2H19A

Crystal structure of resa cys77ala variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
b'SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Molecular Basis for Specificity of the Extracytoplasmic Thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 44
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h19A00
3PINA 5CYYA 4MH2A 3P90A 4RUVA 1XWGA 2L5OA 1K0MA 3WGDA 3LG6A 3PGTA 2BMXA 2C0GA 3HYPA 3M9JA 1EWXA 2PN8A 4LMWA 3ZFLA 3GKKA 3KM6A 2IJYA 2EIQA 4G2EA 14GSA 4EUYA 2XBIA 2O89A 1V40A 2MMOA 4KAEA 4K7NA 5IMAA 2YWIA 4DSQA 2V2GA 2P5QA 2C1YA 4F9ZA 3JCML 4CW9A 3IOSA 3Q19A 2DSAA 3G7IA 1EV4A 2C80A 3G7JA 3HJOA 3I43A 1WP0A 4JU5A 3GA4A 3D4MA 2HI7A 2F3MA 4GLTA 4TR1B 2AJQB 1TDIA 1ZZYA 5KN3A 5KN0A 1Y25A 2WFCA 1GTBA 3D4TA 2X99A 4GCIA 4IN0A 2XPEA 4XCSA 3ZYWA 3ME7A 4XRDA 3D5JA 3F0IA 2C0EA 3ZREA 2H6YA 4WBJA 3GX8A 1XZOA 2DMMA 1OC3A 11GSA 4NPBA 3GHAA 3GTUA 1V2AA 1QUWA 5IO2A 2PBJA 2DIYA 4NXIA 1TK0B 2V1MA 3KMOA 3NIVA 3KEBA 2YPMA 3CTGA 1XW9A 3ZIVA 3RHBA 2GLRA 2GVPA 2VOCA 3IXRA 1AUCA 5IPGA 4GWRA 5D93A 3VLNA 3E9JB 3IHQA 3L9UA 3GFKA 4PQHA 5GAND 2DJJA 2E7PA 3M8NA 3GURA 4MA9A 4IGJA 5B7CA 1JZOA 4V2MA 3PR8A 1XWAA 4MF5A 2K18A 4L0WA 2PPTA 4N10A 3VK9A 1V98A 2YWOA 4MCUA 1KBNA 3TJKA 1OYJA 1PKZA 2VL2A 1ML6A 1GUHA 1BJXA 3NOFA 1USBA 2TRXA 3S9FA 2DJ1A 2I1UA 4EDYA 4EE0A 5EL8A 2O8VB 2I4AA 2B7JA 1VF2A 3LGCA 4MJEA 5ECNB 5DCHA 1A0FA 5KN2A 5FHIA 3U6VA 1IYHA 3CBUA 2H70A 9GSSA 4HS1A 2M46A 3HJMA 2IN3A 1M9AA 5CO3A 1TRUA 4OO4A 4X1UA 3ZL5A 1JZWA 5F05A 4EDZA 4PURA 5DALB 2HZEA 3UL3A 5L71A 22GSA 17GSA 5D8IA 3GV1A 2LRCA 3FRCA 3EC3A 3OR5A 1HYUA 1SL0B 1ZMAA 6GSYA 3HJPA 1EP7A 3ZZXA 2H71A 3HKRA 2C8UA 2F51A 5DQYA 2VL3A 2FWHA 2YWMA 3KH7A 1ZOFA 1F6MC 4MZBA 1WIKA 1M0UA 3CXGA 1SYXA 1ZL9A 4YH2A 2GZYA 3FZ4A 4Q5QA 2KOKA 1PA3A 3VWWA 1WPIA 2H1GA 4TRXA 2N5FA 4OWYA 2OKAA 4ZBBA 4DSRA 4LLRA 3NZNA 3R2QA 5B6NA 2YWNA 4O5RA 1H4OA 2G2QA 2M80A 4LA1A 5HQPA 4KW6A 1R5AA 6GSXA 4TR0A 2O7KA 2AUVA 1NSWA 4IJ3A 3IBHA 5KEJA 1THXA 2CAIA 3HZ4A 3US3A 4XS6A 2LRTA 2CX4A 4L5OA 5INYA 4G9HA 1VF1A 1EEJA 2DIZA 2FGXA 3LJRA 5HFKA 5F0GA 3C73A 2CZ2A 2L4CA 2ZNMA 1THOA 2LSTA 2IMEA 5H5RA 8GSSA 2IWTA 3QD9A 4PNFA 5CRGA 4ZB8A 4NV2A 3IC4A 5GZZB 2F9SA 1ZYQB 2H6ZA 4X0XA 3MSZA 5EVOA 4XRAA 2KUCA 5IO0A 1T4ZA 2FCHA 12GSA 2L4QA 3LXZA 3EYTA 4MMMA 4V2LA 3TJGA 3UEMA 1Y6EA 3GKMA 5AN1A 5LNKe 1SL2B 4ULXA 4G10A 1F37A 4J2FA 4HJMA 2NPBA 1G6WA 2GQMA 5ECMB 3EU3A 1Z6NA 4MPGA 5D9VA 3H1NA 2WCIA 3C8EA 5CREA 2IFQB 2HRNA 7GSSA 1TK8B 4ML6A 2GZZA 4IQ1A 1Z3EA 1T8EB 4HZ4A 1GNEA 2OE1A 1FG4A 3DRNA 4MK3A 1U6TA 2PERA 4XIHA 1F3AA 5JCUA 4TW5A 4E8HA 2HT9A 2B5EA 1TW9A 1PSQA 1XCCA 4MJBA 4TR4A 3MAKA 1MTCA 3IA1A 1RW1A 2LNTA 1WOUA 1W4VA 2LS5A 2JU5A 3FR6A 4F82A 4J56E 3F4TA 2LNSA 4DSSA 1FVJA 2L59A 3BOAA 1XW5A 3I6AA 4XS4A 2AHEA 5JCGA 3APOA 1W89A 3TOTA 1R5PA 4K7IA 4Q5FA 1YF0A 2H74A 3IV4A 5ECQB 3DWVA 5HR0A 2LJKA 3M3MA 3KIJA 1SK0A 2BJXA 1AXDA 4HZ2A 1KNGA 1OKTA 3RBTA 3DIEA 4TOPA 1J9BA 4GSTA 2IIYA 2VM2A 3U5RE 1YJ6A 3I69A 4G19A 2YV7A 4JR4A 4K7OA 3CSJA 2FWEA 2V6OA 4K1FA 3GIXA 1TTZA 4OFMA 1ILOA 1K0OA 1SK2A 2VL9A 3IRAA 5GAPD 4KB3A 5HR2A 1A0RP 1V57A 3IAM2 4MF7A 1R26A 1ERTA 2MBTA 1Z7RA 3IAS2 3APQA 2A4VA 1NHYA 2N5BA 3H8QA 4WEYA 3F63A 2AB6A 2YNXA 1O81A 2B3SA 3KXOA 4MABA 4EO3A 3LORA 2YP6A 2GSTA 1YDKA 3A2WA 2MYGA 2HNLA 2X8HA 3TJBA 3M0FA 2WGRA 4POMA 3TKSC 4H86A 4OFTA 2FUG2 1QXHA 1KTEA 1MDKA 4N30A 5J41A 2EIOA 2OACA 5IMVA 2ON7A 2E2MA 2FA8A 3KGKA 5ECSA 2FD3A 4RQRA 3TJJA 2JZTA 1JZRA 2F8FA 3GYKA 3QFBC 4POBA 4O32A 3FZAA 2WRTA 3RAZA 3G7YA 2H1BA 3TUEA 1TP9A 1FAAA 4KSOA 4RI6A 1ZYEA 2L6DA 3GTUB 1SL1B 2CQ9A 2C3TA 1M9BA 1O8WA 2E0QA 2DMLA 4EXJA 2MMNA 1PGTA 2KP1A 5GSSA 4GQCA 19GSA 2K6VA 1I5GA 1YQ1A 4PGTA 1FOVA 3LSZA 2NBSA 1TRSA 4PUAA 1YF1A 1R7HA 4BWQA 1A23A 4PNGA 4F2IA 2H0HA 4KDYA 2YCDA 6GSWA 1ERVA 2C0DA 2A2RA 4FYCA 1Z5YE 2VD0A 3E3EA 2HXKA 2JADA 4ILFA 3DGQA 3FHKA 4RI7A 3F4SA 2MMAA 4TR3A 3TOUA 3FZ5A 4MF6A 4LL4B 2PVOC 1PX7A 1S3AA 3UBLA 1XWCA 4AJ7A 4NWYA 2DJKA 3ZVJA 5JWRB 2I3YA 2HZEB 1GSDA 3DYRA 2OADA 5J4UA 5HFIA 5HFGA 3GSTA 1YEXA 1O8XA 1X0RA 3DXBA 3Q6OA 3UARA 5LCZA 2FWFA 3ZIJA 3TRXA 3IR4A 5IM9A 1ERWA 4AF2A 3VWUA 1A24A 1T4YA 4BVXA 4MZCA 1GSSA 2H19A 3W8JA 3L9VA 2X64A 4EKZA 1ON4A 2HZFA 1TI1A 3WT2A 3EURA 4IELA 5G31A 3ED3A 2OA7A 3IE3A 1A8YA 3QPMA 3E0UA 2LJRA 2P31A 3FZ9A 2VLTA 5A4WA 1A2MA 5H5SA 5J9BA 3BCKA 3HZ8A 2HLSA 3QDNA 4PX1A 3V1WA 1GP1A 1AC1A 2GQKA 1K0BA 1GRXA 4EVMA 2FNOA 4K0GA 3ZVJD 5DQSA 4ZBAA 1SK1A 1GH2A 4ACSA 3L0HA 5DCGA 3EWLA 1TOFA 3ERWA 3A2XA 2CV4A 1UA5A 2PMTA 1A2JA 5D9TA 2H1AA 1GSEA 4ECBA 1URMA 2FA4A 3MWHA 5E4WA 3GX0A 4ZL8A 1BAYA 2CA8A 6GSSA 1GL8A 4WF5A 3VWVA 2J9HA 3F8UA 2XBQA 4GSNA 4HEA2 5DJLA 3FKFA 1HQOA 2H75A 16GSA 3N5OA 1DE2A 2B5XA 3VPTA 3KTLA 2HYXA 5HR1A 2H01A 1QFNA 1OVNA 1OC9A 4WBRD 3DMLA 2PU9C 5ENUA 1GSQA 1R4WA 3RPPA 5G1LA 2B1LA 3LEFA 1MDJA 3HA9A 4V1Ap 1BEDA 4YAVA 2JSZA 1JHBA 2WZ9A 1SU9A 1EV9A 5G2ZA 5IOXA 4FIWA 3VURA 3F6DA 4KDXA 1FW1A 4NHWA 2LQOA 5JWOB 4MLYA 3VI5A 3KH9A 2RUFA 5DJMA 4F03A 1Z9HA 4K9ZA 2H76A 2BTOT 2L6CA 4K6XA 4I6XA 3WD6A 2XHFA 1CQHA 2G0FA 2XC2A 1ST9A 4KGIA 4PQ1A 2LKUA 4L0UA 5EY6A 2LJAA 1BQ7A 4I97A 3HHVA 1M2DA 3HVSA 3RHCA 2WS2A 2AAWA 1FB6A 1LU4A 1K0DA 1GNWA 1K0NA 3ZITA 1EGOA 4FO5A 5CRHA 1XWBA 5C04A 1UN2A 2IMIA 3CMIA 4DSSB 4K2DA 1XBSA 4I5QA 2EC4A 4KSMA 1WE0A 4LMVA 4N0VA 1PMTA 4F0BA 1U3IA 1B9XC 1MDIA 3C1RA 3FK8A 1Z7PA 4NAXA 4XTSA 18GSA 3GH6A 2IPAA 4J57E 4IP1A 2RUEA 2RLIA 1ZCPA 2H0GA 2VO4A 3KCMA 1ACVA 2LRNA 4KCEA 2VIMA 3C7MA 2AYTA 1O73A 4TXVA 4K8MA 4MZWA 4AGSA 1AQXA 3HVVA 4ID0A 1NM3A 5G5FA 2HE3A 2R5GA 1JLVA 5KN1A 1FO5A 1B8XA 6GSUA 4FYUA 3GN3A 5AISA 2H1DA 4POLA 1CQGA 2ALBA 4IJIA 1K3OA 3CRUA 4OD7A 5JWQB 1EOGA 2KLXA 1SD8A 1QQ2A 2TRCP 5A4UA 4JEDA 2OBKA 3L78A 4I8BA 4TVEA 2NVLA 1FVKA 1WJKA 2VUPA 3J7Yk 4ZL9A 2JSYA 3Q74A 4I2TA 4ZILA 3WGXA 4YQVA 4NMUA 3D22A 1XIYA 5ABRA 4N0ZA 1PL1A 6GSVA 1O6JA 2LEGA 3TKPA 5ID2A 2VLVA 3CSHA 3FR9A 1DE1A 5C00A 2L5LA 2GQLA 3F9UA 1WRYA 1XVQA 1WMJA 1DUGA 2V41A 2GT6A 3QAVA 2CT6A 4WR4A 4EL1A 2WJUA 3ZFBA 4OFNA 3F6FA 3DD3A 3HCZA 1DBYA 4ECCA 1PRXA 4KUNA 5AGYA 2KP2A 1DSBA 1T3BA 5G1KA 3TKRA 1YZXA 3CTFA 2K9FA 4D73A 2B1KA 2FY6A 4KCAA 1F3BA 4P3YB 2HSYA 1GTUA 2RM6A 1ZGNA 2O87A 4KX4A 2MZCA 5IOWA 2F8AA 5CRWA 1F9MA 1PKWA 2ON5A 4Z7XA 2DC5A 5D96A 4OO5A 4FH8A 1QMVA 1SD9A 1GUMA 2B7KA 1MEKA 5F07A 3UIWA 3GNJA 3CSIA 2RIIA 3C1SA 1G0TA 2TIRA 3DVXA 2H30A 3O6TA 2YJHA 4HI7A 4GTUA 2N5AA 13GSA 2OJLA 4DEJA 2R37A 4DVCA 1BG5A 3KD0A 4V1Ag 3LQ7A 4YAPA 4ECJA 3TKSA 4GXZA 1UC7A 5CP1A 1MD3A 2C0FA 2DJ3A 3EMPA 1J0FA 4HOJA 4HU9A 3A5WA 5AIXA 1ABAA 2WDUA 2H72A 4ZIJA 3APSA 5GSTA 3G9BA 2DJ2A 1AW9A 1JLWA 3MNGA 2YJ7A 3IPZA 4CHSA 4E8EA 1LBKA 1GSYA 3GUSA 2K8SA 2CZ3A 2CVKA 4HQZA 3WT1A 2YANA 4L8EA 4KDUA 4HJ2A 4NV5A 1YKCA 3H93A 4QL9A 2YN1A 4ZL7A 2KHPA 2Z9SA 4IQAA 1MD4A 2M72A 1HD2A 2D2ZA 1OAZA 2VCQA 1A8LA 3L9SA 2VCZA 5DBQA 1PN9A 1IYIA 5CRDA 3FW2A 2H0IA 3AY8A 4YQMA 2K8VA 4KA0A 3EMXA 3RDWA 1YY7A 3KP9A 2GSQA 1EGRA 1AQWA 4Q5NA 4NHZA 2P0GA 1A2LA 3A2VA 4MP4A 1BX9A 1XOAA 2JZSA 2NDOA 2YV9A 3L4NA 1EOHA 3LYKA 3C71A 3K8NA 5AIVA 4YQUA 1TU8A 4IW9A 3ISOA 4ZB9A 1O85A 1O7UA 2WB9A 2IMDA 5A5KA 10GSA 2QGVA 4HDEA 5H5QA 1TU7A 2GTUA 3ERFA 3UMAA 2I81A 5COHA 1B48A 2IMFA 2FHEA 4EC0A 2B5YA 5B8BA 2YOIA 3QCPA 3H79A 3VFIA 1NHOA 2H73A 2X8CA 2OBIA 1OC8A 3F4RA 2IL3A 5IMZA 3UJ1A 5DAKA 4TXOA 3F3QA 4IP6A 2JZRA 3TGZA 1Q4JA 3WGEA 2FWGA 5J5NA 2OE0A 2DJ0A 1X9MB 2J23A 2C3NA 4GQFA 1RQMA 3RPNA 2E2GA 5ECKB 1GSFA 5J9CA 3ERGA 1BYEA 2I9HA 1T7PB 4Q5RA 3EU4A 4O7HA 4HQSA 1TK5B 1HNAA 4PQIA 3LFLA 1XOBA 3GKNA 1OC9B 5IMFA 2L57A 2HRFA 2VCVA 1X5DA 3BBYA 4KE3A 4JR6A 4X43A 3P8WA 4F0CA 1T1VA 3HD5A 2LQQA 4N11A 1XWKA 1E2YA 3DEXA 1QK8A 4IHUA 1B4PA 5F8BA 3WYWA 4QL7A 5EPFA 1SJZA 2R4VA 4AJ8A 1H75A 1SJIA 3QFAC 2GGTA 2VM1A 4TR1A 2CVDA 4BL7A 3UOMA 2C3QA 4MH3A 3HDCA 2JACA 2PWJA 2LTKA 1FHEA 3IK9A 5ECRB 1X5EA 4JZQA 2DLXA 2H6XA 4PUFC 4IKHA 6GSTA 1AAZA 2VL2C 3ZLPA 2CX3A 5HR3A 2RM5A 2GDRA 3HVXA 1XFLA 5FT3A 1JFUA 1T00A 3F3RA 4TKYA 4ZXGA 3HY2A 4MJCA 2QC7A 4O92A 1FB0A 3IK7A 3GRXA 5ECIB 3VPQA 3UVTA 4WXTA 1S3DA 2VCTA 2NTOA 2FLSA 5B8AA 1GLPA 3VI7A 1AIUA 3BCIA 1V9WA 2GS3A 5D9WA 1SKWB 4GRFA 4V2NA 2V6KA 1V58A 5ELGA 2R3XA 4ISDA 1YKAA 3LWAA 3MDKA 3ZRDA 4QQ7A 1F2EA 2LV3A 5IPHA 3DVWA 4JBBA 3ZTLA 3D21A 3D0ZA 5A4VA 5ECHB 1VRSD 5CNWA 4LL1B 5F06A 3ZMKA 4JE1A 2CAQA 3QOUA 2C4JA 4EF0A 3O3TA 1G7EA 2OE3A 3IDVA 5B6MA 2PUKC 2P5RA 4TN8A 1GULA 1GWCA 2MMZA 3QR6A 1GUKA 1Q98A 1YEPA 5DVBA 4ECIA 3H4KA 2H8LA 3FEUA 1VF4A 3ME8A 5D73A 4GSSA 3M1GA 5JCWA 4WR5A 1SKRB 3DKSA 1E6BA 5DALA 1TI3A 2X8GA 1G7OA 4IBPA 4XS4B 2HSHA 4WETA 3J7Yb 2DBCA 5E59A 5ID2B 5IQYA 3P2AA 1TKDB 4KNDA 2VD1A 4BWSA 1K3LA 1EEMA 3SBCA 1XPVA 4MDCA 3GL3A 3P7XA 3W6GA 4PXOA 1M2AA 4CDOA 1TXXA 3TCOA 5G5EA 1EZKA 4RQXA 1X5CA 4BVYA 2R6KA 1TJDA 4GF0A 1RK4A 1N2AA 1U3AA 4BA7A 1SENA 4POKA 1UVZA 1M7TA 4ZB6A 4D73B 4FYBA 1K0CA 1PD21 3FYGA 4IVFA 5G30A 2LUSA 3Q18A 3O76A 1PX6A 3QAGA 3BJ5A 3LXTA 2GZPA 5IIZA 3TKQA 1M99A 3M9KA 1TRVA 2XPDA 1SYRA 3GKXA 2V32A 2GSRA 4WF4A 3GH9A 5CAXA 3PH9A 5D9XA 1HNCA 1U87A 3EINA 3FY7A 1J08A 1B4QA 1N8JA 3TB2A 1U88A 2VCXA 1EP8A 20GSA 3GMFA 1GLQA 1K3YA 2H66A 2YZHA 3VWXA 3TRQA 4OCFA 1OKDA 3QAWA 3KTBA 2CVBA 2QSIA 5FWGA 1AQVA 1B9YC 4OMVA 4HU7A 3SWLA 4IS0A 3UBKA 1KEBA 2HFDA 3I9V2 3KJYA 1GTIA 3N9JA 4MPFA 1TRWA 5ECPB 2IFQA 4BPYA 3D6IA 2YZUA 1NW2A 1XVWA 3CRTA 2PVQA 2GT5A 2VAFA 3GL5A 3EE2A 4ML1A 5J3RA 3LYPA 1X9SB 3TJFA 2R2JA 1X9WB 1GSUA 1OE8A 2QKEA 3BD2A 2ZCTA 2O85A 5IMCA 1HNBA 4XS1A 3A3TA 1VGLA 1S3CA 1C72A 2ZUPA 1SKSB 1XW6A 5DDLA 1VF3A 2VCWA 3FR3A 2JL4A 5ELAA 2GSSA 3QMXA 4I2UA 3EVIA 4OCEA 5ECLB 3GSSA 4KH7A 1OE7A 3HXSA 2A2SA 2IMKA 3ZMLA 3UVHA 1GTAA 1QGVA 2ES7A 1ERUA 2EIRA 1LJRA 1M2BA 4K0NA 4ZBDA 3KP8A 3TKSE 1PL2A 5ECOB 4WKWA 2WULA 2REMA 4AJ6A 3TRPA 1WWJA 1K0AA 4L5LA 4MJAA 2B6MA 2MBSA 4JRRA 1PQNA 2AV4A 3TDGA 1I9DA 5IMDA 3UAPA 3KZQA 5DAKB 4TXOB 4XHMA 3CYNA 1G6YA 4HUAA 1JZDA 2PGTA 3KMNA 1XXUA 2VLUA 5LD0A 1SJ6A 3W8SA 1Z6MA
