2H19A

Crystal structure of resa cys77ala variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Molecular Basis for Specificity of the Extracytoplasmic Thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h19A00
2H1DA 3ZTLA 3FKFA 4FYCA 1G0TA 1PN9A 5IMCA 4IP1A 1V9WA 1PA3A 3MAKA 4IQ1A 2O85A 5EY6A 2K8VA 3IV4A 2IL3A 2DMLA 3TJJA 2IMFA 3WD6A 4RI6A 1T4ZA 4JRRA 2OBKA 4KSMA 3HZ8A 2K6VA 1TK0B 4CDOA 1MTCA 1YF1A 2H6YA 3GTUB 2IFQA 4K8MA 1OYJA 2O89A 3W6GA 3UARA 1ZCPA 5EVOA 3DIEA 3IOSA 2H70A 3E9JB 1PGTA 2DIZA 1TJDA 4E8EA 5A4WA 3TJFA 2V41A 1XBSA 3KXOA 1J0FA 4GSSA 2PVOC 2CVKA 1XOBA 3AY8A 1KTEA 3UBKA 4ECIA 1S3CA 3PGTA 1K0AA 4MJBA 2HRNA 2H6XA 3TGZA 2XHFA 2EC4A 4ZL9A 3O76A 5IMVA 4MF7A 4MABA 2H75A 3KMOA 4K6XA 4ML1A 3H8QA 5CYYA 1BJXA 1FOVA 4OFTA 4MDCA 1FG4A 2F8AA 1M2BA 2H76A 4Q5RA 3GNJA 1O73A 2NDOA 5FWGA 4WR5A 2VL2A 5D73A 1XZOA 2B3SA 2OA7A 3US3A 5DJMA 1JLVA 3O6TA 1XW9A 1X0RA 1Z7RA 1EWXA 2H6ZA 4ACSA 5HFIA 4EL1A 1XOAA 1X9WB 1O6JA 2EIQA 1EGOA 2FD3A 1SENA 1UN2A 1KNGA 5JCGA 4XRAA 1XCCA 2CZ3A 3EINA 1ZYQB 3BCKA 1Z6NA 2L6DA 4L5LA 3DRNA 5KEJA 4TXVA 2HI7A 3I6AA 5IPGA 3LQ7A 1K0OA 3FEUA 2AYTA 4FO5A 5D9VA 4J2FA 3QAVA 1YEXA 1ILOA 4POMA 1SL1B 4I2UA 5FT3A 4DSSB 4BWSA 2H1BA 3FW2A 2I4AA 2VCZA 1GSQA 2BMXA 5E4WA 3GSSA 3TUEA 4ISDA 3EWLA 2VD0A 1W4VA 4EUYA 5B6NA 1WWJA 3NOFA 3F8UA 4XHMA 1B9YC 2MBTA 2XC2A 3H79A 1E2YA 2VLTA 2NBSA 2WS2A 1HNAA 2YZUA 5JCUA 3GTUA 3F9UA 3G7YA 3LYKA 3LG6A 17GSA 3IR4A 2P5RA 3TRXA 2VUPA 2YWIA 5IMZA 5F0GA 1NHOA 18GSA 3E0UA 2K9FA 2RLIA 1EV4A 3KP8A 2AV4A 3NIVA 1GSSA 1F2EA 1RQMA 2OE0A 4KSOA 2HSYA 2H0GA 2GQLA 4ECBA 3ZL5A 5DJLA 4GF0A 2YP6A 2H66A 1OC9A 1CQHA 2H71A 3FZ4A 1ZMAA 1GSFA 4NAXA 4KX4A 1BX9A 4HS1A 4F0CA 1F6MC 5CAXA 3VWVA 3UAPA 4PUAA 2LRTA 3LYPA 1K0NA 2GSRA 4KDUA 2QKEA 4KH7A 3KD0A 2HXKA 2L59A 4K0NA 1A23A 2DJ2A 2CA8A 3P8WA 1O8XA 3ZYWA 1F9MA 2LS5A 3BCIA 2X8CA 4MP4A 1TI3A 3LXZA 1XFLA 5E59A 2QC7A 4F03A 1EV9A 4OCFA 3CTGA 3D4MA 3KMNA 3QFBC 1ACVA 3EE2A 5IOWA 4JR6A 1TOFA 5HFGA 4MJAA 4PNFA 1F3BA 2L57A 5DQSA 3UBLA 1DUGA 1FHEA 3LSZA 1TRUA 1MDIA 3E3EA 3OR5A 4LMVA 2PWJA 2CZ2A 2MMAA 3KTBA 2OJLA 3MNGA 5DAKA 5HR0A 5ECHB 1R26A 2KUCA 3HKRA 2N5AA 3QAWA 2GDRA 4QQ7A 4DSSA 16GSA 1SKRB 2MMZA 1TU8A 2GT6A 3GYKA 5A4UA 2IPAA 3GV1A 1N2AA 2CX4A 3U5RE 4YAPA 2GLRA 4KA0A 5DALB 2C1YA 3M8NA 3QCPA 2HSHA 2WB9A 1XVQA 3W8SA 2GQMA 1A8LA 1SK2A 9GSSA 1SK0A 4KAEA 1TK5B 4F82A 4V2MA 3CMIA 5JCWA 2NVLA 3HVXA 3L0HA 4N11A 4MA9A 1OC8A 3DVWA 2C8UA 5B7CA 4YQVA 1WRYA 4X43A 4NV2A 4QL9A 1SJZA 1N8JA 2B5XA 4WBRD 3UIWA 1BAYA 5G1LA 3VFIA 1G6YA 5D9WA 3FRCA 4POBA 3WGEA 3GMFA 2OADA 2FA8A 3TKSA 4QL7A 1R5PA 2KP2A 3D22A 1DSBA 1PL2A 1WE0A 2H1GA 1JFUA 2HE3A 4K9ZA 1GUHA 2LUSA 4X1UA 4DVCA 3NZNA 3KTLA 1PL1A 2HNLA 4L5OA 5HQPA 1OKDA 14GSA 3ZFBA 3KM6A 4NHZA 2XBIA 5B6MA 5J9BA 4WKWA 1PRXA 5A5KA 2FWFA 4AJ7A 1GSYA 1OVNA 3DMLA 3FK8A 2E7PA 4IP6A 4NXIA 5L71A 4GQFA 2WRTA 2WFCA 3IE3A 2RIIA 1BQ7A 6GSSA 3TJKA 2LJRA 3LEFA 3DGQA 3M1GA 4ID0A 2HZFA 3DXBA 4N0ZA 3IAM2 3CRUA 1XWKA 3KZQA 1EZKA 2VM1A 3P7XA 2GT5A 2DIYA 2OKAA 4MF5A 1TRVA 5LNKe 2E2MA 2VCVA 1X9SB 2X64A 3CSHA 4F2IA 4GSTA 2JZTA 3EVIA 3GN3A 1A2JA 4ZIJA 2F8FA 1EP7A 2DJ3A 4I97A 2GVPA 4LMWA 4O92A 2IMDA 3RHBA 2CAIA 3M9KA 4ZBDA 1UA5A 1T3BA 2RM5A 3CBUA 2ES7A 3TRPA 2VLVA 4LA1A 4L0UA 3CXGA 1QXHA 3G9BA 4ZBBA 2DBCA 2B1KA 3GSTA 4MK3A 2C80A 1Z3EA 4CHSA 1ZOFA 3A3TA 2C3TA 4KB3A 1HD2A 4HEA2 1SD8A 1WIKA 4GQCA 2LQOA 1A24A 4RQXA 2VOCA 3H93A 3HYPA 4GWRA 2VAFA 1S3DA 3QR6A 3HVVA 1Z7PA 3ERWA 2GTUA 2ZCTA 2B7JA 4HQZA 3LWAA 12GSA 1M2AA 2RM6A 4WETA 1A8YA 3Q6OA 5INYA 6GSXA 2HRFA 3LXTA 2IIYA 4GCIA 4GRFA 5EPFA 5IQYA 1U6TA 1C72A 3VWXA 3QDNA 1YDKA 4BWQA 3UEMA 4EDYA 3IK7A 4IS0A 4KUNA 2P31A 4HJMA 4ZILA 1MD4A 4ECJA 4TKYA 1IYIA 1NHYA 5J9CA 3SWLA 4TR1B 1TRSA 5H5SA 1H75A 4E8HA 3DYRA 3K8NA 5IMDA 1XIYA 3RBTA 3VPTA 3FR3A 8GSSA 1T7PB 4AJ8A 3QOUA 2KLXA 1XW5A 1YEPA 1A2LA 4OFMA 1TP9A 1MEKA 1SL2B 4RQRA 1Z5YE 2Z9SA 3EMPA 3IPZA 1AUCA 1TDIA 4Q5QA 4OCEA 7GSSA 5A4VA 1M2DA 1ZYEA 1V57A 1TI1A 2HYXA 2CAQA 1M9AA 22GSA 5ECNB 3RHCA 1JZWA 1R5AA 5B8AA 4LL4B 4EVMA 2R6KA 1ML6A 1YQ1A 4TRXA 2O87A 3L9SA 4ZXGA 3L9UA 3TOUA 4BVXA 1TW9A 4V2LA 5IO0A 4ZB8A 3ZITA 1GP1A 1PX7A 4Q5FA 1ERWA 3J7Yk 5G1KA 4KW6A 1THXA 1BG5A 1XPVA 1PKZA 2BJXA 2BTOT 3L4NA 3L9VA 5KN3A 1U88A 4IKHA 5ID2B 1PD21 1K3YA 4JZQA 1U3AA 4AJ6A 4MH3A 2HLSA 2YWOA 5D8IA 3GL5A 1GSDA 3BD2A 5IOXA 1OC3A 3C8EA 3DD3A 2C3NA 4N0VA 2VCXA 5LD0A 4CW9A 4MZBA 3LJRA 4MH2A 1Q98A 2H8LA 3HA9A 1F37A 3QAGA 1YY7A 4NV5A 1ERVA 2LQQA 2L5OA 3F3RA 3H1NA 3MSZA 3TJBA 2WZ9A 1QUWA 1YJ6A 4BL7A 4YH2A 5GAPD 5GSSA 2C0DA 2PGTA 4BVYA 2MZCA 3TCOA 3HJMA 1GULA 1GNWA 2FGXA 2GGTA 4EC0A 2L4CA 3FY7A 1TXXA 5ENUA 1YKAA 3FZAA 2OBIA 2O8VB 3ZLPA 2JADA 2OE1A 4TR4A 3C1SA 3TKQA 5IMAA 3ZVJD 2E0QA 4ZB6A 2C0EA 3M3MA 1K0BA 4TR1A 1OE7A 2YN1A 1IYHA 3SBCA 2PPTA 1B4QA 2DC5A 2DJKA 2XPDA 4Q5NA 1SJ6A 4ULXA 2H0HA 4ECCA 4NPBA 3DKSA 2JZRA 4MLYA 1PKWA 3IXRA 4ZL7A 2H0IA 3TKSE 1XWCA 2LKUA 2V1MA 2LSTA 2VIMA 3GKNA 3ZREA 2XBQA 1GTBA 4GSNA 5ECOB 1AQXA 2WJUA 2GZYA 4DSRA 5AGYA 1TTZA 1Q4JA 3VI7A 4J57E 4HUAA 3DWVA 2HFDA 4MF6A 4Z7XA 2CQ9A 3QD9A 4PQHA 4BA7A 1EOHA 1YKCA 1FVKA 2ON7A 4XTSA 1LBKA 4MMMA 1WP0A 4IQAA 4EO3A 3ZMKA 2OE3A 3KH7A 5IIZA 1SK1A 2TIRA 6GSVA 3KGKA 5ELAA 4OO4A 3HDCA 4TN8A 1GNEA 1PMTA 5DDLA 2FWEA 3HD5A 3GH9A 10GSA 1SKSB 1RW1A 2AAWA 2VM2A 2ZNMA 4YQMA 3U6VA 4KE3A 5D93A 2TRCP 3ZZXA 4AF2A 1ON4A 4IBPA 1OE8A 2YWMA 1K3OA 4EDZA 4RI7A 3IHQA 3ME8A 3UJ1A 4GXZA 1AQVA 4V1Ap 2NPBA 4HZ4A 1PSQA 3QFAC 2FNOA 1K0DA 4MCUA 2A4VA 3ZIJA 1BYEA 3C73A 3PH9A 3G7IA 2DJ0A 4V1Ag 1VRSD 3CYNA 3KIJA 3IK9A 2MMOA 3RAZA 4D73B 1J08A 3TRQA 4HJ2A 2JSYA 4MPGA 4DEJA 5KN1A 4IN0A 2LJAA 1B48A 1ZGNA 5J3RA 1AC1A 2YWNA 2F9SA 4TXOB 2DSAA 1URMA 2FWHA 3GUSA 2AUVA 4KNDA 4L0WA 1BEDA 1XVWA 1G7OA 4O5RA 3RPNA 4WF5A 2FA4A 4WR4A 5GAND 4I5QA 1SJIA 5CRDA 2R4VA 1GTUA 2DJJA 3HY2A 2V2GA 4XS4B 4ILFA 5DBQA 2PU9C 1QMVA 4MPFA 2RUFA 4IVFA 5IM9A 4YAVA 1YF0A 1XWAA 5ABRA 3F4SA 1AAZA 1GLQA 5J4UA 2R3XA 4PQ1A 2LJKA 4HDEA 1FVJA 2NTOA 2J9HA 1SYRA 4HZ2A 2PN8A 2YJHA 1WJKA 3F4TA 5EL8A 5F07A 3L78A 5AIVA 5DQYA 1TKDB 2KOKA 2CVBA 1WOUA 3Q19A 3GH6A 3D21A 1I5GA 5G5EA 3CSJA 2FCHA 4KDYA 3ERFA 2PMTA 1UVZA 4OWYA 2R37A 13GSA 1TK8B 1JZRA 3O3TA 3ED3A 2FWGA 3QPMA 4WBJA 2VL2C 5G30A 2QSIA 1M9BA 5HR3A 1V58A 1JLWA 4FYUA 2B5EA 1B9XC 1GWCA 1ST9A 3C1RA 2X8GA 1RK4A 5DVBA 1E6BA 3HJOA 5ECLB 3UVHA 4ML6A 2V32A 3VI5A 5J41A 2QGVA 2I3YA 3FR9A 3EU4A 3M9JA 2X8HA 1AQWA 1O81A 4IW9A 1ABAA 3KEBA 4O32A 5F8BA 3LORA 3A5WA 3UL3A 3S9FA 1EEMA 5G31A 3GFKA 3C71A 3TDGA 2R5GA 2A2SA 4L8EA 3EYTA 4D73A 3H4KA 3UMAA 5IO2A 1Z9HA 1GUMA 2YCDA 2B5YA 2H74A 2REMA 3IAS2 5DALA 1O7UA 4X0XA 3UOMA 3IDVA 4XCSA 1M0UA 1KEBA 3V1WA 4OFNA 1VF1A 4K7NA 4OMVA 2PERA 4K2DA 1FO5A 3IBHA 1W89A 2CVDA 2M72A 2CX3A 4O7HA 4HOJA 2VCQA 3RDWA 3Q74A 1THOA 2OACA 2JACA 5LCZA 2ZUPA 5ECQB 2FUG2 4XS4A 5F05A 2IMKA 11GSA 3F6FA 4P3YB 2F51A 2L6CA 3GX8A 1UC7A 1KBNA 1T1VA 6GSYA 3GL3A 4TR3A 2IMIA 3TB2A 1VGLA 4FIWA 5H5RA 3GX0A 2N5FA 3F6DA 2AHEA 1HQOA 4I2TA 3DEXA 3EURA 1DBYA 1ZZYA 5AISA 1JZOA 3C7MA 2B7KA 1WMJA 4KDXA 1AW9A 2O7KA 4F9ZA 4PURA 5IPHA 2GZPA 3CSIA 2V6OA 1K3LA 3PR8A 3F3QA 4JU5A 1GUKA 5D96A 2C4JA 1GSUA 1GL8A 4N10A 5J5NA 5HR2A 2JU5A 5CNWA 2GZZA 1A0RP 1QK8A 1HNBA 1NM3A 2KP1A 4RUVA 4AGSA 4OO5A 2H30A 2D2ZA 2MYGA 5HR1A 2YANA 1EGRA 3LGCA 2L5LA 3GRXA 4TR0A 3PINA 2K18A 2WGRA 3VURA 3APOA 2K8SA 3WYWA 4HU9A 1DE1A 3A2XA 2GQKA 5G5FA 1X9MB 2H01A 1XXUA 5HFKA 2HT9A 1OC9B 2WDUA 3BJ5A 4WEYA 5GSTA 4PXOA 2I9HA 1VF3A 1R4WA 5ECPB 4PNGA 3GIXA 2G2QA 1LJRA 2LEGA 2J23A 20GSA 4MZWA 2LNTA 1ZL9A 3I9V2 3KP9A 2V6KA 3EMXA 4EF0A 1GTIA 3F63A 2F3MA 3ME7A 1YZXA 2R2JA 3HVSA 1XWBA 4FYBA 2XPEA 3ZFLA 4I6XA 3KCMA 3HXSA 2LRNA 4GTUA 5JWRB 3JCML 5KN0A 6GSWA 1T00A 2B6MA 1K0CA 4PQIA 5CO3A 1DE2A 3TKPA 2FY6A 4XIHA 1MD3A 3APSA 4KCAA 2ON5A 3TKSC 4MZCA 4WF4A 3TJGA 2DJ1A 3VPQA 5DAKB 1I9DA 3G7JA 2E2GA 2L4QA 2AJQB 5C00A 1A2MA 1HYUA 4WXTA 4IJ3A 2M46A 1X5DA 2DLXA 3VLNA 4IHUA 4POKA 3D6IA 4GLTA 2H72A 1QQ2A 19GSA 4ZBAA 4G9HA 3ERGA 5JWOB 3IC4A 2LV3A 5IMFA 4G19A 2YOIA 3CRTA 4EE0A 2AB6A 4FH8A 3ZMLA 3ZRDA 1WPIA 2YV9A 2GSQA 3HCZA 2TRXA 1QFNA 1GH2A 2VD1A 3UVTA 2YZHA 4TVEA 1FB6A 1U3IA 5D9XA 2CV4A 1GSEA 5COHA 1GTAA 4G2EA 4XS1A 2P5QA 4POLA 4LL1B 4PGTA 2P0GA 2H19A 2VO4A 2IWTA 3D0ZA 4PUFC 1JZDA 2PBJA 2MBSA 1Y25A 4H86A 4KCEA 4NHWA 4K7IA 1FB0A 2FLSA 4F0BA 5ID2A 4N30A 5ECIB 2C0GA 4IJIA 2A2RA 2GSSA 2IN3A 1M99A 4EKZA 5G2ZA 5CRGA 1PQNA 2WCIA 2G0FA 2GS3A 5C04A 1Z6MA 4V2NA 4K1FA 4MJEA 3GA4A 5F06A 3I69A 3GHAA 4ZL8A 1SYXA 3APQA 4BPYA 1V40A 2HZEB 3P90A 2EIRA 2H73A 4MJCA 1B8XA 3GURA 3HJPA 3VK9A 3FZ5A 1MDJA 2YJ7A 1S3AA 1O8WA 1Y6EA 5ECSA 3F0IA 4OD7A 2GSTA 1TU7A 5CREA 3ZIVA 4HQSA 4JEDA 2EIOA 1OAZA 2I81A 2YPMA 2IJYA 1USBA 5CRHA 3HHVA 1PX6A 2JL4A 2WULA 4G10A 3CTFA 1A0FA 1EOGA 1V2AA 2B1LA 4JE1A 1LU4A 1QGVA 4ZB9A 5GZZB 3W8JA 3IA1A 1X5CA 3MWHA 1TRWA 3N9JA 3FR6A 3IRAA 4DSQA 3VWWA 2FHEA 1HNCA 3RPPA 1K0MA 3DVXA 1AXDA 1VF4A 1NSWA 5DCGA 2JSZA 1M7TA 2LTKA 1GRXA 5B8BA 2X99A 1SD9A 2H1AA 3D5JA 2C0FA 4K0GA 4YQUA 3QMXA 1EEJA 4K7OA 4EXJA 2ALBA 6GSUA 1GLPA 3MDKA 3HZ4A 4NWYA 2LRCA 1FW1A 2YV7A 1G7EA 3WGXA 1T4YA 1U87A 3WGDA 4XS6A 2MMNA 5JWQB 4TW5A 3EC3A 3WT2A 3TKRA 5FHIA 3WT1A 4I8BA 1V98A 2IFQB 2VL3A 2PVQA 2VL9A 1R7HA 1SU9A 1OKTA 2PUKC 5ECMB 4NMUA 3LFLA 3TOTA 1X5EA 5KN2A 2DMMA 4TOPA 1EP8A 1NW2A 1ERUA 4JBBA 1H4OA 3FHKA 3GKKA 1SL0B 1CQGA 3GKMA 6GSTA 1G6WA 5DCHA 1F3AA 5ECRB 5D9TA 4IELA 2HZEA 3D4TA 4JR4A 2VCTA 3I43A 4PX1A 5CP1A 4LLRA 3VWUA 1FAAA 3GKXA 1JHBA 5AN1A 3N5OA 3F4RA 1SKWB 2KHPA 3P2AA 1ERTA 3EU3A 3BBYA 4TXOA 5CRWA 5AIXA 1J9BA 2CT6A 4KGIA 1XWGA 3BOAA 4IGJA 1MDKA 2VLUA 4HI7A 3J7Yb 2M80A 2I1UA 2JZSA 1T8EB 1VF2A 2VCWA 3R2QA 1AIUA 3M0FA 4J56E 3ISOA 2N5BA 4XRDA 2RUEA 1B4PA 4HU7A 3A2WA 5ELGA 5ECKB 3FYGA 2C3QA 2YNXA 2LNSA 3ZVJA 1XW6A 5H5QA 3KJYA 3KH9A 3A2VA 2IMEA 3FZ9A 3Q18A 1O85A
