2VL2A

Oxidized and reduced forms of human peroxiredoxin 5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
161
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN-5
publication title The Crystal Structures of Oxidized Forms of Human Peroxiredoxin 5 with an Intramolecular Disulfide Bond Confirm the Proposed Enzymatic Mechanism for Atypical 2-Cys Peroxiredoxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 161
sequence length 162
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vl2A00
2OACA 5DALB 1UN2A 3CTFA 3TKQA 2JACA 3CSJA 2JZSA 2BMXA 4OD7A 1GSSA 5E59A 3F3RA 4X1UA 5IO0A 3C71A 5IPGA 3VPTA 1NHYA 1FHEA 1YY7A 1ERWA 3I43A 2PVOC 4MDCA 3D5JA 3FZ5A 3HZ4A 4EXJA 4O7HA 4NHWA 4IELA 4GXZA 4CHSA 2TRXA 2MMOA 2MYGA 4MF5A 1H75A 2I9HA 5D9VA 2XC2A 5D96A 1PL1A 2OBIA 4RQRA 1BQ7A 1HNAA 1TXXA 4ZL9A 3ME8A 2VD1A 1WE0A 5FWGA 4WBRD 1TK5B 5D9XA 2A2RA 2IMDA 5ID2A 3ME7A 4XS1A 1M2BA 4XRDA 3IK9A 2AAWA 2DJJA 3VWUA 4DSSB 3G7JA 3J7Yk 2H6ZA 1GUMA 4RI7A 1F9MA 3IPZA 1EGOA 2PN8A 3GFKA 4IP1A 2YV9A 2QKEA 4YQMA 3BCKA 1K0AA 1U88A 2VAFA 1NW2A 2V32A 2V6KA 2C80A 3MSZA 4LA1A 1ZL9A 4GSSA 4EC0A 4DSRA 3GTUA 5ECQB 5ECOB 3UL3A 5INYA 1XCCA 6GSYA 4GQFA 4MJEA 4RI6A 2HZFA 1RK4A 4G9HA 1OE8A 1X5DA 3C1SA 3F4SA 2DJKA 1OE7A 1TJDA 5D73A 5ECKB 1M9BA 1R7HA 5DAKA 5J5NA 3H8QA 1TI3A 4ECCA 1TK8B 2HSHA 1XWKA 1A2MA 5J9CA 5DBQA 1M99A 3CSHA 1EP7A 2NTOA 2CQ9A 1PQNA 3ZVJA 1X9WB 2GT6A 4MCUA 3D21A 5H5RA 2FD3A 2OE0A 4TVEA 1ERVA 2H6XA 8GSSA 4HU7A 5KN2A 3D4TA 4HJMA 1OAZA 1G7OA 2WDUA 2FWFA 3FZ4A 2J9HA 3KZQA 3DGQA 3HHVA 2RUEA 1ZYEA 5ELGA 1AIUA 1MDJA 5IPHA 4TXOB 2YNXA 3TUEA 1QQ2A 4K8MA 1M7TA 2HLSA 1ZCPA 2AYTA 2I3YA 2NBSA 2GQLA 1XWBA 5IMCA 4X43A 1T4ZA 1FOVA 3IRAA 4OFTA 2CZ2A 3QDNA 5HFIA 3ZIVA 5LNKe 2YZHA 4NMUA 3IE3A 4IN0A 2YN1A 2CA8A 2FY6A 5EPFA 4JU5A 4PUAA 1K0CA 1U6TA 4TXVA 2B1KA 2WULA 1GTBA 4AJ6A 1FB0A 4TOPA 3UARA 3I6AA 1F6MC 2WCIA 2H1DA 3TKSA 5DQSA 1K0MA 2IMEA 2R37A 3SWLA 4TR1A 1LJRA 4EE0A 4KGIA 3CRUA 1E2YA 2O7KA 2GVPA 4FO5A 2DJ0A 4HUAA 2CAIA 2H66A 5C00A 1J08A 2AV4A 2RM6A 5HFKA 5J3RA 1HQOA 2V2GA 3OR5A 3KTBA 1H4OA 1OC8A 2ZCTA 5D9TA 1JZDA 2PGTA 2H1AA 2KOKA 2WFCA 3TB2A 5ECLB 1C72A 3M9JA 2WB9A 1R26A 3D4MA 1GSDA 4I2TA 1TDIA 1MDKA 4N11A 4I5QA 4WR5A 4JZQA 1JZOA 3FKFA 3KM6A 2TIRA 5IMFA 2CVDA 2WS2A 2KP1A 3TJGA 4MH3A 5EVOA 2G0FA 1XWAA 4XS4A 4IP6A 5B7CA 1AQVA 2E0QA 3GURA 1SD8A 3VPQA 1SKWB 2PPTA 5CRWA 4KSOA 1EV4A 2G2QA 2CX4A 4IS0A 6GSSA 2YJHA 2XPDA 3PGTA 1E6BA 3UJ1A 1AQXA 1THXA 2H6YA 3FW2A 2OA7A 4O5RA 1UC7A 4IW9A 5GZZB 3QAVA 3KH9A 4ML6A 3F4TA 3TJBA 3LXTA 2ALBA 5ID2B 2CVKA 3EMPA 4MJAA 3M3MA 4IJIA 3TKSC 3GYKA 5ECSA 4F9ZA 1F3BA 2NVLA 2VL3A 3DWVA 1TOFA 2L4QA 4BPYA 3KP8A 4HQZA 1JLWA 4J57E 1ILOA 1K0DA 1UA5A 4BA7A 3O76A 4ML1A 4IJ3A 1HNBA 3HJOA 4GRFA 3ZL5A 4NHZA 1QGVA 3ZLPA 2YJ7A 3EWLA 4KDUA 1TU7A 3CRTA 3EURA 2LQQA 1XZOA 1ZGNA 2H8LA 1XOBA 3F9UA 3QOUA 3O6TA 4MJCA 4K0GA 5G30A 4TKYA 2NDOA 4OO4A 4KDXA 2YV7A 1JFUA 2Z9SA 4F2IA 2LNSA 2GT5A 2VCXA 5DAKB 2R6KA 4JEDA 2PERA 4JBBA 4PUFC 3DMLA 4RUVA 2M46A 5H5SA 4EF0A 2HI7A 1XW6A 4KH7A 3E0UA 4YAPA 1AQWA 2REMA 3VK9A 3V1WA 3QR6A 5COHA 5AIXA 3CSIA 2LJAA 2MBSA 4OFMA 4ACSA 1NSWA 3ISOA 1ZYQB 3KCMA 3IAS2 5HQPA 1GWCA 2ZUPA 2A4VA 4HZ4A 3ZRDA 4N0ZA 3ZYWA 3KJYA 1OKTA 3U5RE 4AGSA 2L5OA 4MABA 1MDIA 3QAWA 1YF1A 2D2ZA 17GSA 2H0IA 1YEXA 3F63A 2VCWA 2XHFA 3PR8A 1Z6NA 2P5QA 3E3EA 1K0OA 3KMOA 3TJFA 5J41A 2P31A 4EUYA 2JSYA 1DSBA 1T00A 3ZITA 1QK8A 5FT3A 1GL8A 5G31A 1GTAA 4POMA 3L9SA 2MMAA 1MTCA 2VO4A 2LJRA 4TR1B 4MH2A 2ON7A 1S3AA 4ECBA 4QL7A 3HVVA 1U3IA 3GL3A 1XVQA 2GSTA 5F0GA 3MAKA 2CX3A 2I81A 3F4RA 3P90A 5D8IA 2LV3A 3L9UA 1WP0A 1B9YC 1GTIA 3TRPA 4PNGA 1Z7RA 1R5AA 3IXRA 3APOA 4Z7XA 1GSEA 2CAQA 2MBTA 1XWCA 3ZZXA 1J9BA 2C4JA 2FA4A 3KD0A 4NXIA 4I8BA 4I6XA 3Q18A 4GSNA 2DMMA 2RLIA 1B9XC 1F3AA 3GKMA 2VL9A 1WOUA 2EIOA 2JADA 16GSA 3UOMA 4FYCA 1OC9A 5CREA 4IQAA 2OBKA 6GSTA 1SYXA 3L9VA 5ECRB 3ERWA 2X8CA 1GTUA 3F6FA 3DXBA 2JSZA 1A2JA 3WGXA 4IHUA 4V2MA 4XS4B 1Q98A 1GSFA 4JRRA 3QFBC 2XBIA 1U87A 3QD9A 2QC7A 1XW9A 2KUCA 2FUG2 2N5BA 4IGJA 6GSXA 4N0VA 3FHKA 2DBCA 5G5FA 6GSVA 1G6WA 4WEYA 2GGTA 1V57A 10GSA 4KUNA 1YQ1A 2YWMA 3ZREA 4E8HA 2EC4A 2B7JA 5HR3A 3LGCA 3FYGA 2HT9A 1EEMA 5F07A 5G5EA 2C3NA 2IIYA 5IM9A 3SBCA 2K9FA 2CZ3A 2LNTA 1SJZA 2IFQB 1M2AA 3EMXA 3MNGA 4QQ7A 1Q4JA 2OADA 3VWVA 2IMIA 5JWRB 1YJ6A 4HZ2A 4KDYA 4ECIA 2X8GA 2H30A 2VM2A 2VUPA 1QFNA 4XCSA 4ZB9A 4V1Ag 1Z6MA 4JE1A 2L57A 3ERFA 3A5WA 2C0EA 1DUGA 4DEJA 2IPAA 2KP2A 3P2AA 1Y25A 2B7KA 2I1UA 1GNWA 2DIYA 2R3XA 1UVZA 1YKAA 1M9AA 4DVCA 4EDYA 1WPIA 3I9V2 5ELAA 1NM3A 3G7YA 1A2LA 4XTSA 4EO3A 1SU9A 1F37A 2VD0A 3D22A 2H1GA 4XIHA 4KCAA 3EE2A 4O92A 4IVFA 2AB6A 2C1YA 3IAM2 4MK3A 3ZTLA 3IBHA 3U6VA 3ZFLA 5CO3A 1QUWA 2WZ9A 4HQSA 1AUCA 3N9JA 1EGRA 1SENA 1AAZA 3DEXA 3LYKA 22GSA 1OKDA 1EZKA 3GKKA 3DD3A 4BWSA 3FR9A 2B5YA 4K1FA 4K7NA 2GDRA 5GAND 1U3AA 2QSIA 3ZVJD 2H0HA 1ABAA 2KHPA 2FGXA 1FVKA 4Q5NA 5KN3A 1KEBA 4CDOA 2B6MA 4YQUA 2HRFA 3GNJA 3GKXA 5ECHB 3IR4A 1QXHA 4O32A 3CXGA 4D73B 3TDGA 1X5CA 4MPGA 2HZEB 2I4AA 3IK7A 5DALA 3PH9A 4ZB8A 5AN1A 3QCPA 4HDEA 3FK8A 4EKZA 2X8HA 3DVXA 1VF1A 1YKCA 12GSA 1EOGA 3GL5A 2MMNA 4N10A 4J56E 4XS6A 1XFLA 3L4NA 3KMNA 2CV4A 1XOAA 2CT6A 2XBQA 1JLVA 1SL1B 3H1NA 3F3QA 3M9KA 4K2DA 5DVBA 3HD5A 11GSA 3KIJA 4P3YB 1T8EB 4HOJA 2VCZA 1GSYA 2PMTA 3DRNA 4HJ2A 4LMVA 2WRTA 3E9JB 5E4WA 1AC1A 3UBLA 1FW1A 3EVIA 3HDCA 1LU4A 1GULA 2WJUA 1ST9A 1USBA 3A2VA 3TCOA 1PX7A 3C73A 3VI5A 2YWNA 2DJ2A 20GSA 5A4UA 3N5OA 3CMIA 3Q6OA 1WWJA 4PNFA 4XHMA 1W4VA 3A3TA 3RHCA 1HYUA 4KB3A 3APSA 1VRSD 4K9ZA 4ULXA 2V1MA 2AUVA 2YP6A 3WYWA 3M8NA 3HVSA 2P5RA 1OC9B 3VURA 3VWWA 4YH2A 2FWEA 3PINA 3TRQA 3IDVA 3LQ7A 3GX8A 4MZBA 1GSQA 4EDZA 2LSTA 1K3OA 4QL9A 3CTGA 2K8SA 4GCIA 5CRGA 1Z3EA 2K8VA 2JZRA 2PVQA 4NV5A 4XRAA 3ED3A 3S9FA 6GSUA 4PXOA 1SJIA 1V58A 2C3TA 3G9BA 1I5GA 2GLRA 3ERGA 1XIYA 4IBPA 1K3LA 1M2DA 2VL2C 3LJRA 2FLSA 5CYYA 1T4YA 1T7PB 3BJ5A 1CQGA 5B6NA 5D9WA 3GTUB 1TW9A 1S3CA 2H1BA 3L78A 4PQIA 3TGZA 5G2ZA 1TRWA 4KA0A 1V98A 5HR2A 3GH6A 1FG4A 3RHBA 2GSSA 2PUKC 2YWIA 5GSTA 1YF0A 3WD6A 2LEGA 2IL3A 3HXSA 5G1KA 13GSA 2DJ1A 2E2GA 1Z7PA 4BWQA 1V9WA 3P8WA 3HY2A 3UVTA 3BOAA 1AXDA 5B8BA 18GSA 3EU4A 4ZILA 2XPEA 3W8JA 1GH2A 1O8WA 1X0RA 4EVMA 5D93A 3US3A 2LQOA 5DJLA 1SL2B 5IMAA 2GSRA 4POBA 2AJQB 3MWHA 2DSAA 2B3SA 3LSZA 4OMVA 4DSQA 3JCML 4WF5A 1BG5A 3TOTA 4L0WA 4WF4A 1K0NA 4Q5FA 2MMZA 2C3QA 4WXTA 5B6MA 1BJXA 3LG6A 3O3TA 4BVXA 3GHAA 4GTUA 4G10A 5DQYA 1FVJA 5KN0A 1ZZYA 5A5KA 5DCGA 1VF2A 2YPMA 1O85A 4MF7A 4V1Ap 4NPBA 1A0FA 4OO5A 3HA9A 3DKSA 1V40A 2BTOT 4TR4A 3GIXA 2DLXA 3F6DA 2GZZA 4PX1A 1GUHA 5LCZA 5DDLA 2DC5A 1X9MB 3UVHA 1T1VA 1MD4A 1DE1A 1B4QA 2PU9C 1WJKA 2L59A 3IA1A 2LUSA 3H4KA 5HR1A 1GLQA 4JR4A 3FR3A 2HXKA 1AW9A 4F82A 5IMDA 5JWQB 3DYRA 1PN9A 2LKUA 4GSTA 1W89A 1A24A 2R4VA 3TJJA 5EY6A 1EWXA 4OCFA 5J9BA 2C0FA 3IC4A 3TKPA 2GS3A 4FIWA 1PRXA 2BJXA 3FY7A 5ECPB 3HYPA 3EINA 2C0DA 1FB6A 3MDKA 1TKDB 1TTZA 1R5PA 4MZCA 3HKRA 6GSWA 4KNDA 2GZPA 1KTEA 3GH9A 1G7EA 3Q74A 1MD3A 4ZL8A 4KX4A 2FHEA 2IWTA 3KEBA 3HJPA 2RM5A 4J2FA 2YANA 2VIMA 1G6YA 5DJMA 2H19A 4YQVA 1SYRA 1WMJA 3TKRA 2R5GA 4HU9A 3D6IA 3WT1A 2H73A 4I97A 4TR3A 5AGYA 2LRCA 2YCDA 3BBYA 5LD0A 1BEDA 1O6JA 4FH8A 4K7IA 1FAAA 1GUKA 1O81A 2J23A 3LEFA 2OE3A 2X99A 2DIZA 3Q19A 4TW5A 2IJYA 2WGRA 2F3MA 1ZOFA 1THOA 2AHEA 7GSSA 1SK2A 2X64A 4NAXA 5B8AA 1GLPA 1DBYA 