chains in the Genus database with same CATH superfamily
3PINA 5CYYA 4MH2A 3P90A 4RUVA 1XWGA 2L5OA 1K0MA 3WGDA 3LG6A 3PGTA 2BMXA 2C0GA 3HYPA 3M9JA 1EWXA 2PN8A 4LMWA 3ZFLA 3GKKA 3KM6A 2IJYA 2EIQA 4G2EA 14GSA 4EUYA 2XBIA 2O89A 1V40A 2MMOA 4KAEA 4K7NA 5IMAA 2YWIA 4DSQA 2V2GA 2P5QA 2C1YA 4F9ZA 3JCML 4CW9A 3IOSA 4O5QA 1ZYPA 3Q19A 2DSAA 3G7IA 1EV4A 2C80A 3G7JA 3HJOA 3I43A 1PN0A 1WP0A 4JU5A 3GA4A 3D4MA 2HI7A 2F3MA 4GLTA 4TR1B 2AJQB 4BL7B 1TDIA 1ZZYA 5KN3A 5KN0A 1Y25A 2WFCA 1GTBA 3D4TA 2X99A 4GCIA 4IN0A 2XPEA 4XCSA 3ZYWA 3ME7A 4XRDA 3D5JA 3F0IA 2C0EA 3ZREA 2H6YA 4WBJA 3GX8A 1XZOA 2DMMA 1OC3A 11GSA 4NPBA 3GHAA 3GTUA 1V2AA 1QUWA 5IO2A 2PBJA 2DIYA 4NXIA 1TK0B 2V1MA 3KMOA 3NIVA 3KEBA 2YPMA 3CTGA 1XW9A 3ZIVA 2R0GA 3RHBA 2GLRA 5BMUA 2GVPA 3EPTA 2VOCA 3IXRA 1AUCA 5IPGA 4GWRA 5D93A 3VLNA 3E9JB 3IHQA 3L9UA 3GFKA 4PQHA 5GAND 2DJJA 2E7PA 3M8NA 3GURA 4MA9A 4IGJA 5B7CA 1JZOA 4V2MA 3PR8A 1XWAA 4MF5A 2K18A 4L0WA 2PPTA 4N10A 3VK9A 1V98A 2YWOA 2UZ8A 4MCUA 1KBNA 3TJKA 1OYJA 1PKZA 2VL2A 1ML6A 1GUHA 1BJXA 3NOFA 1USBA 2TRXA 3S9FA 2DJ1A 2I1UA 4EDYA 4EE0A 5EL8A 2O8VB 2I4AA 2B7JA 1VF2A 3LGCA 4MJEA 5ECNB 5DCHA 1A0FA 5KN2A 5FHIA 3U6VA 1IYHA 3CBUA 2H70A 9GSSA 4HS1A 2M46A 3HJMA 2IN3A 1M9AA 5CO3A 1TRUA 4OO4A 4X1UA 3ZL5A 1JZWA 5F05A 4EDZA 4PURA 5DALB 2HZEA 3UL3A 5L71A 22GSA 17GSA 5D8IA 3GV1A 2LRCA 3FRCA 3EC3A 3OR5A 1HYUA 1SL0B 1ZMAA 6GSYA 3HJPA 1EP7A 5KOXA 3ZZXA 2H71A 3HKRA 2C8UA 2F51A 5DQYA 2VL3A 4CY6A 2FWHA 2YWMA 3KH7A 1ZOFA 1F6MC 4MZBA 1WIKA 1M0UA 3CXGA 1SYXA 1ZL9A 4YH2A 2GZYA 3FZ4A 4Q5QA 2KOKA 1PA3A 3VWWA 1WPIA 2H1GA 4BVYB 4TRXA 2N5FA 4OWYA 2OKAA 4ZBBA 4DSRA 2QA1A 4LLRA 3NZNA 3R2QA 5B6NA 2YWNA 4O5RA 1H4OA 2G2QA 2M80A 4LA1A 5HQPA 4KW6A 1R5AA 6GSXA 4TR0A 2O7KA 2AUVA 1NSWA 4IJ3A 3IBHA 5KEJA 1THXA 2CAIA 3HZ4A 3US3A 4XS6A 2LRTA 4K2XA 4FQUA 2CX4A 4L5OA 5INYA 4G9HA 1VF1A 1EEJA 2DIZA 2FGXA 3LJRA 5HFKA 5F0GA 3C73A 2CZ2A 2L4CA 2ZNMA 1THOA 2LSTA 2IMEA 5H5RA 8GSSA 2IWTA 3QD9A 4PNFA 5CRGA 4ZB8A 4NV2A 4BIKA 3IC4A 5GZZB 2F9SA 1ZYQB 2H6ZA 4X0XA 3MSZA 5EVOA 4XRAA 2KUCA 5IO0A 1T4ZA 2FCHA 12GSA 2L4QA 3LXZA 3EYTA 4MMMA 4V2LA 3TJGA 3UEMA 1Y6EA 3GKMA 5AN1A 5LNKe 1SL2B 2HRAA 4ULXA 4G10A 1F37A 4J2FA 4HJMA 2NPBA 1G6WA 2GQMA 5ECMB 3EU3A 1Z6NA 4MPGA 5D9VA 3H1NA 1ZYNA 2WCIA 3C8EA 5CREA 2IFQB 2HRNA 7GSSA 1TK8B 4ML6A 2GZZA 4IQ1A 1Z3EA 1T8EB 4HZ4A 1GNEA 2OE1A 1FG4A 3DRNA 4MK3A 1U6TA 2PERA 4XIHA 1F3AA 5JCUA 4TW5A 4E8HA 2HT9A 2B5EA 2HRKA 1TW9A 1PSQA 1XCCA 4MJBA 4TR4A 3MAKA 1MTCA 3IA1A 1RW1A 2LNTA 1WOUA 1W4VA 2LS5A 2JU5A 3FR6A 4F82A 4J56E 3F4TA 2LNSA 4DSSA 1FVJA 2L59A 3BOAA 1XW5A 3I6AA 4XS4A 2AHEA 5JCGA 4USSA 3APOA 1W89A 3TOTA 1R5PA 4K7IA 4Q5FA 1YF0A 2H74A 3IV4A 5ECQB 3DWVA 5HR0A 2LJKA 3M3MA 3KIJA 1SK0A 2BJXA 1AXDA 4HZ2A 1KNGA 1OKTA 3RBTA 3DIEA 4TOPA 1J9BA 4GSTA 2IIYA 2VM2A 3U5RE 1XG8A 1YJ6A 3I69A 4G19A 2YV7A 4JR4A 4K7OA 3CSJA 2FWEA 2V6OA 4K1FA 3GIXA 1TTZA 4OFMA 1ILOA 1K0OA 1SK2A 2VL9A 3IRAA 5GAPD 4KB3A 5HR2A 1A0RP 1V57A 3IAM2 4MF7A 1R26A 1ERTA 2MBTA 1Z7RA 3IAS2 3APQA 2A4VA 1NHYA 2N5BA 3H8QA 4WEYA 3F63A 2AB6A 2YNXA 1O81A 2B3SA 3KXOA 4MABA 4EO3A 3LORA 2YP6A 2GSTA 1YDKA 3A2WA 2MYGA 2HNLA 2X8HA 3TJBA 3M0FA 2WGRA 4POMA 3TKSC 4H86A 4OFTA 2FUG2 1QXHA 1KTEA 1MDKA 4N30A 5J41A 2EIOA 2OACA 5IMVA 2ON7A 5BRTA 2E2MA 2FA8A 3KGKA 5ECSA 2FD3A 4RQRA 3TJJA 2JZTA 1JZRA 2F8FA 3GYKA 3QFBC 4POBA 4O32A 3FZAA 2WRTA 3RAZA 3G7YA 2H1BA 3TUEA 1TP9A 1FAAA 4KSOA 4RI6A 1ZYEA 2L6DA 3GTUB 1SL1B 2CQ9A 2C3TA 1M9BA 1O8WA 2E0QA 2DMLA 4EXJA 2MMNA 1PGTA 2KP1A 5GSSA 4GQCA 19GSA 2K6VA 1I5GA 1YQ1A 4PGTA 1FOVA 3LSZA 2NBSA 1TRSA 4PUAA 1YF1A 2DKIA 4PTSA 1R7HA 4BWQA 1A23A 4PNGA 2X49A 4F2IA 2H0HA 4KDYA 2YCDA 6GSWA 1ERVA 2C0DA 2A2RA 4FYCA 1Z5YE 4KF9A 2VD0A 3E3EA 2HXKA 2JADA 2HSMA 4ILFA 3DGQA 3FHKA 4RI7A 3F4SA 2MMAA 4TR3A 3TOUA 3FZ5A 4MF6A 4LL4B 2PVOC 1PX7A 1S3AA 3UBLA 4EIQA 1XWCA 4AJ7A 4NWYA 2DJKA 3ZVJA 5JWRB 2I3YA 2HZEB 1GSDA 3DYRA 2OADA 5J4UA 5HFIA 5HFGA 3GSTA 1YEXA 1O8XA 1X0RA 3DXBA 3Q6OA 3UARA 5LCZA 2FWFA 3ZIJA 3TRXA 3IR4A 5IM9A 1ERWA 4AF2A 3VWUA 1A24A 3R3EA 1T4YA 4BVXA 4MZCA 1GSSA 2H19A 3W8JA 3L9VA 2X64A 4EKZA 1ON4A 2HZFA 1TI1A 3WT2A 3EURA 4IELA 5G31A 3ED3A 2OA7A 3IE3A 1A8YA 3QPMA 3E0UA 2LJRA 2P31A 3FZ9A 2VLTA 5A4WA 1A2MA 5H5SA 5J9BA 3BCKA 3HZ8A 2HLSA 3QDNA 4PX1A 3V1WA 1GP1A 1M3IA 1AC1A 2GQKA 1K0BA 1GRXA 4EVMA 2FNOA 4K0GA 3ZVJD 5DQSA 4ZBAA 1SK1A 1GH2A 4ACSA 3L0HA 5DCGA 3EWLA 1TOFA 3ERWA 3A2XA 2CV4A 4K5SA 1UA5A 2PMTA 1A2JA 5D9TA 2H1AA 1GSEA 4ECBA 1URMA 2FA4A 3MWHA 5E4WA 3GX0A 4ZL8A 1BAYA 2CA8A 6GSSA 1GL8A 4WF5A 3VWVA 2J9HA 3F8UA 2XBQA 4GSNA 4HEA2 5DJLA 3FKFA 1HQOA 2H75A 16GSA 3N5OA 1DE2A 2B5XA 3VPTA 3KTLA 2HYXA 5HR1A 2H01A 1QFNA 1OVNA 1OC9A 4WBRD 3DMLA 2PU9C 5ENUA 1GSQA 1R4WA 3RPPA 5G1LA 2B1LA 3LEFA 1MDJA 3HA9A 4V1Ap 1BEDA 4YAVA 2JSZA 1JHBA 2WZ9A 1SU9A 1EV9A 5G2ZA 5IOXA 4FIWA 3VURA 3F6DA 4KDXA 1FW1A 4NHWA 2LQOA 5JWOB 4MLYA 3VI5A 3KH9A 2RUFA 5DJMA 4F03A 1Z9HA 4K9ZA 2H76A 2BTOT 2L6CA 4K6XA 4I6XA 3WD6A 2XHFA 1CQHA 2G0FA 2XC2A 1ST9A 4KGIA 4PQ1A 2LKUA 4L0UA 4Z2TA 5EY6A 2LJAA 1BQ7A 4I97A 3HHVA 1M2DA 3HVSA 3RHCA 2WS2A 2AAWA 1FB6A 1LU4A 1K0DA 1GNWA 4Z2UA 1K0NA 3ZITA 1EGOA 4FO5A 5CRHA 1XWBA 5C04A 1UN2A 2IMIA 3CMIA 4DSSB 4K2DA 1XBSA 4I5QA 2EC4A 4KSMA 1WE0A 4LMVA 4N0VA 1PMTA 4F0BA 2X4AA 1U3IA 1B9XC 1MDIA 3C1RA 3FK8A 1Z7PA 4NAXA 4XTSA 4A5PA 18GSA 3GH6A 2IPAA 4J57E 4IP1A 2RUEA 2RLIA 1ZCPA 2H0GA 2VO4A 3KCMA 2R0PA 1ACVA 2LRNA 4KCEA 5KOWA 2VIMA 3C7MA 2AYTA 1O73A 4TXVA 4K8MA 4MZWA 4AGSA 1AQXA 3HVVA 4ID0A 1NM3A 5G5FA 2HE3A 2R5GA 4Z2RA 1JLVA 5KN1A 1FO5A 1B8XA 6GSUA 4FYUA 3GN3A 5AISA 2H1DA 4POLA 1CQGA 2ALBA 4IJIA 1K3OA 3CRUA 4OD7A 5JWQB 1EOGA 2KLXA 1SD8A 1QQ2A 2TRCP 5A4UA 4JEDA 2OBKA 3L78A 4I8BA 4TVEA 2NVLA 1FVKA 1WJKA 2VUPA 3J7Yk 4ZL9A 2JSYA 3Q74A 4I2TA 4ZILA 3WGXA 4YQVA 4NMUA 3D22A 1XIYA 5ABRA 4N0ZA 1PL1A 6GSVA 1O6JA 1M3JA 2LEGA 3TKPA 5ID2A 2VLVA 3CSHA 3FR9A 1DE1A 5C00A 2L5LA 2GQLA 3A5IA 3F9UA 1WRYA 1XVQA 1WMJA 1DUGA 2V41A 2GT6A 3QAVA 2CT6A 4WR4A 4EL1A 2WJUA 3ZFBA 4OFNA 3F6FA 3DD3A 3HCZA 1DBYA 4ECCA 1PRXA 4KUNA 5AGYA 2KP2A 1T3BA 1DSBA 5G1KA 3TKRA 1YZXA 3CTFA 2K9FA 4D73A 2B1KA 2FY6A 4KCAA 1F3BA 4P3YB 2HSYA 1GTUA 2RM6A 1ZGNA 2O87A 4KX4A 2MZCA 5IOWA 2F8AA 5CRWA 1F9MA 1PKWA 2ON5A 4Z7XA 2DC5A 5D96A 4OO5A 4FH8A 1QMVA 1SD9A 1GUMA 2B7KA 1MEKA 5F07A 3UIWA 3GNJA 3CSIA 2RIIA 3C1SA 1G0TA 2TIRA 3DVXA 2H30A 3O6TA 2YJHA 4HI7A 4GTUA 2N5AA 13GSA 2OJLA 4DEJA 2R37A 4DVCA 1BG5A 3KD0A 4V1Ag 1FOHA 3HVNA 3LQ7A 4YAPA 4ECJA 3TKSA 4GXZA 1UC7A 5CP1A 1MD3A 2C0FA 2DJ3A 3EMPA 1J0FA 4HOJA 4HU9A 3A5WA 5AIXA 1ABAA 2WDUA 2H72A 4ZIJA 3APSA 5GSTA 3G9BA 2DJ2A 1AW9A 1JLWA 3MNGA 2YJ7A 3IPZA 4CHSA 4E8EA 1LBKA 1GSYA 3GUSA 2K8SA 2CZ3A 2CVKA 4HQZA 3IC8A 3WT1A 2YANA 4L8EA 4KDUA 4HJ2A 4NV5A 1YKCA 3H93A 4QL9A 2YN1A 4ZL7A 2KHPA 2Z9SA 4IQAA 1MD4A 2M72A 1HD2A 2D2ZA 3CQFA 1OAZA 2VCQA 1A8LA 3L9SA 2VCZA 5DBQA 1PN9A 1IYIA 2QA2A 5CRDA 3FW2A 2H0IA 3AY8A 4YQMA 2K8VA 4KA0A 3EMXA 3RDWA 1YY7A 3KP9A 2GSQA 4BVXB 1EGRA 1AQWA 4Q5NA 4NHZA 2P0GA 1A2LA 3A2VA 4MP4A 1BX9A 1XOAA 2JZSA 2NDOA 2YV9A 3L4NA 1EOHA 3LYKA 3C71A 3K8NA 5AIVA 4YQUA 1TU8A 4IW9A 3ISOA 4ZB9A 1O85A 1PFOA 1O7UA 2WB9A 2IMDA 5A5KA 10GSA 2QGVA 4HDEA 5H5QA 1TU7A 2GTUA 3ERFA 3UMAA 2I81A 5COHA 1B48A 2IMFA 2FHEA 4EC0A 2B5YA 5B8BA 2YOIA 3QCPA 3H79A 3VFIA 1NHOA 2H73A 2X8CA 2OBIA 1OC8A 3F4RA 2IL3A 5IMZA 3UJ1A 5DAKA 4TXOA 3F3QA 4IP6A 2JZRA 3TGZA 1Q4JA 3WGEA 2FWGA 5J5NA 2OE0A 2DJ0A 1X9MB 2J23A 2C3NA 4GQFA 1RQMA 3RPNA 2E2GA 5ECKB 1GSFA 5J9CA 3ERGA 1BYEA 2I9HA 1T7PB 4G0IA 4Q5RA 4G0KA 3EU4A 4O7HA 4HQSA 1TK5B 1HNAA 4PQIA 3LFLA 1XOBA 3GKNA 1OC9B 5IMFA 2L57A 2HRFA 2VCVA 1X5DA 3BBYA 4KE3A 4JR6A 4X43A 3P8WA 4F0CA 1T1VA 3HD5A 2LQQA 4N11A 1XWKA 4HSCX 1E2YA 3DEXA 4G0LA 1QK8A 4IHUA 1B4PA 5F8BA 3WYWA 4QL7A 5EPFA 1SJZA 2R4VA 4AJ8A 1H75A 1SJIA 3QFAC 2GGTA 2VM1A 4TR1A 2CVDA 4BL7A 3UOMA 2C3QA 4MH3A 3HDCA 2JACA 2PWJA 2LTKA 1FHEA 3IK9A 5ECRB 1X5EA 4JZQA 2DLXA 2H6XA 4PUFC 4IKHA 6GSTA 1AAZA 2VL2C 3ZLPA 2CX3A 2R0CA 5HR3A 2RM5A 3MIXA 2GDRA 3HVXA 1XFLA 5FT3A 1JFUA 1T00A 3F3RA 4TKYA 4ZXGA 3HY2A 4MJCA 2QC7A 4O92A 1FB0A 3IK7A 3GRXA 5ECIB 3VPQA 3UVTA 4WXTA 1S3DA 2VCTA 2NTOA 2FLSA 3LW9A 5B8AA 1GLPA 3VI7A 1AIUA 3BCIA 2DKHA 1V9WA 2GS3A 5D9WA 1SKWB 4GRFA 4V2NA 2V6KA 1V58A 5ELGA 2R3XA 4ISDA 1YKAA 3LWAA 3MDKA 3ZRDA 4QQ7A 1F2EA 2LV3A 5IPHA 3DVWA 4JBBA 3ZTLA 3D21A 3D0ZA 2A4HA 5A4VA 5ECHB 1VRSD 5CNWA 4LL1B 5F06A 3ZMKA 4JE1A 2CAQA 3QOUA 2C4JA 4EF0A 3O3TA 1G7EA 2OE3A 3IDVA 5B6MA 2PUKC 3IHGA 2P5RA 4TN8A 1GULA 1GWCA 2MMZA 3QR6A 1GUKA 1Q98A 1YEPA 5DVBA 2A2PA 4ECIA 3H4KA 2H8LA 3FEUA 3PPUA 1VF4A 3ME8A 3FMWA 5D73A 4GSSA 3M1GA 5JCWA 4WR5A 1SKRB 3DKSA 1E6BA 5DALA 1TI3A 2X8GA 4YKGA 1G7OA 4IBPA 4XS4B 2HSHA 4WETA 3J7Yb 2DBCA 5E59A 5ID2B 5IQYA 4ICYA 3P2AA 1TKDB 4KNDA 2VD1A 4BWSA 1K3LA 1EEMA 3SBCA 1XPVA 4MDCA 3GL3A 3P7XA 3W6GA 4PXOA 1M2AA 4CDOA 1TXXA 3TCOA 5G5EA 1EZKA 4RQXA 1X5CA 4K5RA 4BVYA 2R6KA 1TJDA 4GF0A 1RK4A 1N2AA 1U3AA 4BA7A 1SENA 4POKA 1UVZA 1M7TA 4ZB6A 4D73B 4FYBA 4CY8A 1K0CA 1PD21 3FYGA 4IVFA 5G30A 2LUSA 3Q18A 3O76A 1PX6A 3QAGA 1S3RA 3BJ5A 3LXTA 2GZPA 5IIZA 3TKQA 1M99A 3M9KA 1TRVA 2XPDA 1SYRA 3GKXA 2V32A 2GSRA 4WF4A 3GH9A 5CAXA 3PH9A 5D9XA 1HNCA 1U87A 3EINA 3FY7A 1J08A 1B4QA 1N8JA 3TB2A 1U88A 4YKFA 2VCXA 1EP8A 20GSA 3GMFA 1GLQA 1K3YA 2H66A 2YZHA 3VWXA 3TRQA 4OCFA 1OKDA 3QAWA 3KTBA 2CVBA 2QSIA 5FWGA 1AQVA 1B9YC 4OMVA 4HU7A 3SWLA 4IS0A 3UBKA 1KEBA 2HFDA 3I9V2 3KJYA 1GTIA 3N9JA 4MPFA 1TRWA 5ECPB 2IFQA 4BPYA 3D6IA 2YZUA 1NW2A 1XVWA 3CRTA 2PVQA 2GT5A 2VAFA 3GL5A 3EE2A 4ML1A 5J3RA 3LYPA 1X9SB 3TJFA 2R2JA 1X9WB 4X4JA 1GSUA 1OE8A 2QKEA 4MNNA 3BD2A 2ZCTA 2O85A 5IMCA 1HNBA 4XS1A 3A3TA 1VGLA 1S3CA 1C72A 2ZUPA 1SKSB 1XW6A 5DDLA 1VF3A 2VCWA 3FR3A 2JL4A 5ELAA 2GSSA 3QMXA 4I2UA 3EVIA 4OCEA 5ECLB 3GSSA 4KH7A 1OE7A 3HXSA 2A2SA 2IMKA 3ZMLA 3UVHA 1GTAA 1QGVA 2ES7A 1ERUA 2EIRA 1LJRA 1M2BA 4K0NA 4ZBDA 3KP8A 3TKSE 1PL2A 5ECOB 4WKWA 4O5UA 2WULA 2REMA 4AJ6A 3TRPA 1WWJA 1K0AA 4L5LA 4MJAA 2B6MA 2MBSA 4JRRA 1PQNA 2AV4A 3TDGA 1I9DA 5IMDA 3UAPA 3KZQA 5DAKB 4TXOB 4XHMA 3CYNA 1G6YA 4HUAA 1JZDA 2PGTA 3MYDA 3KMNA 1XXUA 2VLUA 4EIPA 5LD0A 1SJ6A 3W8SA 1Z6MA