chains in the Genus database with same CATH superfamily
2H1DA 3ZTLA 3FKFA 4FYCA 1G0TA 1PN9A 5IMCA 4IP1A 1V9WA 1PA3A 3MAKA 4IQ1A 2O85A 5EY6A 2K8VA 3IV4A 2IL3A 2DMLA 3TJJA 2IMFA 3WD6A 4RI6A 1T4ZA 4JRRA 2OBKA 4KSMA 3HZ8A 2K6VA 1TK0B 4CDOA 1MTCA 1YF1A 2H6YA 3GTUB 2IFQA 4K8MA 1OYJA 2O89A 3W6GA 3UARA 1ZCPA 5EVOA 3DIEA 3IOSA 2H70A 3E9JB 1PGTA 2DIZA 1TJDA 4E8EA 5A4WA 3TJFA 4FQUA 2V41A 1XBSA 3KXOA 1J0FA 4GSSA 2PVOC 2CVKA 1XOBA 3AY8A 1KTEA 4G0KA 3UBKA 4ECIA 1S3CA 3PGTA 1K0AA 4MJBA 2QA2A 2HRNA 2H6XA 3TGZA 2XHFA 2EC4A 4ZL9A 3O76A 4K2XA 5IMVA 4MF7A 4MABA 2H75A 3KMOA 4K6XA 4ML1A 3H8QA 5CYYA 1BJXA 1FOVA 4OFTA 4MDCA 1FG4A 2DKHA 2F8AA 1M2BA 2H76A 2HRAA 4Q5RA 3GNJA 1O73A 2NDOA 5FWGA 4WR5A 2VL2A 5D73A 1XZOA 2B3SA 2OA7A 3US3A 5DJMA 1JLVA 3O6TA 1XW9A 1X0RA 1Z7RA 1EWXA 2H6ZA 4ACSA 5HFIA 4EL1A 2A4HA 1XOAA 1X9WB 1O6JA 2EIQA 1EGOA 2FD3A 1SENA 1UN2A 1KNGA 4Z2TA 1ZYNA 5JCGA 4XRAA 1XCCA 2CZ3A 3EINA 1ZYQB 3BCKA 1Z6NA 2L6DA 4L5LA 3R3EA 3DRNA 5KEJA 4TXVA 2HI7A 3I6AA 5IPGA 3LQ7A 1K0OA 3FEUA 2AYTA 4FO5A 5D9VA 4J2FA 3QAVA 1YEXA 1ILOA 4POMA 1SL1B 4I2UA 5FT3A 4DSSB 4Z2UA 4BWSA 2H1BA 3FW2A 2I4AA 2VCZA 1GSQA 2BMXA 5E4WA 3GSSA 1XG8A 3TUEA 4ISDA 3EWLA 2VD0A 1W4VA 4EUYA 5B6NA 1WWJA 3NOFA 3F8UA 4XHMA 1B9YC 2MBTA 2XC2A 3H79A 1E2YA 2VLTA 2NBSA 2WS2A 1HNAA 2YZUA 5JCUA 3GTUA 3F9UA 3G7YA 3LYKA 3LG6A 17GSA 3IR4A 2P5RA 3TRXA 2VUPA 2YWIA 5IMZA 5F0GA 1NHOA 18GSA 3E0UA 2K9FA 2RLIA 1EV4A 3KP8A 2AV4A 3NIVA 1GSSA 1F2EA 1RQMA 2OE0A 4KSOA 2HSYA 2H0GA 2GQLA 4ECBA 3ZL5A 5DJLA 4GF0A 2YP6A 2H66A 1OC9A 1CQHA 2H71A 3FZ4A 1ZMAA 1GSFA 4NAXA 1PFOA 4KX4A 1BX9A 4HS1A 4F0CA 1F6MC 5CAXA 3VWVA 3UAPA 4PUAA 2LRTA 3LYPA 1K0NA 5BRTA 2GSRA 4KDUA 2QKEA 4KH7A 3KD0A 2HXKA 2L59A 4K0NA 1A23A 2DJ2A 2CA8A 3P8WA 1O8XA 3ZYWA 1F9MA 2LS5A 3BCIA 2X8CA 4MP4A 1TI3A 3LXZA 1XFLA 5E59A 2QC7A 4F03A 1EV9A 4OCFA 3CTGA 3D4MA 3KMNA 3QFBC 1ACVA 3EE2A 5IOWA 4JR6A 1TOFA 5HFGA 4MJAA 4PNFA 1F3BA 2L57A 5DQSA 3UBLA 1DUGA 1FHEA 3LSZA 1TRUA 1MDIA 3E3EA 3OR5A 4LMVA 2PWJA 2CZ2A 2MMAA 3KTBA 2OJLA 3MNGA 5DAKA 5HR0A 5ECHB 1R26A 2KUCA 3HKRA 2N5AA 3QAWA 2GDRA 4QQ7A 4DSSA 16GSA 1SKRB 2MMZA 4EIPA 1TU8A 2GT6A 3GYKA 5A4UA 2IPAA 3GV1A 1N2AA 2CX4A 3U5RE 4YAPA 2GLRA 4KA0A 5DALB 4CY8A 2C1YA 3M8NA 3QCPA 2HSHA 2WB9A 1XVQA 3W8SA 2GQMA 1A8LA 1SK2A 9GSSA 1SK0A 4KAEA 1TK5B 4F82A 4V2MA 3CMIA 5JCWA 2NVLA 3HVXA 3L0HA 4N11A 4MA9A 1M3IA 1OC8A 3DVWA 2C8UA 5B7CA 4YQVA 1WRYA 4X43A 4NV2A 4QL9A 1SJZA 1N8JA 2B5XA 4WBRD 3UIWA 1BAYA 5G1LA 3VFIA 1G6YA 5D9WA 3FRCA 4POBA 3WGEA 3GMFA 2OADA 2FA8A 3TKSA 4QL7A 1R5PA 2KP2A 3D22A 1DSBA 1PL2A 1WE0A 2H1GA 1JFUA 2HE3A 4K9ZA 1GUHA 2LUSA 2X4AA 4X1UA 4DVCA 3NZNA 3EPTA 3KTLA 1PL1A 2HNLA 4L5OA 5HQPA 1OKDA 14GSA 3ZFBA 3KM6A 4NHZA 2XBIA 5B6MA 5J9BA 4WKWA 1PRXA 5A5KA 2FWFA 4AJ7A 1GSYA 1OVNA 3DMLA 3FK8A 2E7PA 4IP6A 4NXIA 5L71A 4GQFA 2WRTA 2WFCA 3IE3A 2RIIA 4Z2RA 1BQ7A 6GSSA 3TJKA 2LJRA 3LEFA 3DGQA 3M1GA 4ID0A 2HZFA 3DXBA 4N0ZA 3IAM2 3CRUA 1XWKA 3KZQA 1EZKA 2VM1A 3P7XA 2GT5A 2DIYA 2OKAA 4MF5A 1TRVA 5LNKe 2E2MA 2VCVA 4BVXB 1X9SB 2X64A 3CSHA 4F2IA 4GSTA 2JZTA 3EVIA 3GN3A 1A2JA 4ZIJA 2F8FA 1EP7A 2DJ3A 4I97A 2GVPA 4LMWA 4O92A 2IMDA 3RHBA 2CAIA 3M9KA 4ZBDA 1UA5A 1T3BA 2RM5A 3CBUA 2ES7A 3TRPA 2VLVA 4LA1A 4L0UA 3CXGA 1QXHA 3G9BA 4ZBBA 2DBCA 2B1KA 3GSTA 4MK3A 2C80A 1Z3EA 4CHSA 1ZOFA 3A3TA 2C3TA 4KB3A 1HD2A 4HEA2 1SD8A 1WIKA 4GQCA 2LQOA 1A24A 4RQXA 2VOCA 3H93A 3HYPA 4GWRA 2VAFA 1S3DA 3QR6A 3HVVA 1Z7PA 3ERWA 2GTUA 2QA1A 2ZCTA 2B7JA 4HQZA 3LWAA 12GSA 1M2AA 5BMUA 2RM6A 4BVYB 4WETA 1A8YA 3Q6OA 5INYA 6GSXA 2HRFA 3LXTA 2IIYA 4GCIA 4GRFA 5EPFA 5IQYA 1U6TA 1C72A 3VWXA 3QDNA 1YDKA 4BWQA 3UEMA 4EDYA 3IK7A 4IS0A 4KUNA 2P31A 4HJMA 4ZILA 1MD4A 4ECJA 4HSCX 4TKYA 1IYIA 1NHYA 5J9CA 3SWLA 4TR1B 1TRSA 5H5SA 1H75A 4E8HA 3DYRA 5KOWA 3K8NA 5IMDA 1XIYA 3RBTA 3VPTA 3FR3A 8GSSA 1T7PB 4AJ8A 3QOUA 2KLXA 1XW5A 1YEPA 1A2LA 4OFMA 1TP9A 1MEKA 1SL2B 4RQRA 1Z5YE 2Z9SA 3EMPA 3IPZA 1AUCA 1TDIA 4Q5QA 4OCEA 7GSSA 5A4VA 1M2DA 1ZYEA 1V57A 1TI1A 2HYXA 4BIKA 2CAQA 1M9AA 22GSA 5ECNB 3RHCA 1JZWA 1R5AA 5B8AA 4LL4B 2UZ8A 4EVMA 2R6KA 1ML6A 1YQ1A 4TRXA 2O87A 3L9SA 4ZXGA 3L9UA 3TOUA 4BVXA 1TW9A 4O5UA 4V2LA 5IO0A 4ZB8A 3ZITA 1GP1A 1PX7A 4Q5FA 1ERWA 3J7Yk 5G1KA 4KW6A 1THXA 1BG5A 1XPVA 1PKZA 2BJXA 2BTOT 3L4NA 3L9VA 5KN3A 1U88A 4IKHA 4MNNA 5ID2B 1PD21 1K3YA 4JZQA 3LW9A 3A5IA 1U3AA 4AJ6A 4MH3A 2HLSA 2YWOA 5D8IA 3GL5A 2X49A 1GSDA 3BD2A 5IOXA 1OC3A 3C8EA 3DD3A 2C3NA 4N0VA 2VCXA 3FMWA 5LD0A 4CW9A 4MZBA 3LJRA 4MH2A 1Q98A 2H8LA 3HA9A 1F37A 3QAGA 1YY7A 4NV5A 1ERVA 2LQQA 2L5OA 3F3RA 3H1NA 3MSZA 3TJBA 2WZ9A 1QUWA 1YJ6A 4BL7A 4YH2A 5GAPD 5GSSA 2C0DA 2PGTA 4BVYA 2MZCA 3TCOA 3HJMA 1GULA 1GNWA 2FGXA 2GGTA 4CY6A 4EC0A 2L4CA 3FY7A 1TXXA 5ENUA 1YKAA 3FZAA 2OBIA 2O8VB 3ZLPA 2JADA 2OE1A 4TR4A 3C1SA 3TKQA 5IMAA 3ZVJD 2E0QA 4ZB6A 2C0EA 3M3MA 1K0BA 4TR1A 1OE7A 2YN1A 1IYHA 3SBCA 2PPTA 1B4QA 2DC5A 2DJKA 2XPDA 4Q5NA 1SJ6A 4ULXA 2H0HA 4ECCA 4NPBA 3DKSA 2JZRA 5KOXA 4MLYA 1PKWA 3IXRA 4ZL7A 2H0IA 3TKSE 1XWCA 2LKUA 2V1MA 2LSTA 2VIMA 3GKNA 3ZREA 2XBQA 1GTBA 4GSNA 5ECOB 1AQXA 2WJUA 2GZYA 4DSRA 5AGYA 1TTZA 1Q4JA 3VI7A 4J57E 4HUAA 4G0IA 3DWVA 2HFDA 4MF6A 4Z7XA 2CQ9A 3QD9A 4PQHA 4BA7A 4USSA 1EOHA 1YKCA 1FVKA 2ON7A 4XTSA 1LBKA 4MMMA 1WP0A 4IQAA 4EO3A 3ZMKA 2OE3A 3KH7A 5IIZA 1SK1A 2TIRA 6GSVA 3KGKA 5ELAA 4OO4A 3HDCA 4TN8A 1GNEA 1PMTA 5DDLA 2FWEA 1ZYPA 3HD5A 3GH9A 10GSA 1SKSB 2R0PA 1RW1A 2AAWA 2VM2A 2ZNMA 4YQMA 3U6VA 4KE3A 5D93A 2TRCP 3ZZXA 4AF2A 4X4JA 1ON4A 4IBPA 1OE8A 2YWMA 1K3OA 4EDZA 4RI7A 3IHQA 3ME8A 3UJ1A 4GXZA 1AQVA 4V1Ap 2NPBA 4HZ4A 1PSQA 3QFAC 2FNOA 1K0DA 4MCUA 2A4VA 3ZIJA 1BYEA 3C73A 3PH9A 3G7IA 2DJ0A 4V1Ag 1VRSD 3CYNA 3KIJA 3IK9A 2MMOA 3RAZA 4D73B 1J08A 3TRQA 4HJ2A 2JSYA 4MPGA 4DEJA 5KN1A 4IN0A 2LJAA 1B48A 1ZGNA 5J3RA 1AC1A 2YWNA 2F9SA 4TXOB 2DSAA 1URMA 2FWHA 3GUSA 2AUVA 4KNDA 4L0WA 1BEDA 1XVWA 1G7OA 4O5RA 3RPNA 4WF5A 2FA4A 4WR4A 5GAND 4I5QA 1SJIA 5CRDA 2R4VA 1GTUA 2DJJA 3HY2A 2V2GA 4XS4B 4ILFA 5DBQA 2PU9C 1QMVA 4MPFA 2RUFA 4IVFA 5IM9A 4YAVA 1YF0A 1XWAA 5ABRA 3F4SA 1AAZA 1GLQA 5J4UA 2R3XA 4PQ1A 2LJKA 4HDEA 1FVJA 2NTOA 2J9HA 1SYRA 4HZ2A 2PN8A 2YJHA 1WJKA 3F4TA 5EL8A 5F07A 3L78A 5AIVA 5DQYA 1TKDB 2KOKA 2CVBA 1WOUA 3Q19A 3GH6A 3D21A 1I5GA 3IC8A 5G5EA 3CSJA 2FCHA 4KDYA 3ERFA 2PMTA 1UVZA 4OWYA 2R37A 13GSA 1TK8B 1JZRA 3O3TA 3ED3A 2FWGA 3QPMA 4WBJA 2VL2C 5G30A 2QSIA 1M9BA 5HR3A 1V58A 1JLWA 4FYUA 2B5EA 3MIXA 1B9XC 1GWCA 1ST9A 3C1RA 2X8GA 1RK4A 5DVBA 1E6BA 3HJOA 5ECLB 3UVHA 4ML6A 2V32A 3VI5A 5J41A 2QGVA 2I3YA 3FR9A 3EU4A 3M9JA 2X8HA 1AQWA 1O81A 4IW9A 1ABAA 3KEBA 4O32A 5F8BA 3LORA 3A5WA 3UL3A 3S9FA 1EEMA 5G31A 3GFKA 3C71A 3TDGA 2R5GA 2A2SA 4L8EA 3EYTA 4D73A 3H4KA 3UMAA 2A2PA 5IO2A 1Z9HA 1GUMA 2YCDA 2B5YA 2H74A 2REMA 3IAS2 5DALA 1O7UA 4X0XA 3HVNA 3UOMA 3IDVA 4XCSA 1M0UA 1KEBA 3V1WA 4OFNA 1VF1A 4K7NA 4OMVA 2PERA 4K2DA 1FO5A 3IBHA 1W89A 3PPUA 2CVDA 2M72A 2CX3A 4O7HA 4HOJA 2VCQA 3RDWA 3Q74A 1THOA 2OACA 2JACA 5LCZA 2ZUPA 5ECQB 2FUG2 4XS4A 5F05A 2IMKA 11GSA 3F6FA 4P3YB 3MYDA 2F51A 2L6CA 3GX8A 3CQFA 1UC7A 1KBNA 1T1VA 6GSYA 3GL3A 4TR3A 2IMIA 3TB2A 1VGLA 4FIWA 5H5RA 3GX0A 2N5FA 3F6DA 2AHEA 1HQOA 4I2TA 3DEXA 3EURA 1DBYA 1ZZYA 5AISA 1JZOA 3C7MA 2B7KA 1WMJA 4KDXA 1AW9A 2O7KA 4EIQA 4F9ZA 4PURA 5IPHA 2GZPA 3CSIA 2V6OA 1K3LA 3PR8A 3F3QA 4JU5A 1GUKA 5D96A 2C4JA 1GSUA 1GL8A 4N10A 5J5NA 4YKFA 5HR2A 2JU5A 5CNWA 2GZZA 1A0RP 1QK8A 1HNBA 1NM3A 2KP1A 4RUVA 4AGSA 4OO5A 2H30A 2D2ZA 2MYGA 5HR1A 2YANA 1EGRA 3LGCA 2L5LA 3GRXA 4TR0A 3PINA 2K18A 2WGRA 3VURA 3APOA 2K8SA 3WYWA 4HU9A 1DE1A 3A2XA 2GQKA 5G5FA 1X9MB 2H01A 1XXUA 5HFKA 2HT9A 1OC9B 2WDUA 3BJ5A 4WEYA 5GSTA 4PXOA 2I9HA 1VF3A 1R4WA 3IHGA 5ECPB 4PNGA 3GIXA 2G2QA 1LJRA 2LEGA 2J23A 20GSA 4MZWA 2LNTA 1ZL9A 4K5RA 3I9V2 3KP9A 2V6KA 3EMXA 1M3JA 4EF0A 1GTIA 3F63A 2F3MA 3ME7A 1YZXA 2R2JA 2HSMA 3HVSA 1XWBA 4FYBA 2XPEA 3ZFLA 2DKIA 4I6XA 3KCMA 3HXSA 2LRNA 4GTUA 5JWRB 3JCML 5KN0A 6GSWA 1T00A 2B6MA 1K0CA 4PQIA 5CO3A 1DE2A 3TKPA 2FY6A 4XIHA 1MD3A 3APSA 4KCAA 2ON5A 3TKSC 4MZCA 4A5PA 4WF4A 3TJGA 2DJ1A 3VPQA 5DAKB 1I9DA 3G7JA 2E2GA 2L4QA 4YKGA 2AJQB 2R0GA 5C00A 1A2MA 1HYUA 4WXTA 4IJ3A 2M46A 1X5DA 2DLXA 3VLNA 4IHUA 4POKA 3D6IA 4GLTA 2H72A 1QQ2A 19GSA 4ZBAA 4G9HA 3ERGA 5JWOB 3IC4A 2LV3A 5IMFA 4G19A 2YOIA 1PN0A 3CRTA 4EE0A 2AB6A 4FH8A 3ZMLA 3ZRDA 1WPIA 2YV9A 2GSQA 3HCZA 2TRXA 1QFNA 1GH2A 2VD1A 3UVTA 2YZHA 4TVEA 1FB6A 1U3IA 5D9XA 2CV4A 1GSEA 5COHA 1GTAA 4G2EA 4XS1A 4O5QA 2P5QA 4POLA 4LL1B 4PGTA 2P0GA 2H19A 2VO4A 2IWTA 3D0ZA 4PUFC 1JZDA 2PBJA 2MBSA 1Y25A 4H86A 4KCEA 4NHWA 4K7IA 1FB0A 2FLSA 4F0BA 5ID2A 4N30A 5ECIB 2C0GA 4IJIA 2A2RA 2GSSA 2IN3A 4ICYA 1M99A 4EKZA 5G2ZA 5CRGA 1PQNA 2WCIA 2G0FA 2GS3A 5C04A 1Z6MA 4V2NA 4K1FA 4MJEA 3GA4A 4BL7B 1FOHA 5F06A 3I69A 3GHAA 4ZL8A 1SYXA 3APQA 4BPYA 1V40A 2HZEB 3P90A 2EIRA 2H73A 4MJCA 1B8XA 3GURA 3HJPA 3VK9A 3FZ5A 1MDJA 2YJ7A 1S3AA 1O8WA 1Y6EA 5ECSA 3F0IA 4OD7A 2GSTA 1TU7A 5CREA 3ZIVA 4HQSA 4JEDA 2EIOA 1OAZA 2I81A 2YPMA 2IJYA 1USBA 5CRHA 3HHVA 1PX6A 2JL4A 2WULA 1S3RA 4G10A 3CTFA 1A0FA 1EOGA 1V2AA 2B1LA 4JE1A 1LU4A 1QGVA 4ZB9A 4PTSA 5GZZB 3W8JA 3IA1A 1X5CA 3MWHA 4K5SA 1TRWA 3N9JA 3FR6A 3IRAA 4DSQA 3VWWA 2FHEA 1HNCA 3RPPA 1K0MA 3DVXA 1AXDA 1VF4A 1NSWA 5DCGA 2JSZA 1M7TA 2LTKA 1GRXA 5B8BA 2X99A 1SD9A 2H1AA 3D5JA 2C0FA 4K0GA 4YQUA 3QMXA 4KF9A 1EEJA 4K7OA 4EXJA 2ALBA 6GSUA 1GLPA 3MDKA 3HZ4A 4NWYA 2LRCA 1FW1A 2YV7A 1G7EA 3WGXA 1T4YA 1U87A 3WGDA 4XS6A 2MMNA 5JWQB 4TW5A 3EC3A 3WT2A 3TKRA 5FHIA 3WT1A 4I8BA 1V98A 2IFQB 2VL3A 2PVQA 2VL9A 1R7HA 1SU9A 1OKTA 2PUKC 2HRKA 5ECMB 4NMUA 3LFLA 3TOTA 1X5EA 5KN2A 2DMMA 4TOPA 1EP8A 1NW2A 1ERUA 4JBBA 4G0LA 1H4OA 3FHKA 3GKKA 1SL0B 1CQGA 3GKMA 6GSTA 1G6WA 5DCHA 1F3AA 5ECRB 5D9TA 4IELA 2HZEA 3D4TA 4JR4A 2VCTA 3I43A 4PX1A 5CP1A 4LLRA 3VWUA 2R0CA 1FAAA 3GKXA 1JHBA 5AN1A 3N5OA 3F4RA 1SKWB 2KHPA 3P2AA 1ERTA 3EU3A 3BBYA 4TXOA 5CRWA 5AIXA 1J9BA 2CT6A 4KGIA 1XWGA 3BOAA 4IGJA 1MDKA 2VLUA 4HI7A 3J7Yb 2M80A 2I1UA 2JZSA 1T8EB 1VF2A 2VCWA 3R2QA 1AIUA 3M0FA 4J56E 3ISOA 2N5BA 4XRDA 2RUEA 1B4PA 4HU7A 3A2WA 5ELGA 5ECKB 3FYGA 2C3QA 2YNXA 2LNSA 3ZVJA 1XW6A 5H5QA 3KJYA 3KH9A 3A2VA 2IMEA 3FZ9A 3Q18A 1O85A
