2H19A

Crystal structure of resa cys77ala variant
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
138
structure length
138
Chain Sequence
SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Molecular Basis for Specificity of the Extracytoplasmic Thioredoxin ResA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 44
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2h19A00
3ZTLA 3WYWA 1G0TA 4I8BA 8GSSA 13GSA 3FHKA 4PNGA 4IBPA 4OCFA 1SL2B 3GX0A 1UC7A 4GXZA 2HSYA 2VM1A 2LNTA 3BJ5A 2ZNMA 2OA7A 3HDCA 3CTGA 2H8LA 3QR6A 1Q4JA 3N9JA 4V1Ap 3TKRA 2YWOA 2I4AA 2N5BA 4NWYA 2IJYA 2WRTA 1GLQA 4KSOA 1THXA 2LEGA 2E7PA 1XW5A 4KX4A 2B3SA 3GSSA 4P3YB 4NV5A 4K2DA 1JHBA 4DSRA 4EE0A 1GSEA 1SKRB 3IK9A 5J9CA 2O89A 3GSTA 4FH8A 4PURA 4K9ZA 3HHVA 1FVKA 5F06A 4GWRA 1FW1A 2AAWA 2YJ7A 1PL1A 2PVOC 2EIQA 1O7UA 1A23A 2FY6A 1T8EB 3QCPA 3ZREA 2PMTA 3K8NA 5ELGA 3PGTA 3Q18A 1JZRA 4TXOB 4G2EA 2ON7A 3Q74A 4IJIA 4XRAA 1XW6A 3D22A 1VF1A 5DCGA 3BCIA 3CRUA 2H0HA 4KUNA 4IHUA 1V57A 1F6MC 3GIXA 2HZEA 5ECQB 2DJKA 2HZFA 2YV7A 3A2VA 3KXOA 3TB2A 1YKAA 4RQXA 2GQKA 5GAND 4TR0A 1HNAA 4FIWA 3LGCA 1XVQA 2VM2A 3KP8A 3FKFA 5HR0A 4ZXGA 2OE0A 4MP4A 1WWJA 3RDWA 1KEBA 1KBNA 5HQPA 3E3EA 2VLTA 5F8BA 2LRTA 1GRXA 4BVXA 1SYXA 2E2MA 5AIXA 3GUSA 3E0UA 1V58A 4OMVA 3RAZA 1TU7A 3RHBA 3L4NA 2DMMA 1GH2A 3VK9A 1EEMA 5IO0A 1SJ6A 4JBBA 4MZWA 4XCSA 4WXTA 2C80A 4K7NA 4HQZA 5JWQB 1K0CA 1GL8A 3EU3A 1K3LA 4PXOA 2X8GA 3FR3A 1K0MA 4HJMA 5F05A 6GSUA 2C8UA 2VL9A 3TKQA 4BA7A 3SWLA 1Y25A 4ZILA 4MK3A 3IAM2 1X5CA 3IK7A 1AUCA 2CQ9A 2WB9A 3TGZA 2AV4A 1A2MA 4OFTA 1GP1A 1YJ6A 1FAAA 1JZOA 1PQNA 2V2GA 2LJRA 4HI7A 3QAWA 1V9WA 2YN1A 1AXDA 4FO5A 1HNBA 2IFQA 3P90A 4PQ1A 4CW9A 3C71A 3FR9A 6GSTA 1Z6MA 3A2XA 4MJBA 1OKTA 3M8NA 1O81A 2K8SA 2C0FA 1B9YC 2G0FA 4MZCA 3GYKA 1SL0B 2PPTA 3HY2A 3A3TA 1AW9A 2H76A 1QMVA 1G6WA 1R26A 3VWXA 2GSSA 2H75A 4PUAA 1YY7A 4V1Ag 3G9BA 1J08A 2VCTA 4IQ1A 1YZXA 3MAKA 2YZUA 4AJ8A 2CVBA 3WGXA 2FUG2 1LJRA 4K7IA 2B5YA 3EURA 1BEDA 3DD3A 2PWJA 4GSTA 1TI1A 4J56E 3HVVA 5JWOB 2OBIA 5CNWA 2FLSA 3FZ4A 2CVDA 4ILFA 2DBCA 3TRQA 4I6XA 2DJ1A 3TKPA 2BJXA 1TK8B 2C3QA 2PN8A 4MJCA 5DALB 1VF4A 2EIOA 3G7IA 2QSIA 1WP0A 4IKHA 4F0CA 1TK0B 3ZVJA 1GTIA 2IMIA 1A2JA 1ERVA 3FEUA 4DSQA 5HR2A 1N8JA 4O92A 4EXJA 3CTFA 1O6JA 5A4WA 3UARA 4KW6A 1JFUA 3P8WA 1F3BA 2DIYA 3DEXA 1DSBA 3QFBC 2AYTA 2LNSA 1PX6A 3IDVA 2AUVA 1PRXA 3LQ7A 4EVMA 4BPYA 4MABA 4BVYA 3UMAA 2VAFA 5B8BA 3HVXA 3PR8A 2I3YA 1MDJA 1NHYA 5A4UA 1EV9A 2FA4A 12GSA 4XS1A 4KH7A 3TRXA 2GTUA 3KM6A 2H70A 3DYRA 3L9UA 4I2TA 3ZFLA 3DVXA 4K8MA 1X0RA 2WDUA 3IA1A 18GSA 4KDXA 1V98A 2H74A 3GNJA 3HA9A 4POMA 1Z9HA 1V40A 3AY8A 1F37A 4IS0A 4TW5A 4XHMA 4XS4B 3GURA 1WOUA 4TVEA 4QL7A 1FOVA 1SJIA 2HNLA 1XW9A 1AC1A 1MTCA 4HU7A 4JR4A 4LLRA 4OFMA 1PN9A 1SJZA 5DQSA 1PA3A 3P7XA 1ON4A 3IHQA 4NXIA 3FZAA 3O76A 3GKXA 1SU9A 5IMVA 2YPMA 4TKYA 4IGJA 1TP9A 2OKAA 3IE3A 4MJEA 2GGTA 3HCZA 3I9V2 1WIKA 3F3QA 3H8QA 5DJMA 1EP7A 2H01A 1OVNA 3TKSE 3QD9A 2L4CA 4X0XA 2HSHA 2IWTA 4LA1A 2RUEA 5FHIA 1SKWB 5C00A 2DJ2A 2GLRA 2B5XA 1DBYA 3TOTA 3L9SA 1PGTA 3HZ4A 1Z7RA 3PH9A 3KGKA 5IOWA 2A2RA 1ZYQB 4JR6A 4MH2A 2PUKC 3UOMA 1J9BA 4POLA 4IP1A 4TRXA 4DSSB 5FWGA 1OYJA 2K6VA 2H1BA 5ECHB 4L0UA 1B8XA 2PERA 2X99A 4HUAA 2I1UA 2YP6A 4V2LA 3EU4A 2JSZA 1YKCA 2ALBA 3EVIA 3HJPA 2B6MA 2DLXA 3ED3A 2M80A 4WBJA 1ACVA 1TKDB 2FWHA 4GTUA 1XWKA 3ERFA 3HJMA 1IYIA 1ERUA 5IQYA 4X43A 1ZOFA 5CREA 3HXSA 4ECBA 5FT3A 5KN1A 2KP2A 1ERTA 1SKSB 2ON5A 2YWMA 5CP1A 5ECPB 2H6XA 4GF0A 4KCAA 3BCKA 5CRHA 3APQA 2GSTA 2H30A 3DGQA 3KMOA 3IOSA 1GNEA 2LRNA 3M9KA 5ECOB 3IR4A 1B48A 2K9FA 3G7YA 1OE7A 4OD7A 1DUGA 5EY6A 5F07A 3GTUA 1T3BA 4BWQA 3MDKA 3UVTA 4J57E 2F9SA 1YF1A 2IMDA 2VLVA 5GZZB 4XS6A 2XBIA 3UVHA 1OC3A 5ID2B 1RK4A 3FZ9A 2XHFA 2JL4A 4WBRD 2LJAA 1QUWA 2WGRA 3LSZA 1AQWA 3ZMKA 3FYGA 3KMNA 1BJXA 3DMLA 1PX7A 1XOBA 2A4VA 3GH9A 5ECKB 3RBTA 2R4VA 3VPQA 1TRSA 2LS5A 3KP9A 1YF0A 3LXZA 4TR1B 5HFGA 2J23A 3ZL5A 1B4QA 3VI7A 1CQGA 3Q19A 1GSFA 5G2ZA 1U88A 2F8FA 2AJQB 2YOIA 4HZ2A 4MA9A 2YWIA 4K1FA 3FK8A 3H1NA 4L0WA 4LL4B 4I5QA 2ZUPA 4G9HA 5H5RA 2H0IA 1GSYA 4PQIA 5B6NA 2LUSA 2NPBA 6GSYA 5DVBA 3LXTA 5G1KA 4IQAA 5DAKA 3J7Yb 2KUCA 4E8HA 1SK2A 2HRFA 1EGOA 1A8LA 2PVQA 1GSQA 4NMUA 5INYA 4N11A 2XC2A 3P2AA 2B5EA 3F3RA 1A0RP 5ELAA 1O8XA 3EMPA 4K7OA 2PGTA 4YQVA 1S3CA 2Z9SA 3ZIVA 4DEJA 1AQXA 1K0AA 3DKSA 3DXBA 5KN3A 2B7JA 4EC0A 2H1AA 2BTOT 5C04A 1TW9A 3APOA 4YAVA 4EDYA 3GRXA 1G7OA 3I43A 1R5AA 1U3IA 5A5KA 4HJ2A 4AF2A 2TRCP 1PSQA 3H4KA 1ZGNA 3O3TA 1XOAA 4L5OA 3FZ5A 2H0GA 2E2GA 1MD4A 1GUHA 2DSAA 3DIEA 3TOUA 2C3NA 2G2QA 5ECRB 3ZYWA 2MBTA 3TRPA 2GT5A 1J0FA 5AIVA 3TKSA 16GSA 2JADA 4GQFA 1U3AA 1TTZA 4ZL9A 1HQOA 3SBCA 3US3A 4HZ4A 4EL1A 3BBYA 3WGDA 2GVPA 3HKRA 5D9TA 2C0EA 3UEMA 2YV9A 4ZBBA 3NIVA 2WJUA 4ZL8A 5F0GA 7GSSA 1WMJA 3EE2A 2CVKA 5J4UA 2MMOA 1Z6NA 4KSMA 2C3TA 2OBKA 4MPGA 2YCDA 3QDNA 1W89A 3IRAA 5EL8A 2NVLA 3NOFA 1TU8A 5AN1A 3EC3A 3ZRDA 1PKZA 3TUEA 2KOKA 1R7HA 3FY7A 4NPBA 4XRDA 5J5NA 2P0GA 1VGLA 1GNWA 4JEDA 4GQCA 3Q6OA 3CYNA 1XVWA 2P5RA 4WEYA 5J41A 11GSA 2WS2A 1OC9A 2JZRA 2IPAA 4ZBDA 4KDUA 5CRDA 4E8EA 4QL9A 2CA8A 9GSSA 4L5LA 3VWUA 1XPVA 2QC7A 4KA0A 2K18A 4OO5A 1TI3A 1MD3A 2LTKA 5ECSA 2A2SA 2WCIA 4EKZA 2V41A 4LMWA 2DJ3A 1S3AA 4J2FA 3EINA 1A8YA 2HZEB 3WT2A 1X5DA 20GSA 1KTEA 5E4WA 1QK8A 4ECCA 4MF7A 5EVOA 3C1RA 3ZFBA 1OAZA 3A5WA 1EWXA 1W4VA 1HYUA 1MDIA 4XTSA 3QAGA 1YEPA 2V32A 4CHSA 1F3AA 3F4SA 1U6TA 3VWWA 4KB3A 3LJRA 4MF5A 4IN0A 5HFKA 1T7PB 2R6KA 1M2AA 3CBUA 3HYPA 3CRTA 3F4RA 3KD0A 3I6AA 5JCGA 4RUVA 4TR3A 5E59A 2XPDA 5EPFA 3QMXA 1YDKA 4WF5A 2OACA 1G7EA 1Z5YE 1XWBA 3TCOA 5B7CA 3MSZA 1GTAA 2V6KA 2R5GA 4KNDA 2DIZA 2L59A 1T4ZA 3CXGA 1B9XC 5JWRB 3TJBA 4WF4A 2XBQA 2BMXA 2VCQA 2VCVA 3ZMLA 4F0BA 2KLXA 4O32A 3GKNA 4PGTA 4TOPA 2V1MA 1JZWA 4NAXA 4JU5A 4ZBAA 2XPEA 4POBA 5ENUA 3VI5A 1F9MA 4WETA 3NZNA 5GAPD 1QQ2A 1PD21 3ERWA 4LL1B 5IM9A 2IFQB 5D93A 3DRNA 2GT6A 5GSTA 1GLPA 3IC4A 1AQVA 5DQYA 2TRXA 2IIYA 1BX9A 5IPGA 4N10A 2GSRA 1AIUA 1ZMAA 4H86A 5LCZA 2VL2A 2MMNA 3ZITA 2YNXA 1K0BA 4NHWA 2JZSA 1K0DA 3MWHA 2DMLA 3VWVA 5HFIA 6GSSA 1KNGA 3ME8A 1OC9B 1E6BA 2I81A 2CT6A 4ULXA 1Z3EA 4EDZA 3FR6A 1I9DA 3PINA 3F63A 4OWYA 3RPPA 2EC4A 4EO3A 3GKMA 4GRFA 2VIMA 1I5GA 3TJFA 3IAS2 4ECIA 2HE3A 4TXOA 4WR5A 1X9MB 3IPZA 2GQMA 2O8VB 4I97A 5JCWA 1HD2A 3LYKA 3DWVA 2FHEA 4ZIJA 2VCWA 3VPTA 3FRCA 4ZL7A 2MMZA 2X8HA 1LU4A 2M72A 5H5SA 3WD6A 1TOFA 4G10A 3IXRA 1FG4A 2IMEA 4L8EA 3UIWA 3OR5A 2EIRA 3DVWA 1RQMA 2LV3A 4WR4A 4MCUA 5JCUA 4PX1A 1SD8A 1T1VA 1XCCA 3UAPA 5ECIB 1SL1B 4F2IA 3L0HA 5AGYA 1XFLA 5KN0A 19GSA 1NM3A 2L57A 5COHA 5L71A 3W6GA 3ME7A 5A4VA 2IMFA 3TKSC 4ML6A 4AGSA 3GHAA 2OE3A 3F9UA 1ERWA 4WKWA 1C72A 4YAPA 3J7Yk 2C0GA 2NBSA 1WJKA 1TRWA 1V2AA 5HR1A 2L5OA 3KH9A 1T00A 1M9AA 2AB6A 4N30A 10GSA 2KHPA 4V2MA 2H71A 3D5JA 2B7KA 1TK5B 1USBA 1JLWA 3EMXA 4FYCA 1FB6A 1GUKA 1M2DA 4AJ7A 2LJKA 3GKKA 3EWLA 2JU5A 3LWAA 4K6XA 5IMZA 2FA8A 4MMMA 5B8AA 2OADA 3M3MA 5D9XA 1R5PA 1OKDA 1ZYEA 3D4TA 4KCEA 4D73A 1Q98A 5LD0A 4MH3A 1S3DA 4BL7A 1H75A 1AAZA 2RLIA 1FHEA 2REMA 2L6DA 3GL5A 4ACSA 4KAEA 1EOHA 3VFIA 1ZL9A 4YH2A 2I9HA 2GSQA 2GZYA 1O73A 1UVZA 1YEXA 1SK0A 4KGIA 2L6CA 1OE8A 2LKUA 3QPMA 1M9BA 4GLTA 2LRCA 3HJOA 4OCEA 5CAXA 3UL3A 2H73A 1N2AA 2FWGA 1THOA 4FYUA 2H19A 3GA4A 1URMA 2VUPA 2J9HA 2M46A 1A24A 4QQ7A 2V6OA 1EP8A 5IO2A 2GS3A 2FGXA 4DVCA 2H72A 1SK1A 3TDGA 1SYRA 2L4QA 2CAIA 2LQOA 4MLYA 3KZQA 2N5FA 1M2BA 1M0UA 3D21A 4AJ6A 3KJYA 1WE0A 4OFNA 1GSSA 1LBKA 1HNCA 1Y6EA 5G1LA 2DJ0A 1GSDA 1XWAA 2CX3A 4MZBA 2K8VA 2H66A 5DALA 2VD1A 2LQQA 3GL3A 2FD3A 1EGRA 3ZLPA 3UBLA 3D6IA 3QAVA 4HOJA 3C1SA 4RI6A 1DE1A 4HDEA 4CDOA 2H1GA 1F2EA 2ZCTA 3H79A 4I2UA 3H93A 1VF2A 3E9JB 3IBHA 1VF3A 4YQUA 1YQ1A 1ABAA 4N0VA 1DE2A 1GWCA 3N5OA 3F6DA 3W8SA 4ID0A 1K0NA 2VO4A 5J9BA 2F3MA 4ECJA 3HVSA 4EUYA 5DDLA 1XIYA 5IMFA 1EEJA 3MNGA 3CMIA 3GX8A 1GSUA 4LMVA 4ZB8A 1H4OA 4NV2A 4Q5QA 1BG5A 2IN3A 3F4TA 3GMFA 1WRYA 5DBQA 1MEKA 2VCXA 2QKEA 3ZIJA 3S9FA 3GTUB 3CSJA 2VD0A 3C73A 5HR3A 5IMAA 5CYYA 3LG6A 2JZTA 3GV1A 5CRWA 4ISDA 2RUFA 2RM5A 5G31A 5KEJA 6GSXA 1QXHA 4Q5FA 2GDRA 2VL2C 3KTLA 4D73B 1ILOA 1EOGA 4Q5NA 2N5AA 4KDYA 1NSWA 3D4MA 5G5FA 3A2WA 3EYTA 2O7KA 1XWCA 5J3RA 1VRSD 2L5LA 2HYXA 2HLSA 14GSA 3L78A 2CX4A 3F0IA 3VLNA 4XS4A 3JCML 1X9WB 3APSA 1G6YA 1SENA 1XBSA 1UN2A 1X5EA 4HQSA 2CAQA 5IIZA 1O8WA 1QGVA 2HT9A 2JSYA 2PBJA 3ERGA 1M99A 2WULA 3L9VA 2C1YA 2F51A 5ECMB 5B6MA 3GH6A 4YQMA 1PL2A 2CV4A 4N0ZA 1U87A 2VOCA 2C0DA 1NW2A 5CO3A 3HZ8A 2C4JA 5DAKB 3KEBA 2QGVA 4ZB6A 4ZB9A 2HI7A 2VCZA 2O87A 1ML6A 2H1DA 2YJHA 2ES7A 2CZ3A 4MPFA 1TRVA 4V2NA 3TJGA 3KCMA 4EF0A 1XWGA 4MDCA 1PMTA 2GQLA 4PNFA 2E0QA 4FYBA 3M1GA 1GTBA 2FWEA 4DSSA 4ML1A 3WGEA 17GSA 3KIJA 1K3YA 1TDIA 2CZ2A 3IV4A 5ECLB 3ISOA 2AHEA 4GCIA 1XXUA 2HRNA 4JE1A 1A2LA 4TR4A 3TJJA 2VL3A 4KE3A 2VLUA 2D2ZA 2B1LA 4HS1A 2F8AA 3BD2A 2R2JA 4GSSA 3ZZXA 4F03A 3LORA 3F8UA 5IMCA 5G5EA 1FO5A 5KN2A 1T4YA 1JZDA 22GSA 4RQRA 3O6TA 5D73A 2H6YA 3U5RE 2IL3A 1ZCPA 3UBKA 5IOXA 2MYGA 5D9VA 2X8CA 1EZKA 3QFAC 2X64A 2LSTA 2WFCA 1EV4A 2NDOA 4X1UA 2HFDA 5H5QA 4RI7A 4O7HA 1K0OA 5IPHA 4TXVA 2OJLA 6GSVA 2OE1A 3M0FA 5D8IA 1CQHA 3C7MA 1FB0A 4IW9A 1GULA 5G30A 2TIRA 4BWSA 2RIIA 4Z7XA 2PU9C 2WZ9A 3CSIA 1K3OA 4POKA 4PQHA 2R37A 3GFKA 5ID2A 4NHZA 2MBSA 1GTUA 2RM6A 2FWFA 3LYPA 3VURA 2FCHA 2P5QA 5ABRA 5LNKe 1B4PA 4JRRA 3QOUA 1NHOA 2O85A 4TN8A 1TRUA 5GSSA 1SD9A 2B1KA 2GZPA 1RW1A 3GN3A 3BOAA 4F82A 1UA5A 5CRGA 3UJ1A 2DJJA 4TR1A 2MMAA 4K0GA 4G19A 2NTOA 5DJLA 1WPIA 3M9JA 5DCHA 4GSNA 3I69A 4JZQA 1TJDA 4IJ3A 4O5RA 3KTBA 5AISA 1O85A 1Z7PA 2FNOA 1BYEA 1E2YA 2JACA 3HD5A 3KH7A 1FVJA 3C8EA 1M7TA 2HXKA 3D0ZA 3RPNA 5ECNB 4IVFA 4IP6A 5D9WA 1BQ7A 3F6FA 3RHCA 4K0NA 1PKWA 4MF6A 4IELA 2P31A 3V1WA 2IMKA 4MJAA 1QFNA 4HU9A 3TJKA 1BAYA 3ZVJD 2YANA 2GZZA 2MZCA 1IYHA 3FW2A 4F9ZA 6GSWA 1MDKA 4OO4A 3LEFA 1X9SB 5IMDA 3U6VA 2KP1A 1XZOA 5D96A 1A0FA 1TXXA 2DC5A 1R4WA 3WT1A 3CSHA 3LFLA 1JLVA 3G7JA 1OC8A 3W8JA 2R3XA 2YZHA 4HEA2 2H6ZA 1GUMA 1ST9A 3R2QA 4PUFC 2YWNA 4Q5RA 1ZZYA 4XIHA