chains in the Genus database with same CATH topology
3PINA 5CYYA 4MH2A 3P90A 4RUVA 1XWGA 2L5OA 1K0MA 3WGDA 3LG6A 3PGTA 2BMXA 2C0GA 3HYPA 3M9JA 1EWXA 2PN8A 4LMWA 3ZFLA 3GKKA 3KM6A 2IJYA 2EIQA 4G2EA 14GSA 4EUYA 2XBIA 2O89A 1V40A 2MMOA 4KAEA 4K7NA 5IMAA 2YWIA 4DSQA 2V2GA 2P5QA 2C1YA 4F9ZA 3JCML 4CW9A 3IOSA 4O5QA 1ZYPA 3Q19A 2DSAA 3G7IA 1EV4A 2C80A 3G7JA 3HJOA 3I43A 1PN0A 1WP0A 4JU5A 3GA4A 3D4MA 2HI7A 2F3MA 4GLTA 4TR1B 2AJQB 4BL7B 1TDIA 1ZZYA 5KN3A 5KN0A 1Y25A 2WFCA 1GTBA 3D4TA 2X99A 4GCIA 4IN0A 2XPEA 4XCSA 3ZYWA 3ME7A 4XRDA 3D5JA 3F0IA 2C0EA 3ZREA 2H6YA 4WBJA 3GX8A 1XZOA 2DMMA 1OC3A 11GSA 4NPBA 3GHAA 3GTUA 1V2AA 1QUWA 5IO2A 2PBJA 2DIYA 4NXIA 1TK0B 2V1MA 3KMOA 3NIVA 3KEBA 2YPMA 3CTGA 1XW9A 3ZIVA 2R0GA 3RHBA 2GLRA 5BMUA 2GVPA 3EPTA 2VOCA 3IXRA 1AUCA 5IPGA 4GWRA 5D93A 3VLNA 3E9JB 3IHQA 3L9UA 3GFKA 4PQHA 5GAND 2DJJA 2E7PA 3M8NA 3GURA 4MA9A 4IGJA 5B7CA 1JZOA 4V2MA 3PR8A 1XWAA 4MF5A 2K18A 4L0WA 2PPTA 4N10A 3VK9A 1V98A 2YWOA 2UZ8A 4MCUA 1KBNA 3TJKA 1OYJA 1PKZA 2VL2A 1ML6A 1GUHA 1BJXA 3NOFA 1USBA 2TRXA 3S9FA 2DJ1A 2I1UA 4EDYA 4EE0A 5EL8A 2O8VB 2I4AA 2B7JA 1VF2A 3LGCA 4MJEA 5ECNB 5DCHA 1A0FA 5KN2A 5FHIA 3U6VA 1IYHA 3CBUA 2H70A 9GSSA 4HS1A 2M46A 3HJMA 2IN3A 1M9AA 5CO3A 1TRUA 4OO4A 4X1UA 3ZL5A 1JZWA 5F05A 4EDZA 4PURA 5DALB 2HZEA 3UL3A 5L71A 22GSA 17GSA 5D8IA 3GV1A 2LRCA 3FRCA 3EC3A 3OR5A 1HYUA 1SL0B 1ZMAA 6GSYA 3HJPA 1EP7A 5KOXA 3ZZXA 2H71A 3HKRA 2C8UA 2F51A 5DQYA 2VL3A 4CY6A 2FWHA 2YWMA 3KH7A 1ZOFA 1F6MC 4MZBA 1WIKA 1M0UA 3CXGA 1SYXA 1ZL9A 4YH2A 2GZYA 3FZ4A 4Q5QA 2KOKA 1PA3A 3VWWA 1WPIA 2H1GA 4BVYB 4TRXA 2N5FA 4OWYA 2OKAA 4ZBBA 4DSRA 2QA1A 4LLRA 3NZNA 3R2QA 5B6NA 2YWNA 4O5RA 1H4OA 2G2QA 2M80A 4LA1A 5HQPA 4KW6A 1R5AA 6GSXA 4TR0A 2O7KA 2AUVA 1NSWA 4IJ3A 3IBHA 5KEJA 1THXA 2CAIA 3HZ4A 3US3A 4XS6A 2LRTA 4K2XA 4FQUA 2CX4A 4L5OA 5INYA 4G9HA 1VF1A 1EEJA 2DIZA 2FGXA 3LJRA 5HFKA 5F0GA 3C73A 2CZ2A 2L4CA 2ZNMA 1THOA 2LSTA 2IMEA 5H5RA 8GSSA 2IWTA 3QD9A 4PNFA 5CRGA 4ZB8A 4NV2A 3IC4A 5GZZB 2F9SA 1ZYQB 2H6ZA 4X0XA 3MSZA 5EVOA 4XRAA 2KUCA 5IO0A 1T4ZA 2FCHA 12GSA 2L4QA 3LXZA 3EYTA 4MMMA 4V2LA 3TJGA 3UEMA 1Y6EA 3GKMA 5AN1A 5LNKe 1SL2B 2HRAA 4ULXA 4G10A 1F37A 4J2FA 4HJMA 2NPBA 1G6WA 2GQMA 5ECMB 3EU3A 1Z6NA 4MPGA 5D9VA 3H1NA 1ZYNA 2WCIA 3C8EA 5CREA 2IFQB 2HRNA 7GSSA 1TK8B 4ML6A 2GZZA 4IQ1A 1Z3EA 1T8EB 4HZ4A 1GNEA 2OE1A 1FG4A 3DRNA 4MK3A 1U6TA 2PERA 4XIHA 1F3AA 5JCUA 4TW5A 4E8HA 2HT9A 2B5EA 2HRKA 1TW9A 1PSQA 1XCCA 4MJBA 4TR4A 3MAKA 1MTCA 3IA1A 1RW1A 2LNTA 1WOUA 1W4VA 2LS5A 2JU5A 3FR6A 4F82A 4J56E 3F4TA 2LNSA 4DSSA 1FVJA 2L59A 3BOAA 1XW5A 3I6AA 4XS4A 2AHEA 5JCGA 4USSA 3APOA 1W89A 3TOTA 1R5PA 4K7IA 4Q5FA 1YF0A 2H74A 3IV4A 5ECQB 3DWVA 5HR0A 2LJKA 3M3MA 3KIJA 1SK0A 2BJXA 1AXDA 4HZ2A 1KNGA 1OKTA 3RBTA 3DIEA 4TOPA 1J9BA 4GSTA 2IIYA 2VM2A 3U5RE 1YJ6A 3I69A 4G19A 2YV7A 4JR4A 4K7OA 3CSJA 2FWEA 2V6OA 4K1FA 3GIXA 1TTZA 4OFMA 1ILOA 1K0OA 1SK2A 2VL9A 3IRAA 5GAPD 4KB3A 5HR2A 1A0RP 1V57A 3IAM2 4MF7A 1R26A 1ERTA 2MBTA 1Z7RA 3IAS2 3APQA 2A4VA 1NHYA 2N5BA 3H8QA 4WEYA 3F63A 2AB6A 2YNXA 1O81A 2B3SA 3KXOA 4MABA 4EO3A 3LORA 2YP6A 2GSTA 1YDKA 3A2WA 2MYGA 2HNLA 2X8HA 3TJBA 3M0FA 2WGRA 4POMA 3TKSC 4H86A 4OFTA 2FUG2 1QXHA 1KTEA 1MDKA 4N30A 5J41A 2EIOA 2OACA 5IMVA 2ON7A 5BRTA 2E2MA 2FA8A 3KGKA 5ECSA 2FD3A 4RQRA 3TJJA 2JZTA 1JZRA 2F8FA 3GYKA 3QFBC 4POBA 4O32A 3FZAA 2WRTA 3RAZA 3G7YA 2H1BA 3TUEA 1TP9A 1FAAA 4KSOA 4RI6A 1ZYEA 2L6DA 3GTUB 1SL1B 2CQ9A 2C3TA 1M9BA 1O8WA 2E0QA 2DMLA 4EXJA 2MMNA 1PGTA 2KP1A 5GSSA 4GQCA 19GSA 2K6VA 1I5GA 1YQ1A 4PGTA 1FOVA 3LSZA 2NBSA 1TRSA 4PUAA 1YF1A 2DKIA 4PTSA 1R7HA 4BWQA 1A23A 4PNGA 2X49A 4F2IA 2H0HA 4KDYA 2YCDA 6GSWA 1ERVA 2C0DA 2A2RA 4FYCA 1Z5YE 4KF9A 2VD0A 3E3EA 2HXKA 2JADA 2HSMA 4ILFA 3DGQA 3FHKA 4RI7A 3F4SA 2MMAA 4TR3A 3TOUA 3FZ5A 4MF6A 4LL4B 2PVOC 1PX7A 1S3AA 3UBLA 4EIQA 1XWCA 4AJ7A 4NWYA 2DJKA 3ZVJA 5JWRB 2I3YA 2HZEB 1GSDA 3DYRA 2OADA 5J4UA 5HFIA 5HFGA 3GSTA 1YEXA 1O8XA 1X0RA 3DXBA 3Q6OA 3UARA 5LCZA 2FWFA 3ZIJA 3TRXA 3IR4A 5IM9A 1ERWA 4AF2A 3VWUA 1A24A 3R3EA 1T4YA 4BVXA 4MZCA 1GSSA 2H19A 3W8JA 3L9VA 2X64A 4EKZA 1ON4A 2HZFA 1TI1A 3WT2A 3EURA 4IELA 5G31A 3ED3A 2OA7A 3IE3A 1A8YA 3QPMA 3E0UA 2LJRA 2P31A 3FZ9A 2VLTA 5A4WA 1A2MA 5H5SA 5J9BA 3BCKA 3HZ8A 2HLSA 3QDNA 4PX1A 3V1WA 1GP1A 1AC1A 2GQKA 1K0BA 1GRXA 4EVMA 2FNOA 4K0GA 3ZVJD 5DQSA 4ZBAA 1SK1A 1GH2A 4ACSA 3L0HA 5DCGA 3EWLA 1TOFA 3ERWA 3A2XA 2CV4A 4K5SA 1UA5A 2PMTA 1A2JA 5D9TA 2H1AA 1GSEA 4ECBA 1URMA 2FA4A 3MWHA 5E4WA 3GX0A 4ZL8A 1BAYA 2CA8A 6GSSA 1GL8A 4WF5A 3VWVA 2J9HA 3F8UA 2XBQA 4GSNA 4HEA2 5DJLA 3FKFA 1HQOA 2H75A 16GSA 3N5OA 1DE2A 2B5XA 3VPTA 3KTLA 2HYXA 5HR1A 2H01A 1QFNA 1OVNA 1OC9A 4WBRD 3DMLA 2PU9C 5ENUA 1GSQA 1R4WA 3RPPA 5G1LA 2B1LA 3LEFA 1MDJA 3HA9A 4V1Ap 1BEDA 4YAVA 2JSZA 1JHBA 2WZ9A 1SU9A 1EV9A 5G2ZA 5IOXA 4FIWA 3VURA 3F6DA 4KDXA 1FW1A 4NHWA 2LQOA 5JWOB 4MLYA 3VI5A 3KH9A 2RUFA 5DJMA 4F03A 1Z9HA 4K9ZA 2H76A 2BTOT 2L6CA 4K6XA 4I6XA 3WD6A 2XHFA 1CQHA 2G0FA 2XC2A 1ST9A 4KGIA 4PQ1A 2LKUA 4L0UA 4Z2TA 5EY6A 2LJAA 1BQ7A 4I97A 3HHVA 1M2DA 3HVSA 3RHCA 2WS2A 2AAWA 1FB6A 1LU4A 1K0DA 1GNWA 4Z2UA 1K0NA 3ZITA 1EGOA 4FO5A 5CRHA 1XWBA 5C04A 1UN2A 2IMIA 3CMIA 4DSSB 4K2DA 1XBSA 4I5QA 2EC4A 4KSMA 1WE0A 4LMVA 4N0VA 1PMTA 4F0BA 2X4AA 1U3IA 1B9XC 1MDIA 3C1RA 3FK8A 1Z7PA 4NAXA 4XTSA 4A5PA 18GSA 3GH6A 2IPAA 4J57E 4IP1A 2RUEA 2RLIA 1ZCPA 2H0GA 2VO4A 3KCMA 2R0PA 1ACVA 2LRNA 4KCEA 5KOWA 2VIMA 3C7MA 2AYTA 1O73A 4TXVA 4K8MA 4MZWA 4AGSA 1AQXA 3HVVA 4ID0A 1NM3A 5G5FA 2HE3A 2R5GA 4Z2RA 1JLVA 5KN1A 1FO5A 1B8XA 6GSUA 4FYUA 3GN3A 5AISA 2H1DA 4POLA 1CQGA 2ALBA 4IJIA 1K3OA 3CRUA 4OD7A 5JWQB 1EOGA 2KLXA 1SD8A 1QQ2A 2TRCP 5A4UA 4JEDA 2OBKA 3L78A 4I8BA 4TVEA 2NVLA 1FVKA 1WJKA 2VUPA 3J7Yk 4ZL9A 2JSYA 3Q74A 4I2TA 4ZILA 3WGXA 4YQVA 4NMUA 3D22A 1XIYA 5ABRA 4N0ZA 1PL1A 6GSVA 1O6JA 2LEGA 3TKPA 5ID2A 2VLVA 3CSHA 3FR9A 1DE1A 5C00A 2L5LA 2GQLA 3A5IA 3F9UA 1WRYA 1XVQA 1WMJA 1DUGA 2V41A 2GT6A 3QAVA 2CT6A 4WR4A 4EL1A 2WJUA 3ZFBA 4OFNA 3F6FA 3DD3A 3HCZA 1DBYA 4ECCA 1PRXA 4KUNA 5AGYA 2KP2A 1T3BA 1DSBA 5G1KA 3TKRA 1YZXA 3CTFA 2K9FA 4D73A 2B1KA 2FY6A 4KCAA 1F3BA 4P3YB 2HSYA 1GTUA 2RM6A 1ZGNA 2O87A 4KX4A 2MZCA 5IOWA 2F8AA 5CRWA 1F9MA 1PKWA 2ON5A 4Z7XA 2DC5A 5D96A 4OO5A 4FH8A 1QMVA 1SD9A 1GUMA 2B7KA 1MEKA 5F07A 3UIWA 3GNJA 3CSIA 2RIIA 3C1SA 1G0TA 2TIRA 3DVXA 2H30A 3O6TA 2YJHA 4HI7A 4GTUA 2N5AA 13GSA 2OJLA 4DEJA 2R37A 4DVCA 1BG5A 3KD0A 4V1Ag 1FOHA 3LQ7A 4YAPA 4ECJA 3TKSA 4GXZA 1UC7A 5CP1A 1MD3A 2C0FA 2DJ3A 3EMPA 1J0FA 4HOJA 4HU9A 3A5WA 5AIXA 1ABAA 2WDUA 2H72A 4ZIJA 3APSA 5GSTA 3G9BA 2DJ2A 1AW9A 1JLWA 3MNGA 2YJ7A 3IPZA 4CHSA 4E8EA 1LBKA 1GSYA 3GUSA 2K8SA 2CZ3A 2CVKA 4HQZA 3IC8A 3WT1A 2YANA 4L8EA 4KDUA 4HJ2A 4NV5A 1YKCA 3H93A 4QL9A 2YN1A 4ZL7A 2KHPA 2Z9SA 4IQAA 1MD4A 2M72A 1HD2A 2D2ZA 1OAZA 2VCQA 1A8LA 3L9SA 2VCZA 5DBQA 1PN9A 1IYIA 2QA2A 5CRDA 3FW2A 2H0IA 3AY8A 4YQMA 2K8VA 4KA0A 3EMXA 3RDWA 1YY7A 3KP9A 2GSQA 4BVXB 1EGRA 1AQWA 4Q5NA 4NHZA 2P0GA 1A2LA 3A2VA 4MP4A 1BX9A 1XOAA 2JZSA 2NDOA 2YV9A 3L4NA 1EOHA 3LYKA 3C71A 3K8NA 5AIVA 4YQUA 1TU8A 4IW9A 3ISOA 4ZB9A 1O85A 1O7UA 2WB9A 2IMDA 5A5KA 10GSA 2QGVA 4HDEA 5H5QA 1TU7A 2GTUA 3ERFA 3UMAA 2I81A 5COHA 1B48A 2IMFA 2FHEA 4EC0A 2B5YA 5B8BA 2YOIA 3QCPA 3H79A 3VFIA 1NHOA 2H73A 2X8CA 2OBIA 1OC8A 3F4RA 2IL3A 5IMZA 3UJ1A 5DAKA 4TXOA 3F3QA 4IP6A 2JZRA 3TGZA 1Q4JA 3WGEA 2FWGA 5J5NA 2OE0A 2DJ0A 1X9MB 2J23A 2C3NA 4GQFA 1RQMA 3RPNA 2E2GA 5ECKB 1GSFA 5J9CA 3ERGA 1BYEA 2I9HA 1T7PB 4G0IA 4Q5RA 4G0KA 3EU4A 4O7HA 4HQSA 1TK5B 1HNAA 4PQIA 3LFLA 1XOBA 3GKNA 1OC9B 5IMFA 2L57A 2HRFA 2VCVA 1X5DA 3BBYA 4KE3A 4JR6A 4X43A 3P8WA 4F0CA 1T1VA 3HD5A 2LQQA 4N11A 1XWKA 1E2YA 3DEXA 4G0LA 1QK8A 4IHUA 1B4PA 5F8BA 3WYWA 4QL7A 5EPFA 1SJZA 2R4VA 4AJ8A 1H75A 1SJIA 3QFAC 2GGTA 2VM1A 4TR1A 2CVDA 4BL7A 3UOMA 2C3QA 4MH3A 3HDCA 2JACA 2PWJA 2LTKA 1FHEA 3IK9A 5ECRB 1X5EA 4JZQA 2DLXA 2H6XA 4PUFC 4IKHA 6GSTA 1AAZA 2VL2C 3ZLPA 2CX3A 2R0CA 5HR3A 2RM5A 3MIXA 2GDRA 3HVXA 1XFLA 5FT3A 1JFUA 1T00A 3F3RA 4TKYA 4ZXGA 3HY2A 