chains in the Genus database with same CATH topology
2H1DA 3ZTLA 3FKFA 4FYCA 1G0TA 1PN9A 5IMCA 4IP1A 1V9WA 1PA3A 3MAKA 4IQ1A 2O85A 5EY6A 2K8VA 3IV4A 2IL3A 2DMLA 3TJJA 2IMFA 3WD6A 4RI6A 1T4ZA 4JRRA 2OBKA 4KSMA 3HZ8A 2K6VA 1TK0B 4CDOA 1MTCA 1YF1A 2H6YA 3GTUB 2IFQA 4K8MA 1OYJA 2O89A 3W6GA 3UARA 1ZCPA 5EVOA 3DIEA 3IOSA 2H70A 3E9JB 1PGTA 2DIZA 1TJDA 4E8EA 5A4WA 3TJFA 4FQUA 2V41A 1XBSA 3KXOA 1J0FA 4GSSA 2PVOC 2CVKA 1XOBA 3AY8A 1KTEA 4G0KA 3UBKA 4ECIA 1S3CA 3PGTA 1K0AA 4MJBA 2QA2A 2HRNA 2H6XA 3TGZA 2XHFA 2EC4A 4ZL9A 3O76A 4K2XA 5IMVA 4MF7A 4MABA 2H75A 3KMOA 4K6XA 4ML1A 3H8QA 5CYYA 1BJXA 1FOVA 4OFTA 4MDCA 1FG4A 2DKHA 2F8AA 1M2BA 2H76A 2HRAA 4Q5RA 3GNJA 1O73A 2NDOA 5FWGA 4WR5A 2VL2A 5D73A 1XZOA 2B3SA 2OA7A 3US3A 5DJMA 1JLVA 3O6TA 1XW9A 1X0RA 1Z7RA 1EWXA 2H6ZA 4ACSA 5HFIA 4EL1A 2A4HA 1XOAA 1X9WB 1O6JA 2EIQA 1EGOA 2FD3A 1SENA 1UN2A 1KNGA 4Z2TA 1ZYNA 5JCGA 4XRAA 1XCCA 2CZ3A 3EINA 1ZYQB 3BCKA 1Z6NA 2L6DA 4L5LA 3R3EA 3DRNA 5KEJA 4TXVA 2HI7A 3I6AA 5IPGA 3LQ7A 1K0OA 3FEUA 2AYTA 4FO5A 5D9VA 4J2FA 3QAVA 1YEXA 1ILOA 4POMA 1SL1B 4I2UA 5FT3A 4DSSB 4Z2UA 4BWSA 2H1BA 3FW2A 2I4AA 2VCZA 1GSQA 2BMXA 5E4WA 3GSSA 3TUEA 4ISDA 3EWLA 2VD0A 1W4VA 4EUYA 5B6NA 1WWJA 3NOFA 3F8UA 4XHMA 1B9YC 2MBTA 2XC2A 3H79A 1E2YA 2VLTA 2NBSA 2WS2A 1HNAA 2YZUA 5JCUA 3GTUA 3F9UA 3G7YA 3LYKA 3LG6A 17GSA 3IR4A 2P5RA 3TRXA 2VUPA 2YWIA 5IMZA 5F0GA 1NHOA 18GSA 3E0UA 2K9FA 2RLIA 1EV4A 3KP8A 2AV4A 3NIVA 1GSSA 1F2EA 1RQMA 2OE0A 4KSOA 2HSYA 2H0GA 2GQLA 4ECBA 3ZL5A 5DJLA 4GF0A 2YP6A 2H66A 1OC9A 1CQHA 2H71A 3FZ4A 1ZMAA 1GSFA 4NAXA 4KX4A 1BX9A 4HS1A 4F0CA 1F6MC 5CAXA 3VWVA 3UAPA 4PUAA 2LRTA 3LYPA 1K0NA 5BRTA 2GSRA 4KDUA 2QKEA 4KH7A 3KD0A 2HXKA 2L59A 4K0NA 1A23A 2DJ2A 2CA8A 3P8WA 1O8XA 3ZYWA 1F9MA 2LS5A 3BCIA 2X8CA 4MP4A 1TI3A 3LXZA 1XFLA 5E59A 2QC7A 4F03A 1EV9A 4OCFA 3CTGA 3D4MA 3KMNA 3QFBC 1ACVA 3EE2A 5IOWA 4JR6A 1TOFA 5HFGA 4MJAA 4PNFA 1F3BA 2L57A 5DQSA 3UBLA 1DUGA 1FHEA 3LSZA 1TRUA 1MDIA 3E3EA 3OR5A 4LMVA 2PWJA 2CZ2A 2MMAA 3KTBA 2OJLA 3MNGA 5DAKA 5HR0A 5ECHB 1R26A 2KUCA 3HKRA 2N5AA 3QAWA 2GDRA 4QQ7A 4DSSA 16GSA 1SKRB 2MMZA 4EIPA 1TU8A 2GT6A 3GYKA 5A4UA 2IPAA 3GV1A 1N2AA 2CX4A 3U5RE 4YAPA 2GLRA 4KA0A 5DALB 4CY8A 2C1YA 3M8NA 3QCPA 2HSHA 2WB9A 1XVQA 3W8SA 2GQMA 1A8LA 1SK2A 9GSSA 1SK0A 4KAEA 1TK5B 4F82A 4V2MA 3CMIA 5JCWA 2NVLA 3HVXA 3L0HA 4N11A 4MA9A 1OC8A 3DVWA 2C8UA 5B7CA 4YQVA 1WRYA 4X43A 4NV2A 4QL9A 1SJZA 1N8JA 2B5XA 4WBRD 3UIWA 1BAYA 5G1LA 3VFIA 1G6YA 5D9WA 3FRCA 4POBA 3WGEA 3GMFA 2OADA 2FA8A 3TKSA 4QL7A 1R5PA 2KP2A 3D22A 1DSBA 1PL2A 1WE0A 2H1GA 1JFUA 2HE3A 4K9ZA 1GUHA 2LUSA 2X4AA 4X1UA 4DVCA 3NZNA 3EPTA 3KTLA 1PL1A 2HNLA 4L5OA 5HQPA 1OKDA 14GSA 3ZFBA 3KM6A 4NHZA 2XBIA 5B6MA 5J9BA 4WKWA 1PRXA 5A5KA 2FWFA 4AJ7A 1GSYA 1OVNA 3DMLA 3FK8A 2E7PA 4IP6A 4NXIA 5L71A 4GQFA 2WRTA 2WFCA 3IE3A 2RIIA 4Z2RA 1BQ7A 6GSSA 3TJKA 2LJRA 3LEFA 3DGQA 3M1GA 4ID0A 2HZFA 3DXBA 4N0ZA 3IAM2 3CRUA 1XWKA 3KZQA 1EZKA 2VM1A 3P7XA 2GT5A 2DIYA 2OKAA 4MF5A 1TRVA 5LNKe 2E2MA 2VCVA 4BVXB 1X9SB 2X64A 3CSHA 4F2IA 4GSTA 2JZTA 3EVIA 3GN3A 1A2JA 4ZIJA 2F8FA 1EP7A 2DJ3A 4I97A 2GVPA 4LMWA 4O92A 2IMDA 3RHBA 2CAIA 3M9KA 4ZBDA 1UA5A 1T3BA 2RM5A 3CBUA 2ES7A 3TRPA 2VLVA 4LA1A 4L0UA 3CXGA 1QXHA 3G9BA 4ZBBA 2DBCA 2B1KA 3GSTA 4MK3A 2C80A 1Z3EA 4CHSA 1ZOFA 3A3TA 2C3TA 4KB3A 1HD2A 4HEA2 1SD8A 1WIKA 4GQCA 2LQOA 1A24A 4RQXA 2VOCA 3H93A 3HYPA 4GWRA 2VAFA 1S3DA 3QR6A 3HVVA 1Z7PA 3ERWA 2GTUA 2QA1A 2ZCTA 2B7JA 4HQZA 3LWAA 12GSA 1M2AA 5BMUA 2RM6A 4BVYB 4WETA 1A8YA 3Q6OA 5INYA 6GSXA 2HRFA 3LXTA 2IIYA 4GCIA 4GRFA 5EPFA 5IQYA 1U6TA 1C72A 3VWXA 3QDNA 1YDKA 4BWQA 3UEMA 4EDYA 3IK7A 4IS0A 4KUNA 2P31A 4HJMA 4ZILA 1MD4A 4ECJA 4TKYA 1IYIA 1NHYA 5J9CA 3SWLA 4TR1B 1TRSA 5H5SA 1H75A 4E8HA 3DYRA 5KOWA 3K8NA 5IMDA 1XIYA 3RBTA 3VPTA 3FR3A 8GSSA 1T7PB 4AJ8A 3QOUA 2KLXA 1XW5A 1YEPA 1A2LA 4OFMA 1TP9A 1MEKA 1SL2B 4RQRA 1Z5YE 2Z9SA 3EMPA 3IPZA 1AUCA 1TDIA 4Q5QA 4OCEA 7GSSA 5A4VA 1M2DA 1ZYEA 1V57A 1TI1A 2HYXA 2CAQA 1M9AA 22GSA 5ECNB 3RHCA 1JZWA 1R5AA 5B8AA 4LL4B 2UZ8A 4EVMA 2R6KA 1ML6A 1YQ1A 4TRXA 2O87A 3L9SA 4ZXGA 3L9UA 3TOUA 4BVXA 1TW9A 4O5UA 4V2LA 5IO0A 4ZB8A 3ZITA 1GP1A 1PX7A 4Q5FA 1ERWA 3J7Yk 5G1KA 4KW6A 1THXA 1BG5A 1XPVA 1PKZA 2BJXA 2BTOT 3L4NA 3L9VA 5KN3A 1U88A 4IKHA 4MNNA 5ID2B 1PD21 1K3YA 4JZQA 3LW9A 3A5IA 1U3AA 4AJ6A 4MH3A 2HLSA 2YWOA 5D8IA 3GL5A 2X49A 1GSDA 3BD2A 5IOXA 1OC3A 3C8EA 3DD3A 2C3NA 4N0VA 2VCXA 3FMWA 5LD0A 4CW9A 4MZBA 3LJRA 4MH2A 1Q98A 2H8LA 3HA9A 1F37A 3QAGA 1YY7A 4NV5A 1ERVA 2LQQA 2L5OA 3F3RA 3H1NA 3MSZA 3TJBA 2WZ9A 1QUWA 1YJ6A 4BL7A 4YH2A 5GAPD 5GSSA 2C0DA 2PGTA 4BVYA 2MZCA 3TCOA 3HJMA 1GULA 1GNWA 2FGXA 2GGTA 4CY6A 4EC0A 2L4CA 3FY7A 1TXXA 5ENUA 1YKAA 3FZAA 2OBIA 2O8VB 3ZLPA 2JADA 2OE1A 4TR4A 3C1SA 3TKQA 5IMAA 3ZVJD 2E0QA 4ZB6A 2C0EA 3M3MA 1K0BA 4TR1A 1OE7A 2YN1A 1IYHA 3SBCA 2PPTA 1B4QA 2DC5A 2DJKA 2XPDA 4Q5NA 1SJ6A 4ULXA 2H0HA 4ECCA 4NPBA 3DKSA 2JZRA 5KOXA 4MLYA 1PKWA 3IXRA 4ZL7A 2H0IA 3TKSE 1XWCA 2LKUA 2V1MA 2LSTA 2VIMA 3GKNA 3ZREA 2XBQA 1GTBA 4GSNA 5ECOB 1AQXA 2WJUA 2GZYA 4DSRA 5AGYA 1TTZA 1Q4JA 3VI7A 4J57E 4HUAA 4G0IA 3DWVA 2HFDA 4MF6A 4Z7XA 2CQ9A 3QD9A 4PQHA 4BA7A 4USSA 1EOHA 1YKCA 1FVKA 2ON7A 4XTSA 1LBKA 4MMMA 1WP0A 4IQAA 4EO3A 3ZMKA 2OE3A 3KH7A 5IIZA 1SK1A 2TIRA 6GSVA 3KGKA 5ELAA 4OO4A 3HDCA 4TN8A 1GNEA 1PMTA 5DDLA 2FWEA 1ZYPA 3HD5A 3GH9A 10GSA 1SKSB 2R0PA 1RW1A 2AAWA 2VM2A 2ZNMA 4YQMA 3U6VA 4KE3A 5D93A 2TRCP 3ZZXA 4AF2A 4X4JA 1ON4A 4IBPA 1OE8A 2YWMA 1K3OA 4EDZA 4RI7A 3IHQA 3ME8A 3UJ1A 4GXZA 1AQVA 4V1Ap 2NPBA 4HZ4A 1PSQA 3QFAC 2FNOA 1K0DA 4MCUA 2A4VA 3ZIJA 1BYEA 3C73A 3PH9A 3G7IA 2DJ0A 4V1Ag 1VRSD 3CYNA 3KIJA 3IK9A 2MMOA 3RAZA 4D73B 1J08A 3TRQA 4HJ2A 2JSYA 4MPGA 4DEJA 5KN1A 4IN0A 2LJAA 1B48A 1ZGNA 5J3RA 1AC1A 2YWNA 2F9SA 4TXOB 2DSAA 1URMA 2FWHA 3GUSA 2AUVA 4KNDA 4L0WA 1BEDA 1XVWA 1G7OA 4O5RA 3RPNA 4WF5A 2FA4A 4WR4A 5GAND 4I5QA 1SJIA 5CRDA 2R4VA 1GTUA 2DJJA 3HY2A 2V2GA 4XS4B 4ILFA 5DBQA 2PU9C 1QMVA 4MPFA 2RUFA 4IVFA 5IM9A 4YAVA 1YF0A 1XWAA 5ABRA 3F4SA 1AAZA 1GLQA 5J4UA 2R3XA 4PQ1A 2LJKA 4HDEA 1FVJA 2NTOA 2J9HA 1SYRA 4HZ2A 2PN8A 2YJHA 1WJKA 3F4TA 5EL8A 5F07A 3L78A 5AIVA 5DQYA 1TKDB 2KOKA 2CVBA 1WOUA 3Q19A 3GH6A 3D21A 1I5GA 3IC8A 5G5EA 3CSJA 2FCHA 4KDYA 3ERFA 2PMTA 1UVZA 4OWYA 2R37A 13GSA 1TK8B 1JZRA 3O3TA 3ED3A 2FWGA 3QPMA 4WBJA 2VL2C 5G30A 2QSIA 1M9BA 5HR3A 1V58A 1JLWA 4FYUA 2B5EA 3MIXA 1B9XC 1GWCA 1ST9A 3C1RA 2X8GA 1RK4A 5DVBA 1E6BA 3HJOA 5ECLB 3UVHA 4ML6A 2V32A 3VI5A 5J41A 2QGVA 2I3YA 3FR9A 3EU4A 3M9JA 2X8HA 1AQWA 1O81A 4IW9A 1ABAA 3KEBA 4O32A 5F8BA 3LORA 3A5WA 3UL3A 3S9FA 1EEMA 5G31A 3GFKA 3C71A 3TDGA 2R5GA 2A2SA 4L8EA 3EYTA 4D73A 3H4KA 3UMAA 2A2PA 5IO2A 1Z9HA 1GUMA 2YCDA 2B5YA 2H74A 2REMA 3IAS2 5DALA 1O7UA 4X0XA 3UOMA 3IDVA 4XCSA 1M0UA 1KEBA 3V1WA 4OFNA 1VF1A 4K7NA 4OMVA 2PERA 4K2DA 1FO5A 3IBHA 1W89A 3PPUA 2CVDA 2M72A 2CX3A 4O7HA 4HOJA 2VCQA 3RDWA 3Q74A 1THOA 2OACA 2JACA 5LCZA 2ZUPA 5ECQB 2FUG2 4XS4A 5F05A 2IMKA 11GSA 3F6FA 4P3YB 3MYDA 2F51A 2L6CA 3GX8A 1UC7A 1KBNA 1T1VA 6GSYA 3GL3A 4TR3A 2IMIA 3TB2A 1VGLA 4FIWA 5H5RA 3GX0A 2N5FA 3F6DA 2AHEA 1HQOA 4I2TA 3DEXA 3EURA 1DBYA 1ZZYA 5AISA 1JZOA 3C7MA 2B7KA 1WMJA 4KDXA 1AW9A 2O7KA 4EIQA 4F9ZA 4PURA 5IPHA 2GZPA 3CSIA 2V6OA 1K3LA 3PR8A 3F3QA 4JU5A 1GUKA 5D96A 2C4JA 1GSUA 1GL8A 4N10A 5J5NA 4YKFA 5HR2A 2JU5A 5CNWA 2GZZA 1A0RP 1QK8A 1HNBA 1NM3A 2KP1A 4RUVA 4AGSA 4OO5A 2H30A 2D2ZA 2MYGA 5HR1A 2YANA 1EGRA 3LGCA 2L5LA 3GRXA 4TR0A 3PINA 2K18A 2WGRA 3VURA 3APOA 2K8SA 3WYWA 4HU9A 1DE1A 3A2XA 2GQKA 5G5FA 1X9MB 2H01A 1XXUA 5HFKA 2HT9A 1OC9B 2WDUA 3BJ5A 4WEYA 5GSTA 4PXOA 2I9HA 1VF3A 1R4WA 3IHGA 5ECPB 4PNGA 3GIXA 2G2QA 1LJRA 2LEGA 2J23A 20GSA 4MZWA 2LNTA 1ZL9A 4K5RA 3I9V2 3KP9A 2V6KA 3EMXA 4EF0A 1GTIA 3F63A 2F3MA 3ME7A 1YZXA 2R2JA 2HSMA 3HVSA 1XWBA 4FYBA 2XPEA 3ZFLA 2DKIA 4I6XA 3KCMA 3HXSA 2LRNA 4GTUA 5JWRB 3JCML 5KN0A 6GSWA 1T00A 2B6MA 1K0CA 4PQIA 5CO3A 1DE2A 3TKPA 2FY6A 4XIHA 1MD3A 3APSA 4KCAA 2ON5A 3TKSC 4MZCA 4A5PA 4WF4A 3TJGA 2DJ1A 3VPQA 5DAKB 1I9DA 3G7JA 2E2GA 2L4QA 4YKGA 2AJQB 2R0GA 5C00A 1A2MA 1HYUA 4WXTA 4IJ3A 2M46A 1X5DA 