3FEUA 2GSQA 4EL1A 3KXOA 3QMXA 4KCEA 1SKRB 4F0BA 4MLYA 4PGTA 2L6DA 2C0GA 2JU5A 5CAXA 4FYUA 2M80A 1PD21 2VCVA 4MA9A 1OC3A 3W6GA 2FA8A 2ES7A 4YAVA 3K8NA 3CBUA 1TP9A 2LRTA 3GN3A 1VF3A 4X0XA 3W8SA 4MF6A 5C04A 3KTLA 2E2MA 1O7UA 4TR0A 3C8EA 4AJ7A 2FNOA 5ECNB 2KLXA 2V6OA 4KE3A 2LJKA 1Y6EA 3TJKA 1SL0B 2EIRA 2H01A 2H71A 3GSSA 5A4VA 5JCUA 2B1LA 1JZWA 5FHIA 2C8UA 5HR0A 5H5QA 2QGVA 2B5XA 2HYXA 2VM1A 4HS1A 3H79A 1XXUA 4K6XA 1SD9A 5IIZA 3QPMA 1SK1A 2IMKA 2V41A 2GQKA 4N30A 5IOWA 3IHQA 5EL8A 2L4CA 5F8BA 4Q5QA 1KNGA 5IMVA 4F0CA 1TRSA 2O8VB 4LL4B 5GAPD 1URMA 1EEJA 1A23A 2H0GA 1GP1A 4PURA 2FWHA 4IKHA 3LFLA 2VLUA 1GNEA 3LORA 1ERTA 3QAGA 1TRUA 1CQHA 4L5LA 4V2NA 1VGLA 3RAZA 1A0RP 1GSUA 2IN3A 2E7PA 4HI7A 1PMTA 1XPVA 1XBSA 2N5AA 2FWGA 2MZCA 3RPPA 1XWGA 1HNCA 1YEPA 1ACVA 4ZL7A 3M1GA 2P0GA 1I9DA 3GRXA 4OWYA 4TRXA 1RW1A 1Z5YE 1FO5A 4I2UA 3GV1A 3NIVA 3BD2A 1DE2A 5IO2A 1PKWA 2VL2A 5JCWA 5ENUA 3ZFBA 1LBKA 5G1LA 2F8AA 5IQYA 3LYPA 1PL2A 2N5FA 2DJ3A 1TK0B 4NV2A 5J4UA 3IV4A 3VI7A 3ZMLA 3VFIA 3G7IA 4PQHA 3DVWA 1XW5A 3I69A 1PGTA 4KW6A 2TRCP 4FYBA 3GX0A 1BX9A 1B8XA 3AY8A 1B48A 3UBKA 4KSMA 1N2AA 3RBTA 1X9SB 3EC3A 3A2WA 3P7XA 1IYHA 3DIEA 4GWRA 3GA4A 3CYNA 4LL1B 4E8EA 5JWOB 1G0TA 3GUSA 5L71A 3VLNA 1R4WA 5KEJA 3RPNA 1BYEA 2ON5A 1X5EA 3LWAA 3KH7A 1B4PA 2JL4A 1NHOA 2LTKA 3GKNA 4CW9A 3UEMA 1WRYA 1K0BA 3GSTA 3LXZA 4MJBA 3HCZA 2K6VA 2LRNA 4AF2A 4GF0A 4DSSA 3KP9A 2HSYA 1O8XA 1IYIA 3A2XA 1VF4A 1OVNA 1ERUA 1YZXA 3EU3A 3NZNA 5F06A 2HRNA 3UMAA 3BCIA 3UIWA 2F8FA 1KBNA 1N8JA 4ZBAA 2HE3A 4TN8A 3APQA 3UAPA 3HJMA 1Z9HA 19GSA 2F9SA 1RQMA 2CVBA 3WGEA 1O73A 4MP4A 4JR6A 2B5EA 5ECIB 1J0FA 5GSSA 4MPFA 3TRXA 3F8UA 2VOCA 1T3BA 5KN1A 4F03A 2OE1A 2A2SA 3KGKA 4NWYA 2IFQA 2R2JA 3VWXA 4BL7A 4H86A 5HFGA 14GSA 1TU8A 1XVWA 2HFDA 4IQ1A 5ABRA 3WGDA 2HNLA 2H72A 9GSSA 2H70A 1SK0A 3TOUA 2GTUA 3ZMKA 2K18A 2PBJA 1JHBA 2O87A 1QMVA 4K0NA 1F2EA 3FRCA 3WT2A 3C7MA 2VLVA 1WIKA 1ML6A 4ID0A 1S3DA 5CNWA 1PX6A 1K3YA 1ON4A 2DMLA 5F05A 4LMWA 5IMZA 3NOFA 4TXOA 2JZTA 4ZBBA 4G2EA 4WR4A 4HEA2 1MEKA 2H74A 2EIQA 3J7Yb 3R2QA 1TRVA 2L5LA 1TI1A 3TKSE 1M0UA 3HVXA 4ZB6A 2VCQA 2M72A 1YDKA 2LS5A 5CRDA 1A8LA 5AISA 1V2AA 1OYJA 4GQCA 4PQ1A 3HZ8A 2OJLA 4AJ8A 4ZBDA 1JZRA 2GZYA 4ISDA 2FCHA 4RQXA 4Q5RA 4OFNA 5ECMB 1GRXA 4ZXGA 5CP1A 2RUFA 3F0IA 2YOIA 3ZIJA 2VLTA 4ILFA 3GMFA 1HD2A 4V2LA 3C1RA 4ECJA 2NPBA 3FZAA 2GQMA 2OKAA 1A8YA 5DCHA 4L5OA 3FZ9A 2O89A 3M0FA 4MZWA 4WBJA 1EOHA 1SJ6A 2YWOA 5IOXA 4KAEA 4POKA 4G19A 2PWJA 4GLTA 4L8EA 4ZIJA 3FR6A 1PKZA 1EV9A 2VCTA 2F51A 2ZNMA 4D73A 2IMFA 2L6CA 4OCEA 2HZEA 4WETA 2O85A 4K7OA 1SKSB 2H75A 4POLA 3EYTA 4MMMA 3IOSA 3RDWA 2YZUA 1PA3A 5A4WA 1PSQA 3L0HA 2RIIA 3H93A 3D0ZA 4LLRA 1EP8A 3QFAC 5AIVA 4BVYA 1ZMAA 4WKWA 5CRHA 1BAYA 2H76A 4L0UA 5JCGA
chains in the Genus database with same CATH superfamily
2OACA 5DALB 2R0GA 1UN2A 3CTFA 3TKQA 2JACA 3CSJA 2JZSA 2BMXA 4OD7A 1GSSA 5E59A 3F3RA 4X1UA 5IO0A 3C71A 5IPGA 3VPTA 1NHYA 1FHEA 1YY7A 1ERWA 2QA2A 3I43A 2PVOC 4MDCA 3D5JA 3FZ5A 3HZ4A 4EXJA 4O7HA 4NHWA 4IELA 4GXZA 4CHSA 2TRXA 2MMOA 2MYGA 4MF5A 1H75A 2I9HA 5D9VA 2XC2A 5D96A 1PL1A 2OBIA 4RQRA 1BQ7A 1HNAA 1TXXA 4ZL9A 3ME8A 2VD1A 1WE0A 5FWGA 4WBRD 1TK5B 5D9XA 1M3IA 2A2RA 2IMDA 1ZYPA 5ID2A 3ME7A 4XS1A 1M2BA 4XRDA 3IK9A 2AAWA 2DJJA 3VWUA 4DSSB 3G7JA 3J7Yk 2H6ZA 1GUMA 4RI7A 1F9MA 3IPZA 4K5SA 1EGOA 2PN8A 3GFKA 4IP1A 2YV9A 2QKEA 4YQMA 3BCKA 1K0AA 1PFOA 1U88A 2VAFA 1NW2A 2V32A 2V6KA 2C80A 3MSZA 4LA1A 1ZL9A 4GSSA 4EC0A 4DSRA 3GTUA 5ECQB 5ECOB 3UL3A 5INYA 1XCCA 6GSYA 4GQFA 4MJEA 4RI6A 2HZFA 1RK4A 4G9HA 1OE8A 1X5DA 3C1SA 3F4SA 2DJKA 1OE7A 1TJDA 5D73A 5ECKB 1M9BA 1R7HA 5DAKA 5J5NA 3H8QA 1TI3A 4ECCA 1TK8B 2HSHA 1XWKA 1A2MA 5J9CA 5DBQA 1M99A 3CSHA 1EP7A 2NTOA 2CQ9A 1PQNA 3ZVJA 1X9WB 2GT6A 4MCUA 3D21A 5H5RA 2FD3A 2OE0A 4TVEA 1ERVA 2H6XA 8GSSA 4HU7A 5KN2A 3D4TA 4HJMA 1OAZA 1G7OA 2WDUA 2FWFA 3FZ4A 2J9HA 3KZQA 3DGQA 3HHVA 2RUEA 1ZYEA 5ELGA 1AIUA 1MDJA 5IPHA 4TXOB 2YNXA 3TUEA 2DKHA 1QQ2A 4K8MA 1M7TA 2HLSA 1ZCPA 2AYTA 2I3YA 1ZYNA 2NBSA 2GQLA 1XWBA 5IMCA 4X43A 1T4ZA 1FOVA 3IRAA 4OFTA 2CZ2A 3QDNA 5HFIA 3ZIVA 5LNKe 2YZHA 4NMUA 3IE3A 4IN0A 2YN1A 2CA8A 2FY6A 5EPFA 4JU5A 4PUAA 1K0CA 1U6TA 4TXVA 2B1KA 2WULA 3R3EA 1GTBA 4AJ6A 1FB0A 4TOPA 3UARA 3I6AA 1F6MC 2WCIA 2H1DA 3TKSA 5DQSA 1K0MA 2IMEA 2R37A 3SWLA 4TR1A 1LJRA 4EE0A 1XG8A 4KGIA 3CRUA 1E2YA 2O7KA 2GVPA 4FO5A 2DJ0A 3MYDA 4HUAA 2CAIA 2H66A 1M3JA 5C00A 1J08A 2AV4A 2RM6A 5HFKA 5J3RA 1HQOA 3HVNA 2V2GA 3OR5A 3KTBA 1H4OA 1OC8A 2ZCTA 5D9TA 1JZDA 2PGTA 2H1AA 2KOKA 2WFCA 3TB2A 4BVYB 5ECLB 5KOXA 1C72A 3M9JA 2WB9A 1R26A 3D4MA 1GSDA 4I2TA 1PN0A 1TDIA 1MDKA 4N11A 4I5QA 4WR5A 4JZQA 1JZOA 3FKFA 3KM6A 2TIRA 5IMFA 2CVDA 2WS2A 2KP1A 3TJGA 4MH3A 5EVOA 3EPTA 2G0FA 1XWAA 4XS4A 4IP6A 5B7CA 4G0IA 1AQVA 2E0QA 3GURA 1SD8A 3VPQA 1SKWB 2PPTA 5CRWA 4KSOA 1EV4A 2G2QA 2CX4A 4IS0A 6GSSA 2YJHA 2XPDA 3PGTA 1E6BA 3UJ1A 1AQXA 1THXA 2H6YA 3FW2A 2OA7A 4O5RA 1UC7A 4IW9A 5GZZB 3QAVA 3KH9A 4ML6A 3F4TA 3TJBA 3LXTA 2ALBA 5ID2B 2CVKA 3EMPA 4MJAA 3M3MA 4IJIA 3TKSC 3GYKA 5ECSA 4F9ZA 1F3BA 2NVLA 2VL3A 3DWVA 1TOFA 2L4QA 4BPYA 3KP8A 4HQZA 1JLWA 4J57E 1ILOA 1K0DA 1UA5A 4BA7A 3O76A 4ML1A 4IJ3A 1HNBA 3HJOA 4GRFA 3ZL5A 4NHZA 1QGVA 3ZLPA 2YJ7A 3EWLA 4KDUA 1TU7A 3CRTA 3EURA 4YKFA 2LQQA 1XZOA 1ZGNA 2H8LA 1XOBA 3F9UA 3QOUA 3O6TA 4MJCA 4K0GA 5G30A 4TKYA 2NDOA 4OO4A 4KDXA 2YV7A 1JFUA 2Z9SA 4F2IA 2LNSA 2GT5A 2VCXA 5DAKB 2R6KA 4JEDA 2PERA 4JBBA 4PUFC 3DMLA 4RUVA 2M46A 5H5SA 4EF0A 2HI7A 1XW6A 4KH7A 3E0UA 4YAPA 1AQWA 2REMA 3VK9A 3V1WA 3QR6A 5COHA 5AIXA 3CSIA 2LJAA 2MBSA 5KOWA 4OFMA 4ACSA 1NSWA 3ISOA 1ZYQB 3KCMA 3IAS2 5HQPA 1GWCA 2ZUPA 2A4VA 4HZ4A 3ZRDA 4N0ZA 3ZYWA 3KJYA 2DKIA 1OKTA 3U5RE 4AGSA 2L5OA 4MABA 1MDIA 3QAWA 1YF1A 2D2ZA 17GSA 4CY6A 2H0IA 1YEXA 3F63A 2VCWA 3CQFA 2XHFA 3PR8A 1Z6NA 2P5QA 3E3EA 1K0OA 3KMOA 3TJFA 5J41A 2P31A 4EUYA 2JSYA 1DSBA 1T00A 3ZITA 1QK8A 5FT3A 1GL8A 5G31A 1GTAA 4POMA 3L9SA 2MMAA 1MTCA 2VO4A 2LJRA 4TR1B 4MH2A 2ON7A 1S3AA 4ECBA 4QL7A 3HVVA 1U3IA 3GL3A 1XVQA 2GSTA 5F0GA 3MAKA 2CX3A 2I81A 3F4RA 3P90A 5D8IA 2LV3A 3L9UA 1WP0A 1B9YC 1GTIA 3TRPA 4PNGA 1Z7RA 2A4HA 1R5AA 2QA1A 3IXRA 3APOA 4Z7XA 1GSEA 2CAQA 2MBTA 1XWCA 3ZZXA 1J9BA 2C4JA 2FA4A 3KD0A 4NXIA 4I8BA 4PTSA 4I6XA 3Q18A 4GSNA 2DMMA 2RLIA 1B9XC 1F3AA 3GKMA 2VL9A 1WOUA 2EIOA 2JADA 16GSA 3UOMA 4FYCA 1OC9A 5CREA 4IQAA 2OBKA 6GSTA 1SYXA 3L9VA 5ECRB 2X49A 3ERWA 2X8CA 1GTUA 3F6FA 3DXBA 2JSZA 1A2JA 4FQUA 3WGXA 4IHUA 4V2MA 4XS4B 1Q98A 1GSFA 4JRRA 3QFBC 2XBIA 1U87A 3QD9A 2QC7A 1XW9A 2R0CA 2KUCA 2FUG2 2N5BA 4IGJA 6GSXA 4N0VA 3FHKA 2DBCA 5G5FA 6GSVA 1G6WA 4WEYA 2GGTA 1V57A 10GSA 4KUNA 1YQ1A 2YWMA 3ZREA 4X4JA 4E8HA 2EC4A 2B7JA 5HR3A 3LGCA 3FYGA 2HT9A 1EEMA 5F07A 5G5EA 2C3NA 2IIYA 5IM9A 3SBCA 2K9FA 2CZ3A 2LNTA 1SJZA 4G0KA 2IFQB 1M2AA 3EMXA 4BL7B 3MNGA 4QQ7A 1Q4JA 2OADA 3VWVA 2IMIA 5JWRB 1YJ6A 4HZ2A 4KDYA 4ECIA 2X8GA 2H30A 2VM2A 2VUPA 1QFNA 4XCSA 4ZB9A 4V1Ag 1Z6MA 4JE1A 2L57A 3ERFA 3A5WA 2C0EA 1DUGA 4DEJA 2IPAA 2KP2A 3P2AA 1Y25A 2B7KA 2I1UA 1GNWA 2DIYA 2R3XA 1UVZA 1YKAA 1M9AA 4DVCA 4EDYA 1WPIA 3I9V2 5ELAA 1NM3A 3G7YA 1A2LA 4XTSA 4EO3A 1SU9A 1F37A 2HRKA 2VD0A 3D22A 2H1GA 4XIHA 4KCAA 3EE2A 4O92A 4IVFA 2AB6A 2C1YA 3IAM2 4MK3A 3ZTLA 3IBHA 4Z2UA 3U6VA 3ZFLA 5CO3A 1QUWA 2WZ9A 4HQSA 1AUCA 3N9JA 1EGRA 1SENA 1AAZA 3DEXA 3LYKA 22GSA 1OKDA 1EZKA 3GKKA 3DD3A 4BWSA 3FR9A 2B5YA 4K1FA 4K7NA 