4MJCA 2QC7A 4O92A 1FB0A 3IK7A 3GRXA 5ECIB 3VPQA 3UVTA 4WXTA 1S3DA 2VCTA 2NTOA 2FLSA 3LW9A 5B8AA 1GLPA 3VI7A 1AIUA 3BCIA 2DKHA 1V9WA 2GS3A 5D9WA 1SKWB 4GRFA 4V2NA 2V6KA 1V58A 5ELGA 2R3XA 4ISDA 1YKAA 3LWAA 3MDKA 3ZRDA 4QQ7A 1F2EA 2LV3A 5IPHA 3DVWA 4JBBA 3ZTLA 3D21A 3D0ZA 2A4HA 5A4VA 5ECHB 1VRSD 5CNWA 4LL1B 5F06A 3ZMKA 4JE1A 2CAQA 3QOUA 2C4JA 4EF0A 3O3TA 1G7EA 2OE3A 3IDVA 5B6MA 2PUKC 3IHGA 2P5RA 4TN8A 1GULA 1GWCA 2MMZA 3QR6A 1GUKA 1Q98A 1YEPA 5DVBA 2A2PA 4ECIA 3H4KA 2H8LA 3FEUA 3PPUA 1VF4A 3ME8A 3FMWA 5D73A 4GSSA 3M1GA 5JCWA 4WR5A 1SKRB 3DKSA 1E6BA 5DALA 1TI3A 2X8GA 4YKGA 1G7OA 4IBPA 4XS4B 2HSHA 4WETA 3J7Yb 2DBCA 5E59A 5ID2B 5IQYA 4ICYA 3P2AA 1TKDB 4KNDA 2VD1A 4BWSA 1K3LA 1EEMA 3SBCA 1XPVA 4MDCA 3GL3A 3P7XA 3W6GA 4PXOA 1M2AA 4CDOA 1TXXA 3TCOA 5G5EA 1EZKA 4RQXA 1X5CA 4K5RA 4BVYA 2R6KA 1TJDA 4GF0A 1RK4A 1N2AA 1U3AA 4BA7A 1SENA 4POKA 1UVZA 1M7TA 4ZB6A 4D73B 4FYBA 4CY8A 1K0CA 1PD21 3FYGA 4IVFA 5G30A 2LUSA 3Q18A 3O76A 1PX6A 3QAGA 3BJ5A 3LXTA 2GZPA 5IIZA 3TKQA 1M99A 3M9KA 1TRVA 2XPDA 1SYRA 3GKXA 2V32A 2GSRA 4WF4A 3GH9A 5CAXA 3PH9A 5D9XA 1HNCA 1U87A 3EINA 3FY7A 1J08A 1B4QA 1N8JA 3TB2A 1U88A 4YKFA 2VCXA 1EP8A 20GSA 3GMFA 1GLQA 1K3YA 2H66A 2YZHA 3VWXA 3TRQA 4OCFA 1OKDA 3QAWA 3KTBA 2CVBA 2QSIA 5FWGA 1AQVA 1B9YC 4OMVA 4HU7A 3SWLA 4IS0A 3UBKA 1KEBA 2HFDA 3I9V2 3KJYA 1GTIA 3N9JA 4MPFA 1TRWA 5ECPB 2IFQA 4BPYA 3D6IA 2YZUA 1NW2A 1XVWA 3CRTA 2PVQA 2GT5A 2VAFA 3GL5A 3EE2A 4ML1A 5J3RA 3LYPA 1X9SB 3TJFA 2R2JA 1X9WB 4X4JA 1GSUA 1OE8A 2QKEA 4MNNA 3BD2A 2ZCTA 2O85A 5IMCA 1HNBA 4XS1A 3A3TA 1VGLA 1S3CA 1C72A 2ZUPA 1SKSB 1XW6A 5DDLA 1VF3A 2VCWA 3FR3A 2JL4A 5ELAA 2GSSA 3QMXA 4I2UA 3EVIA 4OCEA 5ECLB 3GSSA 4KH7A 1OE7A 3HXSA 2A2SA 2IMKA 3ZMLA 3UVHA 1GTAA 1QGVA 2ES7A 1ERUA 2EIRA 1LJRA 1M2BA 4K0NA 4ZBDA 3KP8A 3TKSE 1PL2A 5ECOB 4WKWA 4O5UA 2WULA 2REMA 4AJ6A 3TRPA 1WWJA 1K0AA 4L5LA 4MJAA 2B6MA 2MBSA 4JRRA 1PQNA 2AV4A 3TDGA 1I9DA 5IMDA 3UAPA 3KZQA 5DAKB 4TXOB 4XHMA 3CYNA 1G6YA 4HUAA 1JZDA 2PGTA 3MYDA 3KMNA 1XXUA 2VLUA 4EIPA 5LD0A 1SJ6A 3W8SA 1Z6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIN A;  5CYY A;  4MH2 A;  3P90 A;  4RUV A;  1XWG A;  2L5O A;  1K0M A;  3WGD A;  3LG6 A;  3PGT A;  2BMX A;  2C0G A;  3HYP A;  3M9J A;  1EWX A;  2PN8 A;  4LMW A;  3ZFL A;  3GKK A;  3KM6 A;  2IJY A;  2EIQ A;  4G2E A;  14GS A;  4EUY A;  2XBI A;  2O89 A;  1V40 A;  2MMO A;  4KAE A;  4K7N A;  5IMA A;  2YWI A;  4DSQ A;  2V2G A;  2P5Q A;  2C1Y A;  4F9Z A;  3JCM L;  4CW9 A;  3IOS A;  3Q19 A;  2DSA A;  3G7I A;  1EV4 A;  2C80 A;  3G7J A;  3HJO A;  3I43 A;  1WP0 A;  4JU5 A;  3GA4 A;  3D4M A;  2HI7 A;  2F3M A;  4GLT A;  4TR1 B;  2AJQ B;  1TDI A;  1ZZY A;  5KN3 A;  5KN0 A;  1Y25 A;  2WFC A;  1GTB A;  3D4T A;  2X99 A;  4GCI A;  4IN0 A;  2XPE A;  4XCS A;  3ZYW A;  3ME7 A;  4XRD A;  3D5J A;  3F0I A;  2C0E A;  3ZRE A;  2H6Y A;  4WBJ A;  3GX8 A;  1XZO A;  2DMM A;  1OC3 A;  11GS A;  4NPB A;  3GHA A;  3GTU A;  1V2A A;  1QUW A;  5IO2 A;  2PBJ A;  2DIY A;  4NXI A;  1TK0 B;  2V1M A;  3KMO A;  3NIV A;  3KEB A;  2YPM A;  3CTG A;  1XW9 A;  3ZIV A;  3RHB A;  2GLR A;  2GVP A;  2VOC A;  3IXR A;  1AUC A;  5IPG A;  4GWR A;  5D93 A;  3VLN A;  3E9J B;  3IHQ A;  3L9U A;  3GFK A;  4PQH A;  5GAN D;  2DJJ A;  2E7P A;  3M8N A;  3GUR A;  4MA9 A;  4IGJ A;  5B7C A;  1JZO A;  4V2M A;  3PR8 A;  1XWA A;  4MF5 A;  2K18 A;  4L0W A;  2PPT A;  4N10 A;  3VK9 A;  1V98 A;  2YWO A;  4MCU A;  1KBN A;  3TJK A;  1OYJ A;  1PKZ A;  2VL2 A;  1ML6 A;  1GUH A;  1BJX A;  3NOF A;  1USB A;  2TRX A;  3S9F A;  2DJ1 A;  2I1U A;  4EDY A;  4EE0 A;  5EL8 A;  2O8V B;  2I4A A;  2B7J A;  1VF2 A;  3LGC A;  4MJE A;  5ECN B;  5DCH A;  1A0F A;  5KN2 A;  5FHI A;  3U6V A;  1IYH A;  3CBU A;  2H70 A;  9GSS A;  4HS1 A;  2M46 A;  3HJM A;  2IN3 A;  1M9A A;  5CO3 A;  1TRU A;  4OO4 A;  4X1U A;  3ZL5 A;  1JZW A;  5F05 A;  4EDZ A;  4PUR A;  5DAL B;  2HZE A;  3UL3 A;  5L71 A;  22GS A;  17GS A;  5D8I A;  3GV1 A;  2LRC A;  3FRC A;  3EC3 A;  3OR5 A;  1HYU A;  1SL0 B;  1ZMA A;  6GSY A;  3HJP A;  1EP7 A;  3ZZX A;  2H71 A;  3HKR A;  2C8U A;  2F51 A;  5DQY A;  2VL3 A;  2FWH A;  2YWM A;  3KH7 A;  1ZOF A;  1F6M C;  4MZB A;  1WIK A;  1M0U A;  3CXG A;  1SYX A;  1ZL9 A;  4YH2 A;  2GZY A;  3FZ4 A;  4Q5Q A;  2KOK A;  1PA3 A;  3VWW A;  1WPI A;  2H1G A;  4TRX A;  2N5F A;  4OWY A;  2OKA A;  4ZBB A;  4DSR A;  4LLR A;  3NZN A;  3R2Q A;  5B6N A;  2YWN A;  4O5R A;  1H4O A;  2G2Q A;  2M80 A;  4LA1 A;  5HQP A;  4KW6 A;  1R5A A;  6GSX A;  4TR0 A;  2O7K A;  2AUV A;  1NSW A;  4IJ3 A;  3IBH A;  5KEJ A;  1THX A;  2CAI A;  3HZ4 A;  3US3 A;  4XS6 A;  2LRT A;  2CX4 A;  4L5O A;  5INY A;  4G9H A;  1VF1 A;  1EEJ A;  2DIZ A;  2FGX A;  3LJR A;  5HFK A;  5F0G A;  3C73 A;  2CZ2 A;  2L4C A;  2ZNM A;  1THO A;  2LST A;  2IME A;  5H5R A;  8GSS A;  2IWT A;  3QD9 A;  4PNF A;  5CRG A;  4ZB8 A;  4NV2 A;  3IC4 A;  5GZZ B;  2F9S A;  1ZYQ B;  2H6Z A;  4X0X A;  3MSZ A;  5EVO A;  4XRA A;  2KUC A;  5IO0 A;  1T4Z A;  2FCH A;  12GS A;  2L4Q A;  3LXZ A;  3EYT A;  4MMM A;  4V2L A;  3TJG A;  3UEM A;  1Y6E A;  3GKM A;  5AN1 A;  5LNK e;  1SL2 B;  4ULX A;  4G10 A;  1F37 A;  4J2F A;  4HJM A;  2NPB A;  1G6W A;  2GQM A;  5ECM B;  3EU3 A;  1Z6N A;  4MPG A;  5D9V A;  3H1N A;  2WCI A;  3C8E A;  5CRE A;  2IFQ B;  2HRN A;  7GSS A;  1TK8 B;  4ML6 A;  2GZZ A;  4IQ1 A;  1Z3E A;  1T8E B;  4HZ4 A;  1GNE A;  2OE1 A;  1FG4 A;  3DRN A;  4MK3 A;  1U6T A;  2PER A;  4XIH A;  1F3A A;  5JCU A;  4TW5 A;  4E8H A;  2HT9 A;  2B5E A;  1TW9 A;  1PSQ A;  1XCC A;  4MJB A;  4TR4 A;  3MAK A;  1MTC A;  3IA1 A;  1RW1 A;  2LNT A;  1WOU A;  1W4V A;  2LS5 A;  2JU5 A;  3FR6 A;  4F82 A;  4J56 E;  3F4T A;  2LNS A;  4DSS A;  1FVJ A;  2L59 A;  3BOA A;  1XW5 A;  3I6A A;  4XS4 A;  2AHE A;  5JCG A;  3APO A;  1W89 A;  3TOT A;  1R5P A;  4K7I A;  4Q5F A;  1YF0 A;  2H74 A;  3IV4 A;  5ECQ B;  3DWV A;  5HR0 A;  2LJK A;  3M3M A;  3KIJ A;  1SK0 A;  2BJX A;  1AXD A;  4HZ2 A;  1KNG A;  1OKT A;  3RBT A;  3DIE A;  4TOP A;  1J9B A;  4GST A;  2IIY A;  2VM2 A;  3U5R E;  1YJ6 A;  3I69 A;  4G19 A;  2YV7 A;  4JR4 A;  4K7O A;  3CSJ A;  2FWE A;  2V6O A;  4K1F A;  3GIX A;  1TTZ A;  4OFM A;  1ILO A;  1K0O A;  1SK2 A;  2VL9 A;  3IRA A;  5GAP D;  4KB3 A;  5HR2 A;  1A0R P;  1V57 A;  3IAM 2;  4MF7 A;  1R26 A;  1ERT A;  2MBT A;  1Z7R A;  3IAS 2;  3APQ A;  2A4V A;  1NHY A;  2N5B A;  3H8Q A;  4WEY A;  3F63 A;  2AB6 A;  2YNX A;  1O81 A;  2B3S A;  3KXO A;  4MAB A;  4EO3 A;  3LOR A;  2YP6 A;  2GST A;  1YDK A;  3A2W A;  2MYG A;  2HNL A;  2X8H A;  3TJB A;  3M0F A;  2WGR A;  4POM A;  3TKS C;  4H86 A;  4OFT A;  2FUG 2;  1QXH A;  1KTE A;  1MDK A;  4N30 A;  5J41 A;  2EIO A;  2OAC A;  5IMV A;  2ON7 A;  2E2M A;  2FA8 A;  3KGK A;  5ECS A;  2FD3 A;  4RQR A;  3TJJ A;  2JZT A;  1JZR A;  2F8F A;  3GYK A;  3QFB C;  4POB A;  4O32 A;  3FZA A;  2WRT A;  3RAZ A;  3G7Y A;  2H1B A;  3TUE A;  1TP9 A;  1FAA A;  4KSO A;  4RI6 A;  1ZYE A;  2L6D A;  3GTU B;  1SL1 B;  2CQ9 A;  2C3T A;  1M9B A;  1O8W A;  2E0Q A;  2DML A;  4EXJ A;  2MMN A;  1PGT A;  2KP1 A;  5GSS A;  4GQC A;  19GS A;  2K6V A;  1I5G A;  1YQ1 A;  4PGT A;  1FOV A;  3LSZ A;  2NBS A;  1TRS A;  4PUA A;  1YF1 A;  1R7H A;  4BWQ A;  1A23 A;  4PNG A;  4F2I A;  2H0H A;  4KDY A;  2YCD A;  6GSW A;  1ERV A;  2C0D A;  2A2R A;  4FYC A;  1Z5Y E;  2VD0 A;  3E3E A;  2HXK A;  2JAD A;  4ILF A;  3DGQ A;  3FHK A;  4RI7 A;  3F4S A;  2MMA A;  4TR3 A;  3TOU A;  3FZ5 A;  4MF6 A;  4LL4 B;  2PVO C;  1PX7 A;  1S3A A;  3UBL A;  1XWC A;  4AJ7 A;  4NWY A;  2DJK A;  3ZVJ A;  5JWR B;  2I3Y A;  2HZE B;  1GSD A;  3DYR A;  2OAD A;  5J4U A;  5HFI A;  5HFG A;  3GST A;  1YEX A;  1O8X A;  1X0R A;  3DXB A;  3Q6O A;  3UAR A;  5LCZ A;  2FWF A;  3ZIJ A;  3TRX A;  3IR4 A;  5IM9 A;  1ERW A;  4AF2 A;  3VWU A;  1A24 A;  1T4Y A;  4BVX A;  4MZC A;  1GSS A;  2H19 A;  3W8J A;  3L9V A;  2X64 A;  4EKZ A;  1ON4 A;  2HZF A;  1TI1 A;  3WT2 A;  3EUR A;  4IEL A;  5G31 A;  3ED3 A;  2OA7 A;  3IE3 A;  1A8Y A;  3QPM A;  3E0U A;  2LJR A;  2P31 A;  3FZ9 A;  2VLT A;  5A4W A;  1A2M A;  5H5S A;  5J9B A;  3BCK A;  3HZ8 A;  2HLS A;  3QDN A;  4PX1 A;  3V1W A;  1GP1 A;  1AC1 A;  2GQK A;  1K0B A;  1GRX A;  4EVM A;  2FNO A;  4K0G A;  3ZVJ D;  5DQS A;  4ZBA A;  1SK1 A;  1GH2 A;  4ACS A;  3L0H A;  5DCG A;  3EWL A;  1TOF A;  3ERW A;  3A2X A;  2CV4 A;  1UA5 A;  2PMT A;  1A2J A;  5D9T A;  2H1A A;  1GSE A;  4ECB A;  1URM A;  2FA4 A;  3MWH A;  5E4W A;  3GX0 A;  4ZL8 A;  1BAY A;  2CA8 A;  6GSS A;  1GL8 A;  4WF5 A;  3VWV A;  2J9H A;  3F8U A;  2XBQ A;  4GSN A;  4HEA 2;  5DJL A;  3FKF A;  1HQO A;  2H75 A;  16GS A;  3N5O A;  1DE2 A;  2B5X A;  3VPT A;  3KTL A;  2HYX A;  5HR1 A;  2H01 A;  1QFN A;  1OVN A;  1OC9 A;  4WBR D;  3DML A;  2PU9 C;  5ENU A;  1GSQ A;  1R4W A;  3RPP A;  5G1L A;  2B1L A;  3LEF A;  1MDJ A;  3HA9 A;  4V1A p;  1BED A;  4YAV A;  2JSZ A;  1JHB A;  2WZ9 A;  1SU9 A;  1EV9 A;  5G2Z A;  5IOX A;  4FIW A;  3VUR A;  3F6D A;  4KDX A;  1FW1 A;  4NHW A;  2LQO A;  5JWO B;  4MLY A;  3VI5 A;  3KH9 A;  2RUF A;  5DJM A;  4F03 A;  1Z9H A;  4K9Z A;  2H76 A;  2BTO T;  2L6C A;  4K6X A;  4I6X A;  3WD6 A;  2XHF A;  1CQH A;  2G0F A;  2XC2 A;  1ST9 A;  4KGI A;  4PQ1 A;  2LKU A;  4L0U A;  5EY6 A;  2LJA A;  1BQ7 A;  4I97 A;  3HHV A;  1M2D A;  3HVS A;  3RHC A;  2WS2 