2DLXA 3VLNA 4IHUA 4POKA 3D6IA 4GLTA 2H72A 1QQ2A 19GSA 4ZBAA 4G9HA 3ERGA 5JWOB 3IC4A 2LV3A 5IMFA 4G19A 2YOIA 1PN0A 3CRTA 4EE0A 2AB6A 4FH8A 3ZMLA 3ZRDA 1WPIA 2YV9A 2GSQA 3HCZA 2TRXA 1QFNA 1GH2A 2VD1A 3UVTA 2YZHA 4TVEA 1FB6A 1U3IA 5D9XA 2CV4A 1GSEA 5COHA 1GTAA 4G2EA 4XS1A 4O5QA 2P5QA 4POLA 4LL1B 4PGTA 2P0GA 2H19A 2VO4A 2IWTA 3D0ZA 4PUFC 1JZDA 2PBJA 2MBSA 1Y25A 4H86A 4KCEA 4NHWA 4K7IA 1FB0A 2FLSA 4F0BA 5ID2A 4N30A 5ECIB 2C0GA 4IJIA 2A2RA 2GSSA 2IN3A 4ICYA 1M99A 4EKZA 5G2ZA 5CRGA 1PQNA 2WCIA 2G0FA 2GS3A 5C04A 1Z6MA 4V2NA 4K1FA 4MJEA 3GA4A 4BL7B 1FOHA 5F06A 3I69A 3GHAA 4ZL8A 1SYXA 3APQA 4BPYA 1V40A 2HZEB 3P90A 2EIRA 2H73A 4MJCA 1B8XA 3GURA 3HJPA 3VK9A 3FZ5A 1MDJA 2YJ7A 1S3AA 1O8WA 1Y6EA 5ECSA 3F0IA 4OD7A 2GSTA 1TU7A 5CREA 3ZIVA 4HQSA 4JEDA 2EIOA 1OAZA 2I81A 2YPMA 2IJYA 1USBA 5CRHA 3HHVA 1PX6A 2JL4A 2WULA 4G10A 3CTFA 1A0FA 1EOGA 1V2AA 2B1LA 4JE1A 1LU4A 1QGVA 4ZB9A 4PTSA 5GZZB 3W8JA 3IA1A 1X5CA 3MWHA 4K5SA 1TRWA 3N9JA 3FR6A 3IRAA 4DSQA 3VWWA 2FHEA 1HNCA 3RPPA 1K0MA 3DVXA 1AXDA 1VF4A 1NSWA 5DCGA 2JSZA 1M7TA 2LTKA 1GRXA 5B8BA 2X99A 1SD9A 2H1AA 3D5JA 2C0FA 4K0GA 4YQUA 3QMXA 4KF9A 1EEJA 4K7OA 4EXJA 2ALBA 6GSUA 1GLPA 3MDKA 3HZ4A 4NWYA 2LRCA 1FW1A 2YV7A 1G7EA 3WGXA 1T4YA 1U87A 3WGDA 4XS6A 2MMNA 5JWQB 4TW5A 3EC3A 3WT2A 3TKRA 5FHIA 3WT1A 4I8BA 1V98A 2IFQB 2VL3A 2PVQA 2VL9A 1R7HA 1SU9A 1OKTA 2PUKC 2HRKA 5ECMB 4NMUA 3LFLA 3TOTA 1X5EA 5KN2A 2DMMA 4TOPA 1EP8A 1NW2A 1ERUA 4JBBA 4G0LA 1H4OA 3FHKA 3GKKA 1SL0B 1CQGA 3GKMA 6GSTA 1G6WA 5DCHA 1F3AA 5ECRB 5D9TA 4IELA 2HZEA 3D4TA 4JR4A 2VCTA 3I43A 4PX1A 5CP1A 4LLRA 3VWUA 2R0CA 1FAAA 3GKXA 1JHBA 5AN1A 3N5OA 3F4RA 1SKWB 2KHPA 3P2AA 1ERTA 3EU3A 3BBYA 4TXOA 5CRWA 5AIXA 1J9BA 2CT6A 4KGIA 1XWGA 3BOAA 4IGJA 1MDKA 2VLUA 4HI7A 3J7Yb 2M80A 2I1UA 2JZSA 1T8EB 1VF2A 2VCWA 3R2QA 1AIUA 3M0FA 4J56E 3ISOA 2N5BA 4XRDA 2RUEA 1B4PA 4HU7A 3A2WA 5ELGA 5ECKB 3FYGA 2C3QA 2YNXA 2LNSA 3ZVJA 1XW6A 5H5QA 3KJYA 3KH9A 3A2VA 2IMEA 3FZ9A 3Q18A 1O85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1D A;  3ZTL A;  3FKF A;  4FYC A;  1G0T A;  1PN9 A;  5IMC A;  4IP1 A;  1V9W A;  1PA3 A;  3MAK A;  4IQ1 A;  2O85 A;  5EY6 A;  2K8V A;  3IV4 A;  2IL3 A;  2DML A;  3TJJ A;  2IMF A;  3WD6 A;  4RI6 A;  1T4Z A;  4JRR A;  2OBK A;  4KSM A;  3HZ8 A;  2K6V A;  1TK0 B;  4CDO A;  1MTC A;  1YF1 A;  2H6Y A;  3GTU B;  2IFQ A;  4K8M A;  1OYJ A;  2O89 A;  3W6G A;  3UAR A;  1ZCP A;  5EVO A;  3DIE A;  3IOS A;  2H70 A;  3E9J B;  1PGT A;  2DIZ A;  1TJD A;  4E8E A;  5A4W A;  3TJF A;  2V41 A;  1XBS A;  3KXO A;  1J0F A;  4GSS A;  2PVO C;  2CVK A;  1XOB A;  3AY8 A;  1KTE A;  3UBK A;  4ECI A;  1S3C A;  3PGT A;  1K0A A;  4MJB A;  2HRN A;  2H6X A;  3TGZ A;  2XHF A;  2EC4 A;  4ZL9 A;  3O76 A;  5IMV A;  4MF7 A;  4MAB A;  2H75 A;  3KMO A;  4K6X A;  4ML1 A;  3H8Q A;  5CYY A;  1BJX A;  1FOV A;  4OFT A;  4MDC A;  1FG4 A;  2F8A A;  1M2B A;  2H76 A;  4Q5R A;  3GNJ A;  1O73 A;  2NDO A;  5FWG A;  4WR5 A;  2VL2 A;  5D73 A;  1XZO A;  2B3S A;  2OA7 A;  3US3 A;  5DJM A;  1JLV A;  3O6T A;  1XW9 A;  1X0R A;  1Z7R A;  1EWX A;  2H6Z A;  4ACS A;  5HFI A;  4EL1 A;  1XOA A;  1X9W B;  1O6J A;  2EIQ A;  1EGO A;  2FD3 A;  1SEN A;  1UN2 A;  1KNG A;  5JCG A;  4XRA A;  1XCC A;  2CZ3 A;  3EIN A;  1ZYQ B;  3BCK A;  1Z6N A;  2L6D A;  4L5L A;  3DRN A;  5KEJ A;  4TXV A;  2HI7 A;  3I6A A;  5IPG A;  3LQ7 A;  1K0O A;  3FEU A;  2AYT A;  4FO5 A;  5D9V A;  4J2F A;  3QAV A;  1YEX A;  1ILO A;  4POM A;  1SL1 B;  4I2U A;  5FT3 A;  4DSS B;  4BWS A;  2H1B A;  3FW2 A;  2I4A A;  2VCZ A;  1GSQ A;  2BMX A;  5E4W A;  3GSS A;  3TUE A;  4ISD A;  3EWL A;  2VD0 A;  1W4V A;  4EUY A;  5B6N A;  1WWJ A;  3NOF A;  3F8U A;  4XHM A;  1B9Y C;  2MBT A;  2XC2 A;  3H79 A;  1E2Y A;  2VLT A;  2NBS A;  2WS2 A;  1HNA A;  2YZU A;  5JCU A;  3GTU A;  3F9U A;  3G7Y A;  3LYK A;  3LG6 A;  17GS A;  3IR4 A;  2P5R A;  3TRX A;  2VUP A;  2YWI A;  5IMZ A;  5F0G A;  1NHO A;  18GS A;  3E0U A;  2K9F A;  2RLI A;  1EV4 A;  3KP8 A;  2AV4 A;  3NIV A;  1GSS A;  1F2E A;  1RQM A;  2OE0 A;  4KSO A;  2HSY A;  2H0G A;  2GQL A;  4ECB A;  3ZL5 A;  5DJL A;  4GF0 A;  2YP6 A;  2H66 A;  1OC9 A;  1CQH A;  2H71 A;  3FZ4 A;  1ZMA A;  1GSF A;  4NAX A;  4KX4 A;  1BX9 A;  4HS1 A;  4F0C A;  1F6M C;  5CAX A;  3VWV A;  3UAP A;  4PUA A;  2LRT A;  3LYP A;  1K0N A;  2GSR A;  4KDU A;  2QKE A;  4KH7 A;  3KD0 A;  2HXK A;  2L59 A;  4K0N A;  1A23 A;  2DJ2 A;  2CA8 A;  3P8W A;  1O8X A;  3ZYW A;  1F9M A;  2LS5 A;  3BCI A;  2X8C A;  4MP4 A;  1TI3 A;  3LXZ A;  1XFL A;  5E59 A;  2QC7 A;  4F03 A;  1EV9 A;  4OCF A;  3CTG A;  3D4M A;  3KMN A;  3QFB C;  1ACV A;  3EE2 A;  5IOW A;  4JR6 A;  1TOF A;  5HFG A;  4MJA A;  4PNF A;  1F3B A;  2L57 A;  5DQS A;  3UBL A;  1DUG A;  1FHE A;  3LSZ A;  1TRU A;  1MDI A;  3E3E A;  3OR5 A;  4LMV A;  2PWJ A;  2CZ2 A;  2MMA A;  3KTB A;  2OJL A;  3MNG A;  5DAK A;  5HR0 A;  5ECH B;  1R26 A;  2KUC A;  3HKR A;  2N5A A;  3QAW A;  2GDR A;  4QQ7 A;  4DSS A;  16GS A;  1SKR B;  2MMZ A;  1TU8 A;  2GT6 A;  3GYK A;  5A4U A;  2IPA A;  3GV1 A;  1N2A A;  2CX4 A;  3U5R E;  4YAP A;  2GLR A;  4KA0 A;  5DAL B;  2C1Y A;  3M8N A;  3QCP A;  2HSH A;  2WB9 A;  1XVQ A;  3W8S A;  2GQM A;  1A8L A;  1SK2 A;  9GSS A;  1SK0 A;  4KAE A;  1TK5 B;  4F82 A;  4V2M A;  3CMI A;  5JCW A;  2NVL A;  3HVX A;  3L0H A;  4N11 A;  4MA9 A;  1OC8 A;  3DVW A;  2C8U A;  5B7C A;  4YQV A;  1WRY A;  4X43 A;  4NV2 A;  4QL9 A;  1SJZ A;  1N8J A;  2B5X A;  4WBR D;  3UIW A;  1BAY A;  5G1L A;  3VFI A;  1G6Y A;  5D9W A;  3FRC A;  4POB A;  3WGE A;  3GMF A;  2OAD A;  2FA8 A;  3TKS A;  4QL7 A;  1R5P A;  2KP2 A;  3D22 A;  1DSB A;  1PL2 A;  1WE0 A;  2H1G A;  1JFU A;  2HE3 A;  4K9Z A;  1GUH A;  2LUS A;  4X1U A;  4DVC A;  3NZN A;  3KTL A;  1PL1 A;  2HNL A;  4L5O A;  5HQP A;  1OKD A;  14GS A;  3ZFB A;  3KM6 A;  4NHZ A;  2XBI A;  5B6M A;  5J9B A;  4WKW A;  1PRX A;  5A5K A;  2FWF A;  4AJ7 A;  1GSY A;  1OVN A;  3DML A;  3FK8 A;  2E7P A;  4IP6 A;  4NXI A;  5L71 A;  4GQF A;  2WRT A;  2WFC A;  3IE3 A;  2RII A;  1BQ7 A;  6GSS A;  3TJK A;  2LJR A;  3LEF A;  3DGQ A;  3M1G A;  4ID0 A;  2HZF A;  3DXB A;  4N0Z A;  3IAM 2;  3CRU A;  1XWK A;  3KZQ A;  1EZK A;  2VM1 A;  3P7X A;  2GT5 A;  2DIY A;  2OKA A;  4MF5 A;  1TRV A;  5LNK e;  2E2M A;  2VCV A;  1X9S B;  2X64 A;  3CSH A;  4F2I A;  4GST A;  2JZT A;  3EVI A;  3GN3 A;  1A2J A;  4ZIJ A;  2F8F A;  1EP7 A;  2DJ3 A;  4I97 A;  2GVP A;  4LMW A;  4O92 A;  2IMD A;  3RHB A;  2CAI A;  3M9K A;  4ZBD A;  1UA5 A;  1T3B A;  2RM5 A;  3CBU A;  2ES7 A;  3TRP A;  2VLV A;  4LA1 A;  4L0U A;  3CXG A;  1QXH A;  3G9B A;  4ZBB A;  2DBC A;  2B1K A;  3GST A;  4MK3 A;  2C80 A;  1Z3E A;  4CHS A;  1ZOF A;  3A3T A;  2C3T A;  4KB3 A;  1HD2 A;  4HEA 2;  1SD8 A;  1WIK A;  4GQC A;  2LQO A;  1A24 A;  4RQX A;  2VOC A;  3H93 A;  3HYP A;  4GWR A;  2VAF A;  1S3D A;  3QR6 A;  3HVV A;  1Z7P A;  3ERW A;  2GTU A;  2ZCT A;  2B7J A;  4HQZ A;  3LWA A;  12GS A;  1M2A A;  2RM6 A;  4WET A;  1A8Y A;  3Q6O A;  5INY A;  6GSX A;  2HRF A;  3LXT A;  2IIY A;  4GCI A;  4GRF A;  5EPF A;  5IQY A;  1U6T A;  1C72 A;  3VWX A;  3QDN A;  1YDK A;  4BWQ A;  3UEM A;  4EDY A;  3IK7 A;  4IS0 A;  4KUN A;  2P31 A;  4HJM A;  4ZIL A;  1MD4 A;  4ECJ A;  4TKY A;  1IYI A;  1NHY A;  5J9C A;  3SWL A;  4TR1 B;  1TRS A;  5H5S A;  1H75 A;  4E8H A;  3DYR A;  3K8N A;  5IMD A;  1XIY A;  3RBT A;  3VPT A;  3FR3 A;  8GSS A;  1T7P B;  4AJ8 A;  3QOU A;  2KLX A;  1XW5 A;  1YEP A;  1A2L A;  4OFM A;  1TP9 A;  1MEK A;  1SL2 B;  4RQR A;  1Z5Y E;  2Z9S A;  3EMP A;  3IPZ A;  1AUC A;  1TDI A;  4Q5Q A;  4OCE A;  7GSS A;  5A4V A;  1M2D A;  1ZYE A;  1V57 A;  1TI1 A;  2HYX A;  2CAQ A;  1M9A A;  22GS A;  5ECN B;  3RHC A;  1JZW A;  1R5A A;  5B8A A;  4LL4 B;  4EVM A;  2R6K A;  1ML6 A;  1YQ1 A;  4TRX A;  2O87 A;  3L9S A;  4ZXG A;  3L9U A;  3TOU A;  4BVX A;  1TW9 A;  4V2L A;  5IO0 A;  4ZB8 A;  3ZIT A;  1GP1 A;  1PX7 A;  4Q5F A;  1ERW A;  3J7Y k;  5G1K A;  4KW6 A;  1THX A;  1BG5 A;  1XPV A;  1PKZ A;  2BJX A;  2BTO T;  3L4N A;  3L9V A;  5KN3 A;  1U88 A;  4IKH A;  5ID2 B;  1PD2 1;  1K3Y A;  4JZQ A;  1U3A A;  4AJ6 A;  4MH3 A;  2HLS A;  2YWO A;  5D8I A;  3GL5 A;  1GSD A;  3BD2 A;  5IOX A;  1OC3 A;  3C8E A;  3DD3 A;  2C3N A;  4N0V A;  2VCX A;  5LD0 A;  4CW9 A;  4MZB A;  3LJR A;  4MH2 A;  1Q98 A;  2H8L A;  3HA9 A;  1F37 A;  3QAG A;  1YY7 A;  4NV5 A;  1ERV A;  2LQQ A;  2L5O A;  3F3R A;  3H1N A;  3MSZ A;  3TJB A;  2WZ9 A;  1QUW A;  1YJ6 A;  4BL7 A;  4YH2 A;  5GAP D;  5GSS A;  2C0D A;  2PGT A;  4BVY A;  2MZC A;  3TCO A;  3HJM A;  1GUL A;  1GNW A;  2FGX A;  2GGT A;  4EC0 A;  2L4C A;  3FY7 A;  1TXX A;  5ENU A;  1YKA A;  3FZA A;  2OBI A;  2O8V B;  3ZLP A;  2JAD A;  2OE1 A;  4TR4 A;  3C1S A;  3TKQ A;  5IMA A;  3ZVJ D;  2E0Q A;  4ZB6 A;  2C0E A;  3M3M A;  1K0B A;  4TR1 A;  1OE7 A;  2YN1 A;  1IYH A;  3SBC A;  2PPT A;  1B4Q A;  2DC5 A;  2DJK A;  2XPD A;  4Q5N A;  1SJ6 A;  4ULX A;  2H0H A;  4ECC A;  4NPB A;  3DKS A;  2JZR A;  4MLY A;  1PKW A;  3IXR A;  4ZL7 A;  2H0I A;  3TKS E;  1XWC A;  2LKU A;  2V1M A;  2LST A;  2VIM A;  3GKN A;  3ZRE A;  2XBQ A;  1GTB A;  4GSN A;  5ECO B;  1AQX A;  2WJU A;  2GZY A;  4DSR A;  5AGY A;  1TTZ A;  1Q4J A;  3VI7 A;  4J57 E;  4HUA A;  3DWV A;  2HFD A;  4MF6 A;  4Z7X A;  2CQ9 A;  3QD9 A;  