chains in the Genus database with same CATH superfamily
3ZTLA 3WYWA 1G0TA 4I8BA 8GSSA 13GSA 3FHKA 4PNGA 4IBPA 4OCFA 1SL2B 3GX0A 1UC7A 4GXZA 4Z2UA 2HSYA 2VM1A 2LNTA 3CQFA 3BJ5A 2ZNMA 1M3IA 2OA7A 3HDCA 3CTGA 4K5RA 2H8LA 3QR6A 1Q4JA 3N9JA 4V1Ap 3TKRA 2YWOA 2I4AA 2N5BA 4NWYA 2IJYA 2WRTA 1GLQA 4KSOA 1THXA 2LEGA 2E7PA 1XW5A 2A2PA 4KX4A 2B3SA 3GSSA 4P3YB 4NV5A 4K2DA 1JHBA 4DSRA 4EE0A 1GSEA 1SKRB 3IK9A 5J9CA 2O89A 3GSTA 4FH8A 4PURA 4K9ZA 3HHVA 1FVKA 5F06A 4GWRA 1FW1A 2AAWA 2YJ7A 1PL1A 2PVOC 2EIQA 1O7UA 1A23A 2FY6A 1T8EB 3QCPA 3ZREA 2PMTA 3K8NA 5ELGA 3PGTA 3Q18A 1JZRA 4KF9A 4EIPA 4TXOB 4G2EA 1XG8A 2ON7A 3Q74A 4IJIA 4XRAA 1XW6A 3D22A 1VF1A 5DCGA 3MIXA 3BCIA 3CRUA 2H0HA 4KUNA 4IHUA 1V57A 1F6MC 3GIXA 2HZEA 5ECQB 2DJKA 2HZFA 2YV7A 3A2VA 3KXOA 3TB2A 1YKAA 4RQXA 2GQKA 5GAND 4TR0A 1HNAA 4FIWA 3LGCA 1XVQA 2VM2A 3KP8A 3FKFA 5HR0A 4ZXGA 2OE0A 4MP4A 1WWJA 3RDWA 1KEBA 1KBNA 5HQPA 3E3EA 2VLTA 5F8BA 2LRTA 1GRXA 4BVXA 1SYXA 2E2MA 5AIXA 3GUSA 3E0UA 1V58A 4OMVA 3RAZA 1TU7A 3RHBA 3L4NA 2DMMA 1GH2A 3VK9A 1EEMA 5IO0A 1SJ6A 4JBBA 4MZWA 4XCSA 4WXTA 1PN0A 2C80A 4K7NA 4HQZA 5JWQB 1K0CA 1GL8A 3EU3A 1K3LA 4PXOA 2X8GA 3FR3A 1K0MA 4HJMA 5F05A 6GSUA 2C8UA 2VL9A 3TKQA 4BA7A 3SWLA 1Y25A 4ZILA 4MK3A 3IAM2 1X5CA 3IK7A 1AUCA 2CQ9A 4G0KA 2WB9A 3TGZA 2AV4A 1A2MA 4OFTA 1GP1A 1YJ6A 1FAAA 4BL7B 1JZOA 1PQNA 2V2GA 2LJRA 5KOWA 4HI7A 3QAWA 1V9WA 2YN1A 1AXDA 4FO5A 1HNBA 2IFQA 3P90A 4PQ1A 4CW9A 3C71A 3FR9A 6GSTA 1Z6MA 3A2XA 4MJBA 1OKTA 3M8NA 1O81A 2K8SA 2C0FA 1B9YC 2G0FA 3A5IA 4MZCA 4Z2RA 3GYKA 1SL0B 2PPTA 3HY2A 3A3TA 1AW9A 2H76A 1QMVA 1G6WA 1R26A 3VWXA 2GSSA 2H75A 4PUAA 1YY7A 4V1Ag 3G9BA 1J08A 2VCTA 4IQ1A 1YZXA 3MAKA 2YZUA 4AJ8A 2CVBA 3EPTA 3WGXA 2FUG2 1LJRA 4K7IA 2B5YA 3EURA 1BEDA 3DD3A 2PWJA 4GSTA 1TI1A 4J56E 3HVVA 5JWOB 2OBIA 5CNWA 2FLSA 3FZ4A 2CVDA 4ILFA 2DBCA 3TRQA 4I6XA 2DJ1A 3TKPA 2BJXA 1TK8B 3IHGA 2C3QA 2PN8A 4MJCA 5DALB 1VF4A 2EIOA 3G7IA 2QSIA 1WP0A 4IKHA 4F0CA 1TK0B 3ZVJA 1GTIA 2IMIA 1A2JA 1ERVA 3FEUA 4DSQA 5HR2A 1N8JA 4O92A 4EXJA 4BVXB 3CTFA 1O6JA 5A4WA 3UARA 4KW6A 1JFUA 3P8WA 1F3BA 2DIYA 3DEXA 1DSBA 3QFBC 2AYTA 2LNSA 1PX6A 3IDVA 2AUVA 1PRXA 3LQ7A 4EVMA 2HSMA 4BPYA 4MABA 4BVYA 3UMAA 2VAFA 5B8BA 3HVXA 3PR8A 2I3YA 1MDJA 1NHYA 5A4UA 1EV9A 2FA4A 12GSA 4XS1A 4KH7A 3TRXA 4YKGA 2GTUA 3KM6A 2H70A 3DYRA 3L9UA 4I2TA 3ZFLA 3DVXA 4K8MA 1X0RA 2WDUA 3IA1A 18GSA 4KDXA 1V98A 2H74A 3GNJA 3HA9A 4POMA 1Z9HA 1V40A 3AY8A 1F37A 4IS0A 4TW5A 4XHMA 4XS4B 3GURA 1WOUA 4TVEA 4QL7A 1FOVA 1SJIA 2HNLA 1XW9A 1AC1A 1MTCA 3LW9A 4HU7A 4JR4A 4LLRA 4OFMA 1PN9A 1SJZA 5DQSA 4Z2TA 1PA3A 3P7XA 1ON4A 3IHQA 4NXIA 3FZAA 3O76A 3GKXA 1SU9A 1ZYPA 5IMVA 2YPMA 4TKYA 4IGJA 1TP9A 2OKAA 3IE3A 4MJEA 2GGTA 3HCZA 3I9V2 1WIKA 3F3QA 2QA1A 3H8QA 5DJMA 1EP7A 4BIKA 2H01A 1OVNA 3TKSE 3QD9A 2L4CA 4X0XA 2HSHA 2IWTA 4LA1A 2RUEA 5FHIA 1SKWB 5C00A 2DJ2A 2GLRA 2B5XA 1DBYA 3TOTA 3L9SA 1PGTA 3HZ4A 1Z7RA 3PH9A 3KGKA 5IOWA 2A2RA 1ZYQB 4JR6A 4MH2A 2PUKC 3UOMA 1J9BA 4POLA 4IP1A 4TRXA 4DSSB 5FWGA 1OYJA 2K6VA 2H1BA 5ECHB 4L0UA 1B8XA 2PERA 2X99A 4HUAA 2I1UA 2YP6A 4V2LA 3EU4A 2JSZA 1YKCA 2ALBA 3EVIA 3HJPA 2B6MA 2DLXA 3ED3A 2M80A 4WBJA 1ACVA 1TKDB 2FWHA 4GTUA 1XWKA 3ERFA 4BVYB 3HJMA 1IYIA 1ERUA 5IQYA 4X43A 1ZOFA 5CREA 3HXSA 4ECBA 5FT3A 5KN1A 2KP2A 1ERTA 4CY8A 1SKSB 2ON5A 2YWMA 5CP1A 5ECPB 2H6XA 4GF0A 4KCAA 3BCKA 5CRHA 3APQA 2GSTA 2H30A 3DGQA 3KMOA 3IOSA 1GNEA 2LRNA 3M9KA 5ECOB 3IR4A 1B48A 2K9FA 3G7YA 2R0GA 1OE7A 4OD7A 1DUGA 5EY6A 5F07A 3GTUA 1T3BA 4BWQA 3MDKA 3UVTA 4J57E 2F9SA 1YF1A 2IMDA 2VLVA 5GZZB 2A4HA 4XS6A 2XBIA 3UVHA 1OC3A 5ID2B 1RK4A 3FZ9A 2XHFA 2JL4A 4WBRD 2LJAA 1QUWA 2WGRA 3LSZA 1AQWA 3ZMKA 3FYGA 3KMNA 1BJXA 3DMLA 1PX7A 1XOBA 2A4VA 3PPUA 3GH9A 5ECKB 3RBTA 2R4VA 3VPQA 1TRSA 2LS5A 3KP9A 1YF0A 4TR1B 3LXZA 5HFGA 2UZ8A 2J23A 3ZL5A 1B4QA 3VI7A 1CQGA 3Q19A 1GSFA 5G2ZA 1U88A 2F8FA 2AJQB 2YOIA 4HZ2A 4MA9A 2YWIA 4K1FA 3FK8A 3H1NA 4L0WA 4LL4B 4I5QA 2ZUPA 4G9HA 5H5RA 2H0IA 1GSYA 4PQIA 5B6NA 2LUSA 2NPBA 6GSYA 5DVBA 3LXTA 5G1KA 4IQAA 5DAKA 3J7Yb 2KUCA 4E8HA 1SK2A 2HRFA 1EGOA 1A8LA 2PVQA 1GSQA 4NMUA 5INYA 4N11A 2XC2A 3P2AA 2B5EA 3F3RA 1A0RP 5ELAA 1O8XA 3EMPA 4K7OA 2PGTA 4YQVA 1S3CA 2Z9SA 3ZIVA 4DEJA 1AQXA 1K0AA 3DKSA 3DXBA 5KN3A 2B7JA 4EC0A 2H1AA 2BTOT 2QA2A 5C04A 1TW9A 3APOA 4YAVA 4EDYA 3GRXA 1G7OA 3I43A 1R5AA 1U3IA 5A5KA 4HJ2A 4AF2A 2TRCP 4O5UA 1PSQA 3H4KA 1ZGNA 3O3TA 1XOAA 4L5OA 3FZ5A 2H0GA 2E2GA 1MD4A 1GUHA 2DSAA 3DIEA 3TOUA 2C3NA 2G2QA 5ECRB 3ZYWA 2MBTA 3TRPA 2GT5A 1J0FA 5AIVA 3TKSA 16GSA 2JADA 4GQFA 1U3AA 1TTZA 4ZL9A 1HQOA 3SBCA 3US3A 4HZ4A 4EL1A 3BBYA 3WGDA 2GVPA 3HKRA 5D9TA 2C0EA 3UEMA 2YV9A 4ZBBA 1PFOA 3NIVA 4K5SA 2WJUA 4ZL8A 5F0GA 7GSSA 1WMJA 3EE2A 2CVKA 5J4UA 2MMOA 1Z6NA 1FOHA 4KSMA 2C3TA 2OBKA 4MPGA 2YCDA 3QDNA 1W89A 3IRAA 5EL8A 2NVLA 3NOFA 1TU8A 5AN1A 3EC3A 3ZRDA 1PKZA 3HVNA 3TUEA 2KOKA 1R7HA 3FY7A 4NPBA 4XRDA 5J5NA 2P0GA 1VGLA 1GNWA 4JEDA 4GQCA 3Q6OA 3CYNA 1XVWA 2P5RA 4WEYA 5J41A 5KOXA 11GSA 2WS2A 1OC9A 2JZRA 2IPAA 4ZBDA 4KDUA 5CRDA 4E8EA 4QL9A 2CA8A 9GSSA 4L5LA 3VWUA 1XPVA 2QC7A 4KA0A 2K18A 4OO5A 1TI3A 1MD3A 2LTKA 5ECSA 2A2SA 2WCIA 4EKZA 2V41A 4LMWA 2DJ3A 1S3AA 3IC8A 4J2FA 3EINA 1A8YA 2HZEB 3WT2A 1X5DA 20GSA 1KTEA 5E4WA 1QK8A 4ECCA 4MF7A 5EVOA 3C1RA 3ZFBA 1OAZA 3A5WA 1EWXA 4ICYA 1W4VA 1HYUA 1MDIA 4XTSA 3QAGA 1YEPA 2V32A 4CHSA 1F3AA 3F4SA 1U6TA 3VWWA 4KB3A 3LJRA 4MF5A 4IN0A 5HFKA 1T7PB 2R6KA 1M2AA 3CBUA 1ZYNA 3HYPA 3CRTA 3F4RA 3KD0A 2X49A 3I6AA 5JCGA 4RUVA 4TR3A 4YKFA 5E59A 2XPDA 5EPFA 3QMXA 1YDKA 4WF5A 2OACA 1G7EA 1Z5YE 1XWBA 3TCOA 5B7CA 3MSZA 1GTAA 2V6KA 2R5GA 4KNDA 2DIZA 2L59A 1T4ZA 3CXGA 1B9XC 5JWRB 3TJBA 4WF4A 2XBQA 2BMXA 2VCQA 2VCVA 3ZMLA 4F0BA 2KLXA 4O32A 3GKNA 4PGTA 4TOPA 2V1MA 1JZWA 4NAXA 4JU5A 4ZBAA 2XPEA 4POBA 5ENUA 3VI5A 1F9MA 4WETA 3NZNA 5GAPD 1QQ2A 1PD21 3ERWA 4LL1B 5IM9A 2IFQB 5D93A 3DRNA 2GT6A 5GSTA 1GLPA 3IC4A 1AQVA 5DQYA 3R3EA 2TRXA 2IIYA 1BX9A 5IPGA 4N10A 2GSRA 1AIUA 1ZMAA 4H86A 5LCZA 2VL2A 2MMNA 3ZITA 2YNXA 1K0BA 4NHWA 2JZSA 1K0DA 3MWHA 2DMLA 3VWVA 5HFIA 6GSSA 1KNGA 3ME8A 1OC9B 1E6BA 2I81A 2CT6A 4ULXA 1Z3EA 4EDZA 3FR6A 1I9DA 3PINA 3F63A 4OWYA 3RPPA 2EC4A 4EO3A 3GKMA 4GRFA 2VIMA 1I5GA 3TJFA 3IAS2 4ECIA 2HE3A 4TXOA 4WR5A 1X9MB 3IPZA 2GQMA 2O8VB 4I97A 5JCWA 1HD2A 3LYKA 3DWVA 2FHEA 4ZIJA 2VCWA 3VPTA 3FRCA 4ZL7A 2MMZA 2X8HA 1LU4A 2M72A 5H5SA 3WD6A 1TOFA 4G10A 3IXRA 1FG4A 2IMEA 4L8EA 3UIWA 3OR5A 2EIRA 3DVWA 1RQMA 2LV3A 4HSCX 4WR4A 4MCUA 5JCUA 4PX1A 2DKHA 1SD8A 1T1VA 1XCCA 3UAPA 5ECIB 1SL1B 4F2IA 3L0HA 5AGYA 1XFLA 5KN0A 19GSA 1NM3A 2L57A 5COHA 5L71A 3W6GA 3ME7A 5A4VA 2IMFA 3TKSC 4ML6A 4AGSA 3GHAA 2OE3A 3F9UA 1ERWA 4WKWA 1C72A 4YAPA 3J7Yk 2C0GA 2NBSA 1WJKA 1TRWA 1V2AA 5HR1A 2L5OA 3KH9A 1T00A 1M9AA 2AB6A 4N30A 10GSA 2KHPA 4V2MA 2H71A 3D5JA 2B7KA 1TK5B 1USBA 1JLWA 3EMXA 4FYCA 1FB6A 1GUKA 1M2DA 4AJ7A 2LJKA 4X4JA 3GKKA 3EWLA 2JU5A 3LWAA 4K6XA 5IMZA 2FA8A 4MMMA 5B8AA 2OADA 3M3MA 5D9XA 1R5PA 1OKDA 1ZYEA 3D4TA 4KCEA 4D73A 1Q98A 5LD0A 4MH3A 1S3DA 4BL7A 1H75A 1AAZA 2RLIA 1FHEA 2REMA 2L6DA 3GL5A 4ACSA 4KAEA 2HRAA 1EOHA 3VFIA 1ZL9A 4YH2A 2I9HA 2GSQA 2GZYA 1O73A 1UVZA 1YEXA 1SK0A 4KGIA 2L6CA 1OE8A 2LKUA 3QPMA 1M9BA 4GLTA 2LRCA 3HJOA 4OCEA 5CAXA 3UL3A 2H73A 1N2AA 2FWGA 1THOA 4FYUA 2H19A 3GA4A 1URMA 2VUPA 2J9HA 2M46A 1A24A 4K2XA 4QQ7A 2V6OA 1EP8A 5IO2A 2GS3A 2FGXA 4DVCA 2H72A 1SK1A 2R0CA 3TDGA 3FMWA 1SYRA 2L4QA 2CAIA 2LQOA 4MLYA 3KZQA 2N5FA 1M2BA 1M0UA 3D21A 4AJ6A 2HRKA 3KJYA 1WE0A 4OFNA 4CY6A 1GSSA 1LBKA 1HNCA 1Y6EA 5G1LA 2DJ0A 1GSDA 1XWAA 2CX3A 4MZBA 2K8VA 2H66A 5DALA 2VD1A 2LQQA 3GL3A 2FD3A 1EGRA 3ZLPA 4O5QA 3UBLA 3D6IA 3QAVA 4HOJA 3C1SA 4RI6A 1DE1A 4HDEA 4CDOA 2H1GA 1F2EA 2ZCTA 3H79A 4I2UA 3H93A 1VF2A 3E9JB 3IBHA 1VF3A 4YQUA 1YQ1A 1ABAA 4N0VA 1DE2A 1GWCA 3N5OA 3F6DA 3W8SA 4ID0A 1K0NA 2VO4A 5J9BA 2F3MA 4ECJA 3HVSA 4EUYA 5DDLA 1XIYA 5IMFA 1EEJA 3MNGA 1M3JA 3CMIA 3GX8A 1GSUA 4LMVA 4ZB8A 1H4OA 4NV2A 4Q5QA 1BG5A 2IN3A 3F4TA 3GMFA 1WRYA 5DBQA 1MEKA 2VCXA 2QKEA 3ZIJA 3S9FA 3GTUB 3CSJA 2VD0A 3C73A 5HR3A 5IMAA 5CYYA 3LG6A 2JZTA 3GV1A 5CRWA 4ISDA 2RUFA 2RM5A 5G31A 5KEJA 6GSXA 1QXHA 4Q5FA 2GDRA 2VL2C 3KTLA 4D73B 1ILOA 1EOGA 4Q5NA 2N5AA 4KDYA 1NSWA 3D4MA 5G5FA 3A2WA 3EYTA 2O7KA 1XWCA 5J3RA 1VRSD 2L5LA 2HYXA 2HLSA 14GSA 3L78A 2CX4A 3F0IA 3VLNA 4XS4A 3JCML 1X9WB 3APSA 1G6YA 1SENA 1XBSA 1UN2A 1X5EA 4HQSA 2CAQA 5IIZA 1O8WA 1QGVA 2HT9A 2JSYA 2PBJA 3ERGA 4A5PA 1M99A 2WULA 3L9VA 2C1YA 2F51A 5ECMB 5B6MA 3GH6A 4YQMA 1PL2A 2CV4A 4N0ZA 1U87A 2VOCA 2C0DA 1NW2A 2R0PA 5CO3A 3HZ8A 2C4JA 5DAKB 3KEBA 2QGVA 4ZB6A 4ZB9A 2HI7A 2VCZA 2O87A 1ML6A 2H1DA 2YJHA 2ES7A 2CZ3A 4MPFA 1TRVA 4V2NA 3TJGA 3KCMA 4EF0A 1XWGA 4MDCA 1PMTA 2GQLA 4PNFA 2E0QA 4FYBA 4FQUA 3M1GA 1GTBA 2FWEA 4DSSA 4ML1A 