A;  2AAW A;  1FB6 A;  1LU4 A;  1K0D A;  1GNW A;  1K0N A;  3ZIT A;  1EGO A;  4FO5 A;  5CRH A;  1XWB A;  5C04 A;  1UN2 A;  2IMI A;  3CMI A;  4DSS B;  4K2D A;  1XBS A;  4I5Q A;  2EC4 A;  4KSM A;  1WE0 A;  4LMV A;  4N0V A;  1PMT A;  4F0B A;  1U3I A;  1B9X C;  1MDI A;  3C1R A;  3FK8 A;  1Z7P A;  4NAX A;  4XTS A;  18GS A;  3GH6 A;  2IPA A;  4J57 E;  4IP1 A;  2RUE A;  2RLI A;  1ZCP A;  2H0G A;  2VO4 A;  3KCM A;  1ACV A;  2LRN A;  4KCE A;  2VIM A;  3C7M A;  2AYT A;  1O73 A;  4TXV A;  4K8M A;  4MZW A;  4AGS A;  1AQX A;  3HVV A;  4ID0 A;  1NM3 A;  5G5F A;  2HE3 A;  2R5G A;  1JLV A;  5KN1 A;  1FO5 A;  1B8X A;  6GSU A;  4FYU A;  3GN3 A;  5AIS A;  2H1D A;  4POL A;  1CQG A;  2ALB A;  4IJI A;  1K3O A;  3CRU A;  4OD7 A;  5JWQ B;  1EOG A;  2KLX A;  1SD8 A;  1QQ2 A;  2TRC P;  5A4U A;  4JED A;  2OBK A;  3L78 A;  4I8B A;  4TVE A;  2NVL A;  1FVK A;  1WJK A;  2VUP A;  3J7Y k;  4ZL9 A;  2JSY A;  3Q74 A;  4I2T A;  4ZIL A;  3WGX A;  4YQV A;  4NMU A;  3D22 A;  1XIY A;  5ABR A;  4N0Z A;  1PL1 A;  6GSV A;  1O6J A;  2LEG A;  3TKP A;  5ID2 A;  2VLV A;  3CSH A;  3FR9 A;  1DE1 A;  5C00 A;  2L5L A;  2GQL A;  3F9U A;  1WRY A;  1XVQ A;  1WMJ A;  1DUG A;  2V41 A;  2GT6 A;  3QAV A;  2CT6 A;  4WR4 A;  4EL1 A;  2WJU A;  3ZFB A;  4OFN A;  3F6F A;  3DD3 A;  3HCZ A;  1DBY A;  4ECC A;  1PRX A;  4KUN A;  5AGY A;  2KP2 A;  1DSB A;  1T3B A;  5G1K A;  3TKR A;  1YZX A;  3CTF A;  2K9F A;  4D73 A;  2B1K A;  2FY6 A;  4KCA A;  1F3B A;  4P3Y B;  2HSY A;  1GTU A;  2RM6 A;  1ZGN A;  2O87 A;  4KX4 A;  2MZC A;  5IOW A;  2F8A A;  5CRW A;  1F9M A;  1PKW A;  2ON5 A;  4Z7X A;  2DC5 A;  5D96 A;  4OO5 A;  4FH8 A;  1QMV A;  1SD9 A;  1GUM A;  2B7K A;  1MEK A;  5F07 A;  3UIW A;  3GNJ A;  3CSI A;  2RII A;  3C1S A;  1G0T A;  2TIR A;  3DVX A;  2H30 A;  3O6T A;  2YJH A;  4HI7 A;  4GTU A;  2N5A A;  13GS A;  2OJL A;  4DEJ A;  2R37 A;  4DVC A;  1BG5 A;  3KD0 A;  4V1A g;  3LQ7 A;  4YAP A;  4ECJ A;  3TKS A;  4GXZ A;  1UC7 A;  5CP1 A;  1MD3 A;  2C0F A;  2DJ3 A;  3EMP A;  1J0F A;  4HOJ A;  4HU9 A;  3A5W A;  5AIX A;  1ABA A;  2WDU A;  2H72 A;  4ZIJ A;  3APS A;  5GST A;  3G9B A;  2DJ2 A;  1AW9 A;  1JLW A;  3MNG A;  2YJ7 A;  3IPZ A;  4CHS A;  4E8E A;  1LBK A;  1GSY A;  3GUS A;  2K8S A;  2CZ3 A;  2CVK A;  4HQZ A;  3WT1 A;  2YAN A;  4L8E A;  4KDU A;  4HJ2 A;  4NV5 A;  1YKC A;  3H93 A;  4QL9 A;  2YN1 A;  4ZL7 A;  2KHP A;  2Z9S A;  4IQA A;  1MD4 A;  2M72 A;  1HD2 A;  2D2Z A;  1OAZ A;  2VCQ A;  1A8L A;  3L9S A;  2VCZ A;  5DBQ A;  1PN9 A;  1IYI A;  5CRD A;  3FW2 A;  2H0I A;  3AY8 A;  4YQM A;  2K8V A;  4KA0 A;  3EMX A;  3RDW A;  1YY7 A;  3KP9 A;  2GSQ A;  1EGR A;  1AQW A;  4Q5N A;  4NHZ A;  2P0G A;  1A2L A;  3A2V A;  4MP4 A;  1BX9 A;  1XOA A;  2JZS A;  2NDO A;  2YV9 A;  3L4N A;  1EOH A;  3LYK A;  3C71 A;  3K8N A;  5AIV A;  4YQU A;  1TU8 A;  4IW9 A;  3ISO A;  4ZB9 A;  1O85 A;  1O7U A;  2WB9 A;  2IMD A;  5A5K A;  10GS A;  2QGV A;  4HDE A;  5H5Q A;  1TU7 A;  2GTU A;  3ERF A;  3UMA A;  2I81 A;  5COH A;  1B48 A;  2IMF A;  2FHE A;  4EC0 A;  2B5Y A;  5B8B A;  2YOI A;  3QCP A;  3H79 A;  3VFI A;  1NHO A;  2H73 A;  2X8C A;  2OBI A;  1OC8 A;  3F4R A;  2IL3 A;  5IMZ A;  3UJ1 A;  5DAK A;  4TXO A;  3F3Q A;  4IP6 A;  2JZR A;  3TGZ A;  1Q4J A;  3WGE A;  2FWG A;  5J5N A;  2OE0 A;  2DJ0 A;  1X9M B;  2J23 A;  2C3N A;  4GQF A;  1RQM A;  3RPN A;  2E2G A;  5ECK B;  1GSF A;  5J9C A;  3ERG A;  1BYE A;  2I9H A;  1T7P B;  4Q5R A;  3EU4 A;  4O7H A;  4HQS A;  1TK5 B;  1HNA A;  4PQI A;  3LFL A;  1XOB A;  3GKN A;  1OC9 B;  5IMF A;  2L57 A;  2HRF A;  2VCV A;  1X5D A;  3BBY A;  4KE3 A;  4JR6 A;  4X43 A;  3P8W A;  4F0C A;  1T1V A;  3HD5 A;  2LQQ A;  4N11 A;  1XWK A;  1E2Y A;  3DEX A;  1QK8 A;  4IHU A;  1B4P A;  5F8B A;  3WYW A;  4QL7 A;  5EPF A;  1SJZ A;  2R4V A;  4AJ8 A;  1H75 A;  1SJI A;  3QFA C;  2GGT A;  2VM1 A;  4TR1 A;  2CVD A;  4BL7 A;  3UOM A;  2C3Q A;  4MH3 A;  3HDC A;  2JAC A;  2PWJ A;  2LTK A;  1FHE A;  3IK9 A;  5ECR B;  1X5E A;  4JZQ A;  2DLX A;  2H6X A;  4PUF C;  4IKH A;  6GST A;  1AAZ A;  2VL2 C;  3ZLP A;  2CX3 A;  5HR3 A;  2RM5 A;  2GDR A;  3HVX A;  1XFL A;  5FT3 A;  1JFU A;  1T00 A;  3F3R A;  4TKY A;  4ZXG A;  3HY2 A;  4MJC A;  2QC7 A;  4O92 A;  1FB0 A;  3IK7 A;  3GRX A;  5ECI B;  3VPQ A;  3UVT A;  4WXT A;  1S3D A;  2VCT A;  2NTO A;  2FLS A;  5B8A A;  1GLP A;  3VI7 A;  1AIU A;  3BCI A;  1V9W A;  2GS3 A;  5D9W A;  1SKW B;  4GRF A;  4V2N A;  2V6K A;  1V58 A;  5ELG A;  2R3X A;  4ISD A;  1YKA A;  3LWA A;  3MDK A;  3ZRD A;  4QQ7 A;  1F2E A;  2LV3 A;  5IPH A;  3DVW A;  4JBB A;  3ZTL A;  3D21 A;  3D0Z A;  5A4V A;  5ECH B;  1VRS D;  5CNW A;  4LL1 B;  5F06 A;  3ZMK A;  4JE1 A;  2CAQ A;  3QOU A;  2C4J A;  4EF0 A;  3O3T A;  1G7E A;  2OE3 A;  3IDV A;  5B6M A;  2PUK C;  2P5R A;  4TN8 A;  1GUL A;  1GWC A;  2MMZ A;  3QR6 A;  1GUK A;  1Q98 A;  1YEP A;  5DVB A;  4ECI A;  3H4K A;  2H8L A;  3FEU A;  1VF4 A;  3ME8 A;  5D73 A;  4GSS A;  3M1G A;  5JCW A;  4WR5 A;  1SKR B;  3DKS A;  1E6B A;  5DAL A;  1TI3 A;  2X8G A;  1G7O A;  4IBP A;  4XS4 B;  2HSH A;  4WET A;  3J7Y b;  2DBC A;  5E59 A;  5ID2 B;  5IQY A;  3P2A A;  1TKD B;  4KND A;  2VD1 A;  4BWS A;  1K3L A;  1EEM A;  3SBC A;  1XPV A;  4MDC A;  3GL3 A;  3P7X A;  3W6G A;  4PXO A;  1M2A A;  4CDO A;  1TXX A;  3TCO A;  5G5E A;  1EZK A;  4RQX A;  1X5C A;  4BVY A;  2R6K A;  1TJD A;  4GF0 A;  1RK4 A;  1N2A A;  1U3A A;  4BA7 A;  1SEN A;  4POK A;  1UVZ A;  1M7T A;  4ZB6 A;  4D73 B;  4FYB A;  1K0C A;  1PD2 1;  3FYG A;  4IVF A;  5G30 A;  2LUS A;  3Q18 A;  3O76 A;  1PX6 A;  3QAG A;  3BJ5 A;  3LXT A;  2GZP A;  5IIZ A;  3TKQ A;  1M99 A;  3M9K A;  1TRV A;  2XPD A;  1SYR A;  3GKX A;  2V32 A;  2GSR A;  4WF4 A;  3GH9 A;  5CAX A;  3PH9 A;  5D9X A;  1HNC A;  1U87 A;  3EIN A;  3FY7 A;  1J08 A;  1B4Q A;  1N8J A;  3TB2 A;  1U88 A;  2VCX A;  1EP8 A;  20GS A;  3GMF A;  1GLQ A;  1K3Y A;  2H66 A;  2YZH A;  3VWX A;  3TRQ A;  4OCF A;  1OKD A;  3QAW A;  3KTB A;  2CVB A;  2QSI A;  5FWG A;  1AQV A;  1B9Y C;  4OMV A;  4HU7 A;  3SWL A;  4IS0 A;  3UBK A;  1KEB A;  2HFD A;  3I9V 2;  3KJY A;  1GTI A;  3N9J A;  4MPF A;  1TRW A;  5ECP B;  2IFQ A;  4BPY A;  3D6I A;  2YZU A;  1NW2 A;  1XVW A;  3CRT A;  2PVQ A;  2GT5 A;  2VAF A;  3GL5 A;  3EE2 A;  4ML1 A;  5J3R A;  3LYP A;  1X9S B;  3TJF A;  2R2J A;  1X9W B;  1GSU A;  1OE8 A;  2QKE A;  3BD2 A;  2ZCT A;  2O85 A;  5IMC A;  1HNB A;  4XS1 A;  3A3T A;  1VGL A;  1S3C A;  1C72 A;  2ZUP A;  1SKS B;  1XW6 A;  5DDL A;  1VF3 A;  2VCW A;  3FR3 A;  2JL4 A;  5ELA A;  2GSS A;  3QMX A;  4I2U A;  3EVI A;  4OCE A;  5ECL B;  3GSS A;  4KH7 A;  1OE7 A;  3HXS A;  2A2S A;  2IMK A;  3ZML A;  3UVH A;  1GTA A;  1QGV A;  2ES7 A;  1ERU A;  2EIR A;  1LJR A;  1M2B A;  4K0N A;  4ZBD A;  3KP8 A;  3TKS E;  1PL2 A;  5ECO B;  4WKW A;  2WUL A;  2REM A;  4AJ6 A;  3TRP A;  1WWJ A;  1K0A A;  4L5L A;  4MJA A;  2B6M A;  2MBS A;  4JRR A;  1PQN A;  2AV4 A;  3TDG A;  1I9D A;  5IMD A;  3UAP A;  3KZQ A;  5DAK B;  4TXO B;  4XHM A;  3CYN A;  1G6Y A;  4HUA A;  1JZD A;  2PGT A;  3KMN A;  1XXU A;  2VLU A;  5LD0 A;  1SJ6 A;  3W8S A;  1Z6M A; 
#chains in the Genus database with same CATH topology
 3PIN A;  5CYY A;  4MH2 A;  3P90 A;  4RUV A;  1XWG A;  2L5O A;  1K0M A;  3WGD A;  3LG6 A;  3PGT A;  2BMX A;  2C0G A;  3HYP A;  3M9J A;  1EWX A;  2PN8 A;  4LMW A;  3ZFL A;  3GKK A;  3KM6 A;  2IJY A;  2EIQ A;  4G2E A;  14GS A;  4EUY A;  2XBI A;  2O89 A;  1V40 A;  2MMO A;  4KAE A;  4K7N A;  5IMA A;  2YWI A;  4DSQ A;  2V2G A;  2P5Q A;  2C1Y A;  4F9Z A;  3JCM L;  4CW9 A;  3IOS A;  4O5Q A;  1ZYP A;  3Q19 A;  2DSA A;  3G7I A;  1EV4 A;  2C80 A;  3G7J A;  3HJO A;  3I43 A;  1PN0 A;  1WP0 A;  4JU5 A;  3GA4 A;  3D4M A;  2HI7 A;  2F3M A;  4GLT A;  4TR1 B;  2AJQ B;  4BL7 B;  1TDI A;  1ZZY A;  5KN3 A;  5KN0 A;  1Y25 A;  2WFC A;  1GTB A;  3D4T A;  2X99 A;  4GCI A;  4IN0 A;  2XPE A;  4XCS A;  3ZYW A;  3ME7 A;  4XRD A;  3D5J A;  3F0I A;  2C0E A;  3ZRE A;  2H6Y A;  4WBJ A;  3GX8 A;  1XZO A;  2DMM A;  1OC3 A;  11GS A;  4NPB A;  3GHA A;  3GTU A;  1V2A A;  1QUW A;  5IO2 A;  2PBJ A;  2DIY A;  4NXI A;  1TK0 B;  2V1M A;  3KMO A;  3NIV A;  3KEB A;  2YPM A;  3CTG A;  1XW9 A;  3ZIV A;  2R0G A;  3RHB A;  2GLR A;  5BMU A;  2GVP A;  3EPT A;  2VOC A;  3IXR A;  1AUC A;  5IPG A;  4GWR A;  5D93 A;  3VLN A;  3E9J B;  3IHQ A;  3L9U A;  3GFK A;  4PQH A;  5GAN D;  2DJJ A;  2E7P A;  3M8N A;  3GUR A;  4MA9 A;  4IGJ A;  5B7C A;  1JZO A;  4V2M A;  3PR8 A;  1XWA A;  4MF5 A;  2K18 A;  4L0W A;  2PPT A;  4N10 A;  3VK9 A;  1V98 A;  2YWO A;  2UZ8 A;  4MCU A;  1KBN A;  3TJK A;  1OYJ A;  1PKZ A;  2VL2 A;  1ML6 A;  1GUH A;  1BJX A;  3NOF A;  1USB A;  2TRX A;  3S9F A;  2DJ1 A;  2I1U A;  4EDY A;  4EE0 A;  5EL8 A;  2O8V B;  2I4A A;  2B7J A;  1VF2 A;  3LGC A;  4MJE A;  5ECN B;  5DCH A;  1A0F A;  5KN2 A;  5FHI A;  3U6V A;  1IYH A;  3CBU A;  2H70 A;  9GSS A;  4HS1 A;  2M46 A;  3HJM A;  2IN3 A;  1M9A A;  5CO3 A;  1TRU A;  4OO4 A;  4X1U A;  3ZL5 A;  1JZW A;  5F05 A;  4EDZ A;  4PUR A;  5DAL B;  2HZE A;  3UL3 A;  5L71 A;  22GS A;  17GS A;  5D8I A;  3GV1 A;  2LRC A;  3FRC A;  3EC3 A;  3OR5 A;  1HYU A;  1SL0 B;  1ZMA A;  6GSY A;  3HJP A;  1EP7 A;  5KOX A;  3ZZX A;  2H71 A;  3HKR A;  2C8U A;  2F51 A;  5DQY A;  2VL3 A;  4CY6 A;  2FWH