2GDRA 4K2XA 5GAND 1U3AA 2QSIA 3ZVJD 2H0HA 1ABAA 2KHPA 4HSCX 2FGXA 4K5RA 1FVKA 4Q5NA 4USSA 5KN3A 1KEBA 4CDOA 2B6MA 4YQUA 2HRFA 3GNJA 3GKXA 5ECHB 3IR4A 1QXHA 4O32A 3CXGA 4D73B 4EIPA 3TDGA 1X5CA 4MPGA 2HZEB 2I4AA 3IK7A 5DALA 3PH9A 4G0LA 4ZB8A 5AN1A 3QCPA 4HDEA 3FK8A 4EKZA 2X8HA 3DVXA 1VF1A 1YKCA 12GSA 1EOGA 3GL5A 2MMNA 4N10A 4J56E 4XS6A 1XFLA 3L4NA 3KMNA 2CV4A 1XOAA 2CT6A 2XBQA 1JLVA 1SL1B 3H1NA 3F3QA 3M9KA 4K2DA 5DVBA 3HD5A 11GSA 3KIJA 4P3YB 1T8EB 2HRAA 4HOJA 2VCZA 1GSYA 2PMTA 3DRNA 4HJ2A 4LMVA 2WRTA 3E9JB 5E4WA 1AC1A 3UBLA 1FW1A 3EVIA 3HDCA 1LU4A 1GULA 2WJUA 1ST9A 1USBA 3A2VA 3TCOA 1PX7A 3C73A 3VI5A 2YWNA 2DJ2A 20GSA 5A4UA 3N5OA 3CMIA 3Q6OA 3IHGA 1WWJA 4PNFA 4XHMA 1W4VA 3A3TA 3RHCA 1HYUA 4KB3A 3APSA 1VRSD 4K9ZA 4ULXA 2V1MA 2AUVA 2YP6A 3WYWA 3M8NA 4MNNA 3HVSA 2P5RA 1OC9B 3VURA 3VWWA 4YH2A 2FWEA 3PINA 3TRQA 3IDVA 3LQ7A 3GX8A 4MZBA 1GSQA 4EDZA 2LSTA 1K3OA 4QL9A 3CTGA 2K8SA 4GCIA 5CRGA 1Z3EA 2K8VA 2JZRA 2PVQA 4NV5A 4XRAA 5BRTA 3ED3A 3S9FA 6GSUA 4PXOA 1SJIA 1V58A 2C3TA 3G9BA 1I5GA 2GLRA 3ERGA 1XIYA 4IBPA 1K3LA 1M2DA 2VL2C 3LJRA 2FLSA 5CYYA 1T4YA 1T7PB 3BJ5A 1CQGA 5B6NA 5D9WA 3GTUB 1TW9A 1S3CA 2H1BA 3L78A 4PQIA 3TGZA 5G2ZA 1TRWA 4KA0A 1V98A 5HR2A 3GH6A 1FG4A 3RHBA 2GSSA 2PUKC 2YWIA 5GSTA 1YF0A 3WD6A 2LEGA 2IL3A 3HXSA 5G1KA 13GSA 2DJ1A 2E2GA 1Z7PA 4BWQA 1V9WA 3P8WA 3HY2A 3UVTA 3BOAA 1AXDA 5B8BA 18GSA 3EU4A 4ZILA 2XPEA 3W8JA 1GH2A 1O8WA 1X0RA 4EVMA 5D93A 3US3A 2LQOA 5DJLA 1SL2B 5IMAA 2GSRA 4POBA 2AJQB 3MWHA 2DSAA 2B3SA 3LSZA 4OMVA 4DSQA 3JCML 4WF5A 4O5UA 1BG5A 3TOTA 4L0WA 4WF4A 1K0NA 4Q5FA 2MMZA 2C3QA 4WXTA 5B6MA 1BJXA 3LG6A 3O3TA 4BVXA 3GHAA 4GTUA 1S3RA 4G10A 5DQYA 1FVJA 5KN0A 1ZZYA 5A5KA 5DCGA 1VF2A 2YPMA 1O85A 4MF7A 4V1Ap 4NPBA 1A0FA 4OO5A 3HA9A 3DKSA 1V40A 2BTOT 4TR4A 3GIXA 2DLXA 3F6DA 2GZZA 4PX1A 1GUHA 5LCZA 5DDLA 3MIXA 2DC5A 1X9MB 3UVHA 1T1VA 1MD4A 1DE1A 4O5QA 1B4QA 2PU9C 1WJKA 2L59A 3IA1A 2LUSA 3H4KA 5HR1A 3A5IA 1GLQA 4JR4A 3FR3A 2HXKA 2A2PA 1AW9A 4F82A 5IMDA 5JWQB 3DYRA 1PN9A 2LKUA 4GSTA 1W89A 1A24A 2R4VA 3TJJA 5EY6A 1EWXA 4OCFA 5J9BA 2C0FA 3IC4A 3TKPA 2GS3A 4FIWA 1PRXA 2BJXA 3FY7A 5ECPB 3HYPA 3EINA 2C0DA 1FB6A 3MDKA 1TKDB 1TTZA 1R5PA 4MZCA 3HKRA 6GSWA 4KNDA 2GZPA 1KTEA 3GH9A 1G7EA 3Q74A 1MD3A 4ZL8A 4KX4A 2FHEA 2IWTA 3KEBA 3HJPA 2RM5A 4J2FA 2YANA 2VIMA 1G6YA 5DJMA 2H19A 4BIKA 4YQVA 1SYRA 1WMJA 3TKRA 2R5GA 4HU9A 3D6IA 3WT1A 2H73A 4I97A 4TR3A 5AGYA 2LRCA 2YCDA 3BBYA 5LD0A 1BEDA 1O6JA 3FMWA 4FH8A 4K7IA 1FAAA 1GUKA 1O81A 2J23A 3LEFA 2OE3A 2X99A 2UZ8A 2DIZA 3Q19A 4TW5A 2IJYA 2WGRA 2F3MA 1ZOFA 1THOA 2AHEA 7GSSA 1SK2A 2X64A 4NAXA 5B8AA 1GLPA 1DBYA 3FEUA 2GSQA 4EL1A 3KXOA 3QMXA 4KCEA 1SKRB 4F0BA 4MLYA 4PGTA 3IC8A 2L6DA 2C0GA 2JU5A 5CAXA 4FYUA 2M80A 1PD21 2VCVA 4MA9A 1OC3A 3W6GA 4CY8A 2FA8A 2ES7A 4YAVA 3K8NA 3CBUA 1TP9A 2LRTA 3GN3A 1VF3A 3LW9A 4X0XA 3W8SA 4MF6A 5C04A 3KTLA 2E2MA 1O7UA 4TR0A 3C8EA 4AJ7A 2FNOA 5ECNB 2KLXA 2V6OA 4KE3A 2LJKA 1Y6EA 3TJKA 1SL0B 2EIRA 2H01A 2H71A 3GSSA 5A4VA 5JCUA 2B1LA 1JZWA 5FHIA 2C8UA 5HR0A 5H5QA 2QGVA 2B5XA 2HYXA 2VM1A 4HS1A 3H79A 1XXUA 4K6XA 1SD9A 5IIZA 3QPMA 1SK1A 2IMKA 2V41A 2GQKA 4N30A 5IOWA 3IHQA 5EL8A 2L4CA 5F8BA 4Q5QA 1KNGA 5IMVA 4F0CA 1TRSA 2O8VB 4LL4B 5GAPD 1URMA 1EEJA 1A23A 2H0GA 1GP1A 4PURA 2FWHA 4IKHA 3LFLA 2VLUA 1GNEA 3LORA 1ERTA 3QAGA 1TRUA 1CQHA 4L5LA 4V2NA 1VGLA 3RAZA 1A0RP 1GSUA 2IN3A 2E7PA 4HI7A 1PMTA 4YKGA 1XPVA 1XBSA 2N5AA 2FWGA 2MZCA 3RPPA 1XWGA 4BVXB 1HNCA 1YEPA 1ACVA 4ZL7A 3M1GA 2P0GA 1I9DA 3GRXA 4OWYA 4TRXA 1RW1A 1Z5YE 1FO5A 4I2UA 3GV1A 3NIVA 3BD2A 1DE2A 4Z2RA 5IO2A 1PKWA 2VL2A 5JCWA 5ENUA 3ZFBA 1LBKA 5G1LA 2F8AA 5IQYA 3LYPA 4EIQA 1PL2A 2N5FA 2DJ3A 4Z2TA 1TK0B 4NV2A 5J4UA 3IV4A 3VI7A 3ZMLA 3VFIA 3G7IA 4PQHA 3DVWA 1XW5A 3I69A 1PGTA 4KW6A 2TRCP 4FYBA 3GX0A 1BX9A 1B8XA 3AY8A 1B48A 3UBKA 4KSMA 2HSMA 1N2AA 3RBTA 1X9SB 3EC3A 3A2WA 3P7XA 1IYHA 3DIEA 4GWRA 3GA4A 3CYNA 4LL1B 4E8EA 5JWOB 1G0TA 3GUSA 5L71A 3VLNA 1R4WA 5KEJA 3RPNA 1BYEA 2ON5A 1X5EA 3LWAA 3KH7A 1B4PA 2JL4A 1NHOA 2LTKA 3GKNA 4CW9A 3UEMA 1WRYA 1K0BA 3GSTA 3LXZA 4MJBA 3HCZA 2K6VA 2LRNA 4AF2A 4GF0A 4DSSA 3KP9A 2HSYA 1O8XA 1IYIA 3A2XA 1VF4A 1OVNA 1ERUA 1YZXA 3EU3A 3NZNA 5F06A 2HRNA 3UMAA 3BCIA 3UIWA 2F8FA 1KBNA 1N8JA 4ZBAA 2HE3A 4TN8A 3APQA 3UAPA 3HJMA 1Z9HA 19GSA 2F9SA 1RQMA 2CVBA 3WGEA 1O73A 4MP4A 4ICYA 4JR6A 2B5EA 5ECIB 1J0FA 5GSSA 4MPFA 3TRXA 3F8UA 2VOCA 1T3BA 5KN1A 4F03A 2OE1A 2A2SA 3KGKA 4NWYA 2IFQA 2R2JA 3VWXA 4BL7A 4H86A 5HFGA 14GSA 1TU8A 1XVWA 2HFDA 4IQ1A 5ABRA 3WGDA 2HNLA 2H72A 9GSSA 2H70A 1SK0A 3TOUA 2GTUA 3ZMKA 2K18A 2PBJA 1FOHA 4KF9A 1JHBA 2O87A 1QMVA 4K0NA 1F2EA 3FRCA 3WT2A 3C7MA 2VLVA 1WIKA 1ML6A 4ID0A 1S3DA 2R0PA 5CNWA 1PX6A 5BMUA 1K3YA 1ON4A 2DMLA 5F05A 4LMWA 5IMZA 3NOFA 4TXOA 2JZTA 4ZBBA 4G2EA 4WR4A 4HEA2 1MEKA 2H74A 2EIQA 3J7Yb 3R2QA 1TRVA 2L5LA 1TI1A 2X4AA 1M0UA 3HVXA 3TKSE 4ZB6A 2VCQA 2M72A 1YDKA 2LS5A 5CRDA 1A8LA 5AISA 1V2AA 1OYJA 4GQCA 4PQ1A 3HZ8A 3PPUA 2OJLA 4AJ8A 4ZBDA 1JZRA 2GZYA 4ISDA 2FCHA 4RQXA 4Q5RA 4OFNA 5ECMB 1GRXA 4ZXGA 5CP1A 2RUFA 3F0IA 2YOIA 3ZIJA 2VLTA 4ILFA 3GMFA 1HD2A 4V2LA 3C1RA 4ECJA 2NPBA 3FZAA 2GQMA 2OKAA 1A8YA 5DCHA 4L5OA 3FZ9A 2O89A 3M0FA 4MZWA 4WBJA 1EOHA 1SJ6A 2YWOA 5IOXA 4KAEA 4POKA 4G19A 2PWJA 4GLTA 4L8EA 4ZIJA 3FR6A 1PKZA 1EV9A 2VCTA 2F51A 2ZNMA 4D73A 2IMFA 2L6CA 4OCEA 2HZEA 4WETA 2O85A 4K7OA 1SKSB 2H75A 4POLA 3EYTA 4MMMA 3IOSA 3RDWA 2YZUA 1PA3A 5A4WA 1PSQA 3L0HA 2RIIA 3H93A 3D0ZA 4LLRA 4A5PA 1EP8A 3QFAC 5AIVA 4BVYA 1ZMAA 4WKWA 5CRHA 1BAYA 2H76A 4L0UA 5JCGA
chains in the Genus database with same CATH topology
2OACA 5DALB 2R0GA 1UN2A 3CTFA 3TKQA 2JACA 3CSJA 2JZSA 2BMXA 4OD7A 1GSSA 5E59A 3F3RA 4X1UA 5IO0A 3C71A 5IPGA 3VPTA 1NHYA 1FHEA 1YY7A 1ERWA 2QA2A 3I43A 2PVOC 4MDCA 3D5JA 3FZ5A 3HZ4A 4EXJA 4O7HA 4NHWA 4IELA 4GXZA 4CHSA 2TRXA 2MMOA 2MYGA 4MF5A 1H75A 2I9HA 5D9VA 2XC2A 5D96A 1PL1A 2OBIA 4RQRA 1BQ7A 1HNAA 1TXXA 4ZL9A 3ME8A 2VD1A 1WE0A 5FWGA 4WBRD 1TK5B 5D9XA 2A2RA 2IMDA 1ZYPA 5ID2A 3ME7A 4XS1A 1M2BA 4XRDA 3IK9A 2AAWA 2DJJA 3VWUA 4DSSB 3G7JA 3J7Yk 2H6ZA 1GUMA 4RI7A 1F9MA 3IPZA 4K5SA 1EGOA 2PN8A 3GFKA 4IP1A 2YV9A 2QKEA 4YQMA 3BCKA 1K0AA 1U88A 2VAFA 1NW2A 2V32A 2V6KA 2C80A 3MSZA 4LA1A 1ZL9A 4GSSA 4EC0A 4DSRA 3GTUA 5ECQB 5ECOB 3UL3A 5INYA 1XCCA 6GSYA 4GQFA 4MJEA 4RI6A 2HZFA 1RK4A 4G9HA 1OE8A 1X5DA 3C1SA 3F4SA 2DJKA 1OE7A 1TJDA 5D73A 5ECKB 1M9BA 1R7HA 5DAKA 5J5NA 3H8QA 1TI3A 4ECCA 1TK8B 2HSHA 1XWKA 1A2MA 5J9CA 5DBQA 1M99A 3CSHA 1EP7A 2NTOA 2CQ9A 1PQNA 3ZVJA 1X9WB 2GT6A 4MCUA 3D21A 5H5RA 2FD3A 2OE0A 4TVEA 1ERVA 2H6XA 8GSSA 4HU7A 5KN2A 3D4TA 4HJMA 1OAZA 1G7OA 2WDUA 2FWFA 3FZ4A 2J9HA 3KZQA 3DGQA 3HHVA 2RUEA 1ZYEA 5ELGA 1AIUA 1MDJA 5IPHA 4TXOB 2YNXA 3TUEA 2DKHA 1QQ2A 4K8MA 1M7TA 2HLSA 1ZCPA 2AYTA 2I3YA 1ZYNA 2NBSA 2GQLA 1XWBA 5IMCA 4X43A 1T4ZA 1FOVA 3IRAA 4OFTA 2CZ2A 3QDNA 5HFIA 3ZIVA 5LNKe 2YZHA 4NMUA 3IE3A 4IN0A 2YN1A 2CA8A 2FY6A 5EPFA 4JU5A 4PUAA 1K0CA 1U6TA 4TXVA 2B1KA 2WULA 3R3EA 1GTBA 4AJ6A 1FB0A 4TOPA 3UARA 3I6AA 1F6MC 2WCIA 2H1DA 3TKSA 5DQSA 1K0MA 2IMEA 2R37A 3SWLA 4TR1A 1LJRA 4EE0A 4KGIA 3CRUA 1E2YA 2O7KA 2GVPA 4FO5A 2DJ0A 3MYDA 4HUAA 2CAIA 2H66A 5C00A 1J08A 2AV4A 2RM6A 5HFKA 5J3RA 1HQOA 2V2GA 3OR5A 3KTBA 1H4OA 1OC8A 2ZCTA 5D9TA 1JZDA 2PGTA 2H1AA 2KOKA 2WFCA 3TB2A 4BVYB 5ECLB 5KOXA 1C72A 3M9JA 2WB9A 1R26A 3D4MA 1GSDA 4I2TA 1PN0A 1TDIA 1MDKA 4N11A 4I5QA 4WR5A 4JZQA 1JZOA 