3WGEA 2X4AA 17GSA 3KIJA 1K3YA 1TDIA 2CZ2A 3IV4A 5ECLB 3ISOA 2AHEA 4GCIA 1XXUA 3MYDA 2HRNA 4JE1A 1A2LA 4TR4A 3TJJA 2VL3A 4KE3A 2VLUA 2D2ZA 2B1LA 4HS1A 2F8AA 3BD2A 2R2JA 4GSSA 3ZZXA 4F03A 3LORA 3F8UA 5IMCA 5G5EA 1FO5A 5KN2A 1T4YA 1JZDA 22GSA 4RQRA 3O6TA 5D73A 2H6YA 4MNNA 3U5RE 2IL3A 1ZCPA 3UBKA 5IOXA 2MYGA 5D9VA 2X8CA 1EZKA 3QFAC 2X64A 2LSTA 2WFCA 1EV4A 2NDOA 4X1UA 2HFDA 5H5QA 4RI7A 4O7HA 1K0OA 5IPHA 4TXVA 2OJLA 6GSVA 2OE1A 3M0FA 5D8IA 1CQHA 3C7MA 1FB0A 4IW9A 1GULA 5G30A 2TIRA 4BWSA 2RIIA 4Z7XA 2PU9C 2WZ9A 3CSIA 1K3OA 4POKA 5BMUA 4PQHA 2R37A 3GFKA 5ID2A 4NHZA 2MBSA 1GTUA 2RM6A 2FWFA 3LYPA 3VURA 2FCHA 2P5QA 5ABRA 5LNKe 1B4PA 4JRRA 3QOUA 1NHOA 2O85A 4TN8A 1TRUA 5GSSA 1SD9A 2B1KA 2GZPA 1RW1A 3GN3A 3BOAA 4F82A 1UA5A 5CRGA 3UJ1A 2DJJA 4TR1A 5BRTA 2MMAA 4K0GA 4G19A 2NTOA 5DJLA 1WPIA 3M9JA 4GSNA 3I69A 4JZQA 5DCHA 1TJDA 4IJ3A 4O5RA 3KTBA 5AISA 1O85A 1Z7PA 4G0LA 2FNOA 1BYEA 1E2YA 2JACA 3HD5A 3KH7A 1FVJA 3C8EA 1M7TA 2HXKA 3D0ZA 3RPNA 5ECNB 4IVFA 4IP6A 5D9WA 4EIQA 1BQ7A 3F6FA 3RHCA 4K0NA 1PKWA 4MF6A 4IELA 2P31A 3V1WA 2IMKA 4MJAA 1QFNA 4HU9A 3TJKA 1BAYA 2DKIA 3ZVJD 2YANA 2GZZA 2MZCA 1IYHA 3FW2A 4F9ZA 6GSWA 1MDKA 4OO4A 3LEFA 1X9SB 5IMDA 4G0IA 3U6VA 2KP1A 1XZOA 5D96A 1A0FA 1S3RA 1TXXA 2DC5A 1R4WA 3WT1A 3CSHA 3LFLA 1JLVA 3G7JA 4PTSA 1OC8A 3W8JA 2R3XA 2YZHA 4HEA2 2H6ZA 1GUMA 4USSA 1ST9A 3R2QA 4PUFC 2YWNA 4Q5RA 1ZZYA 4XIHA
chains in the Genus database with same CATH topology
3ZTLA 3WYWA 1G0TA 4I8BA 8GSSA 13GSA 3FHKA 4PNGA 4IBPA 4OCFA 1SL2B 3GX0A 1UC7A 4GXZA 4Z2UA 2HSYA 2VM1A 2LNTA 3BJ5A 2ZNMA 2OA7A 3HDCA 3CTGA 4K5RA 2H8LA 3QR6A 1Q4JA 3N9JA 4V1Ap 3TKRA 2YWOA 2I4AA 2N5BA 4NWYA 2IJYA 2WRTA 1GLQA 4KSOA 1THXA 2LEGA 2E7PA 1XW5A 2A2PA 4KX4A 2B3SA 3GSSA 4P3YB 4NV5A 4K2DA 1JHBA 4DSRA 4EE0A 1GSEA 1SKRB 3IK9A 5J9CA 2O89A 3GSTA 4FH8A 4PURA 4K9ZA 3HHVA 1FVKA 5F06A 4GWRA 1FW1A 2AAWA 2YJ7A 1PL1A 2PVOC 2EIQA 1O7UA 1A23A 2FY6A 1T8EB 3QCPA 3ZREA 2PMTA 3K8NA 5ELGA 3PGTA 3Q18A 1JZRA 4KF9A 4EIPA 4TXOB 4G2EA 2ON7A 3Q74A 4IJIA 4XRAA 1XW6A 3D22A 1VF1A 5DCGA 3MIXA 3BCIA 3CRUA 2H0HA 4KUNA 4IHUA 1V57A 1F6MC 3GIXA 2HZEA 5ECQB 2DJKA 2HZFA 2YV7A 3A2VA 3KXOA 3TB2A 1YKAA 4RQXA 2GQKA 5GAND 4TR0A 1HNAA 4FIWA 3LGCA 1XVQA 2VM2A 3KP8A 3FKFA 5HR0A 4ZXGA 2OE0A 4MP4A 1WWJA 3RDWA 1KEBA 1KBNA 5HQPA 3E3EA 2VLTA 5F8BA 2LRTA 1GRXA 4BVXA 1SYXA 2E2MA 5AIXA 3GUSA 3E0UA 1V58A 4OMVA 3RAZA 1TU7A 3RHBA 3L4NA 2DMMA 1GH2A 3VK9A 1EEMA 5IO0A 1SJ6A 4JBBA 4MZWA 4XCSA 4WXTA 1PN0A 2C80A 4K7NA 4HQZA 5JWQB 1K0CA 1GL8A 3EU3A 1K3LA 4PXOA 2X8GA 3FR3A 1K0MA 4HJMA 5F05A 6GSUA 2C8UA 2VL9A 3TKQA 4BA7A 3SWLA 1Y25A 4ZILA 4MK3A 3IAM2 1X5CA 3IK7A 1AUCA 2CQ9A 4G0KA 2WB9A 3TGZA 2AV4A 1A2MA 4OFTA 1GP1A 1YJ6A 1FAAA 4BL7B 1JZOA 1PQNA 2V2GA 2LJRA 5KOWA 4HI7A 3QAWA 1V9WA 2YN1A 1AXDA 4FO5A 1HNBA 2IFQA 3P90A 4PQ1A 4CW9A 3C71A 3FR9A 6GSTA 1Z6MA 3A2XA 4MJBA 1OKTA 3M8NA 1O81A 2K8SA 2C0FA 1B9YC 2G0FA 3A5IA 4MZCA 4Z2RA 3GYKA 1SL0B 2PPTA 3HY2A 3A3TA 1AW9A 2H76A 1QMVA 1G6WA 1R26A 3VWXA 2GSSA 2H75A 4PUAA 1YY7A 4V1Ag 3G9BA 1J08A 2VCTA 4IQ1A 1YZXA 3MAKA 2YZUA 4AJ8A 2CVBA 3EPTA 3WGXA 2FUG2 1LJRA 4K7IA 2B5YA 3EURA 1BEDA 3DD3A 2PWJA 4GSTA 1TI1A 4J56E 3HVVA 5JWOB 2OBIA 5CNWA 2FLSA 3FZ4A 2CVDA 4ILFA 2DBCA 3TRQA 4I6XA 2DJ1A 3TKPA 2BJXA 1TK8B 3IHGA 2C3QA 2PN8A 4MJCA 5DALB 1VF4A 2EIOA 3G7IA 2QSIA 1WP0A 4IKHA 4F0CA 1TK0B 3ZVJA 1GTIA 2IMIA 1A2JA 1ERVA 3FEUA 4DSQA 5HR2A 1N8JA 4O92A 4EXJA 4BVXB 3CTFA 1O6JA 5A4WA 3UARA 4KW6A 1JFUA 3P8WA 1F3BA 2DIYA 3DEXA 1DSBA 3QFBC 2AYTA 2LNSA 1PX6A 3IDVA 2AUVA 1PRXA 3LQ7A 4EVMA 2HSMA 4BPYA 4MABA 4BVYA 3UMAA 2VAFA 5B8BA 3HVXA 3PR8A 2I3YA 1MDJA 1NHYA 5A4UA 1EV9A 2FA4A 12GSA 4XS1A 4KH7A 3TRXA 4YKGA 2GTUA 3KM6A 2H70A 3DYRA 3L9UA 4I2TA 3ZFLA 3DVXA 4K8MA 1X0RA 2WDUA 3IA1A 18GSA 4KDXA 1V98A 2H74A 3GNJA 3HA9A 4POMA 1Z9HA 1V40A 3AY8A 1F37A 4IS0A 4TW5A 4XHMA 4XS4B 3GURA 1WOUA 4TVEA 4QL7A 1FOVA 1SJIA 2HNLA 1XW9A 1AC1A 1MTCA 3LW9A 4HU7A 4JR4A 4LLRA 4OFMA 1PN9A 1SJZA 5DQSA 4Z2TA 1PA3A 3P7XA 1ON4A 3IHQA 4NXIA 3FZAA 3O76A 3GKXA 1SU9A 1ZYPA 5IMVA 2YPMA 4TKYA 4IGJA 1TP9A 2OKAA 3IE3A 4MJEA 2GGTA 3HCZA 3I9V2 1WIKA 3F3QA 2QA1A 3H8QA 5DJMA 1EP7A 2H01A 1OVNA 3TKSE 3QD9A 2L4CA 4X0XA 2HSHA 2IWTA 4LA1A 2RUEA 5FHIA 1SKWB 5C00A 2DJ2A 2GLRA 2B5XA 1DBYA 3TOTA 3L9SA 1PGTA 3HZ4A 1Z7RA 3PH9A 3KGKA 5IOWA 2A2RA 1ZYQB 4JR6A 4MH2A 2PUKC 3UOMA 1J9BA 4POLA 4IP1A 4TRXA 4DSSB 5FWGA 1OYJA 2K6VA 2H1BA 5ECHB 4L0UA 1B8XA 2PERA 2X99A 4HUAA 2I1UA 2YP6A 4V2LA 3EU4A 2JSZA 1YKCA 2ALBA 3EVIA 3HJPA 2B6MA 2DLXA 3ED3A 2M80A 4WBJA 1ACVA 1TKDB 2FWHA 4GTUA 1XWKA 3ERFA 4BVYB 3HJMA 1IYIA 1ERUA 5IQYA 4X43A 1ZOFA 5CREA 3HXSA 4ECBA 5FT3A 5KN1A 2KP2A 1ERTA 4CY8A 1SKSB 2ON5A 2YWMA 5CP1A 5ECPB 2H6XA 4GF0A 4KCAA 3BCKA 5CRHA 3APQA 2GSTA 2H30A 3DGQA 3KMOA 3IOSA 1GNEA 2LRNA 3M9KA 5ECOB 3IR4A 1B48A 2K9FA 3G7YA 2R0GA 1OE7A 4OD7A 1DUGA 5EY6A 5F07A 3GTUA 1T3BA 4BWQA 3MDKA 3UVTA 4J57E 2F9SA 1YF1A 2IMDA 2VLVA 5GZZB 2A4HA 4XS6A 2XBIA 3UVHA 1OC3A 5ID2B 1RK4A 3FZ9A 2XHFA 2JL4A 4WBRD 2LJAA 1QUWA 2WGRA 3LSZA 1AQWA 3ZMKA 3FYGA 3KMNA 1BJXA 3DMLA 1PX7A 1XOBA 2A4VA 3PPUA 3GH9A 5ECKB 3RBTA 2R4VA 3VPQA 1TRSA 2LS5A 3KP9A 1YF0A 4TR1B 3LXZA 5HFGA 2UZ8A 2J23A 3ZL5A 1B4QA 3VI7A 1CQGA 3Q19A 1GSFA 5G2ZA 1U88A 2F8FA 2AJQB 2YOIA 4HZ2A 4MA9A 2YWIA 4K1FA 3FK8A 3H1NA 4L0WA 4LL4B 4I5QA 2ZUPA 4G9HA 5H5RA 2H0IA 1GSYA 4PQIA 5B6NA 2LUSA 2NPBA 6GSYA 5DVBA 3LXTA 5G1KA 4IQAA 5DAKA 3J7Yb 2KUCA 4E8HA 1SK2A 2HRFA 1EGOA 1A8LA 2PVQA 1GSQA 4NMUA 5INYA 4N11A 2XC2A 3P2AA 2B5EA 3F3RA 1A0RP 5ELAA 1O8XA 3EMPA 4K7OA 2PGTA 4YQVA 1S3CA 2Z9SA 3ZIVA 4DEJA 1AQXA 1K0AA 3DKSA 3DXBA 5KN3A 2B7JA 4EC0A 2H1AA 2BTOT 2QA2A 5C04A 1TW9A 3APOA 4YAVA 4EDYA 3GRXA 1G7OA 3I43A 1R5AA 1U3IA 5A5KA 4HJ2A 4AF2A 2TRCP 4O5UA 1PSQA 3H4KA 1ZGNA 3O3TA 1XOAA 4L5OA 3FZ5A 2H0GA 2E2GA 1MD4A 1GUHA 2DSAA 3DIEA 3TOUA 2C3NA 2G2QA 5ECRB 3ZYWA 2MBTA 3TRPA 2GT5A 1J0FA 5AIVA 3TKSA 16GSA 2JADA 4GQFA 1U3AA 1TTZA 4ZL9A 1HQOA 3SBCA 3US3A 4HZ4A 4EL1A 3BBYA 3WGDA 2GVPA 3HKRA 5D9TA 2C0EA 3UEMA 2YV9A 4ZBBA 3NIVA 4K5SA 2WJUA 4ZL8A 5F0GA 7GSSA 1WMJA 3EE2A 2CVKA 5J4UA 2MMOA 1Z6NA 1FOHA 4KSMA 2C3TA 2OBKA 4MPGA 2YCDA 3QDNA 1W89A 3IRAA 5EL8A 2NVLA 3NOFA 1TU8A 5AN1A 3EC3A 3ZRDA 1PKZA 3TUEA 2KOKA 1R7HA 3FY7A 4NPBA 4XRDA 5J5NA 2P0GA 1VGLA 1GNWA 4JEDA 4GQCA 3Q6OA 3CYNA 1XVWA 2P5RA 4WEYA 5J41A 5KOXA 11GSA 2WS2A 1OC9A 2JZRA 2IPAA 4ZBDA 4KDUA 5CRDA 4E8EA 4QL9A 2CA8A 9GSSA 4L5LA 3VWUA 1XPVA 2QC7A 4KA0A 2K18A 4OO5A 1TI3A 1MD3A 2LTKA 5ECSA 2A2SA 2WCIA 4EKZA 2V41A 4LMWA 2DJ3A 1S3AA 3IC8A 4J2FA 3EINA 1A8YA 2HZEB 3WT2A 1X5DA 20GSA 1KTEA 5E4WA 1QK8A 4ECCA 4MF7A 5EVOA 3C1RA 3ZFBA 1OAZA 3A5WA 1EWXA 4ICYA 1W4VA 1HYUA 1MDIA 4XTSA 3QAGA 1YEPA 2V32A 4CHSA 1F3AA 3F4SA 1U6TA 3VWWA 4KB3A 3LJRA 4MF5A 4IN0A 5HFKA 1T7PB 2R6KA 1M2AA 3CBUA 1ZYNA 3HYPA 3CRTA 3F4RA 3KD0A 2X49A 3I6AA 5JCGA 4RUVA 4TR3A 4YKFA 5E59A 2XPDA 5EPFA 3QMXA 1YDKA 4WF5A 2OACA 1G7EA 1Z5YE 1XWBA 3TCOA 5B7CA 3MSZA 1GTAA 2V6KA 2R5GA 4KNDA 2DIZA 2L59A 1T4ZA 3CXGA 1B9XC 5JWRB 3TJBA 4WF4A 2XBQA 2BMXA 2VCQA 2VCVA 3ZMLA 4F0BA 2KLXA 4O32A 3GKNA 4PGTA 4TOPA 2V1MA 1JZWA 4NAXA 4JU5A 4ZBAA 2XPEA 4POBA 5ENUA 3VI5A 1F9MA 4WETA 3NZNA 5GAPD 1QQ2A 1PD21 3ERWA 4LL1B 5IM9A 2IFQB 5D93A 3DRNA 2GT6A 5GSTA 1GLPA 3IC4A 1AQVA 5DQYA 3R3EA 2TRXA 2IIYA 1BX9A 5IPGA 4N10A 2GSRA 1AIUA 1ZMAA 4H86A 5LCZA 2VL2A 2MMNA 3ZITA 2YNXA 1K0BA 4NHWA 2JZSA 1K0DA 3MWHA 2DMLA 3VWVA 5HFIA 6GSSA 1KNGA 3ME8A 1OC9B 1E6BA 2I81A 2CT6A 4ULXA 1Z3EA 4EDZA 3FR6A 1I9DA 3PINA 3F63A 4OWYA 3RPPA 2EC4A 4EO3A 3GKMA 4GRFA 2VIMA 1I5GA 3TJFA 3IAS2 4ECIA 2HE3A 4TXOA 4WR5A 1X9MB 3IPZA 2GQMA 2O8VB 4I97A 5JCWA 1HD2A 3LYKA 3DWVA 2FHEA 4ZIJA 2VCWA 3VPTA 3FRCA 4ZL7A 2MMZA 2X8HA 1LU4A 2M72A 5H5SA 3WD6A 1TOFA 4G10A 3IXRA 1FG4A 2IMEA 4L8EA 3UIWA 3OR5A 2EIRA 3DVWA 1RQMA 2LV3A 4WR4A 4MCUA 5JCUA 4PX1A 2DKHA 1SD8A 1T1VA 1XCCA 3UAPA 5ECIB 1SL1B 4F2IA 3L0HA 5AGYA 1XFLA 5KN0A 19GSA 1NM3A 2L57A 5COHA 5L71A 3W6GA 3ME7A 5A4VA 2IMFA 3TKSC 4ML6A 4AGSA 3GHAA 2OE3A 3F9UA 1ERWA 4WKWA 1C72A 4YAPA 3J7Yk 2C0GA 2NBSA 1WJKA 1TRWA 1V2AA 5HR1A 2L5OA 3KH9A 1T00A 1M9AA 2AB6A 4N30A 10GSA 2KHPA 4V2MA 2H71A 3D5JA 2B7KA 1TK5B 1USBA 1JLWA 3EMXA 4FYCA 1FB6A 1GUKA 1M2DA 4AJ7A 2LJKA 4X4JA 3GKKA 3EWLA 2JU5A 3LWAA 4K6XA 5IMZA 2FA8A 4MMMA 5B8AA 2OADA 3M3MA 5D9XA 1R5PA 1OKDA 1ZYEA 3D4TA 4KCEA 4D73A 1Q98A 5LD0A 4MH3A 1S3DA 4BL7A 1H75A 1AAZA 2RLIA 1FHEA 2REMA 2L6DA 3GL5A 4ACSA 4KAEA 2HRAA 1EOHA 3VFIA 1ZL9A 4YH2A 2I9HA 2GSQA 2GZYA 1O73A 1UVZA 1YEXA 1SK0A 4KGIA 2L6CA 1OE8A 2LKUA 3QPMA 1M9BA 4GLTA 2LRCA 3HJOA 4OCEA 5CAXA 3UL3A 2H73A 1N2AA 2FWGA 1THOA 4FYUA 2H19A 3GA4A 1URMA 2VUPA 2J9HA 2M46A 1A24A 4K2XA 4QQ7A 2V6OA 1EP8A 5IO2A 2GS3A 2FGXA 4DVCA 2H72A 1SK1A 2R0CA 3TDGA 3FMWA 1SYRA 2L4QA 2CAIA 2LQOA 4MLYA 3KZQA 2N5FA 1M2BA 1M0UA 3D21A 4AJ6A 2HRKA 3KJYA 1WE0A 4OFNA 4CY6A 1GSSA 1LBKA 1HNCA 1Y6EA 5G1LA 2DJ0A 1GSDA 1XWAA 2CX3A 4MZBA 2K8VA 2H66A 5DALA 2VD1A 2LQQA 3GL3A 2FD3A 1EGRA 3ZLPA 4O5QA 3UBLA 3D6IA 3QAVA 4HOJA 3C1SA 4RI6A 1DE1A 4HDEA 4CDOA 2H1GA 1F2EA 2ZCTA 3H79A 4I2UA 3H93A 1VF2A 3E9JB 3IBHA 1VF3A 4YQUA 1YQ1A 1ABAA 4N0VA 1DE2A 1GWCA 3N5OA 3F6DA 3W8SA 4ID0A 1K0NA 2VO4A 5J9BA 2F3MA 4ECJA 3HVSA 4EUYA 5DDLA 1XIYA 5IMFA 1EEJA 3MNGA 3CMIA 3GX8A 1GSUA 4LMVA 4ZB8A 1H4OA 4NV2A 4Q5QA 1BG5A 2IN3A 3F4TA 3GMFA 1WRYA 5DBQA 1MEKA 2VCXA 2QKEA 3ZIJA 3S9FA 3GTUB 3CSJA 2VD0A 3C73A 5HR3A 5IMAA 