A;  2YWM A;  3KH7 A;  1ZOF A;  1F6M C;  4MZB A;  1WIK A;  1M0U A;  3CXG A;  1SYX A;  1ZL9 A;  4YH2 A;  2GZY A;  3FZ4 A;  4Q5Q A;  2KOK A;  1PA3 A;  3VWW A;  1WPI A;  2H1G A;  4BVY B;  4TRX A;  2N5F A;  4OWY A;  2OKA A;  4ZBB A;  4DSR A;  2QA1 A;  4LLR A;  3NZN A;  3R2Q A;  5B6N A;  2YWN A;  4O5R A;  1H4O A;  2G2Q A;  2M80 A;  4LA1 A;  5HQP A;  4KW6 A;  1R5A A;  6GSX A;  4TR0 A;  2O7K A;  2AUV A;  1NSW A;  4IJ3 A;  3IBH A;  5KEJ A;  1THX A;  2CAI A;  3HZ4 A;  3US3 A;  4XS6 A;  2LRT A;  4K2X A;  4FQU A;  2CX4 A;  4L5O A;  5INY A;  4G9H A;  1VF1 A;  1EEJ A;  2DIZ A;  2FGX A;  3LJR A;  5HFK A;  5F0G A;  3C73 A;  2CZ2 A;  2L4C A;  2ZNM A;  1THO A;  2LST A;  2IME A;  5H5R A;  8GSS A;  2IWT A;  3QD9 A;  4PNF A;  5CRG A;  4ZB8 A;  4NV2 A;  4BIK A;  3IC4 A;  5GZZ B;  2F9S A;  1ZYQ B;  2H6Z A;  4X0X A;  3MSZ A;  5EVO A;  4XRA A;  2KUC A;  5IO0 A;  1T4Z A;  2FCH A;  12GS A;  2L4Q A;  3LXZ A;  3EYT A;  4MMM A;  4V2L A;  3TJG A;  3UEM A;  1Y6E A;  3GKM A;  5AN1 A;  5LNK e;  1SL2 B;  2HRA A;  4ULX A;  4G10 A;  1F37 A;  4J2F A;  4HJM A;  2NPB A;  1G6W A;  2GQM A;  5ECM B;  3EU3 A;  1Z6N A;  4MPG A;  5D9V A;  3H1N A;  1ZYN A;  2WCI A;  3C8E A;  5CRE A;  2IFQ B;  2HRN A;  7GSS A;  1TK8 B;  4ML6 A;  2GZZ A;  4IQ1 A;  1Z3E A;  1T8E B;  4HZ4 A;  1GNE A;  2OE1 A;  1FG4 A;  3DRN A;  4MK3 A;  1U6T A;  2PER A;  4XIH A;  1F3A A;  5JCU A;  4TW5 A;  4E8H A;  2HT9 A;  2B5E A;  2HRK A;  1TW9 A;  1PSQ A;  1XCC A;  4MJB A;  4TR4 A;  3MAK A;  1MTC A;  3IA1 A;  1RW1 A;  2LNT A;  1WOU A;  1W4V A;  2LS5 A;  2JU5 A;  3FR6 A;  4F82 A;  4J56 E;  3F4T A;  2LNS A;  4DSS A;  1FVJ A;  2L59 A;  3BOA A;  1XW5 A;  3I6A A;  4XS4 A;  2AHE A;  5JCG A;  4USS A;  3APO A;  1W89 A;  3TOT A;  1R5P A;  4K7I A;  4Q5F A;  1YF0 A;  2H74 A;  3IV4 A;  5ECQ B;  3DWV A;  5HR0 A;  2LJK A;  3M3M A;  3KIJ A;  1SK0 A;  2BJX A;  1AXD A;  4HZ2 A;  1KNG A;  1OKT A;  3RBT A;  3DIE A;  4TOP A;  1J9B A;  4GST A;  2IIY A;  2VM2 A;  3U5R E;  1XG8 A;  1YJ6 A;  3I69 A;  4G19 A;  2YV7 A;  4JR4 A;  4K7O A;  3CSJ A;  2FWE A;  2V6O A;  4K1F A;  3GIX A;  1TTZ A;  4OFM A;  1ILO A;  1K0O A;  1SK2 A;  2VL9 A;  3IRA A;  5GAP D;  4KB3 A;  5HR2 A;  1A0R P;  1V57 A;  3IAM 2;  4MF7 A;  1R26 A;  1ERT A;  2MBT A;  1Z7R A;  3IAS 2;  3APQ A;  2A4V A;  1NHY A;  2N5B A;  3H8Q A;  4WEY A;  3F63 A;  2AB6 A;  2YNX A;  1O81 A;  2B3S A;  3KXO A;  4MAB A;  4EO3 A;  3LOR A;  2YP6 A;  2GST A;  1YDK A;  3A2W A;  2MYG A;  2HNL A;  2X8H A;  3TJB A;  3M0F A;  2WGR A;  4POM A;  3TKS C;  4H86 A;  4OFT A;  2FUG 2;  1QXH A;  1KTE A;  1MDK A;  4N30 A;  5J41 A;  2EIO A;  2OAC A;  5IMV A;  2ON7 A;  5BRT A;  2E2M A;  2FA8 A;  3KGK A;  5ECS A;  2FD3 A;  4RQR A;  3TJJ A;  2JZT A;  1JZR A;  2F8F A;  3GYK A;  3QFB C;  4POB A;  4O32 A;  3FZA A;  2WRT A;  3RAZ A;  3G7Y A;  2H1B A;  3TUE A;  1TP9 A;  1FAA A;  4KSO A;  4RI6 A;  1ZYE A;  2L6D A;  3GTU B;  1SL1 B;  2CQ9 A;  2C3T A;  1M9B A;  1O8W A;  2E0Q A;  2DML A;  4EXJ A;  2MMN A;  1PGT A;  2KP1 A;  5GSS A;  4GQC A;  19GS A;  2K6V A;  1I5G A;  1YQ1 A;  4PGT A;  1FOV A;  3LSZ A;  2NBS A;  1TRS A;  4PUA A;  1YF1 A;  2DKI A;  4PTS A;  1R7H A;  4BWQ A;  1A23 A;  4PNG A;  2X49 A;  4F2I A;  2H0H A;  4KDY A;  2YCD A;  6GSW A;  1ERV A;  2C0D A;  2A2R A;  4FYC A;  1Z5Y E;  4KF9 A;  2VD0 A;  3E3E A;  2HXK A;  2JAD A;  2HSM A;  4ILF A;  3DGQ A;  3FHK A;  4RI7 A;  3F4S A;  2MMA A;  4TR3 A;  3TOU A;  3FZ5 A;  4MF6 A;  4LL4 B;  2PVO C;  1PX7 A;  1S3A A;  3UBL A;  4EIQ A;  1XWC A;  4AJ7 A;  4NWY A;  2DJK A;  3ZVJ A;  5JWR B;  2I3Y A;  2HZE B;  1GSD A;  3DYR A;  2OAD A;  5J4U A;  5HFI A;  5HFG A;  3GST A;  1YEX A;  1O8X A;  1X0R A;  3DXB A;  3Q6O A;  3UAR A;  5LCZ A;  2FWF A;  3ZIJ A;  3TRX A;  3IR4 A;  5IM9 A;  1ERW A;  4AF2 A;  3VWU A;  1A24 A;  3R3E A;  1T4Y A;  4BVX A;  4MZC A;  1GSS A;  2H19 A;  3W8J A;  3L9V A;  2X64 A;  4EKZ A;  1ON4 A;  2HZF A;  1TI1 A;  3WT2 A;  3EUR A;  4IEL A;  5G31 A;  3ED3 A;  2OA7 A;  3IE3 A;  1A8Y A;  3QPM A;  3E0U A;  2LJR A;  2P31 A;  3FZ9 A;  2VLT A;  5A4W A;  1A2M A;  5H5S A;  5J9B A;  3BCK A;  3HZ8 A;  2HLS A;  3QDN A;  4PX1 A;  3V1W A;  1GP1 A;  1M3I A;  1AC1 A;  2GQK A;  1K0B A;  1GRX A;  4EVM A;  2FNO A;  4K0G A;  3ZVJ D;  5DQS A;  4ZBA A;  1SK1 A;  1GH2 A;  4ACS A;  3L0H A;  5DCG A;  3EWL A;  1TOF A;  3ERW A;  3A2X A;  2CV4 A;  4K5S A;  1UA5 A;  2PMT A;  1A2J A;  5D9T A;  2H1A A;  1GSE A;  4ECB A;  1URM A;  2FA4 A;  3MWH A;  5E4W A;  3GX0 A;  4ZL8 A;  1BAY A;  2CA8 A;  6GSS A;  1GL8 A;  4WF5 A;  3VWV A;  2J9H A;  3F8U A;  2XBQ A;  4GSN A;  4HEA 2;  5DJL A;  3FKF A;  1HQO A;  2H75 A;  16GS A;  3N5O A;  1DE2 A;  2B5X A;  3VPT A;  3KTL A;  2HYX A;  5HR1 A;  2H01 A;  1QFN A;  1OVN A;  1OC9 A;  4WBR D;  3DML A;  2PU9 C;  5ENU A;  1GSQ A;  1R4W A;  3RPP A;  5G1L A;  2B1L A;  3LEF A;  1MDJ A;  3HA9 A;  4V1A p;  1BED A;  4YAV A;  2JSZ A;  1JHB A;  2WZ9 A;  1SU9 A;  1EV9 A;  5G2Z A;  5IOX A;  4FIW A;  3VUR A;  3F6D A;  4KDX A;  1FW1 A;  4NHW A;  2LQO A;  5JWO B;  4MLY A;  3VI5 A;  3KH9 A;  2RUF A;  5DJM A;  4F03 A;  1Z9H A;  4K9Z A;  2H76 A;  2BTO T;  2L6C A;  4K6X A;  4I6X A;  3WD6 A;  2XHF A;  1CQH A;  2G0F A;  2XC2 A;  1ST9 A;  4KGI A;  4PQ1 A;  2LKU A;  4L0U A;  4Z2T A;  5EY6 A;  2LJA A;  1BQ7 A;  4I97 A;  3HHV A;  1M2D A;  3HVS A;  3RHC A;  2WS2 A;  2AAW A;  1FB6 A;  1LU4 A;  1K0D A;  1GNW A;  4Z2U A;  1K0N A;  3ZIT A;  1EGO A;  4FO5 A;  5CRH A;  1XWB A;  5C04 A;  1UN2 A;  2IMI A;  3CMI A;  4DSS B;  4K2D A;  1XBS A;  4I5Q A;  2EC4 A;  4KSM A;  1WE0 A;  4LMV A;  4N0V A;  1PMT A;  4F0B A;  2X4A A;  1U3I A;  1B9X C;  1MDI A;  3C1R A;  3FK8 A;  1Z7P A;  4NAX A;  4XTS A;  4A5P A;  18GS A;  3GH6 A;  2IPA A;  4J57 E;  4IP1 A;  2RUE A;  2RLI A;  1ZCP A;  2H0G A;  2VO4 A;  3KCM A;  2R0P A;  1ACV A;  2LRN A;  4KCE A;  5KOW A;  2VIM A;  3C7M A;  2AYT A;  1O73 A;  4TXV A;  4K8M A;  4MZW A;  4AGS A;  1AQX A;  3HVV A;  4ID0 A;  1NM3 A;  5G5F A;  2HE3 A;  2R5G A;  4Z2R A;  1JLV A;  5KN1 A;  1FO5 A;  1B8X A;  6GSU A;  4FYU A;  3GN3 A;  5AIS A;  2H1D A;  4POL A;  1CQG A;  2ALB A;  4IJI A;  1K3O A;  3CRU A;  4OD7 A;  5JWQ B;  1EOG A;  2KLX A;  1SD8 A;  1QQ2 A;  2TRC P;  5A4U A;  4JED A;  2OBK A;  3L78 A;  4I8B A;  4TVE A;  2NVL A;  1FVK A;  1WJK A;  2VUP A;  3J7Y k;  4ZL9 A;  2JSY A;  3Q74 A;  4I2T A;  4ZIL A;  3WGX A;  4YQV A;  4NMU A;  3D22 A;  1XIY A;  5ABR A;  4N0Z A;  1PL1 A;  6GSV A;  1O6J A;  1M3J A;  2LEG A;  3TKP A;  5ID2 A;  2VLV A;  3CSH A;  3FR9 A;  1DE1 A;  5C00 A;  2L5L A;  2GQL A;  3A5I A;  3F9U A;  1WRY A;  1XVQ A;  1WMJ A;  1DUG A;  2V41 A;  2GT6 A;  3QAV A;  2CT6 A;  4WR4 A;  4EL1 A;  2WJU A;  3ZFB A;  4OFN A;  3F6F A;  3DD3 A;  3HCZ A;  1DBY A;  4ECC A;  1PRX A;  4KUN A;  5AGY A;  2KP2 A;  1T3B A;  1DSB A;  5G1K A;  3TKR A;  1YZX A;  3CTF A;  2K9F A;  4D73 A;  2B1K A;  2FY6 A;  4KCA A;  1F3B A;  4P3Y B;  2HSY A;  1GTU A;  2RM6 A;  1ZGN A;  2O87 A;  4KX4 A;  2MZC A;  5IOW A;  2F8A A;  5CRW A;  1F9M A;  1PKW A;  2ON5 A;  4Z7X A;  2DC5 A;  5D96 A;  4OO5 A;  4FH8 A;  1QMV A;  1SD9 A;  1GUM A;  2B7K A;  1MEK A;  5F07 A;  3UIW A;  3GNJ A;  3CSI A;  2RII A;  3C1S A;  1G0T A;  2TIR A;  3DVX A;  2H30 A;  3O6T A;  2YJH A;  4HI7 A;  4GTU A;  2N5A A;  13GS A;  2OJL A;  4DEJ A;  2R37 A;  4DVC A;  1BG5 A;  3KD0 A;  4V1A g;  1FOH A;  3HVN A;  3LQ7 A;  4YAP A;  4ECJ A;  3TKS A;  4GXZ A;  1UC7 A;  5CP1 A;  1MD3 A;  2C0F A;  2DJ3 A;  3EMP A;  1J0F A;  4HOJ A;  4HU9 A;  3A5W A;  5AIX A;  1ABA A;  2WDU A;  2H72 A;  4ZIJ A;  3APS A;  5GST A;  3G9B A;  2DJ2 A;  1AW9 A;  1JLW A;  3MNG A;  2YJ7 A;  3IPZ A;  4CHS A;  4E8E A;  1LBK A;  1GSY A;  3GUS A;  2K8S A;  2CZ3 A;  2CVK A;  4HQZ A;  3IC8 A;  3WT1 A;  2YAN A;  4L8E A;  4KDU A;  4HJ2 A;  4NV5 A;  1YKC A;  3H93 A;  4QL9 A;  2YN1 A;  4ZL7 A;  2KHP A;  2Z9S A;  4IQA A;  1MD4 A;  2M72 A;  1HD2 A;  2D2Z A;  3CQF A;  1OAZ A;  2VCQ A;  1A8L A;  3L9S A;  2VCZ A;  5DBQ A;  1PN9 A;  1IYI A;  2QA2 A;  5CRD A;  3FW2 A;  2H0I A;  3AY8 A;  4YQM A;  2K8V A;  4KA0 A;  3EMX A;  3RDW A;  1YY7 A;  3KP9 A;  2GSQ A;  4BVX B;  1EGR A;  1AQW A;  4Q5N A;  4NHZ A;  2P0G A;  1A2L A;  3A2V A;  4MP4 A;  1BX9 A;  1XOA A;  2JZS A;  2NDO A;  2YV9 A;  3L4N A;  1EOH A;  3LYK A;  3C71 A;  3K8N A;  5AIV A;  4YQU A;  1TU8 A;  4IW9 A;  3ISO A;  4ZB9 A;  1O85 A;  1PFO A;  1O7U A;  2WB9 A;  2IMD A;  5A5K A;  10GS A;  2QGV A;  4HDE A;  5H5Q A;  1TU7 A;  2GTU A;  3ERF A;  3UMA A;  2I81 A;  5COH A;  1B48 A;  2IMF A;  2FHE A;  4EC0 A;  2B5Y A;  5B8B A;  2YOI A;  3QCP A;  3H79 A;  3VFI A;  1NHO A;  2H73 A;  2X8C A;  2OBI A;  1OC8 A;  3F4R A;  2IL3 A;  5IMZ A;  3UJ1 A;  5DAK A;  4TXO A;  3F3Q A;  4IP6 A;  2JZR A;  3TGZ A;  1Q4J A;  3WGE A;  2FWG A;  5J5N A;  2OE0 A;  2DJ0 A;  1X9M B;  2J23 A;  2C3N A;  4GQF A;  1RQM A;  3RPN A;  2E2G A;  5ECK B;  1GSF A;  5J9C A;  3ERG A;  1BYE A;  2I9H A;  1T7P B;  4G0I A;  4Q5R A;  4G0K A;  3EU4 A;  4O7H A;  4HQS A;  1TK5 B;  1HNA A;  4PQI A;  3LFL A;  1XOB A;  3GKN A;  1OC9 B;  5IMF A;  2L57 A;  2HRF A;  2VCV A;  1X5D A;  3BBY A;  4KE3 A;  4JR6 A;  4X43 A;  3P8W A;  4F0C A;  1T1V A;  3HD5 A;  2LQQ A;  4N11 A;  1XWK A;  4HSC X;  1E2Y A;  3DEX A;  4G0L A;  1QK8 A;  