3FKFA 3KM6A 2TIRA 5IMFA 2CVDA 2WS2A 2KP1A 3TJGA 4MH3A 5EVOA 3EPTA 2G0FA 1XWAA 4XS4A 4IP6A 5B7CA 4G0IA 1AQVA 2E0QA 3GURA 1SD8A 3VPQA 1SKWB 2PPTA 5CRWA 4KSOA 1EV4A 2G2QA 2CX4A 4IS0A 6GSSA 2YJHA 2XPDA 3PGTA 1E6BA 3UJ1A 1AQXA 1THXA 2H6YA 3FW2A 2OA7A 4O5RA 1UC7A 4IW9A 5GZZB 3QAVA 3KH9A 4ML6A 3F4TA 3TJBA 3LXTA 2ALBA 5ID2B 2CVKA 3EMPA 4MJAA 3M3MA 4IJIA 3TKSC 3GYKA 5ECSA 4F9ZA 1F3BA 2NVLA 2VL3A 3DWVA 1TOFA 2L4QA 4BPYA 3KP8A 4HQZA 1JLWA 4J57E 1ILOA 1K0DA 1UA5A 4BA7A 3O76A 4ML1A 4IJ3A 1HNBA 3HJOA 4GRFA 3ZL5A 4NHZA 1QGVA 3ZLPA 2YJ7A 3EWLA 4KDUA 1TU7A 3CRTA 3EURA 4YKFA 2LQQA 1XZOA 1ZGNA 2H8LA 1XOBA 3F9UA 3QOUA 3O6TA 4MJCA 4K0GA 5G30A 4TKYA 2NDOA 4OO4A 4KDXA 2YV7A 1JFUA 2Z9SA 4F2IA 2LNSA 2GT5A 2VCXA 5DAKB 2R6KA 4JEDA 2PERA 4JBBA 4PUFC 3DMLA 4RUVA 2M46A 5H5SA 4EF0A 2HI7A 1XW6A 4KH7A 3E0UA 4YAPA 1AQWA 2REMA 3VK9A 3V1WA 3QR6A 5COHA 5AIXA 3CSIA 2LJAA 2MBSA 5KOWA 4OFMA 4ACSA 1NSWA 3ISOA 1ZYQB 3KCMA 3IAS2 5HQPA 1GWCA 2ZUPA 2A4VA 4HZ4A 3ZRDA 4N0ZA 3ZYWA 3KJYA 2DKIA 1OKTA 3U5RE 4AGSA 2L5OA 4MABA 1MDIA 3QAWA 1YF1A 2D2ZA 17GSA 4CY6A 2H0IA 1YEXA 3F63A 2VCWA 2XHFA 3PR8A 1Z6NA 2P5QA 3E3EA 1K0OA 3KMOA 3TJFA 5J41A 2P31A 4EUYA 2JSYA 1DSBA 1T00A 3ZITA 1QK8A 5FT3A 1GL8A 5G31A 1GTAA 4POMA 3L9SA 2MMAA 1MTCA 2VO4A 2LJRA 4TR1B 4MH2A 2ON7A 1S3AA 4ECBA 4QL7A 3HVVA 1U3IA 3GL3A 1XVQA 2GSTA 5F0GA 3MAKA 2CX3A 2I81A 3F4RA 3P90A 5D8IA 2LV3A 3L9UA 1WP0A 1B9YC 1GTIA 3TRPA 4PNGA 1Z7RA 2A4HA 1R5AA 2QA1A 3IXRA 3APOA 4Z7XA 1GSEA 2CAQA 2MBTA 1XWCA 3ZZXA 1J9BA 2C4JA 2FA4A 3KD0A 4NXIA 4I8BA 4PTSA 4I6XA 3Q18A 4GSNA 2DMMA 2RLIA 1B9XC 1F3AA 3GKMA 2VL9A 1WOUA 2EIOA 2JADA 16GSA 3UOMA 4FYCA 1OC9A 5CREA 4IQAA 2OBKA 6GSTA 1SYXA 3L9VA 5ECRB 2X49A 3ERWA 2X8CA 1GTUA 3F6FA 3DXBA 2JSZA 1A2JA 4FQUA 3WGXA 4IHUA 4V2MA 4XS4B 1Q98A 1GSFA 4JRRA 3QFBC 2XBIA 1U87A 3QD9A 2QC7A 1XW9A 2R0CA 2KUCA 2FUG2 2N5BA 4IGJA 6GSXA 4N0VA 3FHKA 2DBCA 5G5FA 6GSVA 1G6WA 4WEYA 2GGTA 1V57A 10GSA 4KUNA 1YQ1A 2YWMA 3ZREA 4X4JA 4E8HA 2EC4A 2B7JA 5HR3A 3LGCA 3FYGA 2HT9A 1EEMA 5F07A 5G5EA 2C3NA 2IIYA 5IM9A 3SBCA 2K9FA 2CZ3A 2LNTA 1SJZA 4G0KA 2IFQB 1M2AA 3EMXA 4BL7B 3MNGA 4QQ7A 1Q4JA 2OADA 3VWVA 2IMIA 5JWRB 1YJ6A 4HZ2A 4KDYA 4ECIA 2X8GA 2H30A 2VM2A 2VUPA 1QFNA 4XCSA 4ZB9A 4V1Ag 1Z6MA 4JE1A 2L57A 3ERFA 3A5WA 2C0EA 1DUGA 4DEJA 2IPAA 2KP2A 3P2AA 1Y25A 2B7KA 2I1UA 1GNWA 2DIYA 2R3XA 1UVZA 1YKAA 1M9AA 4DVCA 4EDYA 1WPIA 3I9V2 5ELAA 1NM3A 3G7YA 1A2LA 4XTSA 4EO3A 1SU9A 1F37A 2HRKA 2VD0A 3D22A 2H1GA 4XIHA 4KCAA 3EE2A 4O92A 4IVFA 2AB6A 2C1YA 3IAM2 4MK3A 3ZTLA 3IBHA 4Z2UA 3U6VA 3ZFLA 5CO3A 1QUWA 2WZ9A 4HQSA 1AUCA 3N9JA 1EGRA 1SENA 1AAZA 3DEXA 3LYKA 22GSA 1OKDA 1EZKA 3GKKA 3DD3A 4BWSA 3FR9A 2B5YA 4K1FA 4K7NA 2GDRA 4K2XA 5GAND 1U3AA 2QSIA 3ZVJD 2H0HA 1ABAA 2KHPA 2FGXA 4K5RA 1FVKA 4Q5NA 4USSA 5KN3A 1KEBA 4CDOA 2B6MA 4YQUA 2HRFA 3GNJA 3GKXA 5ECHB 3IR4A 1QXHA 4O32A 3CXGA 4D73B 4EIPA 3TDGA 1X5CA 4MPGA 2HZEB 2I4AA 3IK7A 5DALA 3PH9A 4G0LA 4ZB8A 5AN1A 3QCPA 4HDEA 3FK8A 4EKZA 2X8HA 3DVXA 1VF1A 1YKCA 12GSA 1EOGA 3GL5A 2MMNA 4N10A 4J56E 4XS6A 1XFLA 3L4NA 3KMNA 2CV4A 1XOAA 2CT6A 2XBQA 1JLVA 1SL1B 3H1NA 3F3QA 3M9KA 4K2DA 5DVBA 3HD5A 11GSA 3KIJA 4P3YB 1T8EB 2HRAA 4HOJA 2VCZA 1GSYA 2PMTA 3DRNA 4HJ2A 4LMVA 2WRTA 3E9JB 5E4WA 1AC1A 3UBLA 1FW1A 3EVIA 3HDCA 1LU4A 1GULA 2WJUA 1ST9A 1USBA 3A2VA 3TCOA 1PX7A 3C73A 3VI5A 2YWNA 2DJ2A 20GSA 5A4UA 3N5OA 3CMIA 3Q6OA 3IHGA 1WWJA 4PNFA 4XHMA 1W4VA 3A3TA 3RHCA 1HYUA 4KB3A 3APSA 1VRSD 4K9ZA 4ULXA 2V1MA 2AUVA 2YP6A 3WYWA 3M8NA 4MNNA 3HVSA 2P5RA 1OC9B 3VURA 3VWWA 4YH2A 2FWEA 3PINA 3TRQA 3IDVA 3LQ7A 3GX8A 4MZBA 1GSQA 4EDZA 2LSTA 1K3OA 4QL9A 3CTGA 2K8SA 4GCIA 5CRGA 1Z3EA 2K8VA 2JZRA 2PVQA 4NV5A 4XRAA 5BRTA 3ED3A 3S9FA 6GSUA 4PXOA 1SJIA 1V58A 2C3TA 3G9BA 1I5GA 2GLRA 3ERGA 1XIYA 4IBPA 1K3LA 1M2DA 2VL2C 3LJRA 2FLSA 5CYYA 1T4YA 1T7PB 3BJ5A 1CQGA 5B6NA 5D9WA 3GTUB 1TW9A 1S3CA 2H1BA 3L78A 4PQIA 3TGZA 5G2ZA 1TRWA 4KA0A 1V98A 5HR2A 3GH6A 1FG4A 3RHBA 2GSSA 2PUKC 2YWIA 5GSTA 1YF0A 3WD6A 2LEGA 2IL3A 3HXSA 5G1KA 13GSA 2DJ1A 2E2GA 1Z7PA 4BWQA 1V9WA 3P8WA 3HY2A 3UVTA 3BOAA 1AXDA 5B8BA 18GSA 3EU4A 4ZILA 2XPEA 3W8JA 1GH2A 1O8WA 1X0RA 4EVMA 5D93A 3US3A 2LQOA 5DJLA 1SL2B 5IMAA 2GSRA 4POBA 2AJQB 3MWHA 2DSAA 2B3SA 3LSZA 4OMVA 4DSQA 3JCML 4WF5A 4O5UA 1BG5A 3TOTA 4L0WA 4WF4A 1K0NA 4Q5FA 2MMZA 2C3QA 4WXTA 5B6MA 1BJXA 3LG6A 3O3TA 4BVXA 3GHAA 4GTUA 4G10A 5DQYA 1FVJA 5KN0A 1ZZYA 5A5KA 5DCGA 1VF2A 2YPMA 1O85A 4MF7A 4V1Ap 4NPBA 1A0FA 4OO5A 3HA9A 3DKSA 1V40A 2BTOT 4TR4A 3GIXA 2DLXA 3F6DA 2GZZA 4PX1A 1GUHA 5LCZA 5DDLA 3MIXA 2DC5A 1X9MB 3UVHA 1T1VA 1MD4A 1DE1A 4O5QA 1B4QA 2PU9C 1WJKA 2L59A 3IA1A 2LUSA 3H4KA 5HR1A 3A5IA 1GLQA 4JR4A 3FR3A 2HXKA 2A2PA 1AW9A 4F82A 5IMDA 5JWQB 3DYRA 1PN9A 2LKUA 4GSTA 1W89A 1A24A 2R4VA 3TJJA 5EY6A 1EWXA 4OCFA 5J9BA 2C0FA 3IC4A 3TKPA 2GS3A 4FIWA 1PRXA 2BJXA 3FY7A 5ECPB 3HYPA 3EINA 2C0DA 1FB6A 3MDKA 1TKDB 1TTZA 1R5PA 4MZCA 3HKRA 6GSWA 4KNDA 2GZPA 1KTEA 3GH9A 1G7EA 3Q74A 1MD3A 4ZL8A 4KX4A 2FHEA 2IWTA 3KEBA 3HJPA 2RM5A 4J2FA 2YANA 2VIMA 1G6YA 5DJMA 2H19A 4YQVA 1SYRA 1WMJA 3TKRA 2R5GA 4HU9A 3D6IA 3WT1A 2H73A 4I97A 4TR3A 5AGYA 2LRCA 2YCDA 3BBYA 5LD0A 1BEDA 1O6JA 3FMWA 4FH8A 4K7IA 1FAAA 1GUKA 1O81A 2J23A 3LEFA 2OE3A 2X99A 2UZ8A 2DIZA 3Q19A 4TW5A 2IJYA 2WGRA 2F3MA 1ZOFA 1THOA 2AHEA 7GSSA 1SK2A 2X64A 4NAXA 5B8AA 1GLPA 1DBYA 3FEUA 2GSQA 4EL1A 3KXOA 3QMXA 4KCEA 1SKRB 4F0BA 4MLYA 4PGTA 3IC8A 2L6DA 2C0GA 2JU5A 5CAXA 4FYUA 2M80A 1PD21 2VCVA 4MA9A 1OC3A 3W6GA 4CY8A 2FA8A 2ES7A 4YAVA 3K8NA 3CBUA 1TP9A 2LRTA 3GN3A 1VF3A 3LW9A 4X0XA 3W8SA 4MF6A 5C04A 3KTLA 2E2MA 1O7UA 4TR0A 3C8EA 4AJ7A 2FNOA 5ECNB 2KLXA 2V6OA 4KE3A 2LJKA 1Y6EA 3TJKA 1SL0B 2EIRA 2H01A 2H71A 3GSSA 5A4VA 5JCUA 2B1LA 1JZWA 5FHIA 2C8UA 5HR0A 5H5QA 2QGVA 2B5XA 2HYXA 2VM1A 4HS1A 3H79A 1XXUA 4K6XA 1SD9A 5IIZA 3QPMA 1SK1A 2IMKA 2V41A 2GQKA 4N30A 5IOWA 3IHQA 5EL8A 2L4CA 5F8BA 4Q5QA 1KNGA 5IMVA 4F0CA 1TRSA 2O8VB 4LL4B 5GAPD 1URMA 1EEJA 1A23A 2H0GA 1GP1A 4PURA 2FWHA 4IKHA 3LFLA 2VLUA 1GNEA 3LORA 1ERTA 3QAGA 1TRUA 1CQHA 4L5LA 4V2NA 1VGLA 3RAZA 1A0RP 1GSUA 2IN3A 2E7PA 4HI7A 1PMTA 4YKGA 1XPVA 1XBSA 2N5AA 2FWGA 2MZCA 3RPPA 1XWGA 4BVXB 1HNCA 1YEPA 1ACVA 4ZL7A 3M1GA 2P0GA 1I9DA 3GRXA 4OWYA 4TRXA 1RW1A 1Z5YE 1FO5A 4I2UA 3GV1A 3NIVA 3BD2A 1DE2A 4Z2RA 5IO2A 1PKWA 2VL2A 5JCWA 5ENUA 3ZFBA 1LBKA 5G1LA 2F8AA 5IQYA 3LYPA 4EIQA 1PL2A 2N5FA 2DJ3A 4Z2TA 1TK0B 4NV2A 5J4UA 3IV4A 3VI7A 3ZMLA 3VFIA 3G7IA 4PQHA 3DVWA 1XW5A 3I69A 1PGTA 4KW6A 2TRCP 4FYBA 3GX0A 1BX9A 1B8XA 3AY8A 1B48A 3UBKA 4KSMA 2HSMA 1N2AA 3RBTA 1X9SB 3EC3A 3A2WA 3P7XA 1IYHA 3DIEA 4GWRA 3GA4A 3CYNA 4LL1B 4E8EA 5JWOB 1G0TA 3GUSA 5L71A 3VLNA 1R4WA 5KEJA 3RPNA 1BYEA 2ON5A 1X5EA 3LWAA 3KH7A 1B4PA 2JL4A 1NHOA 2LTKA 3GKNA 4CW9A 3UEMA 1WRYA 1K0BA 3GSTA 3LXZA 4MJBA 3HCZA 2K6VA 2LRNA 4AF2A 4GF0A 4DSSA 3KP9A 2HSYA 1O8XA 1IYIA 3A2XA 1VF4A 1OVNA 1ERUA 1YZXA 3EU3A 3NZNA 5F06A 2HRNA 3UMAA 3BCIA 3UIWA 2F8FA 1KBNA 1N8JA 4ZBAA 2HE3A 4TN8A 3APQA 3UAPA 3HJMA 1Z9HA 19GSA 2F9SA 1RQMA 2CVBA 3WGEA 1O73A 4MP4A 4ICYA 4JR6A 2B5EA 5ECIB 1J0FA 5GSSA 4MPFA 3TRXA 3F8UA 2VOCA 1T3BA 5KN1A 4F03A 2OE1A 2A2SA 3KGKA 4NWYA 2IFQA 2R2JA 3VWXA 4BL7A 4H86A 5HFGA 14GSA 1TU8A 1XVWA 2HFDA 4IQ1A 5ABRA 3WGDA 2HNLA 2H72A 9GSSA 2H70A 1SK0A 3TOUA 2GTUA 3ZMKA 2K18A 2PBJA 1FOHA 4KF9A 1JHBA 2O87A 1QMVA 4K0NA 1F2EA 3FRCA 3WT2A 3C7MA 2VLVA 1WIKA 1ML6A 4ID0A 1S3DA 2R0PA 5CNWA 1PX6A 