5CYYA 3LG6A 2JZTA 3GV1A 5CRWA 4ISDA 2RUFA 2RM5A 5G31A 5KEJA 6GSXA 1QXHA 4Q5FA 2GDRA 2VL2C 3KTLA 4D73B 1ILOA 1EOGA 4Q5NA 2N5AA 4KDYA 1NSWA 3D4MA 5G5FA 3A2WA 3EYTA 2O7KA 1XWCA 5J3RA 1VRSD 2L5LA 2HYXA 2HLSA 14GSA 3L78A 2CX4A 3F0IA 3VLNA 4XS4A 3JCML 1X9WB 3APSA 1G6YA 1SENA 1XBSA 1UN2A 1X5EA 4HQSA 2CAQA 5IIZA 1O8WA 1QGVA 2HT9A 2JSYA 2PBJA 3ERGA 4A5PA 1M99A 2WULA 3L9VA 2C1YA 2F51A 5ECMB 5B6MA 3GH6A 4YQMA 1PL2A 2CV4A 4N0ZA 1U87A 2VOCA 2C0DA 1NW2A 2R0PA 5CO3A 3HZ8A 2C4JA 5DAKB 3KEBA 2QGVA 4ZB6A 4ZB9A 2HI7A 2VCZA 2O87A 1ML6A 2H1DA 2YJHA 2ES7A 2CZ3A 4MPFA 1TRVA 4V2NA 3TJGA 3KCMA 4EF0A 1XWGA 4MDCA 1PMTA 2GQLA 4PNFA 2E0QA 4FYBA 4FQUA 3M1GA 1GTBA 2FWEA 4DSSA 4ML1A 3WGEA 2X4AA 17GSA 3KIJA 1K3YA 1TDIA 2CZ2A 3IV4A 5ECLB 3ISOA 2AHEA 4GCIA 1XXUA 3MYDA 2HRNA 4JE1A 1A2LA 4TR4A 3TJJA 2VL3A 4KE3A 2VLUA 2D2ZA 2B1LA 4HS1A 2F8AA 3BD2A 2R2JA 4GSSA 3ZZXA 4F03A 3LORA 3F8UA 5IMCA 5G5EA 1FO5A 5KN2A 1T4YA 1JZDA 22GSA 4RQRA 3O6TA 5D73A 2H6YA 4MNNA 3U5RE 2IL3A 1ZCPA 3UBKA 5IOXA 2MYGA 5D9VA 2X8CA 1EZKA 3QFAC 2X64A 2LSTA 2WFCA 1EV4A 2NDOA 4X1UA 2HFDA 5H5QA 4RI7A 4O7HA 1K0OA 5IPHA 4TXVA 2OJLA 6GSVA 2OE1A 3M0FA 5D8IA 1CQHA 3C7MA 1FB0A 4IW9A 1GULA 5G30A 2TIRA 4BWSA 2RIIA 4Z7XA 2PU9C 2WZ9A 3CSIA 1K3OA 4POKA 5BMUA 4PQHA 2R37A 3GFKA 5ID2A 4NHZA 2MBSA 1GTUA 2RM6A 2FWFA 3LYPA 3VURA 2FCHA 2P5QA 5ABRA 5LNKe 1B4PA 4JRRA 3QOUA 1NHOA 2O85A 4TN8A 1TRUA 5GSSA 1SD9A 2B1KA 2GZPA 1RW1A 3GN3A 3BOAA 4F82A 1UA5A 5CRGA 3UJ1A 2DJJA 4TR1A 5BRTA 2MMAA 4K0GA 4G19A 2NTOA 5DJLA 1WPIA 3M9JA 4GSNA 3I69A 4JZQA 5DCHA 1TJDA 4IJ3A 4O5RA 3KTBA 5AISA 1O85A 1Z7PA 4G0LA 2FNOA 1BYEA 1E2YA 2JACA 3HD5A 3KH7A 1FVJA 3C8EA 1M7TA 2HXKA 3D0ZA 3RPNA 5ECNB 4IVFA 4IP6A 5D9WA 4EIQA 1BQ7A 3F6FA 3RHCA 4K0NA 1PKWA 4MF6A 4IELA 2P31A 3V1WA 2IMKA 4MJAA 1QFNA 4HU9A 3TJKA 1BAYA 2DKIA 3ZVJD 2YANA 2GZZA 2MZCA 1IYHA 3FW2A 4F9ZA 6GSWA 1MDKA 4OO4A 3LEFA 1X9SB 5IMDA 4G0IA 3U6VA 2KP1A 1XZOA 5D96A 1A0FA 1TXXA 2DC5A 1R4WA 3WT1A 3CSHA 3LFLA 1JLVA 3G7JA 4PTSA 1OC8A 3W8JA 2R3XA 2YZHA 4HEA2 2H6ZA 1GUMA 4USSA 1ST9A 3R2QA 4PUFC 2YWNA 4Q5RA 1ZZYA 4XIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTL A;  3WYW A;  1G0T A;  4I8B A;  8GSS A;  13GS A;  3FHK A;  4PNG A;  4IBP A;  4OCF A;  1SL2 B;  3GX0 A;  1UC7 A;  4GXZ A;  2HSY A;  2VM1 A;  2LNT A;  3BJ5 A;  2ZNM A;  2OA7 A;  3HDC A;  3CTG A;  2H8L A;  3QR6 A;  1Q4J A;  3N9J A;  4V1A p;  3TKR A;  2YWO A;  2I4A A;  2N5B A;  4NWY A;  2IJY A;  2WRT A;  1GLQ A;  4KSO A;  1THX A;  2LEG A;  2E7P A;  1XW5 A;  4KX4 A;  2B3S A;  3GSS A;  4P3Y B;  4NV5 A;  4K2D A;  1JHB A;  4DSR A;  4EE0 A;  1GSE A;  1SKR B;  3IK9 A;  5J9C A;  2O89 A;  3GST A;  4FH8 A;  4PUR A;  4K9Z A;  3HHV A;  1FVK A;  5F06 A;  4GWR A;  1FW1 A;  2AAW A;  2YJ7 A;  1PL1 A;  2PVO C;  2EIQ A;  1O7U A;  1A23 A;  2FY6 A;  1T8E B;  3QCP A;  3ZRE A;  2PMT A;  3K8N A;  5ELG A;  3PGT A;  3Q18 A;  1JZR A;  4TXO B;  4G2E A;  2ON7 A;  3Q74 A;  4IJI A;  4XRA A;  1XW6 A;  3D22 A;  1VF1 A;  5DCG A;  3BCI A;  3CRU A;  2H0H A;  4KUN A;  4IHU A;  1V57 A;  1F6M C;  3GIX A;  2HZE A;  5ECQ B;  2DJK A;  2HZF A;  2YV7 A;  3A2V A;  3KXO A;  3TB2 A;  1YKA A;  4RQX A;  2GQK A;  5GAN D;  4TR0 A;  1HNA A;  4FIW A;  3LGC A;  1XVQ A;  2VM2 A;  3KP8 A;  3FKF A;  5HR0 A;  4ZXG A;  2OE0 A;  4MP4 A;  1WWJ A;  3RDW A;  1KEB A;  1KBN A;  5HQP A;  3E3E A;  2VLT A;  5F8B A;  2LRT A;  1GRX A;  4BVX A;  1SYX A;  2E2M A;  5AIX A;  3GUS A;  3E0U A;  1V58 A;  4OMV A;  3RAZ A;  1TU7 A;  3RHB A;  3L4N A;  2DMM A;  1GH2 A;  3VK9 A;  1EEM A;  5IO0 A;  1SJ6 A;  4JBB A;  4MZW A;  4XCS A;  4WXT A;  2C80 A;  4K7N A;  4HQZ A;  5JWQ B;  1K0C A;  1GL8 A;  3EU3 A;  1K3L A;  4PXO A;  2X8G A;  3FR3 A;  1K0M A;  4HJM A;  5F05 A;  6GSU A;  2C8U A;  2VL9 A;  3TKQ A;  4BA7 A;  3SWL A;  1Y25 A;  4ZIL A;  4MK3 A;  3IAM 2;  1X5C A;  3IK7 A;  1AUC A;  2CQ9 A;  2WB9 A;  3TGZ A;  2AV4 A;  1A2M A;  4OFT A;  1GP1 A;  1YJ6 A;  1FAA A;  1JZO A;  1PQN A;  2V2G A;  2LJR A;  4HI7 A;  3QAW A;  1V9W A;  2YN1 A;  1AXD A;  4FO5 A;  1HNB A;  2IFQ A;  3P90 A;  4PQ1 A;  4CW9 A;  3C71 A;  3FR9 A;  6GST A;  1Z6M A;  3A2X A;  4MJB A;  1OKT A;  3M8N A;  1O81 A;  2K8S A;  2C0F A;  1B9Y C;  2G0F A;  4MZC A;  3GYK A;  1SL0 B;  2PPT A;  3HY2 A;  3A3T A;  1AW9 A;  2H76 A;  1QMV A;  1G6W A;  1R26 A;  3VWX A;  2GSS A;  2H75 A;  4PUA A;  1YY7 A;  4V1A g;  3G9B A;  1J08 A;  2VCT A;  4IQ1 A;  1YZX A;  3MAK A;  2YZU A;  4AJ8 A;  2CVB A;  3WGX A;  2FUG 2;  1LJR A;  4K7I A;  2B5Y A;  3EUR A;  1BED A;  3DD3 A;  2PWJ A;  4GST A;  1TI1 A;  4J56 E;  3HVV A;  5JWO B;  2OBI A;  5CNW A;  2FLS A;  3FZ4 A;  2CVD A;  4ILF A;  2DBC A;  3TRQ A;  4I6X A;  2DJ1 A;  3TKP A;  2BJX A;  1TK8 B;  2C3Q A;  2PN8 A;  4MJC A;  5DAL B;  1VF4 A;  2EIO A;  3G7I A;  2QSI A;  1WP0 A;  4IKH A;  4F0C A;  1TK0 B;  3ZVJ A;  1GTI A;  2IMI A;  1A2J A;  1ERV A;  3FEU A;  4DSQ A;  5HR2 A;  1N8J A;  4O92 A;  4EXJ A;  3CTF A;  1O6J A;  5A4W A;  3UAR A;  4KW6 A;  1JFU A;  3P8W A;  1F3B A;  2DIY A;  3DEX A;  1DSB A;  3QFB C;  2AYT A;  2LNS A;  1PX6 A;  3IDV A;  2AUV A;  1PRX A;  3LQ7 A;  4EVM A;  4BPY A;  4MAB A;  4BVY A;  3UMA A;  2VAF A;  5B8B A;  3HVX A;  3PR8 A;  2I3Y A;  1MDJ A;  1NHY A;  5A4U A;  1EV9 A;  2FA4 A;  12GS A;  4XS1 A;  4KH7 A;  3TRX A;  2GTU A;  3KM6 A;  2H70 A;  3DYR A;  3L9U A;  4I2T A;  3ZFL A;  3DVX A;  4K8M A;  1X0R A;  2WDU A;  3IA1 A;  18GS A;  4KDX A;  1V98 A;  2H74 A;  3GNJ A;  3HA9 A;  4POM A;  1Z9H A;  1V40 A;  3AY8 A;  1F37 A;  4IS0 A;  4TW5 A;  4XHM A;  4XS4 B;  3GUR A;  1WOU A;  4TVE A;  4QL7 A;  1FOV A;  1SJI A;  2HNL A;  1XW9 A;  1AC1 A;  1MTC A;  4HU7 A;  4JR4 A;  4LLR A;  4OFM A;  1PN9 A;  1SJZ A;  5DQS A;  1PA3 A;  3P7X A;  1ON4 A;  3IHQ A;  4NXI A;  3FZA A;  3O76 A;  3GKX A;  1SU9 A;  5IMV A;  2YPM A;  4TKY A;  4IGJ A;  1TP9 A;  2OKA A;  3IE3 A;  4MJE A;  2GGT A;  3HCZ A;  3I9V 2;  1WIK A;  3F3Q A;  3H8Q A;  5DJM A;  1EP7 A;  2H01 A;  1OVN A;  3TKS E;  3QD9 A;  2L4C A;  4X0X A;  2HSH A;  2IWT A;  4LA1 A;  2RUE A;  5FHI A;  1SKW B;  5C00 A;  2DJ2 A;  2GLR A;  2B5X A;  1DBY A;  3TOT A;  3L9S A;  1PGT A;  3HZ4 A;  1Z7R A;  3PH9 A;  3KGK A;  5IOW A;  2A2R A;  1ZYQ B;  4JR6 A;  4MH2 A;  2PUK C;  3UOM A;  1J9B A;  4POL A;  4IP1 A;  4TRX A;  4DSS B;  5FWG A;  1OYJ A;  2K6V A;  2H1B A;  5ECH B;  4L0U A;  1B8X A;  2PER A;  2X99 A;  4HUA A;  2I1U A;  2YP6 A;  4V2L A;  3EU4 A;  2JSZ A;  1YKC A;  2ALB A;  3EVI A;  3HJP A;  2B6M A;  2DLX A;  3ED3 A;  2M80 A;  4WBJ A;  1ACV A;  1TKD B;  2FWH A;  4GTU A;  1XWK A;  3ERF A;  3HJM A;  1IYI A;  1ERU A;  5IQY A;  4X43 A;  1ZOF A;  5CRE A;  3HXS A;  4ECB A;  5FT3 A;  5KN1 A;  2KP2 A;  1ERT A;  1SKS B;  2ON5 A;  2YWM A;  5CP1 A;  5ECP B;  2H6X A;  4GF0 A;  4KCA A;  3BCK A;  5CRH A;  3APQ A;  2GST A;  2H30 A;  3DGQ A;  3KMO A;  3IOS A;  1GNE A;  2LRN A;  3M9K A;  5ECO B;  3IR4 A;  1B48 A;  2K9F A;  3G7Y A;  1OE7 A;  4OD7 A;  1DUG A;  5EY6 A;  5F07 A;  3GTU A;  1T3B A;  4BWQ A;  3MDK A;  3UVT A;  4J57 E;  2F9S A;  1YF1 A;  2IMD A;  2VLV A;  5GZZ B;  4XS6 A;  2XBI A;  3UVH A;  1OC3 A;  5ID2 B;  1RK4 A;  3FZ9 A;  2XHF A;  2JL4 A;  4WBR D;  2LJA A;  1QUW A;  2WGR A;  3LSZ A;  1AQW A;  3ZMK A;  3FYG A;  3KMN A;  1BJX A;  3DML A;  1PX7 A;  1XOB A;  2A4V A;  3GH9 A;  5ECK B;  3RBT A;  2R4V A;  3VPQ A;  1TRS A;  2LS5 A;  3KP9 A;  1YF0 A;  3LXZ A;  4TR1 B;  5HFG A;  2J23 A;  3ZL5 A;  1B4Q A;  3VI7 A;  1CQG A;  3Q19 A;  1GSF A;  5G2Z A;  1U88 A;  2F8F A;  2AJQ B;  2YOI A;  4HZ2 A;  4MA9 A;  2YWI A;  4K1F A;  3FK8 A;  3H1N A;  4L0W A;  4LL4 B;  4I5Q A;  2ZUP A;  4G9H A;  5H5R A;  2H0I A;  1GSY A;  4PQI A;  5B6N A;  2LUS A;  2NPB A;  6GSY A;  5DVB A;  3LXT A;  5G1K A;  4IQA A;  5DAK A;  3J7Y b;  2KUC A;  4E8H A;  1SK2 A;  2HRF A;  1EGO A;  1A8L A;  2PVQ A;  1GSQ A;  4NMU A;  5INY A;  4N11 A;  2XC2 A;  3P2A A;  2B5E A;  3F3R A;  1A0R P;  5ELA A;  1O8X A;  3EMP A;  4K7O A;  2PGT A;  4YQV A;  1S3C A;  2Z9S A;  3ZIV A;  4DEJ A;  1AQX A;  1K0A A;  3DKS A;  3DXB A;  5KN3 A;  2B7J A;  4EC0 A;  2H1A A;  2BTO T;  5C04 A;  1TW9 A;  3APO A;  4YAV A;  4EDY A;  3GRX A;  1G7O A;  3I43 A;  1R5A A;  1U3I A;  5A5K A;  4HJ2 A;  4AF2 A;  2TRC P;  1PSQ A;  3H4K A;  1ZGN A;  3O3T A;  1XOA A;  4L5O A;  3FZ5 A;  2H0G A;  2E2G A;  1MD4 A;  1GUH A;  2DSA A;  3DIE A;  3TOU A;  2C3N A;  2G2Q A;  5ECR B;  3ZYW A;  2MBT A;  3TRP A;  2GT5 A;  1J0F A;  5AIV A;  3TKS A;  16GS A;  2JAD A;  4GQF A;  1U3A A;  1TTZ A;  4ZL9 A;  1HQO A;  3SBC A;  3US3 A;  4HZ4 A;  4EL1 A;  3BBY A;  3WGD A;  2GVP A;  3HKR A;  5D9T A;  2C0E A;  3UEM A;  2YV9 A;  4ZBB A;  3NIV A;  2WJU A;  4ZL8 A;  5F0G A;  7GSS A;  1WMJ A;  3EE2 A;  2CVK A;  5J4U A;  2MMO A;  1Z6N A;  4KSM A;  2C3T A;  2OBK A;  4MPG A;  2YCD A;  3QDN A;  1W89 A;  3IRA A;  5EL8 A;  2NVL A;  3NOF A;  1TU8 A;  5AN1 A;  3EC3 A;  3ZRD A;  1PKZ A;  3TUE A;  2KOK A;  1R7H A;  3FY7 A;  4NPB A;  4XRD A;  5J5N A;  2P0G A;  1VGL A;  1GNW A;  4JED A;  4GQC A;  3Q6O A;  3CYN A;  1XVW A;  2P5R A;  4WEY A;  5J41 A;  11GS A;  2WS2 A;  1OC9 A;  2JZR A;  2IPA A;  4ZBD A;  4KDU A;  5CRD A;  4E8E A;  4QL9 A;  2CA8 A;  9GSS A;  4L5L A;  3VWU A;  1XPV A;  2QC7 A;  4KA0 A;  2K18 A;  4OO5 A;  1TI3 A;  1MD3 A;  2LTK A;  5ECS A;  2A2S A;  2WCI