4IHU A;  1B4P A;  5F8B A;  3WYW A;  4QL7 A;  5EPF A;  1SJZ A;  2R4V A;  4AJ8 A;  1H75 A;  1SJI A;  3QFA C;  2GGT A;  2VM1 A;  4TR1 A;  2CVD A;  4BL7 A;  3UOM A;  2C3Q A;  4MH3 A;  3HDC A;  2JAC A;  2PWJ A;  2LTK A;  1FHE A;  3IK9 A;  5ECR B;  1X5E A;  4JZQ A;  2DLX A;  2H6X A;  4PUF C;  4IKH A;  6GST A;  1AAZ A;  2VL2 C;  3ZLP A;  2CX3 A;  2R0C A;  5HR3 A;  2RM5 A;  3MIX A;  2GDR A;  3HVX A;  1XFL A;  5FT3 A;  1JFU A;  1T00 A;  3F3R A;  4TKY A;  4ZXG A;  3HY2 A;  4MJC A;  2QC7 A;  4O92 A;  1FB0 A;  3IK7 A;  3GRX A;  5ECI B;  3VPQ A;  3UVT A;  4WXT A;  1S3D A;  2VCT A;  2NTO A;  2FLS A;  3LW9 A;  5B8A A;  1GLP A;  3VI7 A;  1AIU A;  3BCI A;  2DKH A;  1V9W A;  2GS3 A;  5D9W A;  1SKW B;  4GRF A;  4V2N A;  2V6K A;  1V58 A;  5ELG A;  2R3X A;  4ISD A;  1YKA A;  3LWA A;  3MDK A;  3ZRD A;  4QQ7 A;  1F2E A;  2LV3 A;  5IPH A;  3DVW A;  4JBB A;  3ZTL A;  3D21 A;  3D0Z A;  2A4H A;  5A4V A;  5ECH B;  1VRS D;  5CNW A;  4LL1 B;  5F06 A;  3ZMK A;  4JE1 A;  2CAQ A;  3QOU A;  2C4J A;  4EF0 A;  3O3T A;  1G7E A;  2OE3 A;  3IDV A;  5B6M A;  2PUK C;  3IHG A;  2P5R A;  4TN8 A;  1GUL A;  1GWC A;  2MMZ A;  3QR6 A;  1GUK A;  1Q98 A;  1YEP A;  5DVB A;  2A2P A;  4ECI A;  3H4K A;  2H8L A;  3FEU A;  3PPU A;  1VF4 A;  3ME8 A;  3FMW A;  5D73 A;  4GSS A;  3M1G A;  5JCW A;  4WR5 A;  1SKR B;  3DKS A;  1E6B A;  5DAL A;  1TI3 A;  2X8G A;  4YKG A;  1G7O A;  4IBP A;  4XS4 B;  2HSH A;  4WET A;  3J7Y b;  2DBC A;  5E59 A;  5ID2 B;  5IQY A;  4ICY A;  3P2A A;  1TKD B;  4KND A;  2VD1 A;  4BWS A;  1K3L A;  1EEM A;  3SBC A;  1XPV A;  4MDC A;  3GL3 A;  3P7X A;  3W6G A;  4PXO A;  1M2A A;  4CDO A;  1TXX A;  3TCO A;  5G5E A;  1EZK A;  4RQX A;  1X5C A;  4K5R A;  4BVY A;  2R6K A;  1TJD A;  4GF0 A;  1RK4 A;  1N2A A;  1U3A A;  4BA7 A;  1SEN A;  4POK A;  1UVZ A;  1M7T A;  4ZB6 A;  4D73 B;  4FYB A;  4CY8 A;  1K0C A;  1PD2 1;  3FYG A;  4IVF A;  5G30 A;  2LUS A;  3Q18 A;  3O76 A;  1PX6 A;  3QAG A;  1S3R A;  3BJ5 A;  3LXT A;  2GZP A;  5IIZ A;  3TKQ A;  1M99 A;  3M9K A;  1TRV A;  2XPD A;  1SYR A;  3GKX A;  2V32 A;  2GSR A;  4WF4 A;  3GH9 A;  5CAX A;  3PH9 A;  5D9X A;  1HNC A;  1U87 A;  3EIN A;  3FY7 A;  1J08 A;  1B4Q A;  1N8J A;  3TB2 A;  1U88 A;  4YKF A;  2VCX A;  1EP8 A;  20GS A;  3GMF A;  1GLQ A;  1K3Y A;  2H66 A;  2YZH A;  3VWX A;  3TRQ A;  4OCF A;  1OKD A;  3QAW A;  3KTB A;  2CVB A;  2QSI A;  5FWG A;  1AQV A;  1B9Y C;  4OMV A;  4HU7 A;  3SWL A;  4IS0 A;  3UBK A;  1KEB A;  2HFD A;  3I9V 2;  3KJY A;  1GTI A;  3N9J A;  4MPF A;  1TRW A;  5ECP B;  2IFQ A;  4BPY A;  3D6I A;  2YZU A;  1NW2 A;  1XVW A;  3CRT A;  2PVQ A;  2GT5 A;  2VAF A;  3GL5 A;  3EE2 A;  4ML1 A;  5J3R A;  3LYP A;  1X9S B;  3TJF A;  2R2J A;  1X9W B;  4X4J A;  1GSU A;  1OE8 A;  2QKE A;  4MNN A;  3BD2 A;  2ZCT A;  2O85 A;  5IMC A;  1HNB A;  4XS1 A;  3A3T A;  1VGL A;  1S3C A;  1C72 A;  2ZUP A;  1SKS B;  1XW6 A;  5DDL A;  1VF3 A;  2VCW A;  3FR3 A;  2JL4 A;  5ELA A;  2GSS A;  3QMX A;  4I2U A;  3EVI A;  4OCE A;  5ECL B;  3GSS A;  4KH7 A;  1OE7 A;  3HXS A;  2A2S A;  2IMK A;  3ZML A;  3UVH A;  1GTA A;  1QGV A;  2ES7 A;  1ERU A;  2EIR A;  1LJR A;  1M2B A;  4K0N A;  4ZBD A;  3KP8 A;  3TKS E;  1PL2 A;  5ECO B;  4WKW A;  4O5U A;  2WUL A;  2REM A;  4AJ6 A;  3TRP A;  1WWJ A;  1K0A A;  4L5L A;  4MJA A;  2B6M A;  2MBS A;  4JRR A;  1PQN A;  2AV4 A;  3TDG A;  1I9D A;  5IMD A;  3UAP A;  3KZQ A;  5DAK B;  4TXO B;  4XHM A;  3CYN A;  1G6Y A;  4HUA A;  1JZD A;  2PGT A;  3MYD A;  3KMN A;  1XXU A;  2VLU A;  4EIP A;  5LD0 A;  1SJ6 A;  3W8S A;  1Z6M A; 
#chains in the Genus database with same CATH homology
 3PIN A;  5CYY A;  4MH2 A;  3P90 A;  4RUV A;  1XWG A;  2L5O A;  1K0M A;  3WGD A;  3LG6 A;  3PGT A;  2BMX A;  2C0G A;  3HYP A;  3M9J A;  1EWX A;  2PN8 A;  4LMW A;  3ZFL A;  3GKK A;  3KM6 A;  2IJY A;  2EIQ A;  4G2E A;  14GS A;  4EUY A;  2XBI A;  2O89 A;  1V40 A;  2MMO A;  4KAE A;  4K7N A;  5IMA A;  2YWI A;  4DSQ A;  2V2G A;  2P5Q A;  2C1Y A;  4F9Z A;  3JCM L;  4CW9 A;  3IOS A;  4O5Q A;  1ZYP A;  3Q19 A;  2DSA A;  3G7I A;  1EV4 A;  2C80 A;  3G7J A;  3HJO A;  3I43 A;  1PN0 A;  1WP0 A;  4JU5 A;  3GA4 A;  3D4M A;  2HI7 A;  2F3M A;  4GLT A;  4TR1 B;  2AJQ B;  4BL7 B;  1TDI A;  1ZZY A;  5KN3 A;  5KN0 A;  1Y25 A;  2WFC A;  1GTB A;  3D4T A;  2X99 A;  4GCI A;  4IN0 A;  2XPE A;  4XCS A;  3ZYW A;  3ME7 A;  4XRD A;  3D5J A;  3F0I A;  2C0E A;  3ZRE A;  2H6Y A;  4WBJ A;  3GX8 A;  1XZO A;  2DMM A;  1OC3 A;  11GS A;  4NPB A;  3GHA A;  3GTU A;  1V2A A;  1QUW A;  5IO2 A;  2PBJ A;  2DIY A;  4NXI A;  1TK0 B;  2V1M A;  3KMO A;  3NIV A;  3KEB A;  2YPM A;  3CTG A;  1XW9 A;  3ZIV A;  2R0G A;  3RHB A;  2GLR A;  5BMU A;  2GVP A;  3EPT A;  2VOC A;  3IXR A;  1AUC A;  5IPG A;  4GWR A;  5D93 A;  3VLN A;  3E9J B;  3IHQ A;  3L9U A;  3GFK A;  4PQH A;  5GAN D;  2DJJ A;  2E7P A;  3M8N A;  3GUR A;  4MA9 A;  4IGJ A;  5B7C A;  1JZO A;  4V2M A;  3PR8 A;  1XWA A;  4MF5 A;  2K18 A;  4L0W A;  2PPT A;  4N10 A;  3VK9 A;  1V98 A;  2YWO A;  2UZ8 A;  4MCU A;  1KBN A;  3TJK A;  1OYJ A;  1PKZ A;  2VL2 A;  1ML6 A;  1GUH A;  1BJX A;  3NOF A;  1USB A;  2TRX A;  3S9F A;  2DJ1 A;  2I1U A;  4EDY A;  4EE0 A;  5EL8 A;  2O8V B;  2I4A A;  2B7J A;  1VF2 A;  3LGC A;  4MJE A;  5ECN B;  5DCH A;  1A0F A;  5KN2 A;  5FHI A;  3U6V A;  1IYH A;  3CBU A;  2H70 A;  9GSS A;  4HS1 A;  2M46 A;  3HJM A;  2IN3 A;  1M9A A;  5CO3 A;  1TRU A;  4OO4 A;  4X1U A;  3ZL5 A;  1JZW A;  5F05 A;  4EDZ A;  4PUR A;  5DAL B;  2HZE A;  3UL3 A;  5L71 A;  22GS A;  17GS A;  5D8I A;  3GV1 A;  2LRC A;  3FRC A;  3EC3 A;  3OR5 A;  1HYU A;  1SL0 B;  1ZMA A;  6GSY A;  3HJP A;  1EP7 A;  5KOX A;  3ZZX A;  2H71 A;  3HKR A;  2C8U A;  2F51 A;  5DQY A;  2VL3 A;  4CY6 A;  2FWH A;  2YWM A;  3KH7 A;  1ZOF A;  1F6M C;  4MZB A;  1WIK A;  1M0U A;  3CXG A;  1SYX A;  1ZL9 A;  4YH2 A;  2GZY A;  3FZ4 A;  4Q5Q A;  2KOK A;  1PA3 A;  3VWW A;  1WPI A;  2H1G A;  4BVY B;  4TRX A;  2N5F A;  4OWY A;  2OKA A;  4ZBB A;  4DSR A;  2QA1 A;  4LLR A;  3NZN A;  3R2Q A;  5B6N A;  2YWN A;  4O5R A;  1H4O A;  2G2Q A;  2M80 A;  4LA1 A;  5HQP A;  4KW6 A;  1R5A A;  6GSX A;  4TR0 A;  2O7K A;  2AUV A;  1NSW A;  4IJ3 A;  3IBH A;  5KEJ A;  1THX A;  2CAI A;  3HZ4 A;  3US3 A;  4XS6 A;  2LRT A;  4K2X A;  4FQU A;  2CX4 A;  4L5O A;  5INY A;  4G9H A;  1VF1 A;  1EEJ A;  2DIZ A;  2FGX A;  3LJR A;  5HFK A;  5F0G A;  3C73 A;  2CZ2 A;  2L4C A;  2ZNM A;  1THO A;  2LST A;  2IME A;  5H5R A;  8GSS A;  2IWT A;  3QD9 A;  4PNF A;  5CRG A;  4ZB8 A;  4NV2 A;  3IC4 A;  5GZZ B;  2F9S A;  1ZYQ B;  2H6Z A;  4X0X A;  3MSZ A;  5EVO A;  4XRA A;  2KUC A;  5IO0 A;  1T4Z A;  2FCH A;  12GS A;  2L4Q A;  3LXZ A;  3EYT A;  4MMM A;  4V2L A;  3TJG A;  3UEM A;  1Y6E A;  3GKM A;  5AN1 A;  5LNK e;  1SL2 B;  2HRA A;  4ULX A;  4G10 A;  1F37 A;  4J2F A;  4HJM A;  2NPB A;  1G6W A;  2GQM A;  5ECM B;  3EU3 A;  1Z6N A;  4MPG A;  5D9V A;  3H1N A;  1ZYN A;  2WCI A;  3C8E A;  5CRE A;  2IFQ B;  2HRN A;  7GSS A;  1TK8 B;  4ML6 A;  2GZZ A;  4IQ1 A;  1Z3E A;  1T8E B;  4HZ4 A;  1GNE A;  2OE1 A;  1FG4 A;  3DRN A;  4MK3 A;  1U6T A;  2PER A;  4XIH A;  1F3A A;  5JCU A;  4TW5 A;  4E8H A;  2HT9 A;  2B5E A;  2HRK A;  1TW9 A;  1PSQ A;  1XCC A;  4MJB A;  4TR4 A;  3MAK A;  1MTC A;  3IA1 A;  1RW1 A;  2LNT A;  1WOU A;  1W4V A;  2LS5 A;  2JU5 A;  3FR6 A;  4F82 A;  4J56 E;  3F4T A;  2LNS A;  4DSS A;  1FVJ A;  2L59 A;  3BOA A;  1XW5 A;  3I6A A;  4XS4 A;  2AHE A;  5JCG A;  4USS A;  3APO A;  1W89 A;  3TOT A;  1R5P A;  4K7I A;  4Q5F A;  1YF0 A;  2H74 A;  3IV4 A;  5ECQ B;  3DWV A;  5HR0 A;  2LJK A;  3M3M A;  3KIJ A;  1SK0 A;  2BJX A;  1AXD A;  4HZ2 A;  1KNG A;  1OKT A;  3RBT A;  3DIE A;  4TOP A;  1J9B A;  4GST A;  2IIY A;  2VM2 A;  3U5R E;  1YJ6 A;  3I69 A;  4G19 A;  2YV7 A;  4JR4 A;  4K7O A;  3CSJ A;  2FWE A;  2V6O A;  4K1F A;  3GIX A;  1TTZ A;  4OFM A;  1ILO A;  1K0O A;  1SK2 A;  2VL9 A;  3IRA A;  5GAP D;  4KB3 A;  5HR2 A;  1A0R P;  1V57 A;  3IAM 2;  4MF7 A;  1R26 A;  1ERT A;  2MBT A;  1Z7R A;  3IAS 2;  3APQ A;  2A4V A;  1NHY A;  2N5B A;  3H8Q A;  4WEY A;  3F63 A;  2AB6 A;  2YNX A;  1O81 A;  2B3S A;  3KXO A;  4MAB A;  4EO3 A;  3LOR A;  2YP6 A;  2GST A;  1YDK A;  3A2W A;  2MYG A;  2HNL A;  2X8H A;  3TJB A;  3M0F A;  2WGR A;  4POM A;  3TKS C;  4H86 A;  4OFT A;  2FUG 2;  1QXH A;  1KTE A;  1MDK A;  4N30 A;  5J41 A;  2EIO A;  2OAC A;  5IMV A;  2ON7 A;  5BRT A;  2E2M A;  2FA8 A;  3KGK A;  5ECS A;  2FD3 A;  4RQR A;  3TJJ A;  2JZT A;  1JZR A;  2F8F A;  3GYK A;  3QFB C;  4POB A;  4O32 A;  3FZA A;  2WRT A;  3RAZ A;  3G7Y A;  2H1B A;  3TUE A;  1TP9 A;  1FAA A;  4KSO A;  4RI6 A;  1ZYE A;  2L6D A;  3GTU B;  1SL1 B;  2CQ9 A;  2C3T A;  1M9B A;  1O8W A;  2E0Q A;  2DML A;  4EXJ A;  2MMN A;  1PGT A;  2KP1 A;  5GSS A;  4GQC A;  19GS A;  2K6V A;  1I5G A;  1YQ1 A;  4PGT A;  1FOV A;  3LSZ A;  2NBS A;  1TRS A;  4PUA A;  1YF1 A;  2DKI A;  4PTS A;  1R7H A;  4BWQ A;  1A23 A;  4PNG A;  2X49 A;  4F2I A;  2H0H A;  4KDY A;  2YCD A;  6GSW A;  1ERV A;  2C0D A;  2A2R A;  4FYC A;  1Z5Y E;  4KF9 A;  2VD0 A;  3E3E A;  2HXK A;  2JAD A;  2HSM A;  4ILF A;  3DGQ A;  3FHK A;  4RI7 A;  3F4S A;  2MMA A;  4TR3 A;  3TOU A;  3FZ5 A;  4MF6 A;  4LL4 B;  2PVO C;  1PX7 A;  1S3A A;  3UBL A;  4EIQ A;  1XWC A;  4AJ7 A;  4NWY