4PQH A;  4BA7 A;  1EOH A;  1YKC A;  1FVK A;  2ON7 A;  4XTS A;  1LBK A;  4MMM A;  1WP0 A;  4IQA A;  4EO3 A;  3ZMK A;  2OE3 A;  3KH7 A;  5IIZ A;  1SK1 A;  2TIR A;  6GSV A;  3KGK A;  5ELA A;  4OO4 A;  3HDC A;  4TN8 A;  1GNE A;  1PMT A;  5DDL A;  2FWE A;  3HD5 A;  3GH9 A;  10GS A;  1SKS B;  1RW1 A;  2AAW A;  2VM2 A;  2ZNM A;  4YQM A;  3U6V A;  4KE3 A;  5D93 A;  2TRC P;  3ZZX A;  4AF2 A;  1ON4 A;  4IBP A;  1OE8 A;  2YWM A;  1K3O A;  4EDZ A;  4RI7 A;  3IHQ A;  3ME8 A;  3UJ1 A;  4GXZ A;  1AQV A;  4V1A p;  2NPB A;  4HZ4 A;  1PSQ A;  3QFA C;  2FNO A;  1K0D A;  4MCU A;  2A4V A;  3ZIJ A;  1BYE A;  3C73 A;  3PH9 A;  3G7I A;  2DJ0 A;  4V1A g;  1VRS D;  3CYN A;  3KIJ A;  3IK9 A;  2MMO A;  3RAZ A;  4D73 B;  1J08 A;  3TRQ A;  4HJ2 A;  2JSY A;  4MPG A;  4DEJ A;  5KN1 A;  4IN0 A;  2LJA A;  1B48 A;  1ZGN A;  5J3R A;  1AC1 A;  2YWN A;  2F9S A;  4TXO B;  2DSA A;  1URM A;  2FWH A;  3GUS A;  2AUV A;  4KND A;  4L0W A;  1BED A;  1XVW A;  1G7O A;  4O5R A;  3RPN A;  4WF5 A;  2FA4 A;  4WR4 A;  5GAN D;  4I5Q A;  1SJI A;  5CRD A;  2R4V A;  1GTU A;  2DJJ A;  3HY2 A;  2V2G A;  4XS4 B;  4ILF A;  5DBQ A;  2PU9 C;  1QMV A;  4MPF A;  2RUF A;  4IVF A;  5IM9 A;  4YAV A;  1YF0 A;  1XWA A;  5ABR A;  3F4S A;  1AAZ A;  1GLQ A;  5J4U A;  2R3X A;  4PQ1 A;  2LJK A;  4HDE A;  1FVJ A;  2NTO A;  2J9H A;  1SYR A;  4HZ2 A;  2PN8 A;  2YJH A;  1WJK A;  3F4T A;  5EL8 A;  5F07 A;  3L78 A;  5AIV A;  5DQY A;  1TKD B;  2KOK A;  2CVB A;  1WOU A;  3Q19 A;  3GH6 A;  3D21 A;  1I5G A;  5G5E A;  3CSJ A;  2FCH A;  4KDY A;  3ERF A;  2PMT A;  1UVZ A;  4OWY A;  2R37 A;  13GS A;  1TK8 B;  1JZR A;  3O3T A;  3ED3 A;  2FWG A;  3QPM A;  4WBJ A;  2VL2 C;  5G30 A;  2QSI A;  1M9B A;  5HR3 A;  1V58 A;  1JLW A;  4FYU A;  2B5E A;  1B9X C;  1GWC A;  1ST9 A;  3C1R A;  2X8G A;  1RK4 A;  5DVB A;  1E6B A;  3HJO A;  5ECL B;  3UVH A;  4ML6 A;  2V32 A;  3VI5 A;  5J41 A;  2QGV A;  2I3Y A;  3FR9 A;  3EU4 A;  3M9J A;  2X8H A;  1AQW A;  1O81 A;  4IW9 A;  1ABA A;  3KEB A;  4O32 A;  5F8B A;  3LOR A;  3A5W A;  3UL3 A;  3S9F A;  1EEM A;  5G31 A;  3GFK A;  3C71 A;  3TDG A;  2R5G A;  2A2S A;  4L8E A;  3EYT A;  4D73 A;  3H4K A;  3UMA A;  5IO2 A;  1Z9H A;  1GUM A;  2YCD A;  2B5Y A;  2H74 A;  2REM A;  3IAS 2;  5DAL A;  1O7U A;  4X0X A;  3UOM A;  3IDV A;  4XCS A;  1M0U A;  1KEB A;  3V1W A;  4OFN A;  1VF1 A;  4K7N A;  4OMV A;  2PER A;  4K2D A;  1FO5 A;  3IBH A;  1W89 A;  2CVD A;  2M72 A;  2CX3 A;  4O7H A;  4HOJ A;  2VCQ A;  3RDW A;  3Q74 A;  1THO A;  2OAC A;  2JAC A;  5LCZ A;  2ZUP A;  5ECQ B;  2FUG 2;  4XS4 A;  5F05 A;  2IMK A;  11GS A;  3F6F A;  4P3Y B;  2F51 A;  2L6C A;  3GX8 A;  1UC7 A;  1KBN A;  1T1V A;  6GSY A;  3GL3 A;  4TR3 A;  2IMI A;  3TB2 A;  1VGL A;  4FIW A;  5H5R A;  3GX0 A;  2N5F A;  3F6D A;  2AHE A;  1HQO A;  4I2T A;  3DEX A;  3EUR A;  1DBY A;  1ZZY A;  5AIS A;  1JZO A;  3C7M A;  2B7K A;  1WMJ A;  4KDX A;  1AW9 A;  2O7K A;  4F9Z A;  4PUR A;  5IPH A;  2GZP A;  3CSI A;  2V6O A;  1K3L A;  3PR8 A;  3F3Q A;  4JU5 A;  1GUK A;  5D96 A;  2C4J A;  1GSU A;  1GL8 A;  4N10 A;  5J5N A;  5HR2 A;  2JU5 A;  5CNW A;  2GZZ A;  1A0R P;  1QK8 A;  1HNB A;  1NM3 A;  2KP1 A;  4RUV A;  4AGS A;  4OO5 A;  2H30 A;  2D2Z A;  2MYG A;  5HR1 A;  2YAN A;  1EGR A;  3LGC A;  2L5L A;  3GRX A;  4TR0 A;  3PIN A;  2K18 A;  2WGR A;  3VUR A;  3APO A;  2K8S A;  3WYW A;  4HU9 A;  1DE1 A;  3A2X A;  2GQK A;  5G5F A;  1X9M B;  2H01 A;  1XXU A;  5HFK A;  2HT9 A;  1OC9 B;  2WDU A;  3BJ5 A;  4WEY A;  5GST A;  4PXO A;  2I9H A;  1VF3 A;  1R4W A;  5ECP B;  4PNG A;  3GIX A;  2G2Q A;  1LJR A;  2LEG A;  2J23 A;  20GS A;  4MZW A;  2LNT A;  1ZL9 A;  3I9V 2;  3KP9 A;  2V6K A;  3EMX A;  4EF0 A;  1GTI A;  3F63 A;  2F3M A;  3ME7 A;  1YZX A;  2R2J A;  3HVS A;  1XWB A;  4FYB A;  2XPE A;  3ZFL A;  4I6X A;  3KCM A;  3HXS A;  2LRN A;  4GTU A;  5JWR B;  3JCM L;  5KN0 A;  6GSW A;  1T00 A;  2B6M A;  1K0C A;  4PQI A;  5CO3 A;  1DE2 A;  3TKP A;  2FY6 A;  4XIH A;  1MD3 A;  3APS A;  4KCA A;  2ON5 A;  3TKS C;  4MZC A;  4WF4 A;  3TJG A;  2DJ1 A;  3VPQ A;  5DAK B;  1I9D A;  3G7J A;  2E2G A;  2L4Q A;  2AJQ B;  5C00 A;  1A2M A;  1HYU A;  4WXT A;  4IJ3 A;  2M46 A;  1X5D A;  2DLX A;  3VLN A;  4IHU A;  4POK A;  3D6I A;  4GLT A;  2H72 A;  1QQ2 A;  19GS A;  4ZBA A;  4G9H A;  3ERG A;  5JWO B;  3IC4 A;  2LV3 A;  5IMF A;  4G19 A;  2YOI A;  3CRT A;  4EE0 A;  2AB6 A;  4FH8 A;  3ZML A;  3ZRD A;  1WPI A;  2YV9 A;  2GSQ A;  3HCZ A;  2TRX A;  1QFN A;  1GH2 A;  2VD1 A;  3UVT A;  2YZH A;  4TVE A;  1FB6 A;  1U3I A;  5D9X A;  2CV4 A;  1GSE A;  5COH A;  1GTA A;  4G2E A;  4XS1 A;  2P5Q A;  4POL A;  4LL1 B;  4PGT A;  2P0G A;  2H19 A;  2VO4 A;  2IWT A;  3D0Z A;  4PUF C;  1JZD A;  2PBJ A;  2MBS A;  1Y25 A;  4H86 A;  4KCE A;  4NHW A;  4K7I A;  1FB0 A;  2FLS A;  4F0B A;  5ID2 A;  4N30 A;  5ECI B;  2C0G A;  4IJI A;  2A2R A;  2GSS A;  2IN3 A;  1M99 A;  4EKZ A;  5G2Z A;  5CRG A;  1PQN A;  2WCI A;  2G0F A;  2GS3 A;  5C04 A;  1Z6M A;  4V2N A;  4K1F A;  4MJE A;  3GA4 A;  5F06 A;  3I69 A;  3GHA A;  4ZL8 A;  1SYX A;  3APQ A;  4BPY A;  1V40 A;  2HZE B;  3P90 A;  2EIR A;  2H73 A;  4MJC A;  1B8X A;  3GUR A;  3HJP A;  3VK9 A;  3FZ5 A;  1MDJ A;  2YJ7 A;  1S3A A;  1O8W A;  1Y6E A;  5ECS A;  3F0I A;  4OD7 A;  2GST A;  1TU7 A;  5CRE A;  3ZIV A;  4HQS A;  4JED A;  2EIO A;  1OAZ A;  2I81 A;  2YPM A;  2IJY A;  1USB A;  5CRH A;  3HHV A;  1PX6 A;  2JL4 A;  2WUL A;  4G10 A;  3CTF A;  1A0F A;  1EOG A;  1V2A A;  2B1L A;  4JE1 A;  1LU4 A;  1QGV A;  4ZB9 A;  5GZZ B;  3W8J A;  3IA1 A;  1X5C A;  3MWH A;  1TRW A;  3N9J A;  3FR6 A;  3IRA A;  4DSQ A;  3VWW A;  2FHE A;  1HNC A;  3RPP A;  1K0M A;  3DVX A;  1AXD A;  1VF4 A;  1NSW A;  5DCG A;  2JSZ A;  1M7T A;  2LTK A;  1GRX A;  5B8B A;  2X99 A;  1SD9 A;  2H1A A;  3D5J A;  2C0F A;  4K0G A;  4YQU A;  3QMX A;  1EEJ A;  4K7O A;  4EXJ A;  2ALB A;  6GSU A;  1GLP A;  3MDK A;  3HZ4 A;  4NWY A;  2LRC A;  1FW1 A;  2YV7 A;  1G7E A;  3WGX A;  1T4Y A;  1U87 A;  3WGD A;  4XS6 A;  2MMN A;  5JWQ B;  4TW5 A;  3EC3 A;  3WT2 A;  3TKR A;  5FHI A;  3WT1 A;  4I8B A;  1V98 A;  2IFQ B;  2VL3 A;  2PVQ A;  2VL9 A;  1R7H A;  1SU9 A;  1OKT A;  2PUK C;  5ECM B;  4NMU A;  3LFL A;  3TOT A;  1X5E A;  5KN2 A;  2DMM A;  4TOP A;  1EP8 A;  1NW2 A;  1ERU A;  4JBB A;  1H4O A;  3FHK A;  3GKK A;  1SL0 B;  1CQG A;  3GKM A;  6GST A;  1G6W A;  5DCH A;  1F3A A;  5ECR B;  5D9T A;  4IEL A;  2HZE A;  3D4T A;  4JR4 A;  2VCT A;  3I43 A;  4PX1 A;  5CP1 A;  4LLR A;  3VWU A;  1FAA A;  3GKX A;  1JHB A;  5AN1 A;  3N5O A;  3F4R A;  1SKW B;  2KHP A;  3P2A A;  1ERT A;  3EU3 A;  3BBY A;  4TXO A;  5CRW A;  5AIX A;  1J9B A;  2CT6 A;  4KGI A;  1XWG A;  3BOA A;  4IGJ A;  1MDK A;  2VLU A;  4HI7 A;  3J7Y b;  2M80 A;  2I1U A;  2JZS A;  1T8E B;  1VF2 A;  2VCW A;  3R2Q A;  1AIU A;  3M0F A;  4J56 E;  3ISO A;  2N5B A;  4XRD A;  2RUE A;  1B4P A;  4HU7 A;  3A2W A;  5ELG A;  5ECK B;  3FYG A;  2C3Q A;  2YNX A;  2LNS A;  3ZVJ A;  1XW6 A;  5H5Q A;  3KJY A;  3KH9 A;  3A2V A;  2IME A;  3FZ9 A;  3Q18 A;  1O85 A; 
#chains in the Genus database with same CATH topology
 2H1D A;  3ZTL A;  3FKF A;  4FYC A;  1G0T A;  1PN9 A;  5IMC A;  4IP1 A;  1V9W A;  1PA3 A;  3MAK A;  4IQ1 A;  2O85 A;  5EY6 A;  2K8V A;  3IV4 A;  2IL3 A;  2DML A;  3TJJ A;  2IMF A;  3WD6 A;  4RI6 A;  1T4Z A;  4JRR A;  2OBK A;  4KSM A;  3HZ8 A;  2K6V A;  1TK0 B;  4CDO A;  1MTC A;  1YF1 A;  2H6Y A;  3GTU B;  2IFQ A;  4K8M A;  1OYJ A;  2O89 A;  3W6G A;  3UAR A;  1ZCP A;  5EVO A;  3DIE A;  3IOS A;  2H70 A;  3E9J B;  1PGT A;  2DIZ A;  1TJD A;  4E8E A;  5A4W A;  3TJF A;  4FQU A;  2V41 A;  1XBS A;  3KXO A;  1J0F A;  4GSS A;  2PVO C;  2CVK A;  1XOB A;  3AY8 A;  1KTE A;  4G0K A;  3UBK A;  4ECI A;  1S3C A;  3PGT A;  1K0A A;  4MJB A;  2QA2 A;  2HRN A;  2H6X A;  3TGZ A;  2XHF A;  2EC4 A;  4ZL9 A;  3O76 A;  4K2X A;  5IMV A;  4MF7 A;  4MAB A;  2H75 A;  3KMO A;  4K6X A;  4ML1 A;  3H8Q A;  5CYY A;  1BJX A;  1FOV A;  4OFT A;  4MDC A;  1FG4 A;  2DKH A;  2F8A A;  1M2B A;  2H76 A;  2HRA A;  4Q5R A;  3GNJ A;  1O73 A;  2NDO A;  5FWG A;  4WR5 A;  2VL2 A;  5D73 A;  1XZO A;  2B3S A;  2OA7 A;  3US3 A;  5DJM A;  1JLV A;  3O6T A;  1XW9 A;  1X0R A;  1Z7R A;  1EWX A;  2H6Z A;  4ACS A;  5HFI A;  4EL1 A;  2A4H A;  1XOA A;  1X9W B;  1O6J A;  2EIQ A;  1EGO A;  2FD3 A;  1SEN A;  1UN2 A;  1KNG A;  4Z2T A;  1ZYN A;  5JCG A;  4XRA A;  1XCC A;  2CZ3 A;  3EIN A;  1ZYQ B;  3BCK A;  1Z6N A;  2L6D A;  4L5L A;  3R3E A;  3DRN A;  5KEJ A;  4TXV A;  2HI7 A;  3I6A A;  5IPG A;  3LQ7 A;  1K0O A;  3FEU A;  2AYT A;  4FO5 A;  5D9V A;  4J2F A;  3QAV A;  1YEX A;  1ILO A;  4POM A;  1SL1 B;  4I2U A;  5FT3 A;  4DSS B;  4Z2U A;  4BWS A;  2H1B A;  3FW2 A;  2I4A A;  2VCZ A;  1GSQ A;  2BMX A;  5E4W A;  3GSS A;  1XG8 A;  3TUE A;  4ISD A;  3EWL A;  2VD0 A;  1W4V A;  4EUY A;  5B6N A;  1WWJ A;  3NOF A;  3F8U A;  4XHM A;  1B9Y C;  2MBT A;  2XC2 A;  3H79 A;  1E2Y A;  2VLT A;  2NBS A;  2WS2 A;  1HNA A;  2YZU A;  5JCU A;  3GTU A;  3F9U A;  3G7Y A;  3LYK A;  3LG6 A;  17GS A;  3IR4 A;  2P5R A;  3TRX A;  2VUP A;  2YWI A;  5IMZ A;  5F0G A;  1NHO A;  18GS A;  3E0U A;  2K9F A;  2RLI A;  1EV4 A;  3KP8 A;  2AV4 A;  3NIV A;  1GSS A;  1F2E A;  1RQM A;  2OE0 A;  4KSO A;  2HSY A;  2H0G A;  