A;  4EKZ A;  2V41 A;  4LMW A;  2DJ3 A;  1S3A A;  4J2F A;  3EIN A;  1A8Y A;  2HZE B;  3WT2 A;  1X5D A;  20GS A;  1KTE A;  5E4W A;  1QK8 A;  4ECC A;  4MF7 A;  5EVO A;  3C1R A;  3ZFB A;  1OAZ A;  3A5W A;  1EWX A;  1W4V A;  1HYU A;  1MDI A;  4XTS A;  3QAG A;  1YEP A;  2V32 A;  4CHS A;  1F3A A;  3F4S A;  1U6T A;  3VWW A;  4KB3 A;  3LJR A;  4MF5 A;  4IN0 A;  5HFK A;  1T7P B;  2R6K A;  1M2A A;  3CBU A;  3HYP A;  3CRT A;  3F4R A;  3KD0 A;  3I6A A;  5JCG A;  4RUV A;  4TR3 A;  5E59 A;  2XPD A;  5EPF A;  3QMX A;  1YDK A;  4WF5 A;  2OAC A;  1G7E A;  1Z5Y E;  1XWB A;  3TCO A;  5B7C A;  3MSZ A;  1GTA A;  2V6K A;  2R5G A;  4KND A;  2DIZ A;  2L59 A;  1T4Z A;  3CXG A;  1B9X C;  5JWR B;  3TJB A;  4WF4 A;  2XBQ A;  2BMX A;  2VCQ A;  2VCV A;  3ZML A;  4F0B A;  2KLX A;  4O32 A;  3GKN A;  4PGT A;  4TOP A;  2V1M A;  1JZW A;  4NAX A;  4JU5 A;  4ZBA A;  2XPE A;  4POB A;  5ENU A;  3VI5 A;  1F9M A;  4WET A;  3NZN A;  5GAP D;  1QQ2 A;  1PD2 1;  3ERW A;  4LL1 B;  5IM9 A;  2IFQ B;  5D93 A;  3DRN A;  2GT6 A;  5GST A;  1GLP A;  3IC4 A;  1AQV A;  5DQY A;  2TRX A;  2IIY A;  1BX9 A;  5IPG A;  4N10 A;  2GSR A;  1AIU A;  1ZMA A;  4H86 A;  5LCZ A;  2VL2 A;  2MMN A;  3ZIT A;  2YNX A;  1K0B A;  4NHW A;  2JZS A;  1K0D A;  3MWH A;  2DML A;  3VWV A;  5HFI A;  6GSS A;  1KNG A;  3ME8 A;  1OC9 B;  1E6B A;  2I81 A;  2CT6 A;  4ULX A;  1Z3E A;  4EDZ A;  3FR6 A;  1I9D A;  3PIN A;  3F63 A;  4OWY A;  3RPP A;  2EC4 A;  4EO3 A;  3GKM A;  4GRF A;  2VIM A;  1I5G A;  3TJF A;  3IAS 2;  4ECI A;  2HE3 A;  4TXO A;  4WR5 A;  1X9M B;  3IPZ A;  2GQM A;  2O8V B;  4I97 A;  5JCW A;  1HD2 A;  3LYK A;  3DWV A;  2FHE A;  4ZIJ A;  2VCW A;  3VPT A;  3FRC A;  4ZL7 A;  2MMZ A;  2X8H A;  1LU4 A;  2M72 A;  5H5S A;  3WD6 A;  1TOF A;  4G10 A;  3IXR A;  1FG4 A;  2IME A;  4L8E A;  3UIW A;  3OR5 A;  2EIR A;  3DVW A;  1RQM A;  2LV3 A;  4WR4 A;  4MCU A;  5JCU A;  4PX1 A;  1SD8 A;  1T1V A;  1XCC A;  3UAP A;  5ECI B;  1SL1 B;  4F2I A;  3L0H A;  5AGY A;  1XFL A;  5KN0 A;  19GS A;  1NM3 A;  2L57 A;  5COH A;  5L71 A;  3W6G A;  3ME7 A;  5A4V A;  2IMF A;  3TKS C;  4ML6 A;  4AGS A;  3GHA A;  2OE3 A;  3F9U A;  1ERW A;  4WKW A;  1C72 A;  4YAP A;  3J7Y k;  2C0G A;  2NBS A;  1WJK A;  1TRW A;  1V2A A;  5HR1 A;  2L5O A;  3KH9 A;  1T00 A;  1M9A A;  2AB6 A;  4N30 A;  10GS A;  2KHP A;  4V2M A;  2H71 A;  3D5J A;  2B7K A;  1TK5 B;  1USB A;  1JLW A;  3EMX A;  4FYC A;  1FB6 A;  1GUK A;  1M2D A;  4AJ7 A;  2LJK A;  3GKK A;  3EWL A;  2JU5 A;  3LWA A;  4K6X A;  5IMZ A;  2FA8 A;  4MMM A;  5B8A A;  2OAD A;  3M3M A;  5D9X A;  1R5P A;  1OKD A;  1ZYE A;  3D4T A;  4KCE A;  4D73 A;  1Q98 A;  5LD0 A;  4MH3 A;  1S3D A;  4BL7 A;  1H75 A;  1AAZ A;  2RLI A;  1FHE A;  2REM A;  2L6D A;  3GL5 A;  4ACS A;  4KAE A;  1EOH A;  3VFI A;  1ZL9 A;  4YH2 A;  2I9H A;  2GSQ A;  2GZY A;  1O73 A;  1UVZ A;  1YEX A;  1SK0 A;  4KGI A;  2L6C A;  1OE8 A;  2LKU A;  3QPM A;  1M9B A;  4GLT A;  2LRC A;  3HJO A;  4OCE A;  5CAX A;  3UL3 A;  2H73 A;  1N2A A;  2FWG A;  1THO A;  4FYU A;  2H19 A;  3GA4 A;  1URM A;  2VUP A;  2J9H A;  2M46 A;  1A24 A;  4QQ7 A;  2V6O A;  1EP8 A;  5IO2 A;  2GS3 A;  2FGX A;  4DVC A;  2H72 A;  1SK1 A;  3TDG A;  1SYR A;  2L4Q A;  2CAI A;  2LQO A;  4MLY A;  3KZQ A;  2N5F A;  1M2B A;  1M0U A;  3D21 A;  4AJ6 A;  3KJY A;  1WE0 A;  4OFN A;  1GSS A;  1LBK A;  1HNC A;  1Y6E A;  5G1L A;  2DJ0 A;  1GSD A;  1XWA A;  2CX3 A;  4MZB A;  2K8V A;  2H66 A;  5DAL A;  2VD1 A;  2LQQ A;  3GL3 A;  2FD3 A;  1EGR A;  3ZLP A;  3UBL A;  3D6I A;  3QAV A;  4HOJ A;  3C1S A;  4RI6 A;  1DE1 A;  4HDE A;  4CDO A;  2H1G A;  1F2E A;  2ZCT A;  3H79 A;  4I2U A;  3H93 A;  1VF2 A;  3E9J B;  3IBH A;  1VF3 A;  4YQU A;  1YQ1 A;  1ABA A;  4N0V A;  1DE2 A;  1GWC A;  3N5O A;  3F6D A;  3W8S A;  4ID0 A;  1K0N A;  2VO4 A;  5J9B A;  2F3M A;  4ECJ A;  3HVS A;  4EUY A;  5DDL A;  1XIY A;  5IMF A;  1EEJ A;  3MNG A;  3CMI A;  3GX8 A;  1GSU A;  4LMV A;  4ZB8 A;  1H4O A;  4NV2 A;  4Q5Q A;  1BG5 A;  2IN3 A;  3F4T A;  3GMF A;  1WRY A;  5DBQ A;  1MEK A;  2VCX A;  2QKE A;  3ZIJ A;  3S9F A;  3GTU B;  3CSJ A;  2VD0 A;  3C73 A;  5HR3 A;  5IMA A;  5CYY A;  3LG6 A;  2JZT A;  3GV1 A;  5CRW A;  4ISD A;  2RUF A;  2RM5 A;  5G31 A;  5KEJ A;  6GSX A;  1QXH A;  4Q5F A;  2GDR A;  2VL2 C;  3KTL A;  4D73 B;  1ILO A;  1EOG A;  4Q5N A;  2N5A A;  4KDY A;  1NSW A;  3D4M A;  5G5F A;  3A2W A;  3EYT A;  2O7K A;  1XWC A;  5J3R A;  1VRS D;  2L5L A;  2HYX A;  2HLS A;  14GS A;  3L78 A;  2CX4 A;  3F0I A;  3VLN A;  4XS4 A;  3JCM L;  1X9W B;  3APS A;  1G6Y A;  1SEN A;  1XBS A;  1UN2 A;  1X5E A;  4HQS A;  2CAQ A;  5IIZ A;  1O8W A;  1QGV A;  2HT9 A;  2JSY A;  2PBJ A;  3ERG A;  1M99 A;  2WUL A;  3L9V A;  2C1Y A;  2F51 A;  5ECM B;  5B6M A;  3GH6 A;  4YQM A;  1PL2 A;  2CV4 A;  4N0Z A;  1U87 A;  2VOC A;  2C0D A;  1NW2 A;  5CO3 A;  3HZ8 A;  2C4J A;  5DAK B;  3KEB A;  2QGV A;  4ZB6 A;  4ZB9 A;  2HI7 A;  2VCZ A;  2O87 A;  1ML6 A;  2H1D A;  2YJH A;  2ES7 A;  2CZ3 A;  4MPF A;  1TRV A;  4V2N A;  3TJG A;  3KCM A;  4EF0 A;  1XWG A;  4MDC A;  1PMT A;  2GQL A;  4PNF A;  2E0Q A;  4FYB A;  3M1G A;  1GTB A;  2FWE A;  4DSS A;  4ML1 A;  3WGE A;  17GS A;  3KIJ A;  1K3Y A;  1TDI A;  2CZ2 A;  3IV4 A;  5ECL B;  3ISO A;  2AHE A;  4GCI A;  1XXU A;  2HRN A;  4JE1 A;  1A2L A;  4TR4 A;  3TJJ A;  2VL3 A;  4KE3 A;  2VLU A;  2D2Z A;  2B1L A;  4HS1 A;  2F8A A;  3BD2 A;  2R2J A;  4GSS A;  3ZZX A;  4F03 A;  3LOR A;  3F8U A;  5IMC A;  5G5E A;  1FO5 A;  5KN2 A;  1T4Y A;  1JZD A;  22GS A;  4RQR A;  3O6T A;  5D73 A;  2H6Y A;  3U5R E;  2IL3 A;  1ZCP A;  3UBK A;  5IOX A;  2MYG A;  5D9V A;  2X8C A;  1EZK A;  3QFA C;  2X64 A;  2LST A;  2WFC A;  1EV4 A;  2NDO A;  4X1U A;  2HFD A;  5H5Q A;  4RI7 A;  4O7H A;  1K0O A;  5IPH A;  4TXV A;  2OJL A;  6GSV A;  2OE1 A;  3M0F A;  5D8I A;  1CQH A;  3C7M A;  1FB0 A;  4IW9 A;  1GUL A;  5G30 A;  2TIR A;  4BWS A;  2RII A;  4Z7X A;  2PU9 C;  2WZ9 A;  3CSI A;  1K3O A;  4POK A;  4PQH A;  2R37 A;  3GFK A;  5ID2 A;  4NHZ A;  2MBS A;  1GTU A;  2RM6 A;  2FWF A;  3LYP A;  3VUR A;  2FCH A;  2P5Q A;  5ABR A;  5LNK e;  1B4P A;  4JRR A;  3QOU A;  1NHO A;  2O85 A;  4TN8 A;  1TRU A;  5GSS A;  1SD9 A;  2B1K A;  2GZP A;  1RW1 A;  3GN3 A;  3BOA A;  4F82 A;  1UA5 A;  5CRG A;  3UJ1 A;  2DJJ A;  4TR1 A;  2MMA A;  4K0G A;  4G19 A;  2NTO A;  5DJL A;  1WPI A;  3M9J A;  5DCH A;  4GSN A;  3I69 A;  4JZQ A;  1TJD A;  4IJ3 A;  4O5R A;  3KTB A;  5AIS A;  1O85 A;  1Z7P A;  2FNO A;  1BYE A;  1E2Y A;  2JAC A;  3HD5 A;  3KH7 A;  1FVJ A;  3C8E A;  1M7T A;  2HXK A;  3D0Z A;  3RPN A;  5ECN B;  4IVF A;  4IP6 A;  5D9W A;  1BQ7 A;  3F6F A;  3RHC A;  4K0N A;  1PKW A;  4MF6 A;  4IEL A;  2P31 A;  3V1W A;  2IMK A;  4MJA A;  1QFN A;  4HU9 A;  3TJK A;  1BAY A;  3ZVJ D;  2YAN A;  2GZZ A;  2MZC A;  1IYH A;  3FW2 A;  4F9Z A;  6GSW A;  1MDK A;  4OO4 A;  3LEF A;  1X9S B;  5IMD A;  3U6V A;  2KP1 A;  1XZO A;  5D96 A;  1A0F A;  1TXX A;  2DC5 A;  1R4W A;  3WT1 A;  3CSH A;  3LFL A;  1JLV A;  3G7J A;  1OC8 A;  3W8J A;  2R3X A;  2YZH A;  4HEA 2;  2H6Z A;  1GUM A;  1ST9 A;  3R2Q A;  4PUF C;  2YWN A;  4Q5R A;  1ZZY A;  4XIH A; 
#chains in the Genus database with same CATH topology
 3ZTL A;  3WYW A;  1G0T A;  4I8B A;  8GSS A;  13GS A;  3FHK A;  4PNG A;  4IBP A;  4OCF A;  1SL2 B;  3GX0 A;  1UC7 A;  4GXZ A;  4Z2U A;  2HSY A;  2VM1 A;  2LNT A;  3CQF A;  3BJ5 A;  2ZNM A;  1M3I A;  2OA7 A;  3HDC A;  3CTG A;  4K5R A;  2H8L A;  3QR6 A;  1Q4J A;  3N9J A;  4V1A p;  3TKR A;  2YWO A;  2I4A A;  2N5B A;  4NWY A;  2IJY A;  2WRT A;  1GLQ A;  4KSO A;  1THX A;  2LEG A;  2E7P A;  1XW5 A;  2A2P A;  4KX4 A;  2B3S A;  3GSS A;  4P3Y B;  4NV5 A;  4K2D A;  1JHB A;  4DSR A;  4EE0 A;  1GSE A;  1SKR B;  3IK9 A;  5J9C A;  2O89 A;  3GST A;  4FH8 A;  4PUR A;  4K9Z A;  3HHV A;  1FVK A;  5F06 A;  4GWR A;  1FW1 A;  2AAW A;  2YJ7 A;  1PL1 A;  2PVO C;  2EIQ A;  1O7U A;  1A23 A;  2FY6 A;  1T8E B;  3QCP A;  3ZRE A;  2PMT A;  3K8N A;  5ELG A;  3PGT A;  3Q18 A;  1JZR A;  4KF9 A;  4EIP A;  4TXO B;  4G2E A;  1XG8 A;  2ON7 A;  3Q74 A;  4IJI A;  4XRA A;  1XW6 A;  3D22 A;  1VF1 A;  5DCG A;  3MIX A;  3BCI A;  3CRU A;  2H0H A;  4KUN A;  4IHU A;  1V57 A;  1F6M C;  3GIX A;  2HZE A;  5ECQ B;  2DJK A;  2HZF A;  2YV7 A;  3A2V A;  3KXO A;  3TB2 A;  1YKA A;  4RQX A;  2GQK A;  5GAN D;  4TR0 A;  1HNA A;  4FIW A;  3LGC A;  1XVQ A;  2VM2 A;  3KP8 A;  3FKF A;  5HR0 A;  4ZXG A;  2OE0 A;  4MP4 A;  1WWJ A;  3RDW A;  1KEB A;  1KBN A;  5HQP A;  3E3E A;  2VLT A;  5F8B A;  2LRT A;  1GRX A;  4BVX A;  1SYX A;  2E2M A;  5AIX A;  3GUS A;  3E0U A;  1V58 A;  4OMV A;  3RAZ A;  1TU7 A;  3RHB A;  3L4N A;  2DMM A;  1GH2 A;  3VK9 A;  1EEM A;  5IO0 A;  1SJ6 A;  4JBB A;  4MZW A;  4XCS A;  4WXT A;  1PN0 A;  2C80 A;  4K7N A;  4HQZ A;  5JWQ B;  1K0C A;  1GL8 A;  3EU3 A;  1K3L A;  4PXO A;  2X8G A;  3FR3 A;  1K0M A;  4HJM A;  5F05 A;  6GSU A;  2C8U A;  2VL9 A;  3TKQ A;  4BA7 A;  3SWL A;  1Y25 A;  4ZIL A;  4MK3 A;  3IAM 2;  1X5C A;  3IK7 A;  1AUC A;  2CQ9 A;  4G0K A;  2WB9 A;  3TGZ A;  2AV4 A;  1A2M A;  4OFT A;  1GP1 A;  1YJ6 A;  1FAA A;  4BL7 B;  1JZO A;  1PQN A;  2V2G A;  2LJR A;  5KOW A;  4HI7 A;  3QAW A;  1V9W A;  2YN1 A;  1AXD A;  4FO5 A;  1HNB A;  2IFQ A;  3P90 A;  4PQ1 A;  4CW9 A;  3C71 A;  3FR9 A;  