5BMUA 1K3YA 1ON4A 2DMLA 5F05A 4LMWA 5IMZA 3NOFA 4TXOA 2JZTA 4ZBBA 4G2EA 4WR4A 4HEA2 1MEKA 2H74A 2EIQA 3J7Yb 3R2QA 1TRVA 2L5LA 1TI1A 2X4AA 1M0UA 3HVXA 3TKSE 4ZB6A 2VCQA 2M72A 1YDKA 2LS5A 5CRDA 1A8LA 5AISA 1V2AA 1OYJA 4GQCA 4PQ1A 3HZ8A 3PPUA 2OJLA 4AJ8A 4ZBDA 1JZRA 2GZYA 4ISDA 2FCHA 4RQXA 4Q5RA 4OFNA 5ECMB 1GRXA 4ZXGA 5CP1A 2RUFA 3F0IA 2YOIA 3ZIJA 2VLTA 4ILFA 3GMFA 1HD2A 4V2LA 3C1RA 4ECJA 2NPBA 3FZAA 2GQMA 2OKAA 1A8YA 5DCHA 4L5OA 3FZ9A 2O89A 3M0FA 4MZWA 4WBJA 1EOHA 1SJ6A 2YWOA 5IOXA 4KAEA 4POKA 4G19A 2PWJA 4GLTA 4L8EA 4ZIJA 3FR6A 1PKZA 1EV9A 2VCTA 2F51A 2ZNMA 4D73A 2IMFA 2L6CA 4OCEA 2HZEA 4WETA 2O85A 4K7OA 1SKSB 2H75A 4POLA 3EYTA 4MMMA 3IOSA 3RDWA 2YZUA 1PA3A 5A4WA 1PSQA 3L0HA 2RIIA 3H93A 3D0ZA 4LLRA 4A5PA 1EP8A 3QFAC 5AIVA 4BVYA 1ZMAA 4WKWA 5CRHA 1BAYA 2H76A 4L0UA 5JCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAC A;  5DAL B;  1UN2 A;  3CTF A;  3TKQ A;  2JAC A;  3CSJ A;  2JZS A;  2BMX A;  4OD7 A;  1GSS A;  5E59 A;  3F3R A;  4X1U A;  5IO0 A;  3C71 A;  5IPG A;  3VPT A;  1NHY A;  1FHE A;  1YY7 A;  1ERW A;  3I43 A;  2PVO C;  4MDC A;  3D5J A;  3FZ5 A;  3HZ4 A;  4EXJ A;  4O7H A;  4NHW A;  4IEL A;  4GXZ A;  4CHS A;  2TRX A;  2MMO A;  2MYG A;  4MF5 A;  1H75 A;  2I9H A;  5D9V A;  2XC2 A;  5D96 A;  1PL1 A;  2OBI A;  4RQR A;  1BQ7 A;  1HNA A;  1TXX A;  4ZL9 A;  3ME8 A;  2VD1 A;  1WE0 A;  5FWG A;  4WBR D;  1TK5 B;  5D9X A;  2A2R A;  2IMD A;  5ID2 A;  3ME7 A;  4XS1 A;  1M2B A;  4XRD A;  3IK9 A;  2AAW A;  2DJJ A;  3VWU A;  4DSS B;  3G7J A;  3J7Y k;  2H6Z A;  1GUM A;  4RI7 A;  1F9M A;  3IPZ A;  1EGO A;  2PN8 A;  3GFK A;  4IP1 A;  2YV9 A;  2QKE A;  4YQM A;  3BCK A;  1K0A A;  1U88 A;  2VAF A;  1NW2 A;  2V32 A;  2V6K A;  2C80 A;  3MSZ A;  4LA1 A;  1ZL9 A;  4GSS A;  4EC0 A;  4DSR A;  3GTU A;  5ECQ B;  5ECO B;  3UL3 A;  5INY A;  1XCC A;  6GSY A;  4GQF A;  4MJE A;  4RI6 A;  2HZF A;  1RK4 A;  4G9H A;  1OE8 A;  1X5D A;  3C1S A;  3F4S A;  2DJK A;  1OE7 A;  1TJD A;  5D73 A;  5ECK B;  1M9B A;  1R7H A;  5DAK A;  5J5N A;  3H8Q A;  1TI3 A;  4ECC A;  1TK8 B;  2HSH A;  1XWK A;  1A2M A;  5J9C A;  5DBQ A;  1M99 A;  3CSH A;  1EP7 A;  2NTO A;  2CQ9 A;  1PQN A;  3ZVJ A;  1X9W B;  2GT6 A;  4MCU A;  3D21 A;  5H5R A;  2FD3 A;  2OE0 A;  4TVE A;  1ERV A;  2H6X A;  8GSS A;  4HU7 A;  5KN2 A;  3D4T A;  4HJM A;  1OAZ A;  1G7O A;  2WDU A;  2FWF A;  3FZ4 A;  2J9H A;  3KZQ A;  3DGQ A;  3HHV A;  2RUE A;  1ZYE A;  5ELG A;  1AIU A;  1MDJ A;  5IPH A;  4TXO B;  2YNX A;  3TUE A;  1QQ2 A;  4K8M A;  1M7T A;  2HLS A;  1ZCP A;  2AYT A;  2I3Y A;  2NBS A;  2GQL A;  1XWB A;  5IMC A;  4X43 A;  1T4Z A;  1FOV A;  3IRA A;  4OFT A;  2CZ2 A;  3QDN A;  5HFI A;  3ZIV A;  5LNK e;  2YZH A;  4NMU A;  3IE3 A;  4IN0 A;  2YN1 A;  2CA8 A;  2FY6 A;  5EPF A;  4JU5 A;  4PUA A;  1K0C A;  1U6T A;  4TXV A;  2B1K A;  2WUL A;  1GTB A;  4AJ6 A;  1FB0 A;  4TOP A;  3UAR A;  3I6A A;  1F6M C;  2WCI A;  2H1D A;  3TKS A;  5DQS A;  1K0M A;  2IME A;  2R37 A;  3SWL A;  4TR1 A;  1LJR A;  4EE0 A;  4KGI A;  3CRU A;  1E2Y A;  2O7K A;  2GVP A;  4FO5 A;  2DJ0 A;  4HUA A;  2CAI A;  2H66 A;  5C00 A;  1J08 A;  2AV4 A;  2RM6 A;  5HFK A;  5J3R A;  1HQO A;  2V2G A;  3OR5 A;  3KTB A;  1H4O A;  1OC8 A;  2ZCT A;  5D9T A;  1JZD A;  2PGT A;  2H1A A;  2KOK A;  2WFC A;  3TB2 A;  5ECL B;  1C72 A;  3M9J A;  2WB9 A;  1R26 A;  3D4M A;  1GSD A;  4I2T A;  1TDI A;  1MDK A;  4N11 A;  4I5Q A;  4WR5 A;  4JZQ A;  1JZO A;  3FKF A;  3KM6 A;  2TIR A;  5IMF A;  2CVD A;  2WS2 A;  2KP1 A;  3TJG A;  4MH3 A;  5EVO A;  2G0F A;  1XWA A;  4XS4 A;  4IP6 A;  5B7C A;  1AQV A;  2E0Q A;  3GUR A;  1SD8 A;  3VPQ A;  1SKW B;  2PPT A;  5CRW A;  4KSO A;  1EV4 A;  2G2Q A;  2CX4 A;  4IS0 A;  6GSS A;  2YJH A;  2XPD A;  3PGT A;  1E6B A;  3UJ1 A;  1AQX A;  1THX A;  2H6Y A;  3FW2 A;  2OA7 A;  4O5R A;  1UC7 A;  4IW9 A;  5GZZ B;  3QAV A;  3KH9 A;  4ML6 A;  3F4T A;  3TJB A;  3LXT A;  2ALB A;  5ID2 B;  2CVK A;  3EMP A;  4MJA A;  3M3M A;  4IJI A;  3TKS C;  3GYK A;  5ECS A;  4F9Z A;  1F3B A;  2NVL A;  2VL3 A;  3DWV A;  1TOF A;  2L4Q A;  4BPY A;  3KP8 A;  4HQZ A;  1JLW A;  4J57 E;  1ILO A;  1K0D A;  1UA5 A;  4BA7 A;  3O76 A;  4ML1 A;  4IJ3 A;  1HNB A;  3HJO A;  4GRF A;  3ZL5 A;  4NHZ A;  1QGV A;  3ZLP A;  2YJ7 A;  3EWL A;  4KDU A;  1TU7 A;  3CRT A;  3EUR A;  2LQQ A;  1XZO A;  1ZGN A;  2H8L A;  1XOB A;  3F9U A;  3QOU A;  3O6T A;  4MJC A;  4K0G A;  5G30 A;  4TKY A;  2NDO A;  4OO4 A;  4KDX A;  2YV7 A;  1JFU A;  2Z9S A;  4F2I A;  2LNS A;  2GT5 A;  2VCX A;  5DAK B;  2R6K A;  4JED A;  2PER A;  4JBB A;  4PUF C;  3DML A;  4RUV A;  2M46 A;  5H5S A;  4EF0 A;  2HI7 A;  1XW6 A;  4KH7 A;  3E0U A;  4YAP A;  1AQW A;  2REM A;  3VK9 A;  3V1W A;  3QR6 A;  5COH A;  5AIX A;  3CSI A;  2LJA A;  2MBS A;  4OFM A;  4ACS A;  1NSW A;  3ISO A;  1ZYQ B;  3KCM A;  3IAS 2;  5HQP A;  1GWC A;  2ZUP A;  2A4V A;  4HZ4 A;  3ZRD A;  4N0Z A;  3ZYW A;  3KJY A;  1OKT A;  3U5R E;  4AGS A;  2L5O A;  4MAB A;  1MDI A;  3QAW A;  1YF1 A;  2D2Z A;  17GS A;  2H0I A;  1YEX A;  3F63 A;  2VCW A;  2XHF A;  3PR8 A;  1Z6N A;  2P5Q A;  3E3E A;  1K0O A;  3KMO A;  3TJF A;  5J41 A;  2P31 A;  4EUY A;  2JSY A;  1DSB A;  1T00 A;  3ZIT A;  1QK8 A;  5FT3 A;  1GL8 A;  5G31 A;  1GTA A;  4POM A;  3L9S A;  2MMA A;  1MTC A;  2VO4 A;  2LJR A;  4TR1 B;  4MH2 A;  2ON7 A;  1S3A A;  4ECB A;  4QL7 A;  3HVV A;  1U3I A;  3GL3 A;  1XVQ A;  2GST A;  5F0G A;  3MAK A;  2CX3 A;  2I81 A;  3F4R A;  3P90 A;  5D8I A;  2LV3 A;  3L9U A;  1WP0 A;  1B9Y C;  1GTI A;  3TRP A;  4PNG A;  1Z7R A;  1R5A A;  3IXR A;  3APO A;  4Z7X A;  1GSE A;  2CAQ A;  2MBT A;  1XWC A;  3ZZX A;  1J9B A;  2C4J A;  2FA4 A;  3KD0 A;  4NXI A;  4I8B A;  4I6X A;  3Q18 A;  4GSN A;  2DMM A;  2RLI A;  1B9X C;  1F3A A;  3GKM A;  2VL9 A;  1WOU A;  2EIO A;  2JAD A;  16GS A;  3UOM A;  4FYC A;  1OC9 A;  5CRE A;  4IQA A;  2OBK A;  6GST A;  1SYX A;  3L9V A;  5ECR B;  3ERW A;  2X8C A;  1GTU A;  3F6F A;  3DXB A;  2JSZ A;  1A2J A;  3WGX A;  4IHU A;  4V2M A;  4XS4 B;  1Q98 A;  1GSF A;  4JRR A;  3QFB C;  2XBI A;  1U87 A;  3QD9 A;  2QC7 A;  1XW9 A;  2KUC A;  2FUG 2;  2N5B A;  4IGJ A;  6GSX A;  4N0V A;  3FHK A;  2DBC A;  5G5F A;  6GSV A;  1G6W A;  4WEY A;  2GGT A;  1V57 A;  10GS A;  4KUN A;  1YQ1 A;  2YWM A;  3ZRE A;  4E8H A;  2EC4 A;  2B7J A;  5HR3 A;  3LGC A;  3FYG A;  2HT9 A;  1EEM A;  5F07 A;  5G5E A;  2C3N A;  2IIY A;  5IM9 A;  3SBC A;  2K9F A;  2CZ3 A;  2LNT A;  1SJZ A;  2IFQ B;  1M2A A;  3EMX A;  3MNG A;  4QQ7 A;  1Q4J A;  2OAD A;  3VWV A;  2IMI A;  5JWR B;  1YJ6 A;  4HZ2 A;  4KDY A;  4ECI A;  2X8G A;  2H30 A;  2VM2 A;  2VUP A;  1QFN A;  4XCS A;  4ZB9 A;  4V1A g;  1Z6M A;  4JE1 A;  2L57 A;  3ERF A;  3A5W A;  2C0E A;  1DUG A;  4DEJ A;  2IPA A;  2KP2 A;  3P2A A;  1Y25 A;  2B7K A;  2I1U A;  1GNW A;  2DIY A;  2R3X A;  1UVZ A;  1YKA A;  1M9A A;  4DVC A;  4EDY A;  1WPI A;  3I9V 2;  5ELA A;  1NM3 A;  3G7Y A;  1A2L A;  4XTS A;  4EO3 A;  1SU9 A;  1F37 A;  2VD0 A;  3D22 A;  2H1G A;  4XIH A;  4KCA A;  3EE2 A;  4O92 A;  4IVF A;  2AB6 A;  2C1Y A;  3IAM 2;  4MK3 A;  3ZTL A;  3IBH A;  3U6V A;  3ZFL A;  5CO3 A;  1QUW A;  2WZ9 A;  4HQS A;  1AUC A;  3N9J A;  1EGR A;  1SEN A;  1AAZ A;  3DEX A;  3LYK A;  22GS A;  1OKD A;  1EZK A;  3GKK A;  3DD3 A;  4BWS A;  3FR9 A;  2B5Y A;  4K1F A;  4K7N A;  2GDR A;  5GAN