2GQL A;  4ECB A;  3ZL5 A;  5DJL A;  4GF0 A;  2YP6 A;  2H66 A;  1OC9 A;  1CQH A;  2H71 A;  3FZ4 A;  1ZMA A;  1GSF A;  4NAX A;  1PFO A;  4KX4 A;  1BX9 A;  4HS1 A;  4F0C A;  1F6M C;  5CAX A;  3VWV A;  3UAP A;  4PUA A;  2LRT A;  3LYP A;  1K0N A;  5BRT A;  2GSR A;  4KDU A;  2QKE A;  4KH7 A;  3KD0 A;  2HXK A;  2L59 A;  4K0N A;  1A23 A;  2DJ2 A;  2CA8 A;  3P8W A;  1O8X A;  3ZYW A;  1F9M A;  2LS5 A;  3BCI A;  2X8C A;  4MP4 A;  1TI3 A;  3LXZ A;  1XFL A;  5E59 A;  2QC7 A;  4F03 A;  1EV9 A;  4OCF A;  3CTG A;  3D4M A;  3KMN A;  3QFB C;  1ACV A;  3EE2 A;  5IOW A;  4JR6 A;  1TOF A;  5HFG A;  4MJA A;  4PNF A;  1F3B A;  2L57 A;  5DQS A;  3UBL A;  1DUG A;  1FHE A;  3LSZ A;  1TRU A;  1MDI A;  3E3E A;  3OR5 A;  4LMV A;  2PWJ A;  2CZ2 A;  2MMA A;  3KTB A;  2OJL A;  3MNG A;  5DAK A;  5HR0 A;  5ECH B;  1R26 A;  2KUC A;  3HKR A;  2N5A A;  3QAW A;  2GDR A;  4QQ7 A;  4DSS A;  16GS A;  1SKR B;  2MMZ A;  4EIP A;  1TU8 A;  2GT6 A;  3GYK A;  5A4U A;  2IPA A;  3GV1 A;  1N2A A;  2CX4 A;  3U5R E;  4YAP A;  2GLR A;  4KA0 A;  5DAL B;  4CY8 A;  2C1Y A;  3M8N A;  3QCP A;  2HSH A;  2WB9 A;  1XVQ A;  3W8S A;  2GQM A;  1A8L A;  1SK2 A;  9GSS A;  1SK0 A;  4KAE A;  1TK5 B;  4F82 A;  4V2M A;  3CMI A;  5JCW A;  2NVL A;  3HVX A;  3L0H A;  4N11 A;  4MA9 A;  1M3I A;  1OC8 A;  3DVW A;  2C8U A;  5B7C A;  4YQV A;  1WRY A;  4X43 A;  4NV2 A;  4QL9 A;  1SJZ A;  1N8J A;  2B5X A;  4WBR D;  3UIW A;  1BAY A;  5G1L A;  3VFI A;  1G6Y A;  5D9W A;  3FRC A;  4POB A;  3WGE A;  3GMF A;  2OAD A;  2FA8 A;  3TKS A;  4QL7 A;  1R5P A;  2KP2 A;  3D22 A;  1DSB A;  1PL2 A;  1WE0 A;  2H1G A;  1JFU A;  2HE3 A;  4K9Z A;  1GUH A;  2LUS A;  2X4A A;  4X1U A;  4DVC A;  3NZN A;  3EPT A;  3KTL A;  1PL1 A;  2HNL A;  4L5O A;  5HQP A;  1OKD A;  14GS A;  3ZFB A;  3KM6 A;  4NHZ A;  2XBI A;  5B6M A;  5J9B A;  4WKW A;  1PRX A;  5A5K A;  2FWF A;  4AJ7 A;  1GSY A;  1OVN A;  3DML A;  3FK8 A;  2E7P A;  4IP6 A;  4NXI A;  5L71 A;  4GQF A;  2WRT A;  2WFC A;  3IE3 A;  2RII A;  4Z2R A;  1BQ7 A;  6GSS A;  3TJK A;  2LJR A;  3LEF A;  3DGQ A;  3M1G A;  4ID0 A;  2HZF A;  3DXB A;  4N0Z A;  3IAM 2;  3CRU A;  1XWK A;  3KZQ A;  1EZK A;  2VM1 A;  3P7X A;  2GT5 A;  2DIY A;  2OKA A;  4MF5 A;  1TRV A;  5LNK e;  2E2M A;  2VCV A;  4BVX B;  1X9S B;  2X64 A;  3CSH A;  4F2I A;  4GST A;  2JZT A;  3EVI A;  3GN3 A;  1A2J A;  4ZIJ A;  2F8F A;  1EP7 A;  2DJ3 A;  4I97 A;  2GVP A;  4LMW A;  4O92 A;  2IMD A;  3RHB A;  2CAI A;  3M9K A;  4ZBD A;  1UA5 A;  1T3B A;  2RM5 A;  3CBU A;  2ES7 A;  3TRP A;  2VLV A;  4LA1 A;  4L0U A;  3CXG A;  1QXH A;  3G9B A;  4ZBB A;  2DBC A;  2B1K A;  3GST A;  4MK3 A;  2C80 A;  1Z3E A;  4CHS A;  1ZOF A;  3A3T A;  2C3T A;  4KB3 A;  1HD2 A;  4HEA 2;  1SD8 A;  1WIK A;  4GQC A;  2LQO A;  1A24 A;  4RQX A;  2VOC A;  3H93 A;  3HYP A;  4GWR A;  2VAF A;  1S3D A;  3QR6 A;  3HVV A;  1Z7P A;  3ERW A;  2GTU A;  2QA1 A;  2ZCT A;  2B7J A;  4HQZ A;  3LWA A;  12GS A;  1M2A A;  5BMU A;  2RM6 A;  4BVY B;  4WET A;  1A8Y A;  3Q6O A;  5INY A;  6GSX A;  2HRF A;  3LXT A;  2IIY A;  4GCI A;  4GRF A;  5EPF A;  5IQY A;  1U6T A;  1C72 A;  3VWX A;  3QDN A;  1YDK A;  4BWQ A;  3UEM A;  4EDY A;  3IK7 A;  4IS0 A;  4KUN A;  2P31 A;  4HJM A;  4ZIL A;  1MD4 A;  4ECJ A;  4HSC X;  4TKY A;  1IYI A;  1NHY A;  5J9C A;  3SWL A;  4TR1 B;  1TRS A;  5H5S A;  1H75 A;  4E8H A;  3DYR A;  5KOW A;  3K8N A;  5IMD A;  1XIY A;  3RBT A;  3VPT A;  3FR3 A;  8GSS A;  1T7P B;  4AJ8 A;  3QOU A;  2KLX A;  1XW5 A;  1YEP A;  1A2L A;  4OFM A;  1TP9 A;  1MEK A;  1SL2 B;  4RQR A;  1Z5Y E;  2Z9S A;  3EMP A;  3IPZ A;  1AUC A;  1TDI A;  4Q5Q A;  4OCE A;  7GSS A;  5A4V A;  1M2D A;  1ZYE A;  1V57 A;  1TI1 A;  2HYX A;  4BIK A;  2CAQ A;  1M9A A;  22GS A;  5ECN B;  3RHC A;  1JZW A;  1R5A A;  5B8A A;  4LL4 B;  2UZ8 A;  4EVM A;  2R6K A;  1ML6 A;  1YQ1 A;  4TRX A;  2O87 A;  3L9S A;  4ZXG A;  3L9U A;  3TOU A;  4BVX A;  1TW9 A;  4O5U A;  4V2L A;  5IO0 A;  4ZB8 A;  3ZIT A;  1GP1 A;  1PX7 A;  4Q5F A;  1ERW A;  3J7Y k;  5G1K A;  4KW6 A;  1THX A;  1BG5 A;  1XPV A;  1PKZ A;  2BJX A;  2BTO T;  3L4N A;  3L9V A;  5KN3 A;  1U88 A;  4IKH A;  4MNN A;  5ID2 B;  1PD2 1;  1K3Y A;  4JZQ A;  3LW9 A;  3A5I A;  1U3A A;  4AJ6 A;  4MH3 A;  2HLS A;  2YWO A;  5D8I A;  3GL5 A;  2X49 A;  1GSD A;  3BD2 A;  5IOX A;  1OC3 A;  3C8E A;  3DD3 A;  2C3N A;  4N0V A;  2VCX A;  3FMW A;  5LD0 A;  4CW9 A;  4MZB A;  3LJR A;  4MH2 A;  1Q98 A;  2H8L A;  3HA9 A;  1F37 A;  3QAG A;  1YY7 A;  4NV5 A;  1ERV A;  2LQQ A;  2L5O A;  3F3R A;  3H1N A;  3MSZ A;  3TJB A;  2WZ9 A;  1QUW A;  1YJ6 A;  4BL7 A;  4YH2 A;  5GAP D;  5GSS A;  2C0D A;  2PGT A;  4BVY A;  2MZC A;  3TCO A;  3HJM A;  1GUL A;  1GNW A;  2FGX A;  2GGT A;  4CY6 A;  4EC0 A;  2L4C A;  3FY7 A;  1TXX A;  5ENU A;  1YKA A;  3FZA A;  2OBI A;  2O8V B;  3ZLP A;  2JAD A;  2OE1 A;  4TR4 A;  3C1S A;  3TKQ A;  5IMA A;  3ZVJ D;  2E0Q A;  4ZB6 A;  2C0E A;  3M3M A;  1K0B A;  4TR1 A;  1OE7 A;  2YN1 A;  1IYH A;  3SBC A;  2PPT A;  1B4Q A;  2DC5 A;  2DJK A;  2XPD A;  4Q5N A;  1SJ6 A;  4ULX A;  2H0H A;  4ECC A;  4NPB A;  3DKS A;  2JZR A;  5KOX A;  4MLY A;  1PKW A;  3IXR A;  4ZL7 A;  2H0I A;  3TKS E;  1XWC A;  2LKU A;  2V1M A;  2LST A;  2VIM A;  3GKN A;  3ZRE A;  2XBQ A;  1GTB A;  4GSN A;  5ECO B;  1AQX A;  2WJU A;  2GZY A;  4DSR A;  5AGY A;  1TTZ A;  1Q4J A;  3VI7 A;  4J57 E;  4HUA A;  4G0I A;  3DWV A;  2HFD A;  4MF6 A;  4Z7X A;  2CQ9 A;  3QD9 A;  4PQH A;  4BA7 A;  4USS A;  1EOH A;  1YKC A;  1FVK A;  2ON7 A;  4XTS A;  1LBK A;  4MMM A;  1WP0 A;  4IQA A;  4EO3 A;  3ZMK A;  2OE3 A;  3KH7 A;  5IIZ A;  1SK1 A;  2TIR A;  6GSV A;  3KGK A;  5ELA A;  4OO4 A;  3HDC A;  4TN8 A;  1GNE A;  1PMT A;  5DDL A;  2FWE A;  1ZYP A;  3HD5 A;  3GH9 A;  10GS A;  1SKS B;  2R0P A;  1RW1 A;  2AAW A;  2VM2 A;  2ZNM A;  4YQM A;  3U6V A;  4KE3 A;  5D93 A;  2TRC P;  3ZZX A;  4AF2 A;  4X4J A;  1ON4 A;  4IBP A;  1OE8 A;  2YWM A;  1K3O A;  4EDZ A;  4RI7 A;  3IHQ A;  3ME8 A;  3UJ1 A;  4GXZ A;  1AQV A;  4V1A p;  2NPB A;  4HZ4 A;  1PSQ A;  3QFA C;  2FNO A;  1K0D A;  4MCU A;  2A4V A;  3ZIJ A;  1BYE A;  3C73 A;  3PH9 A;  3G7I A;  2DJ0 A;  4V1A g;  1VRS D;  3CYN A;  3KIJ A;  3IK9 A;  2MMO A;  3RAZ A;  4D73 B;  1J08 A;  3TRQ A;  4HJ2 A;  2JSY A;  4MPG A;  4DEJ A;  5KN1 A;  4IN0 A;  2LJA A;  1B48 A;  1ZGN A;  5J3R A;  1AC1 A;  2YWN A;  2F9S A;  4TXO B;  2DSA A;  1URM A;  2FWH A;  3GUS A;  2AUV A;  4KND A;  4L0W A;  1BED A;  1XVW A;  1G7O A;  4O5R A;  3RPN A;  4WF5 A;  2FA4 A;  4WR4 A;  5GAN D;  4I5Q A;  1SJI A;  5CRD A;  2R4V A;  1GTU A;  2DJJ A;  3HY2 A;  2V2G A;  4XS4 B;  4ILF A;  5DBQ A;  2PU9 C;  1QMV A;  4MPF A;  2RUF A;  4IVF A;  5IM9 A;  4YAV A;  1YF0 A;  1XWA A;  5ABR A;  3F4S A;  1AAZ A;  1GLQ A;  5J4U A;  2R3X A;  4PQ1 A;  2LJK A;  4HDE A;  1FVJ A;  2NTO A;  2J9H A;  1SYR A;  4HZ2 A;  2PN8 A;  2YJH A;  1WJK A;  3F4T A;  5EL8 A;  5F07 A;  3L78 A;  5AIV A;  5DQY A;  1TKD B;  2KOK A;  2CVB A;  1WOU A;  3Q19 A;  3GH6 A;  3D21 A;  1I5G A;  3IC8 A;  5G5E A;  3CSJ A;  2FCH A;  4KDY A;  3ERF A;  2PMT A;  1UVZ A;  4OWY A;  2R37 A;  13GS A;  1TK8 B;  1JZR A;  3O3T A;  3ED3 A;  2FWG A;  3QPM A;  4WBJ A;  2VL2 C;  5G30 A;  2QSI A;  1M9B A;  5HR3 A;  1V58 A;  1JLW A;  4FYU A;  2B5E A;  3MIX A;  1B9X C;  1GWC A;  1ST9 A;  3C1R A;  2X8G A;  1RK4 A;  5DVB A;  1E6B A;  3HJO A;  5ECL B;  3UVH A;  4ML6 A;  2V32 A;  3VI5 A;  5J41 A;  2QGV A;  2I3Y A;  3FR9 A;  3EU4 A;  3M9J A;  2X8H A;  1AQW A;  1O81 A;  4IW9 A;  1ABA A;  3KEB A;  4O32 A;  5F8B A;  3LOR A;  3A5W A;  3UL3 A;  3S9F A;  1EEM A;  5G31 A;  3GFK A;  3C71 A;  3TDG A;  2R5G A;  2A2S A;  4L8E A;  3EYT A;  4D73 A;  3H4K A;  3UMA A;  2A2P A;  5IO2 A;  1Z9H A;  1GUM A;  2YCD A;  2B5Y A;  2H74 A;  2REM A;  3IAS 2;  5DAL A;  1O7U A;  4X0X A;  3HVN A;  3UOM A;  3IDV A;  4XCS A;  1M0U A;  1KEB A;  3V1W A;  4OFN A;  1VF1 A;  4K7N A;  4OMV A;  2PER A;  4K2D A;  1FO5 A;  3IBH A;  1W89 A;  3PPU A;  2CVD A;  2M72 A;  2CX3 A;  4O7H A;  4HOJ A;  2VCQ A;  3RDW A;  3Q74 A;  1THO A;  2OAC A;  2JAC A;  5LCZ A;  2ZUP A;  5ECQ B;  2FUG 2;  4XS4 A;  5F05 A;  2IMK A;  11GS A;  3F6F A;  4P3Y B;  3MYD A;  2F51 A;  2L6C A;  3GX8 A;  3CQF A;  1UC7 A;  1KBN A;  1T1V A;  6GSY A;  3GL3 A;  4TR3 A;  2IMI A;  3TB2 A;  1VGL A;  4FIW A;  5H5R A;  3GX0 A;  2N5F A;  3F6D A;  2AHE A;  1HQO A;  4I2T A;  3DEX A;  3EUR A;  1DBY A;  1ZZY A;  5AIS A;  1JZO A;  3C7M A;  2B7K A;  1WMJ A;  4KDX A;  1AW9 A;  2O7K A;  4EIQ A;  4F9Z A;  4PUR A;  5IPH A;  2GZP A;  3CSI A;  2V6O A;  1K3L A;  3PR8 A;  3F3Q A;  4JU5 A;  1GUK A;  5D96 A;  2C4J A;  1GSU A;  1GL8 A;  4N10 A;  5J5N A;  4YKF A;  5HR2 A;  2JU5 A;  5CNW A;  2GZZ A;  1A0R P;  1QK8 A;  1HNB A;  1NM3 A;  2KP1 A;  4RUV A;  4AGS A;  4OO5 A;  2H30 A;  2D2Z A;  2MYG A;  5HR1 A;  2YAN A;  1EGR A;  3LGC A;  2L5L A;  3GRX A;  4TR0 A;  3PIN A;  2K18 A;  2WGR A;  3VUR A;  3APO A;  2K8S A;  3WYW A;  4HU9 A;  1DE1 A;  3A2X A;  2GQK A;  5G5F A;  1X9M B;  2H01 A;  1XXU A;  5HFK A;  2HT9 A;  1OC9 B;  2WDU A;  3BJ5 A;  4WEY A;  5GST A;  4PXO A;  2I9H A;  1VF3 A;  1R4W A;  3IHG A;  5ECP B;  4PNG A;  3GIX A;  2G2Q A;  1LJR A;  2LEG A;  2J23 A;  20GS A;  4MZW A;  2LNT A;  1ZL9 A;  4K5R A;  3I9V 2;  3KP9 A;  2V6K