6GST A;  1Z6M A;  3A2X A;  4MJB A;  1OKT A;  3M8N A;  1O81 A;  2K8S A;  2C0F A;  1B9Y C;  2G0F A;  3A5I A;  4MZC A;  4Z2R A;  3GYK A;  1SL0 B;  2PPT A;  3HY2 A;  3A3T A;  1AW9 A;  2H76 A;  1QMV A;  1G6W A;  1R26 A;  3VWX A;  2GSS A;  2H75 A;  4PUA A;  1YY7 A;  4V1A g;  3G9B A;  1J08 A;  2VCT A;  4IQ1 A;  1YZX A;  3MAK A;  2YZU A;  4AJ8 A;  2CVB A;  3EPT A;  3WGX A;  2FUG 2;  1LJR A;  4K7I A;  2B5Y A;  3EUR A;  1BED A;  3DD3 A;  2PWJ A;  4GST A;  1TI1 A;  4J56 E;  3HVV A;  5JWO B;  2OBI A;  5CNW A;  2FLS A;  3FZ4 A;  2CVD A;  4ILF A;  2DBC A;  3TRQ A;  4I6X A;  2DJ1 A;  3TKP A;  2BJX A;  1TK8 B;  3IHG A;  2C3Q A;  2PN8 A;  4MJC A;  5DAL B;  1VF4 A;  2EIO A;  3G7I A;  2QSI A;  1WP0 A;  4IKH A;  4F0C A;  1TK0 B;  3ZVJ A;  1GTI A;  2IMI A;  1A2J A;  1ERV A;  3FEU A;  4DSQ A;  5HR2 A;  1N8J A;  4O92 A;  4EXJ A;  4BVX B;  3CTF A;  1O6J A;  5A4W A;  3UAR A;  4KW6 A;  1JFU A;  3P8W A;  1F3B A;  2DIY A;  3DEX A;  1DSB A;  3QFB C;  2AYT A;  2LNS A;  1PX6 A;  3IDV A;  2AUV A;  1PRX A;  3LQ7 A;  4EVM A;  2HSM A;  4BPY A;  4MAB A;  4BVY A;  3UMA A;  2VAF A;  5B8B A;  3HVX A;  3PR8 A;  2I3Y A;  1MDJ A;  1NHY A;  5A4U A;  1EV9 A;  2FA4 A;  12GS A;  4XS1 A;  4KH7 A;  3TRX A;  4YKG A;  2GTU A;  3KM6 A;  2H70 A;  3DYR A;  3L9U A;  4I2T A;  3ZFL A;  3DVX A;  4K8M A;  1X0R A;  2WDU A;  3IA1 A;  18GS A;  4KDX A;  1V98 A;  2H74 A;  3GNJ A;  3HA9 A;  4POM A;  1Z9H A;  1V40 A;  3AY8 A;  1F37 A;  4IS0 A;  4TW5 A;  4XHM A;  4XS4 B;  3GUR A;  1WOU A;  4TVE A;  4QL7 A;  1FOV A;  1SJI A;  2HNL A;  1XW9 A;  1AC1 A;  1MTC A;  3LW9 A;  4HU7 A;  4JR4 A;  4LLR A;  4OFM A;  1PN9 A;  1SJZ A;  5DQS A;  4Z2T A;  1PA3 A;  3P7X A;  1ON4 A;  3IHQ A;  4NXI A;  3FZA A;  3O76 A;  3GKX A;  1SU9 A;  1ZYP A;  5IMV A;  2YPM A;  4TKY A;  4IGJ A;  1TP9 A;  2OKA A;  3IE3 A;  4MJE A;  2GGT A;  3HCZ A;  3I9V 2;  1WIK A;  3F3Q A;  2QA1 A;  3H8Q A;  5DJM A;  1EP7 A;  4BIK A;  2H01 A;  1OVN A;  3TKS E;  3QD9 A;  2L4C A;  4X0X A;  2HSH A;  2IWT A;  4LA1 A;  2RUE A;  5FHI A;  1SKW B;  5C00 A;  2DJ2 A;  2GLR A;  2B5X A;  1DBY A;  3TOT A;  3L9S A;  1PGT A;  3HZ4 A;  1Z7R A;  3PH9 A;  3KGK A;  5IOW A;  2A2R A;  1ZYQ B;  4JR6 A;  4MH2 A;  2PUK C;  3UOM A;  1J9B A;  4POL A;  4IP1 A;  4TRX A;  4DSS B;  5FWG A;  1OYJ A;  2K6V A;  2H1B A;  5ECH B;  4L0U A;  1B8X A;  2PER A;  2X99 A;  4HUA A;  2I1U A;  2YP6 A;  4V2L A;  3EU4 A;  2JSZ A;  1YKC A;  2ALB A;  3EVI A;  3HJP A;  2B6M A;  2DLX A;  3ED3 A;  2M80 A;  4WBJ A;  1ACV A;  1TKD B;  2FWH A;  4GTU A;  1XWK A;  3ERF A;  4BVY B;  3HJM A;  1IYI A;  1ERU A;  5IQY A;  4X43 A;  1ZOF A;  5CRE A;  3HXS A;  4ECB A;  5FT3 A;  5KN1 A;  2KP2 A;  1ERT A;  4CY8 A;  1SKS B;  2ON5 A;  2YWM A;  5CP1 A;  5ECP B;  2H6X A;  4GF0 A;  4KCA A;  3BCK A;  5CRH A;  3APQ A;  2GST A;  2H30 A;  3DGQ A;  3KMO A;  3IOS A;  1GNE A;  2LRN A;  3M9K A;  5ECO B;  3IR4 A;  1B48 A;  2K9F A;  3G7Y A;  2R0G A;  1OE7 A;  4OD7 A;  1DUG A;  5EY6 A;  5F07 A;  3GTU A;  1T3B A;  4BWQ A;  3MDK A;  3UVT A;  4J57 E;  2F9S A;  1YF1 A;  2IMD A;  2VLV A;  5GZZ B;  2A4H A;  4XS6 A;  2XBI A;  3UVH A;  1OC3 A;  5ID2 B;  1RK4 A;  3FZ9 A;  2XHF A;  2JL4 A;  4WBR D;  2LJA A;  1QUW A;  2WGR A;  3LSZ A;  1AQW A;  3ZMK A;  3FYG A;  3KMN A;  1BJX A;  3DML A;  1PX7 A;  1XOB A;  2A4V A;  3PPU A;  3GH9 A;  5ECK B;  3RBT A;  2R4V A;  3VPQ A;  1TRS A;  2LS5 A;  3KP9 A;  1YF0 A;  4TR1 B;  3LXZ A;  5HFG A;  2UZ8 A;  2J23 A;  3ZL5 A;  1B4Q A;  3VI7 A;  1CQG A;  3Q19 A;  1GSF A;  5G2Z A;  1U88 A;  2F8F A;  2AJQ B;  2YOI A;  4HZ2 A;  4MA9 A;  2YWI A;  4K1F A;  3FK8 A;  3H1N A;  4L0W A;  4LL4 B;  4I5Q A;  2ZUP A;  4G9H A;  5H5R A;  2H0I A;  1GSY A;  4PQI A;  5B6N A;  2LUS A;  2NPB A;  6GSY A;  5DVB A;  3LXT A;  5G1K A;  4IQA A;  5DAK A;  3J7Y b;  2KUC A;  4E8H A;  1SK2 A;  2HRF A;  1EGO A;  1A8L A;  2PVQ A;  1GSQ A;  4NMU A;  5INY A;  4N11 A;  2XC2 A;  3P2A A;  2B5E A;  3F3R A;  1A0R P;  5ELA A;  1O8X A;  3EMP A;  4K7O A;  2PGT A;  4YQV A;  1S3C A;  2Z9S A;  3ZIV A;  4DEJ A;  1AQX A;  1K0A A;  3DKS A;  3DXB A;  5KN3 A;  2B7J A;  4EC0 A;  2H1A A;  2BTO T;  2QA2 A;  5C04 A;  1TW9 A;  3APO A;  4YAV A;  4EDY A;  3GRX A;  1G7O A;  3I43 A;  1R5A A;  1U3I A;  5A5K A;  4HJ2 A;  4AF2 A;  2TRC P;  4O5U A;  1PSQ A;  3H4K A;  1ZGN A;  3O3T A;  1XOA A;  4L5O A;  3FZ5 A;  2H0G A;  2E2G A;  1MD4 A;  1GUH A;  2DSA A;  3DIE A;  3TOU A;  2C3N A;  2G2Q A;  5ECR B;  3ZYW A;  2MBT A;  3TRP A;  2GT5 A;  1J0F A;  5AIV A;  3TKS A;  16GS A;  2JAD A;  4GQF A;  1U3A A;  1TTZ A;  4ZL9 A;  1HQO A;  3SBC A;  3US3 A;  4HZ4 A;  4EL1 A;  3BBY A;  3WGD A;  2GVP A;  3HKR A;  5D9T A;  2C0E A;  3UEM A;  2YV9 A;  4ZBB A;  1PFO A;  3NIV A;  4K5S A;  2WJU A;  4ZL8 A;  5F0G A;  7GSS A;  1WMJ A;  3EE2 A;  2CVK A;  5J4U A;  2MMO A;  1Z6N A;  1FOH A;  4KSM A;  2C3T A;  2OBK A;  4MPG A;  2YCD A;  3QDN A;  1W89 A;  3IRA A;  5EL8 A;  2NVL A;  3NOF A;  1TU8 A;  5AN1 A;  3EC3 A;  3ZRD A;  1PKZ A;  3HVN A;  3TUE A;  2KOK A;  1R7H A;  3FY7 A;  4NPB A;  4XRD A;  5J5N A;  2P0G A;  1VGL A;  1GNW A;  4JED A;  4GQC A;  3Q6O A;  3CYN A;  1XVW A;  2P5R A;  4WEY A;  5J41 A;  5KOX A;  11GS A;  2WS2 A;  1OC9 A;  2JZR A;  2IPA A;  4ZBD A;  4KDU A;  5CRD A;  4E8E A;  4QL9 A;  2CA8 A;  9GSS A;  4L5L A;  3VWU A;  1XPV A;  2QC7 A;  4KA0 A;  2K18 A;  4OO5 A;  1TI3 A;  1MD3 A;  2LTK A;  5ECS A;  2A2S A;  2WCI A;  4EKZ A;  2V41 A;  4LMW A;  2DJ3 A;  1S3A A;  3IC8 A;  4J2F A;  3EIN A;  1A8Y A;  2HZE B;  3WT2 A;  1X5D A;  20GS A;  1KTE A;  5E4W A;  1QK8 A;  4ECC A;  4MF7 A;  5EVO A;  3C1R A;  3ZFB A;  1OAZ A;  3A5W A;  1EWX A;  4ICY A;  1W4V A;  1HYU A;  1MDI A;  4XTS A;  3QAG A;  1YEP A;  2V32 A;  4CHS A;  1F3A A;  3F4S A;  1U6T A;  3VWW A;  4KB3 A;  3LJR A;  4MF5 A;  4IN0 A;  5HFK A;  1T7P B;  2R6K A;  1M2A A;  3CBU A;  1ZYN A;  3HYP A;  3CRT A;  3F4R A;  3KD0 A;  2X49 A;  3I6A A;  5JCG A;  4RUV A;  4TR3 A;  4YKF A;  5E59 A;  2XPD A;  5EPF A;  3QMX A;  1YDK A;  4WF5 A;  2OAC A;  1G7E A;  1Z5Y E;  1XWB A;  3TCO A;  5B7C A;  3MSZ A;  1GTA A;  2V6K A;  2R5G A;  4KND A;  2DIZ A;  2L59 A;  1T4Z A;  3CXG A;  1B9X C;  5JWR B;  3TJB A;  4WF4 A;  2XBQ A;  2BMX A;  2VCQ A;  2VCV A;  3ZML A;  4F0B A;  2KLX A;  4O32 A;  3GKN A;  4PGT A;  4TOP A;  2V1M A;  1JZW A;  4NAX A;  4JU5 A;  4ZBA A;  2XPE A;  4POB A;  5ENU A;  3VI5 A;  1F9M A;  4WET A;  3NZN A;  5GAP D;  1QQ2 A;  1PD2 1;  3ERW A;  4LL1 B;  5IM9 A;  2IFQ B;  5D93 A;  3DRN A;  2GT6 A;  5GST A;  1GLP A;  3IC4 A;  1AQV A;  5DQY A;  3R3E A;  2TRX A;  2IIY A;  1BX9 A;  5IPG A;  4N10 A;  2GSR A;  1AIU A;  1ZMA A;  4H86 A;  5LCZ A;  2VL2 A;  2MMN A;  3ZIT A;  2YNX A;  1K0B A;  4NHW A;  2JZS A;  1K0D A;  3MWH A;  2DML A;  3VWV A;  5HFI A;  6GSS A;  1KNG A;  3ME8 A;  1OC9 B;  1E6B A;  2I81 A;  2CT6 A;  4ULX A;  1Z3E A;  4EDZ A;  3FR6 A;  1I9D A;  3PIN A;  3F63 A;  4OWY A;  3RPP A;  2EC4 A;  4EO3 A;  3GKM A;  4GRF A;  2VIM A;  1I5G A;  3TJF A;  3IAS 2;  4ECI A;  2HE3 A;  4TXO A;  4WR5 A;  1X9M B;  3IPZ A;  2GQM A;  2O8V B;  4I97 A;  5JCW A;  1HD2 A;  3LYK A;  3DWV A;  2FHE A;  4ZIJ A;  2VCW A;  3VPT A;  3FRC A;  4ZL7 A;  2MMZ A;  2X8H A;  1LU4 A;  2M72 A;  5H5S A;  3WD6 A;  1TOF A;  4G10 A;  3IXR A;  1FG4 A;  2IME A;  4L8E A;  3UIW A;  3OR5 A;  2EIR A;  3DVW A;  1RQM A;  2LV3 A;  4HSC X;  4WR4 A;  4MCU A;  5JCU A;  4PX1 A;  2DKH A;  1SD8 A;  1T1V A;  1XCC A;  3UAP A;  5ECI B;  1SL1 B;  4F2I A;  3L0H A;  5AGY A;  1XFL A;  5KN0 A;  19GS A;  1NM3 A;  2L57 A;  5COH A;  5L71 A;  3W6G A;  3ME7 A;  5A4V A;  2IMF A;  3TKS C;  4ML6 A;  4AGS A;  3GHA A;  2OE3 A;  3F9U A;  1ERW A;  4WKW A;  1C72 A;  4YAP A;  3J7Y k;  2C0G A;  2NBS A;  1WJK A;  1TRW A;  1V2A A;  5HR1 A;  2L5O A;  3KH9 A;  1T00 A;  1M9A A;  2AB6 A;  4N30 A;  10GS A;  2KHP A;  4V2M A;  2H71 A;  3D5J A;  2B7K A;  1TK5 B;  1USB A;  1JLW A;  3EMX A;  4FYC A;  1FB6 A;  1GUK A;  1M2D A;  4AJ7 A;  2LJK A;  4X4J A;  3GKK A;  3EWL A;  2JU5 A;  3LWA A;  4K6X A;  5IMZ A;  2FA8 A;  4MMM A;  5B8A A;  2OAD A;  3M3M A;  5D9X A;  1R5P A;  1OKD A;  1ZYE A;  3D4T A;  4KCE A;  4D73 A;  1Q98 A;  5LD0 A;  4MH3 A;  1S3D A;  4BL7 A;  1H75 A;  1AAZ A;  2RLI A;  1FHE A;  2REM A;  2L6D A;  3GL5 A;  4ACS A;  4KAE A;  2HRA A;  1EOH A;  3VFI A;  1ZL9 A;  4YH2 A;  2I9H A;  2GSQ A;  2GZY A;  1O73 A;  1UVZ A;  1YEX A;  1SK0 A;  4KGI A;  2L6C A;  1OE8 A;  2LKU A;  3QPM A;  1M9B A;  4GLT A;  2LRC A;  3HJO A;  4OCE A;  5CAX A;  3UL3 A;  2H73 A;  1N2A A;  2FWG A;  1THO A;  4FYU A;  2H19 A;  3GA4 A;  1URM A;  2VUP A;  2J9H A;  2M46 A;  1A24 A;  4K2X A;  4QQ7 A;  2V6O A;  1EP8 A;  5IO2 A;  2GS3 A;  2FGX A;  4DVC A;  2H72 A;  1SK1 A;  2R0C A;  3TDG A;  3FMW A;  1SYR A;  2L4Q A;  2CAI A;  2LQO A;  4MLY A;  3KZQ A;  2N5F A;  1M2B A;  1M0U A;  3D21 A;  4AJ6 A;  2HRK A;  3KJY A;  1WE0 A;  4OFN A;  4CY6 A;  1GSS A;  1LBK A;  1HNC A;  1Y6E A;  5G1L A;  2DJ0 A;  1GSD A;  1XWA A;  2CX3 A;  4MZB A;  2K8V A;  2H66 A;  5DAL A;  2VD1 A;  2LQQ A;  3GL3 A;  2FD3 A;  1EGR A;  3ZLP A;  4O5Q A;  3UBL A;  3D6I A;  3QAV A;  4HOJ A;  3C1S A;  4RI6 A;  1DE1 A;  4HDE A;  4CDO A;  2H1G A;  1F2E A;  2ZCT A;  3H79 A;  4I2U A;  3H93 A;  1VF2 A;  3E9J B;  3IBH A;  1VF3 A;  4YQU