D;  1U3A A;  2QSI A;  3ZVJ D;  2H0H A;  1ABA A;  2KHP A;  2FGX A;  1FVK A;  4Q5N A;  5KN3 A;  1KEB A;  4CDO A;  2B6M A;  4YQU A;  2HRF A;  3GNJ A;  3GKX A;  5ECH B;  3IR4 A;  1QXH A;  4O32 A;  3CXG A;  4D73 B;  3TDG A;  1X5C A;  4MPG A;  2HZE B;  2I4A A;  3IK7 A;  5DAL A;  3PH9 A;  4ZB8 A;  5AN1 A;  3QCP A;  4HDE A;  3FK8 A;  4EKZ A;  2X8H A;  3DVX A;  1VF1 A;  1YKC A;  12GS A;  1EOG A;  3GL5 A;  2MMN A;  4N10 A;  4J56 E;  4XS6 A;  1XFL A;  3L4N A;  3KMN A;  2CV4 A;  1XOA A;  2CT6 A;  2XBQ A;  1JLV A;  1SL1 B;  3H1N A;  3F3Q A;  3M9K A;  4K2D A;  5DVB A;  3HD5 A;  11GS A;  3KIJ A;  4P3Y B;  1T8E B;  4HOJ A;  2VCZ A;  1GSY A;  2PMT A;  3DRN A;  4HJ2 A;  4LMV A;  2WRT A;  3E9J B;  5E4W A;  1AC1 A;  3UBL A;  1FW1 A;  3EVI A;  3HDC A;  1LU4 A;  1GUL A;  2WJU A;  1ST9 A;  1USB A;  3A2V A;  3TCO A;  1PX7 A;  3C73 A;  3VI5 A;  2YWN A;  2DJ2 A;  20GS A;  5A4U A;  3N5O A;  3CMI A;  3Q6O A;  1WWJ A;  4PNF A;  4XHM A;  1W4V A;  3A3T A;  3RHC A;  1HYU A;  4KB3 A;  3APS A;  1VRS D;  4K9Z A;  4ULX A;  2V1M A;  2AUV A;  2YP6 A;  3WYW A;  3M8N A;  3HVS A;  2P5R A;  1OC9 B;  3VUR A;  3VWW A;  4YH2 A;  2FWE A;  3PIN A;  3TRQ A;  3IDV A;  3LQ7 A;  3GX8 A;  4MZB A;  1GSQ A;  4EDZ A;  2LST A;  1K3O A;  4QL9 A;  3CTG A;  2K8S A;  4GCI A;  5CRG A;  1Z3E A;  2K8V A;  2JZR A;  2PVQ A;  4NV5 A;  4XRA A;  3ED3 A;  3S9F A;  6GSU A;  4PXO A;  1SJI A;  1V58 A;  2C3T A;  3G9B A;  1I5G A;  2GLR A;  3ERG A;  1XIY A;  4IBP A;  1K3L A;  1M2D A;  2VL2 C;  3LJR A;  2FLS A;  5CYY A;  1T4Y A;  1T7P B;  3BJ5 A;  1CQG A;  5B6N A;  5D9W A;  3GTU B;  1TW9 A;  1S3C A;  2H1B A;  3L78 A;  4PQI A;  3TGZ A;  5G2Z A;  1TRW A;  4KA0 A;  1V98 A;  5HR2 A;  3GH6 A;  1FG4 A;  3RHB A;  2GSS A;  2PUK C;  2YWI A;  5GST A;  1YF0 A;  3WD6 A;  2LEG A;  2IL3 A;  3HXS A;  5G1K A;  13GS A;  2DJ1 A;  2E2G A;  1Z7P A;  4BWQ A;  1V9W A;  3P8W A;  3HY2 A;  3UVT A;  3BOA A;  1AXD A;  5B8B A;  18GS A;  3EU4 A;  4ZIL A;  2XPE A;  3W8J A;  1GH2 A;  1O8W A;  1X0R A;  4EVM A;  5D93 A;  3US3 A;  2LQO A;  5DJL A;  1SL2 B;  5IMA A;  2GSR A;  4POB A;  2AJQ B;  3MWH A;  2DSA A;  2B3S A;  3LSZ A;  4OMV A;  4DSQ A;  3JCM L;  4WF5 A;  1BG5 A;  3TOT A;  4L0W A;  4WF4 A;  1K0N A;  4Q5F A;  2MMZ A;  2C3Q A;  4WXT A;  5B6M A;  1BJX A;  3LG6 A;  3O3T A;  4BVX A;  3GHA A;  4GTU A;  4G10 A;  5DQY A;  1FVJ A;  5KN0 A;  1ZZY A;  5A5K A;  5DCG A;  1VF2 A;  2YPM A;  1O85 A;  4MF7 A;  4V1A p;  4NPB A;  1A0F A;  4OO5 A;  3HA9 A;  3DKS A;  1V40 A;  2BTO T;  4TR4 A;  3GIX A;  2DLX A;  3F6D A;  2GZZ A;  4PX1 A;  1GUH A;  5LCZ A;  5DDL A;  2DC5 A;  1X9M B;  3UVH A;  1T1V A;  1MD4 A;  1DE1 A;  1B4Q A;  2PU9 C;  1WJK A;  2L59 A;  3IA1 A;  2LUS A;  3H4K A;  5HR1 A;  1GLQ A;  4JR4 A;  3FR3 A;  2HXK A;  1AW9 A;  4F82 A;  5IMD A;  5JWQ B;  3DYR A;  1PN9 A;  2LKU A;  4GST A;  1W89 A;  1A24 A;  2R4V A;  3TJJ A;  5EY6 A;  1EWX A;  4OCF A;  5J9B A;  2C0F A;  3IC4 A;  3TKP A;  2GS3 A;  4FIW A;  1PRX A;  2BJX A;  3FY7 A;  5ECP B;  3HYP A;  3EIN A;  2C0D A;  1FB6 A;  3MDK A;  1TKD B;  1TTZ A;  1R5P A;  4MZC A;  3HKR A;  6GSW A;  4KND A;  2GZP A;  1KTE A;  3GH9 A;  1G7E A;  3Q74 A;  1MD3 A;  4ZL8 A;  4KX4 A;  2FHE A;  2IWT A;  3KEB A;  3HJP A;  2RM5 A;  4J2F A;  2YAN A;  2VIM A;  1G6Y A;  5DJM A;  2H19 A;  4YQV A;  1SYR A;  1WMJ A;  3TKR A;  2R5G A;  4HU9 A;  3D6I A;  3WT1 A;  2H73 A;  4I97 A;  4TR3 A;  5AGY A;  2LRC A;  2YCD A;  3BBY A;  5LD0 A;  1BED A;  1O6J A;  4FH8 A;  4K7I A;  1FAA A;  1GUK A;  1O81 A;  2J23 A;  3LEF A;  2OE3 A;  2X99 A;  2DIZ A;  3Q19 A;  4TW5 A;  2IJY A;  2WGR A;  2F3M A;  1ZOF A;  1THO A;  2AHE A;  7GSS A;  1SK2 A;  2X64 A;  4NAX A;  5B8A A;  1GLP A;  1DBY A;  3FEU A;  2GSQ A;  4EL1 A;  3KXO A;  3QMX A;  4KCE A;  1SKR B;  4F0B A;  4MLY A;  4PGT A;  2L6D A;  2C0G A;  2JU5 A;  5CAX A;  4FYU A;  2M80 A;  1PD2 1;  2VCV A;  4MA9 A;  1OC3 A;  3W6G A;  2FA8 A;  2ES7 A;  4YAV A;  3K8N A;  3CBU A;  1TP9 A;  2LRT A;  3GN3 A;  1VF3 A;  4X0X A;  3W8S A;  4MF6 A;  5C04 A;  3KTL A;  2E2M A;  1O7U A;  4TR0 A;  3C8E A;  4AJ7 A;  2FNO A;  5ECN B;  2KLX A;  2V6O A;  4KE3 A;  2LJK A;  1Y6E A;  3TJK A;  1SL0 B;  2EIR A;  2H01 A;  2H71 A;  3GSS A;  5A4V A;  5JCU A;  2B1L A;  1JZW A;  5FHI A;  2C8U A;  5HR0 A;  5H5Q A;  2QGV A;  2B5X A;  2HYX A;  2VM1 A;  4HS1 A;  3H79 A;  1XXU A;  4K6X A;  1SD9 A;  5IIZ A;  3QPM A;  1SK1 A;  2IMK A;  2V41 A;  2GQK A;  4N30 A;  5IOW A;  3IHQ A;  5EL8 A;  2L4C A;  5F8B A;  4Q5Q A;  1KNG A;  5IMV A;  4F0C A;  1TRS A;  2O8V B;  4LL4 B;  5GAP D;  1URM A;  1EEJ A;  1A23 A;  2H0G A;  1GP1 A;  4PUR A;  2FWH A;  4IKH A;  3LFL A;  2VLU A;  1GNE A;  3LOR A;  1ERT A;  3QAG A;  1TRU A;  1CQH A;  4L5L A;  4V2N A;  1VGL A;  3RAZ A;  1A0R P;  1GSU A;  2IN3 A;  2E7P A;  4HI7 A;  1PMT A;  1XPV A;  1XBS A;  2N5A A;  2FWG A;  2MZC A;  3RPP A;  1XWG A;  1HNC A;  1YEP A;  1ACV A;  4ZL7 A;  3M1G A;  2P0G A;  1I9D A;  3GRX A;  4OWY A;  4TRX A;  1RW1 A;  1Z5Y E;  1FO5 A;  4I2U A;  3GV1 A;  3NIV A;  3BD2 A;  1DE2 A;  5IO2 A;  1PKW A;  2VL2 A;  5JCW A;  5ENU A;  3ZFB A;  1LBK A;  5G1L A;  2F8A A;  5IQY A;  3LYP A;  1PL2 A;  2N5F A;  2DJ3 A;  1TK0 B;  4NV2 A;  5J4U A;  3IV4 A;  3VI7 A;  3ZML A;  3VFI A;  3G7I A;  4PQH A;  3DVW A;  1XW5 A;  3I69 A;  1PGT A;  4KW6 A;  2TRC P;  4FYB A;  3GX0 A;  1BX9 A;  1B8X A;  3AY8 A;  1B48 A;  3UBK A;  4KSM A;  1N2A A;  3RBT A;  1X9S B;  3EC3 A;  3A2W A;  3P7X A;  1IYH A;  3DIE A;  4GWR A;  3GA4 A;  3CYN A;  4LL1 B;  4E8E A;  5JWO B;  1G0T A;  3GUS A;  5L71 A;  3VLN A;  1R4W A;  5KEJ A;  3RPN A;  1BYE A;  2ON5 A;  1X5E A;  3LWA A;  3KH7 A;  1B4P A;  2JL4 A;  1NHO A;  2LTK A;  3GKN A;  4CW9 A;  3UEM A;  1WRY A;  1K0B A;  3GST A;  3LXZ A;  4MJB A;  3HCZ A;  2K6V A;  2LRN A;  4AF2 A;  4GF0 A;  4DSS A;  3KP9 A;  2HSY A;  1O8X A;  1IYI A;  3A2X A;  1VF4 A;  1OVN A;  1ERU A;  1YZX A;  3EU3 A;  3NZN A;  5F06 A;  2HRN A;  3UMA A;  3BCI A;  3UIW A;  2F8F A;  1KBN A;  1N8J A;  4ZBA A;  2HE3 A;  4TN8 A;  3APQ A;  3UAP A;  3HJM A;  1Z9H A;  19GS A;  2F9S A;  1RQM A;  2CVB A;  3WGE A;  1O73 A;  4MP4 A;  4JR6 A;  2B5E A;  5ECI B;  1J0F A;  5GSS A;  4MPF A;  3TRX A;  3F8U A;  2VOC A;  1T3B A;  5KN1 A;  4F03 A;  2OE1 A;  2A2S A;  3KGK A;  4NWY A;  2IFQ A;  2R2J A;  3VWX A;  4BL7 A;  4H86 A;  5HFG A;  14GS A;  1TU8 A;  1XVW A;  2HFD A;  4IQ1 A;  5ABR A;  3WGD A;  2HNL A;  2H72 A;  9GSS A;  2H70 A;  1SK0 A;  3TOU A;  2GTU A;  3ZMK A;  2K18 A;  2PBJ A;  1JHB A;  2O87 A;  1QMV A;  4K0N A;  1F2E A;  3FRC A;  3WT2 A;  3C7M A;  2VLV A;  1WIK A;  1ML6 A;  4ID0 A;  1S3D A;  5CNW A;  1PX6 A;  1K3Y A;  1ON4 A;  2DML A;  5F05 A;  4LMW A;  5IMZ A;  3NOF A;  4TXO A;  2JZT A;  4ZBB A;  4G2E A;  4WR4 A;  4HEA 2;  1MEK A;  2H74 A;  2EIQ A;  3J7Y b;  3R2Q A;  1TRV A;  2L5L A;  1TI1 A;  3TKS E;  1M0U A;  3HVX A;  4ZB6 A;  2VCQ A;  2M72 A;  1YDK A;  2LS5 A;  5CRD A;  1A8L A;  5AIS A;  1V2A A;  1OYJ A;  4GQC A;  4PQ1 A;  3HZ8 A;  2OJL A;  4AJ8 A;  4ZBD A;  1JZR A;  2GZY A;  4ISD A;  2FCH A;  4RQX A;  4Q5R A;  4OFN A;  5ECM B;  1GRX A;  4ZXG A;  5CP1 A;  2RUF A;  3F0I A;  2YOI A;  3ZIJ A;  2VLT A;  4ILF A;  3GMF A;  1HD2 A;  4V2L A;  3C1R A;  4ECJ A;  2NPB A;  3FZA A;  2GQM A;  2OKA A;  1A8Y A;  5DCH A;  4L5O A;  3FZ9 A;  2O89 A;  3M0F A;  4MZW A;  4WBJ A;  1EOH A;  1SJ6 A;  2YWO A;  5IOX A;  4KAE A;  4POK A;  4G19 A;  2PWJ A;  4GLT A;  4L8E A;  4ZIJ A;  3FR6 A;  1PKZ A;  1EV9 A;  2VCT A;  2F51 A;  2ZNM A;  4D73 A;  2IMF A;  2L6C A;  4OCE A;  2HZE A;  4WET A;  2O85 A;  4K7O A;  1SKS B;  2H75 A;  4POL A;  3EYT A;  4MMM A;  3IOS A;  3RDW A;  2YZU A;  1PA3 A;  5A4W A;  1PSQ A;  3L0H A;  2RII A;  3H93 A;  3D0Z A;  4LLR A;  1EP8 A;  3QFA C;  5AIV A;  4BVY A;  1ZMA A;  4WKW A;  5CRH A;  1BAY A;  2H76 A;  4L0U A;  5JCG A; 