A;  3EMX A;  1M3J A;  4EF0 A;  1GTI A;  3F63 A;  2F3M A;  3ME7 A;  1YZX A;  2R2J A;  2HSM A;  3HVS A;  1XWB A;  4FYB A;  2XPE A;  3ZFL A;  2DKI A;  4I6X A;  3KCM A;  3HXS A;  2LRN A;  4GTU A;  5JWR B;  3JCM L;  5KN0 A;  6GSW A;  1T00 A;  2B6M A;  1K0C A;  4PQI A;  5CO3 A;  1DE2 A;  3TKP A;  2FY6 A;  4XIH A;  1MD3 A;  3APS A;  4KCA A;  2ON5 A;  3TKS C;  4MZC A;  4A5P A;  4WF4 A;  3TJG A;  2DJ1 A;  3VPQ A;  5DAK B;  1I9D A;  3G7J A;  2E2G A;  2L4Q A;  4YKG A;  2AJQ B;  2R0G A;  5C00 A;  1A2M A;  1HYU A;  4WXT A;  4IJ3 A;  2M46 A;  1X5D A;  2DLX A;  3VLN A;  4IHU A;  4POK A;  3D6I A;  4GLT A;  2H72 A;  1QQ2 A;  19GS A;  4ZBA A;  4G9H A;  3ERG A;  5JWO B;  3IC4 A;  2LV3 A;  5IMF A;  4G19 A;  2YOI A;  1PN0 A;  3CRT A;  4EE0 A;  2AB6 A;  4FH8 A;  3ZML A;  3ZRD A;  1WPI A;  2YV9 A;  2GSQ A;  3HCZ A;  2TRX A;  1QFN A;  1GH2 A;  2VD1 A;  3UVT A;  2YZH A;  4TVE A;  1FB6 A;  1U3I A;  5D9X A;  2CV4 A;  1GSE A;  5COH A;  1GTA A;  4G2E A;  4XS1 A;  4O5Q A;  2P5Q A;  4POL A;  4LL1 B;  4PGT A;  2P0G A;  2H19 A;  2VO4 A;  2IWT A;  3D0Z A;  4PUF C;  1JZD A;  2PBJ A;  2MBS A;  1Y25 A;  4H86 A;  4KCE A;  4NHW A;  4K7I A;  1FB0 A;  2FLS A;  4F0B A;  5ID2 A;  4N30 A;  5ECI B;  2C0G A;  4IJI A;  2A2R A;  2GSS A;  2IN3 A;  4ICY A;  1M99 A;  4EKZ A;  5G2Z A;  5CRG A;  1PQN A;  2WCI A;  2G0F A;  2GS3 A;  5C04 A;  1Z6M A;  4V2N A;  4K1F A;  4MJE A;  3GA4 A;  4BL7 B;  1FOH A;  5F06 A;  3I69 A;  3GHA A;  4ZL8 A;  1SYX A;  3APQ A;  4BPY A;  1V40 A;  2HZE B;  3P90 A;  2EIR A;  2H73 A;  4MJC A;  1B8X A;  3GUR A;  3HJP A;  3VK9 A;  3FZ5 A;  1MDJ A;  2YJ7 A;  1S3A A;  1O8W A;  1Y6E A;  5ECS A;  3F0I A;  4OD7 A;  2GST A;  1TU7 A;  5CRE A;  3ZIV A;  4HQS A;  4JED A;  2EIO A;  1OAZ A;  2I81 A;  2YPM A;  2IJY A;  1USB A;  5CRH A;  3HHV A;  1PX6 A;  2JL4 A;  2WUL A;  1S3R A;  4G10 A;  3CTF A;  1A0F A;  1EOG A;  1V2A A;  2B1L A;  4JE1 A;  1LU4 A;  1QGV A;  4ZB9 A;  4PTS A;  5GZZ B;  3W8J A;  3IA1 A;  1X5C A;  3MWH A;  4K5S A;  1TRW A;  3N9J A;  3FR6 A;  3IRA A;  4DSQ A;  3VWW A;  2FHE A;  1HNC A;  3RPP A;  1K0M A;  3DVX A;  1AXD A;  1VF4 A;  1NSW A;  5DCG A;  2JSZ A;  1M7T A;  2LTK A;  1GRX A;  5B8B A;  2X99 A;  1SD9 A;  2H1A A;  3D5J A;  2C0F A;  4K0G A;  4YQU A;  3QMX A;  4KF9 A;  1EEJ A;  4K7O A;  4EXJ A;  2ALB A;  6GSU A;  1GLP A;  3MDK A;  3HZ4 A;  4NWY A;  2LRC A;  1FW1 A;  2YV7 A;  1G7E A;  3WGX A;  1T4Y A;  1U87 A;  3WGD A;  4XS6 A;  2MMN A;  5JWQ B;  4TW5 A;  3EC3 A;  3WT2 A;  3TKR A;  5FHI A;  3WT1 A;  4I8B A;  1V98 A;  2IFQ B;  2VL3 A;  2PVQ A;  2VL9 A;  1R7H A;  1SU9 A;  1OKT A;  2PUK C;  2HRK A;  5ECM B;  4NMU A;  3LFL A;  3TOT A;  1X5E A;  5KN2 A;  2DMM A;  4TOP A;  1EP8 A;  1NW2 A;  1ERU A;  4JBB A;  4G0L A;  1H4O A;  3FHK A;  3GKK A;  1SL0 B;  1CQG A;  3GKM A;  6GST A;  1G6W A;  5DCH A;  1F3A A;  5ECR B;  5D9T A;  4IEL A;  2HZE A;  3D4T A;  4JR4 A;  2VCT A;  3I43 A;  4PX1 A;  5CP1 A;  4LLR A;  3VWU A;  2R0C A;  1FAA A;  3GKX A;  1JHB A;  5AN1 A;  3N5O A;  3F4R A;  1SKW B;  2KHP A;  3P2A A;  1ERT A;  3EU3 A;  3BBY A;  4TXO A;  5CRW A;  5AIX A;  1J9B A;  2CT6 A;  4KGI A;  1XWG A;  3BOA A;  4IGJ A;  1MDK A;  2VLU A;  4HI7 A;  3J7Y b;  2M80 A;  2I1U A;  2JZS A;  1T8E B;  1VF2 A;  2VCW A;  3R2Q A;  1AIU A;  3M0F A;  4J56 E;  3ISO A;  2N5B A;  4XRD A;  2RUE A;  1B4P A;  4HU7 A;  3A2W A;  5ELG A;  5ECK B;  3FYG A;  2C3Q A;  2YNX A;  2LNS A;  3ZVJ A;  1XW6 A;  5H5Q A;  3KJY A;  3KH9 A;  3A2V A;  2IME A;  3FZ9 A;  3Q18 A;  1O85 A; 
#chains in the Genus database with same CATH homology
 2H1D A;  3ZTL A;  3FKF A;  4FYC A;  1G0T A;  1PN9 A;  5IMC A;  4IP1 A;  1V9W A;  1PA3 A;  3MAK A;  4IQ1 A;  2O85 A;  5EY6 A;  2K8V A;  3IV4 A;  2IL3 A;  2DML A;  3TJJ A;  2IMF A;  3WD6 A;  4RI6 A;  1T4Z A;  4JRR A;  2OBK A;  4KSM A;  3HZ8 A;  2K6V A;  1TK0 B;  4CDO A;  1MTC A;  1YF1 A;  2H6Y A;  3GTU B;  2IFQ A;  4K8M A;  1OYJ A;  2O89 A;  3W6G A;  3UAR A;  1ZCP A;  5EVO A;  3DIE A;  3IOS A;  2H70 A;  3E9J B;  1PGT A;  2DIZ A;  1TJD A;  4E8E A;  5A4W A;  3TJF A;  4FQU A;  2V41 A;  1XBS A;  3KXO A;  1J0F A;  4GSS A;  2PVO C;  2CVK A;  1XOB A;  3AY8 A;  1KTE A;  4G0K A;  3UBK A;  4ECI A;  1S3C A;  3PGT A;  1K0A A;  4MJB A;  2QA2 A;  2HRN A;  2H6X A;  3TGZ A;  2XHF A;  2EC4 A;  4ZL9 A;  3O76 A;  4K2X A;  5IMV A;  4MF7 A;  4MAB A;  2H75 A;  3KMO A;  4K6X A;  4ML1 A;  3H8Q A;  5CYY A;  1BJX A;  1FOV A;  4OFT A;  4MDC A;  1FG4 A;  2DKH A;  2F8A A;  1M2B A;  2H76 A;  2HRA A;  4Q5R A;  3GNJ A;  1O73 A;  2NDO A;  5FWG A;  4WR5 A;  2VL2 A;  5D73 A;  1XZO A;  2B3S A;  2OA7 A;  3US3 A;  5DJM A;  1JLV A;  3O6T A;  1XW9 A;  1X0R A;  1Z7R A;  1EWX A;  2H6Z A;  4ACS A;  5HFI A;  4EL1 A;  2A4H A;  1XOA A;  1X9W B;  1O6J A;  2EIQ A;  1EGO A;  2FD3 A;  1SEN A;  1UN2 A;  1KNG A;  4Z2T A;  1ZYN A;  5JCG A;  4XRA A;  1XCC A;  2CZ3 A;  3EIN A;  1ZYQ B;  3BCK A;  1Z6N A;  2L6D A;  4L5L A;  3R3E A;  3DRN A;  5KEJ A;  4TXV A;  2HI7 A;  3I6A A;  5IPG A;  3LQ7 A;  1K0O A;  3FEU A;  2AYT A;  4FO5 A;  5D9V A;  4J2F A;  3QAV A;  1YEX A;  1ILO A;  4POM A;  1SL1 B;  4I2U A;  5FT3 A;  4DSS B;  4Z2U A;  4BWS A;  2H1B A;  3FW2 A;  2I4A A;  2VCZ A;  1GSQ A;  2BMX A;  5E4W A;  3GSS A;  3TUE A;  4ISD A;  3EWL A;  2VD0 A;  1W4V A;  4EUY A;  5B6N A;  1WWJ A;  3NOF A;  3F8U A;  4XHM A;  1B9Y C;  2MBT A;  2XC2 A;  3H79 A;  1E2Y A;  2VLT A;  2NBS A;  2WS2 A;  1HNA A;  2YZU A;  5JCU A;  3GTU A;  3F9U A;  3G7Y A;  3LYK A;  3LG6 A;  17GS A;  3IR4 A;  2P5R A;  3TRX A;  2VUP A;  2YWI A;  5IMZ A;  5F0G A;  1NHO A;  18GS A;  3E0U A;  2K9F A;  2RLI A;  1EV4 A;  3KP8 A;  2AV4 A;  3NIV A;  1GSS A;  1F2E A;  1RQM A;  2OE0 A;  4KSO A;  2HSY A;  2H0G A;  2GQL A;  4ECB A;  3ZL5 A;  5DJL A;  4GF0 A;  2YP6 A;  2H66 A;  1OC9 A;  1CQH A;  2H71 A;  3FZ4 A;  1ZMA A;  1GSF A;  4NAX A;  4KX4 A;  1BX9 A;  4HS1 A;  4F0C A;  1F6M C;  5CAX A;  3VWV A;  3UAP A;  4PUA A;  2LRT A;  3LYP A;  1K0N A;  5BRT A;  2GSR A;  4KDU A;  2QKE A;  4KH7 A;  3KD0 A;  2HXK A;  2L59 A;  4K0N A;  1A23 A;  2DJ2 A;  2CA8 A;  3P8W A;  1O8X A;  3ZYW A;  1F9M A;  2LS5 A;  3BCI A;  2X8C A;  4MP4 A;  1TI3 A;  3LXZ A;  1XFL A;  5E59 A;  2QC7 A;  4F03 A;  1EV9 A;  4OCF A;  3CTG A;  3D4M A;  3KMN A;  3QFB C;  1ACV A;  3EE2 A;  5IOW A;  4JR6 A;  1TOF A;  5HFG A;  4MJA A;  4PNF A;  1F3B A;  2L57 A;  5DQS A;  3UBL A;  1DUG A;  1FHE A;  3LSZ A;  1TRU A;  1MDI A;  3E3E A;  3OR5 A;  4LMV A;  2PWJ A;  2CZ2 A;  2MMA A;  3KTB A;  2OJL A;  3MNG A;  5DAK A;  5HR0 A;  5ECH B;  1R26 A;  2KUC A;  3HKR A;  2N5A A;  3QAW A;  2GDR A;  4QQ7 A;  4DSS A;  16GS A;  1SKR B;  2MMZ A;  4EIP A;  1TU8 A;  2GT6 A;  3GYK A;  5A4U A;  2IPA A;  3GV1 A;  1N2A A;  2CX4 A;  3U5R E;  4YAP A;  2GLR A;  4KA0 A;  5DAL B;  4CY8 A;  2C1Y A;  3M8N A;  3QCP A;  2HSH A;  2WB9 A;  1XVQ A;  3W8S A;  2GQM A;  1A8L A;  1SK2 A;  9GSS A;  1SK0 A;  4KAE A;  1TK5 B;  4F82 A;  4V2M A;  3CMI A;  5JCW A;  2NVL A;  3HVX A;  3L0H A;  4N11 A;  4MA9 A;  1OC8 A;  3DVW A;  2C8U A;  5B7C A;  4YQV A;  1WRY A;  4X43 A;  4NV2 A;  4QL9 A;  1SJZ A;  1N8J A;  2B5X A;  4WBR D;  3UIW A;  1BAY A;  5G1L A;  3VFI A;  1G6Y A;  5D9W A;  3FRC A;  4POB A;  3WGE A;  3GMF A;  2OAD A;  2FA8 A;  3TKS A;  4QL7 A;  1R5P A;  2KP2 A;  3D22 A;  1DSB A;  1PL2 A;  1WE0 A;  2H1G A;  1JFU A;  2HE3 A;  4K9Z A;  1GUH A;  2LUS A;  2X4A A;  4X1U A;  4DVC A;  3NZN A;  3EPT A;  3KTL A;  1PL1 A;  2HNL A;  4L5O A;  5HQP A;  1OKD A;  14GS A;  3ZFB A;  3KM6 A;  4NHZ A;  2XBI A;  5B6M A;  5J9B A;  4WKW A;  1PRX A;  5A5K A;  2FWF A;  4AJ7 A;  1GSY A;  1OVN A;  3DML A;  3FK8 A;  2E7P A;  4IP6 A;  4NXI A;  5L71 A;  4GQF A;  2WRT A;  2WFC A;  3IE3 A;  2RII A;  4Z2R A;  1BQ7 A;  6GSS A;  3TJK A;  2LJR A;  3LEF A;  3DGQ A;  3M1G A;  4ID0 A;  2HZF A;  3DXB A;  4N0Z A;  3IAM 2;  3CRU A;  1XWK A;  3KZQ A;  1EZK A;  2VM1 A;  3P7X A;  2GT5 A;  2DIY A;  2OKA A;  4MF5 A;  1TRV A;  5LNK e;  2E2M A;  2VCV A;  4BVX B;  1X9S B;  2X64 A;  3CSH A;  4F2I A;  4GST A;  2JZT A;  3EVI A;  3GN3 A;  1A2J A;  4ZIJ A;  2F8F A;  1EP7 A;  2DJ3 A;  4I97 A;  2GVP A;  4LMW A;  4O92 A;  2IMD A;  3RHB A;  2CAI A;  3M9K A;  4ZBD A;  1UA5 A;  1T3B A;  2RM5 A;  3CBU A;  2ES7 A;  3TRP A;  2VLV A;  4LA1 A;  4L0U A;  3CXG A;  1QXH A;  3G9B A;  4ZBB A;  2DBC A;  2B1K A;  3GST A;  4MK3 A;  2C80 A;  1Z3E A;  4CHS A;  1ZOF A;  3A3T A;  2C3T A;  4KB3 A;  1HD2 A;  4HEA 2;  1SD8 A;  1WIK A;  4GQC A;  2LQO A;  1A24 A;  4RQX A;  2VOC A;  3H93 A;  3HYP A;  4GWR A;  2VAF A;  1S3D A;  3QR6 A;  3HVV A;  1Z7P A;  3ERW A;  2GTU A;  2QA1 A;  2ZCT A;  2B7J A;  4HQZ A;  3LWA A;  12GS A;  1M2A A;  5BMU A;  2RM6 A;  4BVY B;  4WET A;  1A8Y A;  3Q6O A;  5INY A;  6GSX A;  2HRF A;  3LXT A;  2IIY A;  4GCI A;  4GRF A;  5EPF A;  5IQY A;  1U6T A;  1C72 A;  3VWX A;  3QDN A;  1YDK A;  4BWQ A;  3UEM A;  4EDY A;  3IK7 A;  4IS0 A;  4KUN A;  2P31 A;  4HJM A;  4ZIL A;  1MD4 A;  4ECJ A;  4TKY A;  1IYI A;  1NHY A;  5J9C A;  3SWL A;  4TR1 B;  1TRS A;  5H5S A;  1H75 A;  4E8H A;  3DYR A;  5KOW A;  3K8N A;  5IMD A;  1XIY A;  3RBT A;  3VPT A;  3FR3 A;  8GSS A;  1T7P B;  4AJ8 A;  3QOU A;  2KLX A;  1XW5 A;  1YEP A;  1A2L A;  4OFM A;  1TP9 A;  1MEK A;  1SL2 