A;  2DJK A;  3ZVJ A;  5JWR B;  2I3Y A;  2HZE B;  1GSD A;  3DYR A;  2OAD A;  5J4U A;  5HFI A;  5HFG A;  3GST A;  1YEX A;  1O8X A;  1X0R A;  3DXB A;  3Q6O A;  3UAR A;  5LCZ A;  2FWF A;  3ZIJ A;  3TRX A;  3IR4 A;  5IM9 A;  1ERW A;  4AF2 A;  3VWU A;  1A24 A;  3R3E A;  1T4Y A;  4BVX A;  4MZC A;  1GSS A;  2H19 A;  3W8J A;  3L9V A;  2X64 A;  4EKZ A;  1ON4 A;  2HZF A;  1TI1 A;  3WT2 A;  3EUR A;  4IEL A;  5G31 A;  3ED3 A;  2OA7 A;  3IE3 A;  1A8Y A;  3QPM A;  3E0U A;  2LJR A;  2P31 A;  3FZ9 A;  2VLT A;  5A4W A;  1A2M A;  5H5S A;  5J9B A;  3BCK A;  3HZ8 A;  2HLS A;  3QDN A;  4PX1 A;  3V1W A;  1GP1 A;  1AC1 A;  2GQK A;  1K0B A;  1GRX A;  4EVM A;  2FNO A;  4K0G A;  3ZVJ D;  5DQS A;  4ZBA A;  1SK1 A;  1GH2 A;  4ACS A;  3L0H A;  5DCG A;  3EWL A;  1TOF A;  3ERW A;  3A2X A;  2CV4 A;  4K5S A;  1UA5 A;  2PMT A;  1A2J A;  5D9T A;  2H1A A;  1GSE A;  4ECB A;  1URM A;  2FA4 A;  3MWH A;  5E4W A;  3GX0 A;  4ZL8 A;  1BAY A;  2CA8 A;  6GSS A;  1GL8 A;  4WF5 A;  3VWV A;  2J9H A;  3F8U A;  2XBQ A;  4GSN A;  4HEA 2;  5DJL A;  3FKF A;  1HQO A;  2H75 A;  16GS A;  3N5O A;  1DE2 A;  2B5X A;  3VPT A;  3KTL A;  2HYX A;  5HR1 A;  2H01 A;  1QFN A;  1OVN A;  1OC9 A;  4WBR D;  3DML A;  2PU9 C;  5ENU A;  1GSQ A;  1R4W A;  3RPP A;  5G1L A;  2B1L A;  3LEF A;  1MDJ A;  3HA9 A;  4V1A p;  1BED A;  4YAV A;  2JSZ A;  1JHB A;  2WZ9 A;  1SU9 A;  1EV9 A;  5G2Z A;  5IOX A;  4FIW A;  3VUR A;  3F6D A;  4KDX A;  1FW1 A;  4NHW A;  2LQO A;  5JWO B;  4MLY A;  3VI5 A;  3KH9 A;  2RUF A;  5DJM A;  4F03 A;  1Z9H A;  4K9Z A;  2H76 A;  2BTO T;  2L6C A;  4K6X A;  4I6X A;  3WD6 A;  2XHF A;  1CQH A;  2G0F A;  2XC2 A;  1ST9 A;  4KGI A;  4PQ1 A;  2LKU A;  4L0U A;  4Z2T A;  5EY6 A;  2LJA A;  1BQ7 A;  4I97 A;  3HHV A;  1M2D A;  3HVS A;  3RHC A;  2WS2 A;  2AAW A;  1FB6 A;  1LU4 A;  1K0D A;  1GNW A;  4Z2U A;  1K0N A;  3ZIT A;  1EGO A;  4FO5 A;  5CRH A;  1XWB A;  5C04 A;  1UN2 A;  2IMI A;  3CMI A;  4DSS B;  4K2D A;  1XBS A;  4I5Q A;  2EC4 A;  4KSM A;  1WE0 A;  4LMV A;  4N0V A;  1PMT A;  4F0B A;  2X4A A;  1U3I A;  1B9X C;  1MDI A;  3C1R A;  3FK8 A;  1Z7P A;  4NAX A;  4XTS A;  4A5P A;  18GS A;  3GH6 A;  2IPA A;  4J57 E;  4IP1 A;  2RUE A;  2RLI A;  1ZCP A;  2H0G A;  2VO4 A;  3KCM A;  2R0P A;  1ACV A;  2LRN A;  4KCE A;  5KOW A;  2VIM A;  3C7M A;  2AYT A;  1O73 A;  4TXV A;  4K8M A;  4MZW A;  4AGS A;  1AQX A;  3HVV A;  4ID0 A;  1NM3 A;  5G5F A;  2HE3 A;  2R5G A;  4Z2R A;  1JLV A;  5KN1 A;  1FO5 A;  1B8X A;  6GSU A;  4FYU A;  3GN3 A;  5AIS A;  2H1D A;  4POL A;  1CQG A;  2ALB A;  4IJI A;  1K3O A;  3CRU A;  4OD7 A;  5JWQ B;  1EOG A;  2KLX A;  1SD8 A;  1QQ2 A;  2TRC P;  5A4U A;  4JED A;  2OBK A;  3L78 A;  4I8B A;  4TVE A;  2NVL A;  1FVK A;  1WJK A;  2VUP A;  3J7Y k;  4ZL9 A;  2JSY A;  3Q74 A;  4I2T A;  4ZIL A;  3WGX A;  4YQV A;  4NMU A;  3D22 A;  1XIY A;  5ABR A;  4N0Z A;  1PL1 A;  6GSV A;  1O6J A;  2LEG A;  3TKP A;  5ID2 A;  2VLV A;  3CSH A;  3FR9 A;  1DE1 A;  5C00 A;  2L5L A;  2GQL A;  3A5I A;  3F9U A;  1WRY A;  1XVQ A;  1WMJ A;  1DUG A;  2V41 A;  2GT6 A;  3QAV A;  2CT6 A;  4WR4 A;  4EL1 A;  2WJU A;  3ZFB A;  4OFN A;  3F6F A;  3DD3 A;  3HCZ A;  1DBY A;  4ECC A;  1PRX A;  4KUN A;  5AGY A;  2KP2 A;  1T3B A;  1DSB A;  5G1K A;  3TKR A;  1YZX A;  3CTF A;  2K9F A;  4D73 A;  2B1K A;  2FY6 A;  4KCA A;  1F3B A;  4P3Y B;  2HSY A;  1GTU A;  2RM6 A;  1ZGN A;  2O87 A;  4KX4 A;  2MZC A;  5IOW A;  2F8A A;  5CRW A;  1F9M A;  1PKW A;  2ON5 A;  4Z7X A;  2DC5 A;  5D96 A;  4OO5 A;  4FH8 A;  1QMV A;  1SD9 A;  1GUM A;  2B7K A;  1MEK A;  5F07 A;  3UIW A;  3GNJ A;  3CSI A;  2RII A;  3C1S A;  1G0T A;  2TIR A;  3DVX A;  2H30 A;  3O6T A;  2YJH A;  4HI7 A;  4GTU A;  2N5A A;  13GS A;  2OJL A;  4DEJ A;  2R37 A;  4DVC A;  1BG5 A;  3KD0 A;  4V1A g;  1FOH A;  3LQ7 A;  4YAP A;  4ECJ A;  3TKS A;  4GXZ A;  1UC7 A;  5CP1 A;  1MD3 A;  2C0F A;  2DJ3 A;  3EMP A;  1J0F A;  4HOJ A;  4HU9 A;  3A5W A;  5AIX A;  1ABA A;  2WDU A;  2H72 A;  4ZIJ A;  3APS A;  5GST A;  3G9B A;  2DJ2 A;  1AW9 A;  1JLW A;  3MNG A;  2YJ7 A;  3IPZ A;  4CHS A;  4E8E A;  1LBK A;  1GSY A;  3GUS A;  2K8S A;  2CZ3 A;  2CVK A;  4HQZ A;  3IC8 A;  3WT1 A;  2YAN A;  4L8E A;  4KDU A;  4HJ2 A;  4NV5 A;  1YKC A;  3H93 A;  4QL9 A;  2YN1 A;  4ZL7 A;  2KHP A;  2Z9S A;  4IQA A;  1MD4 A;  2M72 A;  1HD2 A;  2D2Z A;  1OAZ A;  2VCQ A;  1A8L A;  3L9S A;  2VCZ A;  5DBQ A;  1PN9 A;  1IYI A;  2QA2 A;  5CRD A;  3FW2 A;  2H0I A;  3AY8 A;  4YQM A;  2K8V A;  4KA0 A;  3EMX A;  3RDW A;  1YY7 A;  3KP9 A;  2GSQ A;  4BVX B;  1EGR A;  1AQW A;  4Q5N A;  4NHZ A;  2P0G A;  1A2L A;  3A2V A;  4MP4 A;  1BX9 A;  1XOA A;  2JZS A;  2NDO A;  2YV9 A;  3L4N A;  1EOH A;  3LYK A;  3C71 A;  3K8N A;  5AIV A;  4YQU A;  1TU8 A;  4IW9 A;  3ISO A;  4ZB9 A;  1O85 A;  1O7U A;  2WB9 A;  2IMD A;  5A5K A;  10GS A;  2QGV A;  4HDE A;  5H5Q A;  1TU7 A;  2GTU A;  3ERF A;  3UMA A;  2I81 A;  5COH A;  1B48 A;  2IMF A;  2FHE A;  4EC0 A;  2B5Y A;  5B8B A;  2YOI A;  3QCP A;  3H79 A;  3VFI A;  1NHO A;  2H73 A;  2X8C A;  2OBI A;  1OC8 A;  3F4R A;  2IL3 A;  5IMZ A;  3UJ1 A;  5DAK A;  4TXO A;  3F3Q A;  4IP6 A;  2JZR A;  3TGZ A;  1Q4J A;  3WGE A;  2FWG A;  5J5N A;  2OE0 A;  2DJ0 A;  1X9M B;  2J23 A;  2C3N A;  4GQF A;  1RQM A;  3RPN A;  2E2G A;  5ECK B;  1GSF A;  5J9C A;  3ERG A;  1BYE A;  2I9H A;  1T7P B;  4G0I A;  4Q5R A;  4G0K A;  3EU4 A;  4O7H A;  4HQS A;  1TK5 B;  1HNA A;  4PQI A;  3LFL A;  1XOB A;  3GKN A;  1OC9 B;  5IMF A;  2L57 A;  2HRF A;  2VCV A;  1X5D A;  3BBY A;  4KE3 A;  4JR6 A;  4X43 A;  3P8W A;  4F0C A;  1T1V A;  3HD5 A;  2LQQ A;  4N11 A;  1XWK A;  1E2Y A;  3DEX A;  4G0L A;  1QK8 A;  4IHU A;  1B4P A;  5F8B A;  3WYW A;  4QL7 A;  5EPF A;  1SJZ A;  2R4V A;  4AJ8 A;  1H75 A;  1SJI A;  3QFA C;  2GGT A;  2VM1 A;  4TR1 A;  2CVD A;  4BL7 A;  3UOM A;  2C3Q A;  4MH3 A;  3HDC A;  2JAC A;  2PWJ A;  2LTK A;  1FHE A;  3IK9 A;  5ECR B;  1X5E A;  4JZQ A;  2DLX A;  2H6X A;  4PUF C;  4IKH A;  6GST A;  1AAZ A;  2VL2 C;  3ZLP A;  2CX3 A;  2R0C A;  5HR3 A;  2RM5 A;  3MIX A;  2GDR A;  3HVX A;  1XFL A;  5FT3 A;  1JFU A;  1T00 A;  3F3R A;  4TKY A;  4ZXG A;  3HY2 A;  4MJC A;  2QC7 A;  4O92 A;  1FB0 A;  3IK7 A;  3GRX A;  5ECI B;  3VPQ A;  3UVT A;  4WXT A;  1S3D A;  2VCT A;  2NTO A;  2FLS A;  3LW9 A;  5B8A A;  1GLP A;  3VI7 A;  1AIU A;  3BCI A;  2DKH A;  1V9W A;  2GS3 A;  5D9W A;  1SKW B;  4GRF A;  4V2N A;  2V6K A;  1V58 A;  5ELG A;  2R3X A;  4ISD A;  1YKA A;  3LWA A;  3MDK A;  3ZRD A;  4QQ7 A;  1F2E A;  2LV3 A;  5IPH A;  3DVW A;  4JBB A;  3ZTL A;  3D21 A;  3D0Z A;  2A4H A;  5A4V A;  5ECH B;  1VRS D;  5CNW A;  4LL1 B;  5F06 A;  3ZMK A;  4JE1 A;  2CAQ A;  3QOU A;  2C4J A;  4EF0 A;  3O3T A;  1G7E A;  2OE3 A;  3IDV A;  5B6M A;  2PUK C;  3IHG A;  2P5R A;  4TN8 A;  1GUL A;  1GWC A;  2MMZ A;  3QR6 A;  1GUK A;  1Q98 A;  1YEP A;  5DVB A;  2A2P A;  4ECI A;  3H4K A;  2H8L A;  3FEU A;  3PPU A;  1VF4 A;  3ME8 A;  3FMW A;  5D73 A;  4GSS A;  3M1G A;  5JCW A;  4WR5 A;  1SKR B;  3DKS A;  1E6B A;  5DAL A;  1TI3 A;  2X8G A;  4YKG A;  1G7O A;  4IBP A;  4XS4 B;  2HSH A;  4WET A;  3J7Y b;  2DBC A;  5E59 A;  5ID2 B;  5IQY A;  4ICY A;  3P2A A;  1TKD B;  4KND A;  2VD1 A;  4BWS A;  1K3L A;  1EEM A;  3SBC A;  1XPV A;  4MDC A;  3GL3 A;  3P7X A;  3W6G A;  4PXO A;  1M2A A;  4CDO A;  1TXX A;  3TCO A;  5G5E A;  1EZK A;  4RQX A;  1X5C A;  4K5R A;  4BVY A;  2R6K A;  1TJD A;  4GF0 A;  1RK4 A;  1N2A A;  1U3A A;  4BA7 A;  1SEN A;  4POK A;  1UVZ A;  1M7T A;  4ZB6 A;  4D73 B;  4FYB A;  4CY8 A;  1K0C A;  1PD2 1;  3FYG A;  4IVF A;  5G30 A;  2LUS A;  3Q18 A;  3O76 A;  1PX6 A;  3QAG A;  3BJ5 A;  3LXT A;  2GZP A;  5IIZ A;  3TKQ A;  1M99 A;  3M9K A;  1TRV A;  2XPD A;  1SYR A;  3GKX A;  2V32 A;  2GSR A;  4WF4 A;  3GH9 A;  5CAX A;  3PH9 A;  5D9X A;  1HNC A;  1U87 A;  3EIN A;  3FY7 A;  1J08 A;  1B4Q A;  1N8J A;  3TB2 A;  1U88 A;  4YKF A;  2VCX A;  1EP8 A;  20GS A;  3GMF A;  1GLQ A;  1K3Y A;  2H66 A;  2YZH A;  3VWX A;  3TRQ A;  4OCF A;  1OKD A;  3QAW A;  3KTB A;  2CVB A;  2QSI A;  5FWG A;  1AQV A;  1B9Y C;  4OMV A;  4HU7 A;  3SWL A;  4IS0 A;  3UBK A;  1KEB A;  2HFD A;  3I9V 2;  3KJY A;  1GTI A;  3N9J A;  4MPF A;  1TRW A;  5ECP B;  2IFQ A;  4BPY A;  3D6I A;  2YZU A;  1NW2 A;  1XVW A;  3CRT A;  2PVQ A;  2GT5 A;  2VAF A;  3GL5 A;  3EE2 A;  4ML1 A;  5J3R A;  3LYP A;  1X9S B;  3TJF A;  2R2J A;  1X9W B;  4X4J A;  1GSU A;  1OE8 A;  2QKE A;  4MNN A;  3BD2 A;  2ZCT A;  2O85 A;  5IMC A;  1HNB A;  4XS1 A;  3A3T A;  1VGL A;  1S3C A;  1C72 A;  2ZUP A;  1SKS B;  1XW6 A;  5DDL A;  1VF3 A;  2VCW A;  3FR3 A;  2JL4 A;  5ELA A;  2GSS A;  3QMX A;  4I2U A;  3EVI A;  4OCE A;  5ECL B;  3GSS A;  4KH7 A;  1OE7 A;  3HXS A;  2A2S A;  2IMK A;  3ZML A;  3UVH A;  1GTA A;  1QGV A;  2ES7 A;  1ERU A;  2EIR A;  1LJR A;  1M2B A;  4K0N A;  4ZBD A;  3KP8 A;  3TKS E;  1PL2 A;  5ECO B;  4WKW A;  4O5U A;  2WUL A;  2REM A;  4AJ6 A;  3TRP A;  1WWJ A;  1K0A A;  4L5L A;  4MJA A;  2B6M A;  2MBS A;  4JRR A;  1PQN A;  2AV4 A;  3TDG A;  1I9D A;  5IMD A;  3UAP A;  3KZQ A;  5DAK B;  4TXO B;  4XHM A;  3CYN A;  1G6Y A;  4HUA A;  1JZD A;  2PGT A;  3MYD A;  3KMN A;  1XXU A;  2VLU A;  4EIP A;  5LD0 A;  1SJ6 A;  3W8S A;  1Z6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...