#chains in the Genus database with same CATH topology
 2OAC A;  5DAL B;  2R0G A;  1UN2 A;  3CTF A;  3TKQ A;  2JAC A;  3CSJ A;  2JZS A;  2BMX A;  4OD7 A;  1GSS A;  5E59 A;  3F3R A;  4X1U A;  5IO0 A;  3C71 A;  5IPG A;  3VPT A;  1NHY A;  1FHE A;  1YY7 A;  1ERW A;  2QA2 A;  3I43 A;  2PVO C;  4MDC A;  3D5J A;  3FZ5 A;  3HZ4 A;  4EXJ A;  4O7H A;  4NHW A;  4IEL A;  4GXZ A;  4CHS A;  2TRX A;  2MMO A;  2MYG A;  4MF5 A;  1H75 A;  2I9H A;  5D9V A;  2XC2 A;  5D96 A;  1PL1 A;  2OBI A;  4RQR A;  1BQ7 A;  1HNA A;  1TXX A;  4ZL9 A;  3ME8 A;  2VD1 A;  1WE0 A;  5FWG A;  4WBR D;  1TK5 B;  5D9X A;  1M3I A;  2A2R A;  2IMD A;  1ZYP A;  5ID2 A;  3ME7 A;  4XS1 A;  1M2B A;  4XRD A;  3IK9 A;  2AAW A;  2DJJ A;  3VWU A;  4DSS B;  3G7J A;  3J7Y k;  2H6Z A;  1GUM A;  4RI7 A;  1F9M A;  3IPZ A;  4K5S A;  1EGO A;  2PN8 A;  3GFK A;  4IP1 A;  2YV9 A;  2QKE A;  4YQM A;  3BCK A;  1K0A A;  1PFO A;  1U88 A;  2VAF A;  1NW2 A;  2V32 A;  2V6K A;  2C80 A;  3MSZ A;  4LA1 A;  1ZL9 A;  4GSS A;  4EC0 A;  4DSR A;  3GTU A;  5ECQ B;  5ECO B;  3UL3 A;  5INY A;  1XCC A;  6GSY A;  4GQF A;  4MJE A;  4RI6 A;  2HZF A;  1RK4 A;  4G9H A;  1OE8 A;  1X5D A;  3C1S A;  3F4S A;  2DJK A;  1OE7 A;  1TJD A;  5D73 A;  5ECK B;  1M9B A;  1R7H A;  5DAK A;  5J5N A;  3H8Q A;  1TI3 A;  4ECC A;  1TK8 B;  2HSH A;  1XWK A;  1A2M A;  5J9C A;  5DBQ A;  1M99 A;  3CSH A;  1EP7 A;  2NTO A;  2CQ9 A;  1PQN A;  3ZVJ A;  1X9W B;  2GT6 A;  4MCU A;  3D21 A;  5H5R A;  2FD3 A;  2OE0 A;  4TVE A;  1ERV A;  2H6X A;  8GSS A;  4HU7 A;  5KN2 A;  3D4T A;  4HJM A;  1OAZ A;  1G7O A;  2WDU A;  2FWF A;  3FZ4 A;  2J9H A;  3KZQ A;  3DGQ A;  3HHV A;  2RUE A;  1ZYE A;  5ELG A;  1AIU A;  1MDJ A;  5IPH A;  4TXO B;  2YNX A;  3TUE A;  2DKH A;  1QQ2 A;  4K8M A;  1M7T A;  2HLS A;  1ZCP A;  2AYT A;  2I3Y A;  1ZYN A;  2NBS A;  2GQL A;  1XWB A;  5IMC A;  4X43 A;  1T4Z A;  1FOV A;  3IRA A;  4OFT A;  2CZ2 A;  3QDN A;  5HFI A;  3ZIV A;  5LNK e;  2YZH A;  4NMU A;  3IE3 A;  4IN0 A;  2YN1 A;  2CA8 A;  2FY6 A;  5EPF A;  4JU5 A;  4PUA A;  1K0C A;  1U6T A;  4TXV A;  2B1K A;  2WUL A;  3R3E A;  1GTB A;  4AJ6 A;  1FB0 A;  4TOP A;  3UAR A;  3I6A A;  1F6M C;  2WCI A;  2H1D A;  3TKS A;  5DQS A;  1K0M A;  2IME A;  2R37 A;  3SWL A;  4TR1 A;  1LJR A;  4EE0 A;  1XG8 A;  4KGI A;  3CRU A;  1E2Y A;  2O7K A;  2GVP A;  4FO5 A;  2DJ0 A;  3MYD A;  4HUA A;  2CAI A;  2H66 A;  1M3J A;  5C00 A;  1J08 A;  2AV4 A;  2RM6 A;  5HFK A;  5J3R A;  1HQO A;  3HVN A;  2V2G A;  3OR5 A;  3KTB A;  1H4O A;  1OC8 A;  2ZCT A;  5D9T A;  1JZD A;  2PGT A;  2H1A A;  2KOK A;  2WFC A;  3TB2 A;  4BVY B;  5ECL B;  5KOX A;  1C72 A;  3M9J A;  2WB9 A;  1R26 A;  3D4M A;  1GSD A;  4I2T A;  1PN0 A;  1TDI A;  1MDK A;  4N11 A;  4I5Q A;  4WR5 A;  4JZQ A;  1JZO A;  3FKF A;  3KM6 A;  2TIR A;  5IMF A;  2CVD A;  2WS2 A;  2KP1 A;  3TJG A;  4MH3 A;  5EVO A;  3EPT A;  2G0F A;  1XWA A;  4XS4 A;  4IP6 A;  5B7C A;  4G0I A;  1AQV A;  2E0Q A;  3GUR A;  1SD8 A;  3VPQ A;  1SKW B;  2PPT A;  5CRW A;  4KSO A;  1EV4 A;  2G2Q A;  2CX4 A;  4IS0 A;  6GSS A;  2YJH A;  2XPD A;  3PGT A;  1E6B A;  3UJ1 A;  1AQX A;  1THX A;  2H6Y A;  3FW2 A;  2OA7 A;  4O5R A;  1UC7 A;  4IW9 A;  5GZZ B;  3QAV A;  3KH9 A;  4ML6 A;  3F4T A;  3TJB A;  3LXT A;  2ALB A;  5ID2 B;  2CVK A;  3EMP A;  4MJA A;  3M3M A;  4IJI A;  3TKS C;  3GYK A;  5ECS A;  4F9Z A;  1F3B A;  2NVL A;  2VL3 A;  3DWV A;  1TOF A;  2L4Q A;  4BPY A;  3KP8 A;  4HQZ A;  1JLW A;  4J57 E;  1ILO A;  1K0D A;  1UA5 A;  4BA7 A;  3O76 A;  4ML1 A;  4IJ3 A;  1HNB A;  3HJO A;  4GRF A;  3ZL5 A;  4NHZ A;  1QGV A;  3ZLP A;  2YJ7 A;  3EWL A;  4KDU A;  1TU7 A;  3CRT A;  3EUR A;  4YKF A;  2LQQ A;  1XZO A;  1ZGN A;  2H8L A;  1XOB A;  3F9U A;  3QOU A;  3O6T A;  4MJC A;  4K0G A;  5G30 A;  4TKY A;  2NDO A;  4OO4 A;  4KDX A;  2YV7 A;  1JFU A;  2Z9S A;  4F2I A;  2LNS A;  2GT5 A;  2VCX A;  5DAK B;  2R6K A;  4JED A;  2PER A;  4JBB A;  4PUF C;  3DML A;  4RUV A;  2M46 A;  5H5S A;  4EF0 A;  2HI7 A;  1XW6 A;  4KH7 A;  3E0U A;  4YAP A;  1AQW A;  2REM A;  3VK9 A;  3V1W A;  3QR6 A;  5COH A;  5AIX A;  3CSI A;  2LJA A;  2MBS A;  5KOW A;  4OFM A;  4ACS A;  1NSW A;  3ISO A;  1ZYQ B;  3KCM A;  3IAS 2;  5HQP A;  1GWC A;  2ZUP A;  2A4V A;  4HZ4 A;  3ZRD A;  4N0Z A;  3ZYW A;  3KJY A;  2DKI A;  1OKT A;  3U5R E;  4AGS A;  2L5O A;  4MAB A;  1MDI A;  3QAW A;  1YF1 A;  2D2Z A;  17GS A;  4CY6 A;  2H0I A;  1YEX A;  3F63 A;  2VCW A;  3CQF A;  2XHF A;  3PR8 A;  1Z6N A;  2P5Q A;  3E3E A;  1K0O A;  3KMO A;  3TJF A;  5J41 A;  2P31 A;  4EUY A;  2JSY A;  1DSB A;  1T00 A;  3ZIT A;  1QK8 A;  5FT3 A;  1GL8 A;  5G31 A;  1GTA A;  4POM A;  3L9S A;  2MMA A;  1MTC A;  2VO4 A;  2LJR A;  4TR1 B;  4MH2 A;  2ON7 A;  1S3A A;  4ECB A;  4QL7 A;  3HVV A;  1U3I A;  3GL3 A;  1XVQ A;  2GST A;  5F0G A;  3MAK A;  2CX3 A;  2I81 A;  3F4R A;  3P90 A;  5D8I A;  2LV3 A;  3L9U A;  1WP0 A;  1B9Y C;  1GTI A;  3TRP A;  4PNG A;  1Z7R A;  2A4H A;  1R5A A;  2QA1 A;  3IXR A;  3APO A;  4Z7X A;  1GSE A;  2CAQ A;  2MBT A;  1XWC A;  3ZZX A;  1J9B A;  2C4J A;  2FA4 A;  3KD0 A;  4NXI A;  4I8B A;  4PTS A;  4I6X A;  3Q18 A;  4GSN A;  2DMM A;  2RLI A;  1B9X C;  1F3A A;  3GKM A;  2VL9 A;  1WOU A;  2EIO A;  2JAD A;  16GS A;  3UOM A;  4FYC A;  1OC9 A;  5CRE A;  4IQA A;  2OBK A;  6GST A;  1SYX A;  3L9V A;  5ECR B;  2X49 A;  3ERW A;  2X8C A;  1GTU A;  3F6F A;  3DXB A;  2JSZ A;  1A2J A;  4FQU A;  3WGX A;  4IHU A;  4V2M A;  4XS4 B;  1Q98 A;  1GSF A;  4JRR A;  3QFB C;  2XBI A;  1U87 A;  3QD9 A;  2QC7 A;  1XW9 A;  2R0C A;  2KUC A;  2FUG 2;  2N5B A;  4IGJ A;  6GSX A;  4N0V A;  3FHK A;  2DBC A;  5G5F A;  6GSV A;  1G6W A;  4WEY A;  2GGT A;  1V57 A;  10GS A;  4KUN A;  1YQ1 A;  2YWM A;  3ZRE A;  4X4J A;  4E8H A;  2EC4 A;  2B7J A;  5HR3 A;  3LGC A;  3FYG A;  2HT9 A;  1EEM A;  5F07 A;  5G5E A;  2C3N A;  2IIY A;  5IM9 A;  3SBC A;  2K9F A;  2CZ3 A;  2LNT A;  1SJZ A;  4G0K A;  2IFQ B;  1M2A A;  3EMX A;  4BL7 B;  3MNG A;  4QQ7 A;  1Q4J A;  2OAD A;  3VWV A;  2IMI A;  5JWR B;  1YJ6 A;  4HZ2 A;  4KDY A;  4ECI A;  2X8G A;  2H30 A;  2VM2 A;  2VUP A;  1QFN A;  4XCS A;  4ZB9 A;  4V1A g;  1Z6M A;  4JE1 A;  2L57 A;  3ERF A;  3A5W A;  2C0E A;  1DUG A;  4DEJ A;  2IPA A;  2KP2 A;  3P2A A;  1Y25 A;  2B7K A;  2I1U A;  1GNW A;  2DIY A;  2R3X A;  1UVZ A;  1YKA A;  1M9A A;  4DVC A;  4EDY A;  1WPI A;  3I9V 2;  5ELA A;  1NM3 A;  3G7Y A;  1A2L A;  4XTS A;  4EO3 A;  1SU9 A;  1F37 A;  2HRK A;  2VD0 A;  3D22 A;  2H1G A;  4XIH A;  4KCA A;  3EE2 A;  4O92 A;  4IVF A;  2AB6 A;  2C1Y A;  3IAM 2;  4MK3 A;  3ZTL A;  3IBH A;  4Z2U A;  3U6V A;  3ZFL A;  5CO3 A;  1QUW A;  2WZ9 A;  4HQS A;  1AUC A;  3N9J A;  1EGR A;  1SEN A;  1AAZ A;  3DEX A;  3LYK A;  22GS A;  1OKD A;  1EZK A;  3GKK A;  3DD3 A;  4BWS A;  