A;  1YQ1 A;  1ABA A;  4N0V A;  1DE2 A;  1GWC A;  3N5O A;  3F6D A;  3W8S A;  4ID0 A;  1K0N A;  2VO4 A;  5J9B A;  2F3M A;  4ECJ A;  3HVS A;  4EUY A;  5DDL A;  1XIY A;  5IMF A;  1EEJ A;  3MNG A;  1M3J A;  3CMI A;  3GX8 A;  1GSU A;  4LMV A;  4ZB8 A;  1H4O A;  4NV2 A;  4Q5Q A;  1BG5 A;  2IN3 A;  3F4T A;  3GMF A;  1WRY A;  5DBQ A;  1MEK A;  2VCX A;  2QKE A;  3ZIJ A;  3S9F A;  3GTU B;  3CSJ A;  2VD0 A;  3C73 A;  5HR3 A;  5IMA A;  5CYY A;  3LG6 A;  2JZT A;  3GV1 A;  5CRW A;  4ISD A;  2RUF A;  2RM5 A;  5G31 A;  5KEJ A;  6GSX A;  1QXH A;  4Q5F A;  2GDR A;  2VL2 C;  3KTL A;  4D73 B;  1ILO A;  1EOG A;  4Q5N A;  2N5A A;  4KDY A;  1NSW A;  3D4M A;  5G5F A;  3A2W A;  3EYT A;  2O7K A;  1XWC A;  5J3R A;  1VRS D;  2L5L A;  2HYX A;  2HLS A;  14GS A;  3L78 A;  2CX4 A;  3F0I A;  3VLN A;  4XS4 A;  3JCM L;  1X9W B;  3APS A;  1G6Y A;  1SEN A;  1XBS A;  1UN2 A;  1X5E A;  4HQS A;  2CAQ A;  5IIZ A;  1O8W A;  1QGV A;  2HT9 A;  2JSY A;  2PBJ A;  3ERG A;  4A5P A;  1M99 A;  2WUL A;  3L9V A;  2C1Y A;  2F51 A;  5ECM B;  5B6M A;  3GH6 A;  4YQM A;  1PL2 A;  2CV4 A;  4N0Z A;  1U87 A;  2VOC A;  2C0D A;  1NW2 A;  2R0P A;  5CO3 A;  3HZ8 A;  2C4J A;  5DAK B;  3KEB A;  2QGV A;  4ZB6 A;  4ZB9 A;  2HI7 A;  2VCZ A;  2O87 A;  1ML6 A;  2H1D A;  2YJH A;  2ES7 A;  2CZ3 A;  4MPF A;  1TRV A;  4V2N A;  3TJG A;  3KCM A;  4EF0 A;  1XWG A;  4MDC A;  1PMT A;  2GQL A;  4PNF A;  2E0Q A;  4FYB A;  4FQU A;  3M1G A;  1GTB A;  2FWE A;  4DSS A;  4ML1 A;  3WGE A;  2X4A A;  17GS A;  3KIJ A;  1K3Y A;  1TDI A;  2CZ2 A;  3IV4 A;  5ECL B;  3ISO A;  2AHE A;  4GCI A;  1XXU A;  3MYD A;  2HRN A;  4JE1 A;  1A2L A;  4TR4 A;  3TJJ A;  2VL3 A;  4KE3 A;  2VLU A;  2D2Z A;  2B1L A;  4HS1 A;  2F8A A;  3BD2 A;  2R2J A;  4GSS A;  3ZZX A;  4F03 A;  3LOR A;  3F8U A;  5IMC A;  5G5E A;  1FO5 A;  5KN2 A;  1T4Y A;  1JZD A;  22GS A;  4RQR A;  3O6T A;  5D73 A;  2H6Y A;  4MNN A;  3U5R E;  2IL3 A;  1ZCP A;  3UBK A;  5IOX A;  2MYG A;  5D9V A;  2X8C A;  1EZK A;  3QFA C;  2X64 A;  2LST A;  2WFC A;  1EV4 A;  2NDO A;  4X1U A;  2HFD A;  5H5Q A;  4RI7 A;  4O7H A;  1K0O A;  5IPH A;  4TXV A;  2OJL A;  6GSV A;  2OE1 A;  3M0F A;  5D8I A;  1CQH A;  3C7M A;  1FB0 A;  4IW9 A;  1GUL A;  5G30 A;  2TIR A;  4BWS A;  2RII A;  4Z7X A;  2PU9 C;  2WZ9 A;  3CSI A;  1K3O A;  4POK A;  5BMU A;  4PQH A;  2R37 A;  3GFK A;  5ID2 A;  4NHZ A;  2MBS A;  1GTU A;  2RM6 A;  2FWF A;  3LYP A;  3VUR A;  2FCH A;  2P5Q A;  5ABR A;  5LNK e;  1B4P A;  4JRR A;  3QOU A;  1NHO A;  2O85 A;  4TN8 A;  1TRU A;  5GSS A;  1SD9 A;  2B1K A;  2GZP A;  1RW1 A;  3GN3 A;  3BOA A;  4F82 A;  1UA5 A;  5CRG A;  3UJ1 A;  2DJJ A;  4TR1 A;  5BRT A;  2MMA A;  4K0G A;  4G19 A;  2NTO A;  5DJL A;  1WPI A;  3M9J A;  4GSN A;  3I69 A;  4JZQ A;  5DCH A;  1TJD A;  4IJ3 A;  4O5R A;  3KTB A;  5AIS A;  1O85 A;  1Z7P A;  4G0L A;  2FNO A;  1BYE A;  1E2Y A;  2JAC A;  3HD5 A;  3KH7 A;  1FVJ A;  3C8E A;  1M7T A;  2HXK A;  3D0Z A;  3RPN A;  5ECN B;  4IVF A;  4IP6 A;  5D9W A;  4EIQ A;  1BQ7 A;  3F6F A;  3RHC A;  4K0N A;  1PKW A;  4MF6 A;  4IEL A;  2P31 A;  3V1W A;  2IMK A;  4MJA A;  1QFN A;  4HU9 A;  3TJK A;  1BAY A;  2DKI A;  3ZVJ D;  2YAN A;  2GZZ A;  2MZC A;  1IYH A;  3FW2 A;  4F9Z A;  6GSW A;  1MDK A;  4OO4 A;  3LEF A;  1X9S B;  5IMD A;  4G0I A;  3U6V A;  2KP1 A;  1XZO A;  5D96 A;  1A0F A;  1S3R A;  1TXX A;  2DC5 A;  1R4W A;  3WT1 A;  3CSH A;  3LFL A;  1JLV A;  3G7J A;  4PTS A;  1OC8 A;  3W8J A;  2R3X A;  2YZH A;  4HEA 2;  2H6Z A;  1GUM A;  4USS A;  1ST9 A;  3R2Q A;  4PUF C;  2YWN A;  4Q5R A;  1ZZY A;  4XIH A; 
#chains in the Genus database with same CATH homology
 3ZTL A;  3WYW A;  1G0T A;  4I8B A;  8GSS A;  13GS A;  3FHK A;  4PNG A;  4IBP A;  4OCF A;  1SL2 B;  3GX0 A;  1UC7 A;  4GXZ A;  4Z2U A;  2HSY A;  2VM1 A;  2LNT A;  3BJ5 A;  2ZNM A;  2OA7 A;  3HDC A;  3CTG A;  4K5R A;  2H8L A;  3QR6 A;  1Q4J A;  3N9J A;  4V1A p;  3TKR A;  2YWO A;  2I4A A;  2N5B A;  4NWY A;  2IJY A;  2WRT A;  1GLQ A;  4KSO A;  1THX A;  2LEG A;  2E7P A;  1XW5 A;  2A2P A;  4KX4 A;  2B3S A;  3GSS A;  4P3Y B;  4NV5 A;  4K2D A;  1JHB A;  4DSR A;  4EE0 A;  1GSE A;  1SKR B;  3IK9 A;  5J9C A;  2O89 A;  3GST A;  4FH8 A;  4PUR A;  4K9Z A;  3HHV A;  1FVK A;  5F06 A;  4GWR A;  1FW1 A;  2AAW A;  2YJ7 A;  1PL1 A;  2PVO C;  2EIQ A;  1O7U A;  1A23 A;  2FY6 A;  1T8E B;  3QCP A;  3ZRE A;  2PMT A;  3K8N A;  5ELG A;  3PGT A;  3Q18 A;  1JZR A;  4KF9 A;  4EIP A;  4TXO B;  4G2E A;  2ON7 A;  3Q74 A;  4IJI A;  4XRA A;  1XW6 A;  3D22 A;  1VF1 A;  5DCG A;  3MIX A;  3BCI A;  3CRU A;  2H0H A;  4KUN A;  4IHU A;  1V57 A;  1F6M C;  3GIX A;  2HZE A;  5ECQ B;  2DJK A;  2HZF A;  2YV7 A;  3A2V A;  3KXO A;  3TB2 A;  1YKA A;  4RQX A;  2GQK A;  5GAN D;  4TR0 A;  1HNA A;  4FIW A;  3LGC A;  1XVQ A;  2VM2 A;  3KP8 A;  3FKF A;  5HR0 A;  4ZXG A;  2OE0 A;  4MP4 A;  1WWJ A;  3RDW A;  1KEB A;  1KBN A;  5HQP A;  3E3E A;  2VLT A;  5F8B A;  2LRT A;  1GRX A;  4BVX A;  1SYX A;  2E2M A;  5AIX A;  3GUS A;  3E0U A;  1V58 A;  4OMV A;  3RAZ A;  1TU7 A;  3RHB A;  3L4N A;  2DMM A;  1GH2 A;  3VK9 A;  1EEM A;  5IO0 A;  1SJ6 A;  4JBB A;  4MZW A;  4XCS A;  4WXT A;  1PN0 A;  2C80 A;  4K7N A;  4HQZ A;  5JWQ B;  1K0C A;  1GL8 A;  3EU3 A;  1K3L A;  4PXO A;  2X8G A;  3FR3 A;  1K0M A;  4HJM A;  5F05 A;  6GSU A;  2C8U A;  2VL9 A;  3TKQ A;  4BA7 A;  3SWL A;  1Y25 A;  4ZIL A;  4MK3 A;  3IAM 2;  1X5C A;  3IK7 A;  1AUC A;  2CQ9 A;  4G0K A;  2WB9 A;  3TGZ A;  2AV4 A;  1A2M A;  4OFT A;  1GP1 A;  1YJ6 A;  1FAA A;  4BL7 B;  1JZO A;  1PQN A;  2V2G A;  2LJR A;  5KOW A;  4HI7 A;  3QAW A;  1V9W A;  2YN1 A;  1AXD A;  4FO5 A;  1HNB A;  2IFQ A;  3P90 A;  4PQ1 A;  4CW9 A;  3C71 A;  3FR9 A;  6GST A;  1Z6M A;  3A2X A;  4MJB A;  1OKT A;  3M8N A;  1O81 A;  2K8S A;  2C0F A;  1B9Y C;  2G0F A;  3A5I A;  4MZC A;  4Z2R A;  3GYK A;  1SL0 B;  2PPT A;  3HY2 A;  3A3T A;  1AW9 A;  2H76 A;  1QMV A;  1G6W A;  1R26 A;  3VWX A;  2GSS A;  2H75 A;  4PUA A;  1YY7 A;  4V1A g;  3G9B A;  1J08 A;  2VCT A;  4IQ1 A;  1YZX A;  3MAK A;  2YZU A;  4AJ8 A;  2CVB A;  3EPT A;  3WGX A;  2FUG 2;  1LJR A;  4K7I A;  2B5Y A;  3EUR A;  1BED A;  3DD3 A;  2PWJ A;  4GST A;  1TI1 A;  4J56 E;  3HVV A;  5JWO B;  2OBI A;  5CNW A;  2FLS A;  3FZ4 A;  2CVD A;  4ILF A;  2DBC A;  3TRQ A;  4I6X A;  2DJ1 A;  3TKP A;  2BJX A;  1TK8 B;  3IHG A;  2C3Q A;  2PN8 A;  4MJC A;  5DAL B;  1VF4 A;  2EIO A;  3G7I A;  2QSI A;  1WP0 A;  4IKH A;  4F0C A;  1TK0 B;  3ZVJ A;  1GTI A;  2IMI A;  1A2J A;  1ERV A;  3FEU A;  4DSQ A;  5HR2 A;  1N8J A;  4O92 A;  4EXJ A;  4BVX B;  3CTF A;  1O6J A;  5A4W A;  3UAR A;  4KW6 A;  1JFU A;  3P8W A;  1F3B A;  2DIY A;  3DEX A;  1DSB A;  3QFB C;  2AYT A;  2LNS A;  1PX6 A;  3IDV A;  2AUV A;  1PRX A;  3LQ7 A;  4EVM A;  2HSM A;  4BPY A;  4MAB A;  4BVY A;  3UMA A;  2VAF A;  5B8B A;  3HVX A;  3PR8 A;  2I3Y A;  1MDJ A;  1NHY A;  5A4U A;  1EV9 A;  2FA4 A;  12GS A;  4XS1 A;  4KH7 A;  3TRX A;  4YKG A;  2GTU A;  3KM6 A;  2H70 A;  3DYR A;  3L9U A;  4I2T A;  3ZFL A;  3DVX A;  4K8M A;  1X0R A;  2WDU A;  3IA1 A;  18GS A;  4KDX A;  1V98 A;  2H74 A;  3GNJ A;  3HA9 A;  4POM A;  1Z9H A;  1V40 A;  3AY8 A;  1F37 A;  4IS0 A;  4TW5 A;  4XHM A;  4XS4 B;  3GUR A;  1WOU A;  4TVE A;  4QL7 A;  1FOV A;  1SJI A;  2HNL A;  1XW9 A;  1AC1 A;  1MTC A;  3LW9 A;  4HU7 A;  4JR4 A;  4LLR A;  4OFM A;  1PN9 A;  1SJZ A;  5DQS A;  4Z2T A;  1PA3 A;  3P7X A;  1ON4 A;  3IHQ A;  4NXI A;  3FZA A;  3O76 A;  3GKX A;  1SU9 A;  1ZYP A;  5IMV A;  2YPM A;  4TKY A;  4IGJ A;  1TP9 A;  2OKA A;  3IE3 A;  4MJE A;  2GGT A;  3HCZ A;  3I9V 2;  1WIK A;  3F3Q A;  2QA1 A;  3H8Q A;  5DJM A;  1EP7 A;  2H01 A;  1OVN A;  3TKS E;  3QD9 A;  2L4C A;  4X0X A;  2HSH A;  2IWT A;  4LA1 A;  2RUE A;  5FHI A;  1SKW B;  5C00 A;  2DJ2 A;  2GLR A;  2B5X A;  1DBY A;  3TOT A;  3L9S A;  1PGT A;  3HZ4 A;  1Z7R A;  3PH9 A;  3KGK A;  5IOW A;  2A2R A;  1ZYQ B;  4JR6 A;  4MH2 A;  2PUK C;  3UOM A;  1J9B A;  4POL A;  4IP1 A;  4TRX A;  4DSS B;  5FWG A;  1OYJ A;  2K6V A;  2H1B A;  5ECH B;  4L0U A;  1B8X A;  2PER A;  2X99 A;  4HUA A;  2I1U A;  2YP6 A;  4V2L A;  3EU4 A;  2JSZ A;  1YKC A;  2ALB A;  3EVI A;  3HJP A;  2B6M A;  2DLX A;  3ED3 A;  2M80 A;  4WBJ A;  1ACV A;  1TKD B;  2FWH A;  4GTU A;  1XWK A;  3ERF A;  4BVY B;  3HJM A;  1IYI A;  1ERU A;  5IQY A;  4X43 A;  1ZOF A;  5CRE A;  3HXS A;  4ECB A;  5FT3 A;  5KN1 A;  2KP2 A;  1ERT A;  4CY8 A;  1SKS B;  2ON5 A;  2YWM A;  5CP1 A;  5ECP B;  2H6X A;  4GF0 A;  4KCA A;  3BCK A;  5CRH A;  3APQ A;  2GST A;  2H30 A;  3DGQ A;  3KMO A;  3IOS A;  1GNE A;  2LRN A;  3M9K A;  5ECO B;  3IR4 A;  1B48 A;  2K9F A;  3G7Y A;  2R0G A;  1OE7 A;  4OD7 A;  1DUG A;  5EY6 A;  5F07 A;  3GTU A;  1T3B A;  4BWQ A;  3MDK A;  3UVT A;  4J57 E;  2F9S A;  1YF1 A;  2IMD A;  2VLV A;  5GZZ B;  2A4H A;  4XS6 A;  2XBI A;  3UVH A;  1OC3 A;  5ID2 B;  1RK4 A;  3FZ9 A;  2XHF A;  2JL4 A;  4WBR D;  2LJA A;  1QUW A;  2WGR A;  3LSZ A;  1AQW A;  3ZMK A;  3FYG A;  3KMN A;  1BJX A;  3DML A;  1PX7 A;  1XOB A;  2A4V A;  3PPU A;  3GH9 A;  5ECK B;  3RBT A;  2R4V A;  3VPQ A;  1TRS A;  2LS5 A;  3KP9 A;  1YF0 A;  4TR1 B;  3LXZ A;  5HFG A;  2UZ8 A;  2J23 A;  3ZL5 A;  1B4Q A;  3VI7 A;  1CQG A;  3Q19 A;  1GSF A;  5G2Z A;  1U88 A;  2F8F A;  2AJQ B;  2YOI A;  4HZ2 A;  