B;  4RQR A;  1Z5Y E;  2Z9S A;  3EMP A;  3IPZ A;  1AUC A;  1TDI A;  4Q5Q A;  4OCE A;  7GSS A;  5A4V A;  1M2D A;  1ZYE A;  1V57 A;  1TI1 A;  2HYX A;  2CAQ A;  1M9A A;  22GS A;  5ECN B;  3RHC A;  1JZW A;  1R5A A;  5B8A A;  4LL4 B;  2UZ8 A;  4EVM A;  2R6K A;  1ML6 A;  1YQ1 A;  4TRX A;  2O87 A;  3L9S A;  4ZXG A;  3L9U A;  3TOU A;  4BVX A;  1TW9 A;  4O5U A;  4V2L A;  5IO0 A;  4ZB8 A;  3ZIT A;  1GP1 A;  1PX7 A;  4Q5F A;  1ERW A;  3J7Y k;  5G1K A;  4KW6 A;  1THX A;  1BG5 A;  1XPV A;  1PKZ A;  2BJX A;  2BTO T;  3L4N A;  3L9V A;  5KN3 A;  1U88 A;  4IKH A;  4MNN A;  5ID2 B;  1PD2 1;  1K3Y A;  4JZQ A;  3LW9 A;  3A5I A;  1U3A A;  4AJ6 A;  4MH3 A;  2HLS A;  2YWO A;  5D8I A;  3GL5 A;  2X49 A;  1GSD A;  3BD2 A;  5IOX A;  1OC3 A;  3C8E A;  3DD3 A;  2C3N A;  4N0V A;  2VCX A;  3FMW A;  5LD0 A;  4CW9 A;  4MZB A;  3LJR A;  4MH2 A;  1Q98 A;  2H8L A;  3HA9 A;  1F37 A;  3QAG A;  1YY7 A;  4NV5 A;  1ERV A;  2LQQ A;  2L5O A;  3F3R A;  3H1N A;  3MSZ A;  3TJB A;  2WZ9 A;  1QUW A;  1YJ6 A;  4BL7 A;  4YH2 A;  5GAP D;  5GSS A;  2C0D A;  2PGT A;  4BVY A;  2MZC A;  3TCO A;  3HJM A;  1GUL A;  1GNW A;  2FGX A;  2GGT A;  4CY6 A;  4EC0 A;  2L4C A;  3FY7 A;  1TXX A;  5ENU A;  1YKA A;  3FZA A;  2OBI A;  2O8V B;  3ZLP A;  2JAD A;  2OE1 A;  4TR4 A;  3C1S A;  3TKQ A;  5IMA A;  3ZVJ D;  2E0Q A;  4ZB6 A;  2C0E A;  3M3M A;  1K0B A;  4TR1 A;  1OE7 A;  2YN1 A;  1IYH A;  3SBC A;  2PPT A;  1B4Q A;  2DC5 A;  2DJK A;  2XPD A;  4Q5N A;  1SJ6 A;  4ULX A;  2H0H A;  4ECC A;  4NPB A;  3DKS A;  2JZR A;  5KOX A;  4MLY A;  1PKW A;  3IXR A;  4ZL7 A;  2H0I A;  3TKS E;  1XWC A;  2LKU A;  2V1M A;  2LST A;  2VIM A;  3GKN A;  3ZRE A;  2XBQ A;  1GTB A;  4GSN A;  5ECO B;  1AQX A;  2WJU A;  2GZY A;  4DSR A;  5AGY A;  1TTZ A;  1Q4J A;  3VI7 A;  4J57 E;  4HUA A;  4G0I A;  3DWV A;  2HFD A;  4MF6 A;  4Z7X A;  2CQ9 A;  3QD9 A;  4PQH A;  4BA7 A;  4USS A;  1EOH A;  1YKC A;  1FVK A;  2ON7 A;  4XTS A;  1LBK A;  4MMM A;  1WP0 A;  4IQA A;  4EO3 A;  3ZMK A;  2OE3 A;  3KH7 A;  5IIZ A;  1SK1 A;  2TIR A;  6GSV A;  3KGK A;  5ELA A;  4OO4 A;  3HDC A;  4TN8 A;  1GNE A;  1PMT A;  5DDL A;  2FWE A;  1ZYP A;  3HD5 A;  3GH9 A;  10GS A;  1SKS B;  2R0P A;  1RW1 A;  2AAW A;  2VM2 A;  2ZNM A;  4YQM A;  3U6V A;  4KE3 A;  5D93 A;  2TRC P;  3ZZX A;  4AF2 A;  4X4J A;  1ON4 A;  4IBP A;  1OE8 A;  2YWM A;  1K3O A;  4EDZ A;  4RI7 A;  3IHQ A;  3ME8 A;  3UJ1 A;  4GXZ A;  1AQV A;  4V1A p;  2NPB A;  4HZ4 A;  1PSQ A;  3QFA C;  2FNO A;  1K0D A;  4MCU A;  2A4V A;  3ZIJ A;  1BYE A;  3C73 A;  3PH9 A;  3G7I A;  2DJ0 A;  4V1A g;  1VRS D;  3CYN A;  3KIJ A;  3IK9 A;  2MMO A;  3RAZ A;  4D73 B;  1J08 A;  3TRQ A;  4HJ2 A;  2JSY A;  4MPG A;  4DEJ A;  5KN1 A;  4IN0 A;  2LJA A;  1B48 A;  1ZGN A;  5J3R A;  1AC1 A;  2YWN A;  2F9S A;  4TXO B;  2DSA A;  1URM A;  2FWH A;  3GUS A;  2AUV A;  4KND A;  4L0W A;  1BED A;  1XVW A;  1G7O A;  4O5R A;  3RPN A;  4WF5 A;  2FA4 A;  4WR4 A;  5GAN D;  4I5Q A;  1SJI A;  5CRD A;  2R4V A;  1GTU A;  2DJJ A;  3HY2 A;  2V2G A;  4XS4 B;  4ILF A;  5DBQ A;  2PU9 C;  1QMV A;  4MPF A;  2RUF A;  4IVF A;  5IM9 A;  4YAV A;  1YF0 A;  1XWA A;  5ABR A;  3F4S A;  1AAZ A;  1GLQ A;  5J4U A;  2R3X A;  4PQ1 A;  2LJK A;  4HDE A;  1FVJ A;  2NTO A;  2J9H A;  1SYR A;  4HZ2 A;  2PN8 A;  2YJH A;  1WJK A;  3F4T A;  5EL8 A;  5F07 A;  3L78 A;  5AIV A;  5DQY A;  1TKD B;  2KOK A;  2CVB A;  1WOU A;  3Q19 A;  3GH6 A;  3D21 A;  1I5G A;  3IC8 A;  5G5E A;  3CSJ A;  2FCH A;  4KDY A;  3ERF A;  2PMT A;  1UVZ A;  4OWY A;  2R37 A;  13GS A;  1TK8 B;  1JZR A;  3O3T A;  3ED3 A;  2FWG A;  3QPM A;  4WBJ A;  2VL2 C;  5G30 A;  2QSI A;  1M9B A;  5HR3 A;  1V58 A;  1JLW A;  4FYU A;  2B5E A;  3MIX A;  1B9X C;  1GWC A;  1ST9 A;  3C1R A;  2X8G A;  1RK4 A;  5DVB A;  1E6B A;  3HJO A;  5ECL B;  3UVH A;  4ML6 A;  2V32 A;  3VI5 A;  5J41 A;  2QGV A;  2I3Y A;  3FR9 A;  3EU4 A;  3M9J A;  2X8H A;  1AQW A;  1O81 A;  4IW9 A;  1ABA A;  3KEB A;  4O32 A;  5F8B A;  3LOR A;  3A5W A;  3UL3 A;  3S9F A;  1EEM A;  5G31 A;  3GFK A;  3C71 A;  3TDG A;  2R5G A;  2A2S A;  4L8E A;  3EYT A;  4D73 A;  3H4K A;  3UMA A;  2A2P A;  5IO2 A;  1Z9H A;  1GUM A;  2YCD A;  2B5Y A;  2H74 A;  2REM A;  3IAS 2;  5DAL A;  1O7U A;  4X0X A;  3UOM A;  3IDV A;  4XCS A;  1M0U A;  1KEB A;  3V1W A;  4OFN A;  1VF1 A;  4K7N A;  4OMV A;  2PER A;  4K2D A;  1FO5 A;  3IBH A;  1W89 A;  3PPU A;  2CVD A;  2M72 A;  2CX3 A;  4O7H A;  4HOJ A;  2VCQ A;  3RDW A;  3Q74 A;  1THO A;  2OAC A;  2JAC A;  5LCZ A;  2ZUP A;  5ECQ B;  2FUG 2;  4XS4 A;  5F05 A;  2IMK A;  11GS A;  3F6F A;  4P3Y B;  3MYD A;  2F51 A;  2L6C A;  3GX8 A;  1UC7 A;  1KBN A;  1T1V A;  6GSY A;  3GL3 A;  4TR3 A;  2IMI A;  3TB2 A;  1VGL A;  4FIW A;  5H5R A;  3GX0 A;  2N5F A;  3F6D A;  2AHE A;  1HQO A;  4I2T A;  3DEX A;  3EUR A;  1DBY A;  1ZZY A;  5AIS A;  1JZO A;  3C7M A;  2B7K A;  1WMJ A;  4KDX A;  1AW9 A;  2O7K A;  4EIQ A;  4F9Z A;  4PUR A;  5IPH A;  2GZP A;  3CSI A;  2V6O A;  1K3L A;  3PR8 A;  3F3Q A;  4JU5 A;  1GUK A;  5D96 A;  2C4J A;  1GSU A;  1GL8 A;  4N10 A;  5J5N A;  4YKF A;  5HR2 A;  2JU5 A;  5CNW A;  2GZZ A;  1A0R P;  1QK8 A;  1HNB A;  1NM3 A;  2KP1 A;  4RUV A;  4AGS A;  4OO5 A;  2H30 A;  2D2Z A;  2MYG A;  5HR1 A;  2YAN A;  1EGR A;  3LGC A;  2L5L A;  3GRX A;  4TR0 A;  3PIN A;  2K18 A;  2WGR A;  3VUR A;  3APO A;  2K8S A;  3WYW A;  4HU9 A;  1DE1 A;  3A2X A;  2GQK A;  5G5F A;  1X9M B;  2H01 A;  1XXU A;  5HFK A;  2HT9 A;  1OC9 B;  2WDU A;  3BJ5 A;  4WEY A;  5GST A;  4PXO A;  2I9H A;  1VF3 A;  1R4W A;  3IHG A;  5ECP B;  4PNG A;  3GIX A;  2G2Q A;  1LJR A;  2LEG A;  2J23 A;  20GS A;  4MZW A;  2LNT A;  1ZL9 A;  4K5R A;  3I9V 2;  3KP9 A;  2V6K A;  3EMX A;  4EF0 A;  1GTI A;  3F63 A;  2F3M A;  3ME7 A;  1YZX A;  2R2J A;  2HSM A;  3HVS A;  1XWB A;  4FYB A;  2XPE A;  3ZFL A;  2DKI A;  4I6X A;  3KCM A;  3HXS A;  2LRN A;  4GTU A;  5JWR B;  3JCM L;  5KN0 A;  6GSW A;  1T00 A;  2B6M A;  1K0C A;  4PQI A;  5CO3 A;  1DE2 A;  3TKP A;  2FY6 A;  4XIH A;  1MD3 A;  3APS A;  4KCA A;  2ON5 A;  3TKS C;  4MZC A;  4A5P A;  4WF4 A;  3TJG A;  2DJ1 A;  3VPQ A;  5DAK B;  1I9D A;  3G7J A;  2E2G A;  2L4Q A;  4YKG A;  2AJQ B;  2R0G A;  5C00 A;  1A2M A;  1HYU A;  4WXT A;  4IJ3 A;  2M46 A;  1X5D A;  2DLX A;  3VLN A;  4IHU A;  4POK A;  3D6I A;  4GLT A;  2H72 A;  1QQ2 A;  19GS A;  4ZBA A;  4G9H A;  3ERG A;  5JWO B;  3IC4 A;  2LV3 A;  5IMF A;  4G19 A;  2YOI A;  1PN0 A;  3CRT A;  4EE0 A;  2AB6 A;  4FH8 A;  3ZML A;  3ZRD A;  1WPI A;  2YV9 A;  2GSQ A;  3HCZ A;  2TRX A;  1QFN A;  1GH2 A;  2VD1 A;  3UVT A;  2YZH A;  4TVE A;  1FB6 A;  1U3I A;  5D9X A;  2CV4 A;  1GSE A;  5COH A;  1GTA A;  4G2E A;  4XS1 A;  4O5Q A;  2P5Q A;  4POL A;  4LL1 B;  4PGT A;  2P0G A;  2H19 A;  2VO4 A;  2IWT A;  3D0Z A;  4PUF C;  1JZD A;  2PBJ A;  2MBS A;  1Y25 A;  4H86 A;  4KCE A;  4NHW A;  4K7I A;  1FB0 A;  2FLS A;  4F0B A;  5ID2 A;  4N30 A;  5ECI B;  2C0G A;  4IJI A;  2A2R A;  2GSS A;  2IN3 A;  4ICY A;  1M99 A;  4EKZ A;  5G2Z A;  5CRG A;  1PQN A;  2WCI A;  2G0F A;  2GS3 A;  5C04 A;  1Z6M A;  4V2N A;  4K1F A;  4MJE A;  3GA4 A;  4BL7 B;  1FOH A;  5F06 A;  3I69 A;  3GHA A;  4ZL8 A;  1SYX A;  3APQ A;  4BPY A;  1V40 A;  2HZE B;  3P90 A;  2EIR A;  2H73 A;  4MJC A;  1B8X A;  3GUR A;  3HJP A;  3VK9 A;  3FZ5 A;  1MDJ A;  2YJ7 A;  1S3A A;  1O8W A;  1Y6E A;  5ECS A;  3F0I A;  4OD7 A;  2GST A;  1TU7 A;  5CRE A;  3ZIV A;  4HQS A;  4JED A;  2EIO A;  1OAZ A;  2I81 A;  2YPM A;  2IJY A;  1USB A;  5CRH A;  3HHV A;  1PX6 A;  2JL4 A;  2WUL A;  4G10 A;  3CTF A;  1A0F A;  1EOG A;  1V2A A;  2B1L A;  4JE1 A;  1LU4 A;  1QGV A;  4ZB9 A;  4PTS A;  5GZZ B;  3W8J A;  3IA1 A;  1X5C A;  3MWH A;  4K5S A;  1TRW A;  3N9J A;  3FR6 A;  3IRA A;  4DSQ A;  3VWW A;  2FHE A;  1HNC A;  3RPP A;  1K0M A;  3DVX A;  1AXD A;  1VF4 A;  1NSW A;  5DCG A;  2JSZ A;  1M7T A;  2LTK A;  1GRX A;  5B8B A;  2X99 A;  1SD9 A;  2H1A A;  3D5J A;  2C0F A;  4K0G A;  4YQU A;  3QMX A;  4KF9 A;  1EEJ A;  4K7O A;  4EXJ A;  2ALB A;  6GSU A;  1GLP A;  3MDK A;  3HZ4 A;  4NWY A;  2LRC A;  1FW1 A;  2YV7 A;  1G7E A;  3WGX A;  1T4Y A;  1U87 A;  3WGD A;  4XS6 A;  2MMN A;  5JWQ B;  4TW5 A;  3EC3 A;  3WT2 A;  3TKR A;  5FHI A;  3WT1 A;  4I8B A;  1V98 A;  2IFQ B;  2VL3 A;  2PVQ A;  2VL9 A;  1R7H A;  1SU9 A;  1OKT A;  2PUK C;  2HRK A;  5ECM B;  4NMU A;  3LFL A;  3TOT A;  1X5E A;  5KN2 A;  2DMM A;  4TOP A;  1EP8 A;  1NW2 A;  1ERU A;  4JBB A;  4G0L A;  1H4O A;  3FHK A;  3GKK A;  1SL0 B;  1CQG A;  3GKM A;  6GST A;  1G6W A;  5DCH A;  1F3A A;  5ECR B;  5D9T A;  4IEL A;  2HZE A;  3D4T A;  4JR4 A;  2VCT A;  3I43 A;  4PX1 A;  5CP1 A;  4LLR A;  3VWU A;  2R0C A;  1FAA A;  3GKX A;  1JHB A;  5AN1 A;  3N5O A;  3F4R A;  1SKW B;  2KHP A;  3P2A A;  1ERT A;  3EU3 A;  3BBY A;  4TXO A;  5CRW A;  5AIX A;  1J9B A;  2CT6 A;  4KGI A;  1XWG A;  3BOA A;  4IGJ A;  1MDK A;  2VLU A;  4HI7 A;  3J7Y b;  2M80 A;  2I1U A;  2JZS A;  1T8E B;  1VF2 A;  2VCW A;  3R2Q A;  1AIU A;  3M0F A;  4J56 E;  3ISO A;  2N5B A;  4XRD A;  2RUE A;  1B4P A;  4HU7 A;  3A2W A;  5ELG A;  5ECK B;  3FYG A;  2C3Q A;  2YNX A;  2LNS A;  3ZVJ A;  1XW6 A;  5H5Q A;  3KJY A;  3KH9 A;  3A2V A;  2IME A;  3FZ9 A;  3Q18 A;  1O85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...