4MA9 A;  2YWI A;  4K1F A;  3FK8 A;  3H1N A;  4L0W A;  4LL4 B;  4I5Q A;  2ZUP A;  4G9H A;  5H5R A;  2H0I A;  1GSY A;  4PQI A;  5B6N A;  2LUS A;  2NPB A;  6GSY A;  5DVB A;  3LXT A;  5G1K A;  4IQA A;  5DAK A;  3J7Y b;  2KUC A;  4E8H A;  1SK2 A;  2HRF A;  1EGO A;  1A8L A;  2PVQ A;  1GSQ A;  4NMU A;  5INY A;  4N11 A;  2XC2 A;  3P2A A;  2B5E A;  3F3R A;  1A0R P;  5ELA A;  1O8X A;  3EMP A;  4K7O A;  2PGT A;  4YQV A;  1S3C A;  2Z9S A;  3ZIV A;  4DEJ A;  1AQX A;  1K0A A;  3DKS A;  3DXB A;  5KN3 A;  2B7J A;  4EC0 A;  2H1A A;  2BTO T;  2QA2 A;  5C04 A;  1TW9 A;  3APO A;  4YAV A;  4EDY A;  3GRX A;  1G7O A;  3I43 A;  1R5A A;  1U3I A;  5A5K A;  4HJ2 A;  4AF2 A;  2TRC P;  4O5U A;  1PSQ A;  3H4K A;  1ZGN A;  3O3T A;  1XOA A;  4L5O A;  3FZ5 A;  2H0G A;  2E2G A;  1MD4 A;  1GUH A;  2DSA A;  3DIE A;  3TOU A;  2C3N A;  2G2Q A;  5ECR B;  3ZYW A;  2MBT A;  3TRP A;  2GT5 A;  1J0F A;  5AIV A;  3TKS A;  16GS A;  2JAD A;  4GQF A;  1U3A A;  1TTZ A;  4ZL9 A;  1HQO A;  3SBC A;  3US3 A;  4HZ4 A;  4EL1 A;  3BBY A;  3WGD A;  2GVP A;  3HKR A;  5D9T A;  2C0E A;  3UEM A;  2YV9 A;  4ZBB A;  3NIV A;  4K5S A;  2WJU A;  4ZL8 A;  5F0G A;  7GSS A;  1WMJ A;  3EE2 A;  2CVK A;  5J4U A;  2MMO A;  1Z6N A;  1FOH A;  4KSM A;  2C3T A;  2OBK A;  4MPG A;  2YCD A;  3QDN A;  1W89 A;  3IRA A;  5EL8 A;  2NVL A;  3NOF A;  1TU8 A;  5AN1 A;  3EC3 A;  3ZRD A;  1PKZ A;  3TUE A;  2KOK A;  1R7H A;  3FY7 A;  4NPB A;  4XRD A;  5J5N A;  2P0G A;  1VGL A;  1GNW A;  4JED A;  4GQC A;  3Q6O A;  3CYN A;  1XVW A;  2P5R A;  4WEY A;  5J41 A;  5KOX A;  11GS A;  2WS2 A;  1OC9 A;  2JZR A;  2IPA A;  4ZBD A;  4KDU A;  5CRD A;  4E8E A;  4QL9 A;  2CA8 A;  9GSS A;  4L5L A;  3VWU A;  1XPV A;  2QC7 A;  4KA0 A;  2K18 A;  4OO5 A;  1TI3 A;  1MD3 A;  2LTK A;  5ECS A;  2A2S A;  2WCI A;  4EKZ A;  2V41 A;  4LMW A;  2DJ3 A;  1S3A A;  3IC8 A;  4J2F A;  3EIN A;  1A8Y A;  2HZE B;  3WT2 A;  1X5D A;  20GS A;  1KTE A;  5E4W A;  1QK8 A;  4ECC A;  4MF7 A;  5EVO A;  3C1R A;  3ZFB A;  1OAZ A;  3A5W A;  1EWX A;  4ICY A;  1W4V A;  1HYU A;  1MDI A;  4XTS A;  3QAG A;  1YEP A;  2V32 A;  4CHS A;  1F3A A;  3F4S A;  1U6T A;  3VWW A;  4KB3 A;  3LJR A;  4MF5 A;  4IN0 A;  5HFK A;  1T7P B;  2R6K A;  1M2A A;  3CBU A;  1ZYN A;  3HYP A;  3CRT A;  3F4R A;  3KD0 A;  2X49 A;  3I6A A;  5JCG A;  4RUV A;  4TR3 A;  4YKF A;  5E59 A;  2XPD A;  5EPF A;  3QMX A;  1YDK A;  4WF5 A;  2OAC A;  1G7E A;  1Z5Y E;  1XWB A;  3TCO A;  5B7C A;  3MSZ A;  1GTA A;  2V6K A;  2R5G A;  4KND A;  2DIZ A;  2L59 A;  1T4Z A;  3CXG A;  1B9X C;  5JWR B;  3TJB A;  4WF4 A;  2XBQ A;  2BMX A;  2VCQ A;  2VCV A;  3ZML A;  4F0B A;  2KLX A;  4O32 A;  3GKN A;  4PGT A;  4TOP A;  2V1M A;  1JZW A;  4NAX A;  4JU5 A;  4ZBA A;  2XPE A;  4POB A;  5ENU A;  3VI5 A;  1F9M A;  4WET A;  3NZN A;  5GAP D;  1QQ2 A;  1PD2 1;  3ERW A;  4LL1 B;  5IM9 A;  2IFQ B;  5D93 A;  3DRN A;  2GT6 A;  5GST A;  1GLP A;  3IC4 A;  1AQV A;  5DQY A;  3R3E A;  2TRX A;  2IIY A;  1BX9 A;  5IPG A;  4N10 A;  2GSR A;  1AIU A;  1ZMA A;  4H86 A;  5LCZ A;  2VL2 A;  2MMN A;  3ZIT A;  2YNX A;  1K0B A;  4NHW A;  2JZS A;  1K0D A;  3MWH A;  2DML A;  3VWV A;  5HFI A;  6GSS A;  1KNG A;  3ME8 A;  1OC9 B;  1E6B A;  2I81 A;  2CT6 A;  4ULX A;  1Z3E A;  4EDZ A;  3FR6 A;  1I9D A;  3PIN A;  3F63 A;  4OWY A;  3RPP A;  2EC4 A;  4EO3 A;  3GKM A;  4GRF A;  2VIM A;  1I5G A;  3TJF A;  3IAS 2;  4ECI A;  2HE3 A;  4TXO A;  4WR5 A;  1X9M B;  3IPZ A;  2GQM A;  2O8V B;  4I97 A;  5JCW A;  1HD2 A;  3LYK A;  3DWV A;  2FHE A;  4ZIJ A;  2VCW A;  3VPT A;  3FRC A;  4ZL7 A;  2MMZ A;  2X8H A;  1LU4 A;  2M72 A;  5H5S A;  3WD6 A;  1TOF A;  4G10 A;  3IXR A;  1FG4 A;  2IME A;  4L8E A;  3UIW A;  3OR5 A;  2EIR A;  3DVW A;  1RQM A;  2LV3 A;  4WR4 A;  4MCU A;  5JCU A;  4PX1 A;  2DKH A;  1SD8 A;  1T1V A;  1XCC A;  3UAP A;  5ECI B;  1SL1 B;  4F2I A;  3L0H A;  5AGY A;  1XFL A;  5KN0 A;  19GS A;  1NM3 A;  2L57 A;  5COH A;  5L71 A;  3W6G A;  3ME7 A;  5A4V A;  2IMF A;  3TKS C;  4ML6 A;  4AGS A;  3GHA A;  2OE3 A;  3F9U A;  1ERW A;  4WKW A;  1C72 A;  4YAP A;  3J7Y k;  2C0G A;  2NBS A;  1WJK A;  1TRW A;  1V2A A;  5HR1 A;  2L5O A;  3KH9 A;  1T00 A;  1M9A A;  2AB6 A;  4N30 A;  10GS A;  2KHP A;  4V2M A;  2H71 A;  3D5J A;  2B7K A;  1TK5 B;  1USB A;  1JLW A;  3EMX A;  4FYC A;  1FB6 A;  1GUK A;  1M2D A;  4AJ7 A;  2LJK A;  4X4J A;  3GKK A;  3EWL A;  2JU5 A;  3LWA A;  4K6X A;  5IMZ A;  2FA8 A;  4MMM A;  5B8A A;  2OAD A;  3M3M A;  5D9X A;  1R5P A;  1OKD A;  1ZYE A;  3D4T A;  4KCE A;  4D73 A;  1Q98 A;  5LD0 A;  4MH3 A;  1S3D A;  4BL7 A;  1H75 A;  1AAZ A;  2RLI A;  1FHE A;  2REM A;  2L6D A;  3GL5 A;  4ACS A;  4KAE A;  2HRA A;  1EOH A;  3VFI A;  1ZL9 A;  4YH2 A;  2I9H A;  2GSQ A;  2GZY A;  1O73 A;  1UVZ A;  1YEX A;  1SK0 A;  4KGI A;  2L6C A;  1OE8 A;  2LKU A;  3QPM A;  1M9B A;  4GLT A;  2LRC A;  3HJO A;  4OCE A;  5CAX A;  3UL3 A;  2H73 A;  1N2A A;  2FWG A;  1THO A;  4FYU A;  2H19 A;  3GA4 A;  1URM A;  2VUP A;  2J9H A;  2M46 A;  1A24 A;  4K2X A;  4QQ7 A;  2V6O A;  1EP8 A;  5IO2 A;  2GS3 A;  2FGX A;  4DVC A;  2H72 A;  1SK1 A;  2R0C A;  3TDG A;  3FMW A;  1SYR A;  2L4Q A;  2CAI A;  2LQO A;  4MLY A;  3KZQ A;  2N5F A;  1M2B A;  1M0U A;  3D21 A;  4AJ6 A;  2HRK A;  3KJY A;  1WE0 A;  4OFN A;  4CY6 A;  1GSS A;  1LBK A;  1HNC A;  1Y6E A;  5G1L A;  2DJ0 A;  1GSD A;  1XWA A;  2CX3 A;  4MZB A;  2K8V A;  2H66 A;  5DAL A;  2VD1 A;  2LQQ A;  3GL3 A;  2FD3 A;  1EGR A;  3ZLP A;  4O5Q A;  3UBL A;  3D6I A;  3QAV A;  4HOJ A;  3C1S A;  4RI6 A;  1DE1 A;  4HDE A;  4CDO A;  2H1G A;  1F2E A;  2ZCT A;  3H79 A;  4I2U A;  3H93 A;  1VF2 A;  3E9J B;  3IBH A;  1VF3 A;  4YQU A;  1YQ1 A;  1ABA A;  4N0V A;  1DE2 A;  1GWC A;  3N5O A;  3F6D A;  3W8S A;  4ID0 A;  1K0N A;  2VO4 A;  5J9B A;  2F3M A;  4ECJ A;  3HVS A;  4EUY A;  5DDL A;  1XIY A;  5IMF A;  1EEJ A;  3MNG A;  3CMI A;  3GX8 A;  1GSU A;  4LMV A;  4ZB8 A;  1H4O A;  4NV2 A;  4Q5Q A;  1BG5 A;  2IN3 A;  3F4T A;  3GMF A;  1WRY A;  5DBQ A;  1MEK A;  2VCX A;  2QKE A;  3ZIJ A;  3S9F A;  3GTU B;  3CSJ A;  2VD0 A;  3C73 A;  5HR3 A;  5IMA A;  5CYY A;  3LG6 A;  2JZT A;  3GV1 A;  5CRW A;  4ISD A;  2RUF A;  2RM5 A;  5G31 A;  5KEJ A;  6GSX A;  1QXH A;  4Q5F A;  2GDR A;  2VL2 C;  3KTL A;  4D73 B;  1ILO A;  1EOG A;  4Q5N A;  2N5A A;  4KDY A;  1NSW A;  3D4M A;  5G5F A;  3A2W A;  3EYT A;  2O7K A;  1XWC A;  5J3R A;  1VRS D;  2L5L A;  2HYX A;  2HLS A;  14GS A;  3L78 A;  2CX4 A;  3F0I A;  3VLN A;  4XS4 A;  3JCM L;  1X9W B;  3APS A;  1G6Y A;  1SEN A;  1XBS A;  1UN2 A;  1X5E A;  4HQS A;  2CAQ A;  5IIZ A;  1O8W A;  1QGV A;  2HT9 A;  2JSY A;  2PBJ A;  3ERG A;  4A5P A;  1M99 A;  2WUL A;  3L9V A;  2C1Y A;  2F51 A;  5ECM B;  5B6M A;  3GH6 A;  4YQM A;  1PL2 A;  2CV4 A;  4N0Z A;  1U87 A;  2VOC A;  2C0D A;  1NW2 A;  2R0P A;  5CO3 A;  3HZ8 A;  2C4J A;  5DAK B;  3KEB A;  2QGV A;  4ZB6 A;  4ZB9 A;  2HI7 A;  2VCZ A;  2O87 A;  1ML6 A;  2H1D A;  2YJH A;  2ES7 A;  2CZ3 A;  4MPF A;  1TRV A;  4V2N A;  3TJG A;  3KCM A;  4EF0 A;  1XWG A;  4MDC A;  1PMT A;  2GQL A;  4PNF A;  2E0Q A;  4FYB A;  4FQU A;  3M1G A;  1GTB A;  2FWE A;  4DSS A;  4ML1 A;  3WGE A;  2X4A A;  17GS A;  3KIJ A;  1K3Y A;  1TDI A;  2CZ2 A;  3IV4 A;  5ECL B;  3ISO A;  2AHE A;  4GCI A;  1XXU A;  3MYD A;  2HRN A;  4JE1 A;  1A2L A;  4TR4 A;  3TJJ A;  2VL3 A;  4KE3 A;  2VLU A;  2D2Z A;  2B1L A;  4HS1 A;  2F8A A;  3BD2 A;  2R2J A;  4GSS A;  3ZZX A;  4F03 A;  3LOR A;  3F8U A;  5IMC A;  5G5E A;  1FO5 A;  5KN2 A;  1T4Y A;  1JZD A;  22GS A;  4RQR A;  3O6T A;  5D73 A;  2H6Y A;  4MNN A;  3U5R E;  2IL3 A;  1ZCP A;  3UBK A;  5IOX A;  2MYG A;  5D9V A;  2X8C A;  1EZK A;  3QFA C;  2X64 A;  2LST A;  2WFC A;  1EV4 A;  2NDO A;  4X1U A;  2HFD A;  5H5Q A;  4RI7 A;  4O7H A;  1K0O A;  5IPH A;  4TXV A;  2OJL A;  6GSV A;  2OE1 A;  3M0F A;  5D8I A;  1CQH A;  3C7M A;  1FB0 A;  4IW9 A;  1GUL A;  5G30 A;  2TIR A;  4BWS A;  2RII A;  4Z7X A;  2PU9 C;  2WZ9 A;  3CSI A;  1K3O A;  4POK A;  5BMU A;  4PQH A;  2R37 A;  3GFK A;  5ID2 A;  4NHZ A;  2MBS A;  1GTU A;  2RM6 A;  2FWF A;  3LYP A;  3VUR A;  2FCH A;  2P5Q A;  5ABR A;  5LNK e;  1B4P A;  4JRR A;  3QOU A;  1NHO A;  2O85 A;  4TN8 A;  1TRU A;  5GSS A;  1SD9 A;  2B1K A;  2GZP A;  1RW1 A;  3GN3 A;  3BOA A;  4F82 A;  1UA5 A;  5CRG A;  3UJ1 A;  2DJJ A;  4TR1 A;  5BRT A;  2MMA A;  4K0G A;  4G19 A;  2NTO A;  5DJL A;  1WPI A;  3M9J A;  4GSN A;  3I69 A;  4JZQ A;  5DCH A;  1TJD A;  4IJ3 A;  4O5R A;  3KTB A;  5AIS A;  1O85 A;  1Z7P A;  4G0L A;  2FNO A;  1BYE A;  1E2Y A;  2JAC A;  3HD5 A;  3KH7 A;  1FVJ A;  3C8E A;  1M7T A;  2HXK A;  3D0Z A;  3RPN A;  5ECN B;  4IVF A;  4IP6 A;  5D9W A;  4EIQ A;  1BQ7 A;  3F6F A;  3RHC A;  4K0N A;  1PKW A;  4MF6 A;  4IEL A;  2P31 A;  3V1W A;  2IMK A;  4MJA A;  1QFN A;  4HU9 A;  3TJK A;  1BAY A;  2DKI A;  3ZVJ D;  2YAN A;  2GZZ A;  2MZC A;  1IYH A;  3FW2 A;  4F9Z A;  6GSW A;  1MDK A;  4OO4 A;  3LEF A;  1X9S B;  5IMD A;  4G0I A;  3U6V A;  2KP1 A;  1XZO A;  5D96 A;  1A0F A;  1TXX A;  2DC5 A;  1R4W A;  3WT1 A;  3CSH A;  3LFL A;  1JLV A;  3G7J A;  4PTS A;  1OC8 A;  3W8J A;  2R3X A;  2YZH A;  4HEA 2;  2H6Z A;  1GUM A;  4USS A;  1ST9 A;  3R2Q A;  4PUF C;  2YWN A;  4Q5R A;  1ZZY A;  4XIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...