3FR9 A;  2B5Y A;  4K1F A;  4K7N A;  2GDR A;  4K2X A;  5GAN D;  1U3A A;  2QSI A;  3ZVJ D;  2H0H A;  1ABA A;  2KHP A;  4HSC X;  2FGX A;  4K5R A;  1FVK A;  4Q5N A;  4USS A;  5KN3 A;  1KEB A;  4CDO A;  2B6M A;  4YQU A;  2HRF A;  3GNJ A;  3GKX A;  5ECH B;  3IR4 A;  1QXH A;  4O32 A;  3CXG A;  4D73 B;  4EIP A;  3TDG A;  1X5C A;  4MPG A;  2HZE B;  2I4A A;  3IK7 A;  5DAL A;  3PH9 A;  4G0L A;  4ZB8 A;  5AN1 A;  3QCP A;  4HDE A;  3FK8 A;  4EKZ A;  2X8H A;  3DVX A;  1VF1 A;  1YKC A;  12GS A;  1EOG A;  3GL5 A;  2MMN A;  4N10 A;  4J56 E;  4XS6 A;  1XFL A;  3L4N A;  3KMN A;  2CV4 A;  1XOA A;  2CT6 A;  2XBQ A;  1JLV A;  1SL1 B;  3H1N A;  3F3Q A;  3M9K A;  4K2D A;  5DVB A;  3HD5 A;  11GS A;  3KIJ A;  4P3Y B;  1T8E B;  2HRA A;  4HOJ A;  2VCZ A;  1GSY A;  2PMT A;  3DRN A;  4HJ2 A;  4LMV A;  2WRT A;  3E9J B;  5E4W A;  1AC1 A;  3UBL A;  1FW1 A;  3EVI A;  3HDC A;  1LU4 A;  1GUL A;  2WJU A;  1ST9 A;  1USB A;  3A2V A;  3TCO A;  1PX7 A;  3C73 A;  3VI5 A;  2YWN A;  2DJ2 A;  20GS A;  5A4U A;  3N5O A;  3CMI A;  3Q6O A;  3IHG A;  1WWJ A;  4PNF A;  4XHM A;  1W4V A;  3A3T A;  3RHC A;  1HYU A;  4KB3 A;  3APS A;  1VRS D;  4K9Z A;  4ULX A;  2V1M A;  2AUV A;  2YP6 A;  3WYW A;  3M8N A;  4MNN A;  3HVS A;  2P5R A;  1OC9 B;  3VUR A;  3VWW A;  4YH2 A;  2FWE A;  3PIN A;  3TRQ A;  3IDV A;  3LQ7 A;  3GX8 A;  4MZB A;  1GSQ A;  4EDZ A;  2LST A;  1K3O A;  4QL9 A;  3CTG A;  2K8S A;  4GCI A;  5CRG A;  1Z3E A;  2K8V A;  2JZR A;  2PVQ A;  4NV5 A;  4XRA A;  5BRT A;  3ED3 A;  3S9F A;  6GSU A;  4PXO A;  1SJI A;  1V58 A;  2C3T A;  3G9B A;  1I5G A;  2GLR A;  3ERG A;  1XIY A;  4IBP A;  1K3L A;  1M2D A;  2VL2 C;  3LJR A;  2FLS A;  5CYY A;  1T4Y A;  1T7P B;  3BJ5 A;  1CQG A;  5B6N A;  5D9W A;  3GTU B;  1TW9 A;  1S3C A;  2H1B A;  3L78 A;  4PQI A;  3TGZ A;  5G2Z A;  1TRW A;  4KA0 A;  1V98 A;  5HR2 A;  3GH6 A;  1FG4 A;  3RHB A;  2GSS A;  2PUK C;  2YWI A;  5GST A;  1YF0 A;  3WD6 A;  2LEG A;  2IL3 A;  3HXS A;  5G1K A;  13GS A;  2DJ1 A;  2E2G A;  1Z7P A;  4BWQ A;  1V9W A;  3P8W A;  3HY2 A;  3UVT A;  3BOA A;  1AXD A;  5B8B A;  18GS A;  3EU4 A;  4ZIL A;  2XPE A;  3W8J A;  1GH2 A;  1O8W A;  1X0R A;  4EVM A;  5D93 A;  3US3 A;  2LQO A;  5DJL A;  1SL2 B;  5IMA A;  2GSR A;  4POB A;  2AJQ B;  3MWH A;  2DSA A;  2B3S A;  3LSZ A;  4OMV A;  4DSQ A;  3JCM L;  4WF5 A;  4O5U A;  1BG5 A;  3TOT A;  4L0W A;  4WF4 A;  1K0N A;  4Q5F A;  2MMZ A;  2C3Q A;  4WXT A;  5B6M A;  1BJX A;  3LG6 A;  3O3T A;  4BVX A;  3GHA A;  4GTU A;  1S3R A;  4G10 A;  5DQY A;  1FVJ A;  5KN0 A;  1ZZY A;  5A5K A;  5DCG A;  1VF2 A;  2YPM A;  1O85 A;  4MF7 A;  4V1A p;  4NPB A;  1A0F A;  4OO5 A;  3HA9 A;  3DKS A;  1V40 A;  2BTO T;  4TR4 A;  3GIX A;  2DLX A;  3F6D A;  2GZZ A;  4PX1 A;  1GUH A;  5LCZ A;  5DDL A;  3MIX A;  2DC5 A;  1X9M B;  3UVH A;  1T1V A;  1MD4 A;  1DE1 A;  4O5Q A;  1B4Q A;  2PU9 C;  1WJK A;  2L59 A;  3IA1 A;  2LUS A;  3H4K A;  5HR1 A;  3A5I A;  1GLQ A;  4JR4 A;  3FR3 A;  2HXK A;  2A2P A;  1AW9 A;  4F82 A;  5IMD A;  5JWQ B;  3DYR A;  1PN9 A;  2LKU A;  4GST A;  1W89 A;  1A24 A;  2R4V A;  3TJJ A;  5EY6 A;  1EWX A;  4OCF A;  5J9B A;  2C0F A;  3IC4 A;  3TKP A;  2GS3 A;  4FIW A;  1PRX A;  2BJX A;  3FY7 A;  5ECP B;  3HYP A;  3EIN A;  2C0D A;  1FB6 A;  3MDK A;  1TKD B;  1TTZ A;  1R5P A;  4MZC A;  3HKR A;  6GSW A;  4KND A;  2GZP A;  1KTE A;  3GH9 A;  1G7E A;  3Q74 A;  1MD3 A;  4ZL8 A;  4KX4 A;  2FHE A;  2IWT A;  3KEB A;  3HJP A;  2RM5 A;  4J2F A;  2YAN A;  2VIM A;  1G6Y A;  5DJM A;  2H19 A;  4BIK A;  4YQV A;  1SYR A;  1WMJ A;  3TKR A;  2R5G A;  4HU9 A;  3D6I A;  3WT1 A;  2H73 A;  4I97 A;  4TR3 A;  5AGY A;  2LRC A;  2YCD A;  3BBY A;  5LD0 A;  1BED A;  1O6J A;  3FMW A;  4FH8 A;  4K7I A;  1FAA A;  1GUK A;  1O81 A;  2J23 A;  3LEF A;  2OE3 A;  2X99 A;  2UZ8 A;  2DIZ A;  3Q19 A;  4TW5 A;  2IJY A;  2WGR A;  2F3M A;  1ZOF A;  1THO A;  2AHE A;  7GSS A;  1SK2 A;  2X64 A;  4NAX A;  5B8A A;  1GLP A;  1DBY A;  3FEU A;  2GSQ A;  4EL1 A;  3KXO A;  3QMX A;  4KCE A;  1SKR B;  4F0B A;  4MLY A;  4PGT A;  3IC8 A;  2L6D A;  2C0G A;  2JU5 A;  5CAX A;  4FYU A;  2M80 A;  1PD2 1;  2VCV A;  4MA9 A;  1OC3 A;  3W6G A;  4CY8 A;  2FA8 A;  2ES7 A;  4YAV A;  3K8N A;  3CBU A;  1TP9 A;  2LRT A;  3GN3 A;  1VF3 A;  3LW9 A;  4X0X A;  3W8S A;  4MF6 A;  5C04 A;  3KTL A;  2E2M A;  1O7U A;  4TR0 A;  3C8E A;  4AJ7 A;  2FNO A;  5ECN B;  2KLX A;  2V6O A;  4KE3 A;  2LJK A;  1Y6E A;  3TJK A;  1SL0 B;  2EIR A;  2H01 A;  2H71 A;  3GSS A;  5A4V A;  5JCU A;  2B1L A;  1JZW A;  5FHI A;  2C8U A;  5HR0 A;  5H5Q A;  2QGV A;  2B5X A;  2HYX A;  2VM1 A;  4HS1 A;  3H79 A;  1XXU A;  4K6X A;  1SD9 A;  5IIZ A;  3QPM A;  1SK1 A;  2IMK A;  2V41 A;  2GQK A;  4N30 A;  5IOW A;  3IHQ A;  5EL8 A;  2L4C A;  5F8B A;  4Q5Q A;  1KNG A;  5IMV A;  4F0C A;  1TRS A;  2O8V B;  4LL4 B;  5GAP D;  1URM A;  1EEJ A;  1A23 A;  2H0G A;  1GP1 A;  4PUR A;  2FWH A;  4IKH A;  3LFL A;  2VLU A;  1GNE A;  3LOR A;  1ERT A;  3QAG A;  1TRU A;  1CQH A;  4L5L A;  4V2N A;  1VGL A;  3RAZ A;  1A0R P;  1GSU A;  2IN3 A;  2E7P A;  4HI7 A;  1PMT A;  4YKG A;  1XPV A;  1XBS A;  2N5A A;  2FWG A;  2MZC A;  3RPP A;  1XWG A;  4BVX B;  1HNC A;  1YEP A;  1ACV A;  4ZL7 A;  3M1G A;  2P0G A;  1I9D A;  3GRX A;  4OWY A;  4TRX A;  1RW1 A;  1Z5Y E;  1FO5 A;  4I2U A;  3GV1 A;  3NIV A;  3BD2 A;  1DE2 A;  4Z2R A;  5IO2 A;  1PKW A;  2VL2 A;  5JCW A;  5ENU A;  3ZFB A;  1LBK A;  5G1L A;  2F8A A;  5IQY A;  3LYP A;  4EIQ A;  1PL2 A;  2N5F A;  2DJ3 A;  4Z2T A;  1TK0 B;  4NV2 A;  5J4U A;  3IV4 A;  3VI7 A;  3ZML A;  3VFI A;  3G7I A;  4PQH A;  3DVW A;  1XW5 A;  3I69 A;  1PGT A;  4KW6 A;  2TRC P;  4FYB A;  3GX0 A;  1BX9 A;  1B8X A;  3AY8 A;  1B48 A;  3UBK A;  4KSM A;  2HSM A;  1N2A A;  3RBT A;  1X9S B;  3EC3 A;  3A2W A;  3P7X A;  1IYH A;  3DIE A;  4GWR A;  3GA4 A;  3CYN A;  4LL1 B;  4E8E A;  5JWO B;  1G0T A;  3GUS A;  5L71 A;  3VLN A;  1R4W A;  5KEJ A;  3RPN A;  1BYE A;  2ON5 A;  1X5E A;  3LWA A;  3KH7 A;  1B4P A;  2JL4 A;  1NHO A;  2LTK A;  3GKN A;  4CW9 A;  3UEM A;  1WRY A;  1K0B A;  3GST A;  3LXZ A;  4MJB A;  3HCZ A;  2K6V A;  2LRN A;  4AF2 A;  4GF0 A;  4DSS A;  3KP9 A;  2HSY A;  1O8X A;  1IYI A;  3A2X A;  1VF4 A;  1OVN A;  1ERU A;  1YZX A;  3EU3 A;  3NZN A;  5F06 A;  2HRN A;  3UMA A;  3BCI A;  3UIW A;  2F8F A;  1KBN A;  1N8J A;  4ZBA A;  2HE3 A;  4TN8 A;  3APQ A;  3UAP A;  3HJM A;  1Z9H A;  19GS A;  2F9S A;  1RQM A;  2CVB A;  3WGE A;  1O73 A;  4MP4 A;  4ICY A;  4JR6 A;  2B5E A;  5ECI B;  1J0F A;  5GSS A;  4MPF A;  3TRX A;  3F8U A;  2VOC A;  1T3B A;  5KN1 A;  4F03 A;  2OE1 A;  2A2S A;  3KGK A;  4NWY A;  2IFQ A;  2R2J A;  3VWX A;  4BL7 A;  4H86 A;  5HFG A;  14GS A;  1TU8 A;  1XVW A;  2HFD A;  4IQ1 A;  5ABR A;  3WGD A;  2HNL A;  2H72 A;  9GSS A;  2H70 A;  1SK0 A;  3TOU A;  2GTU A;  3ZMK A;  2K18 A;  2PBJ A;  1FOH A;  4KF9 A;  1JHB A;  2O87 A;  1QMV A;  4K0N A;  1F2E A;  3FRC A;  3WT2 A;  3C7M A;  2VLV A;  1WIK A;  1ML6 A;  4ID0 A;  1S3D A;  2R0P A;  5CNW A;  1PX6 A;  5BMU A;  1K3Y A;  1ON4 A;  2DML A;  5F05 A;  4LMW A;  5IMZ A;  3NOF A;  4TXO A;  2JZT A;  4ZBB A;  4G2E A;  4WR4 A;  4HEA 2;  1MEK A;  2H74 A;  2EIQ A;  3J7Y b;  3R2Q A;  1TRV A;  2L5L A;  1TI1 A;  2X4A A;  1M0U A;  3HVX A;  3TKS E;  4ZB6 A;  2VCQ A;  2M72 A;  1YDK A;  2LS5 A;  5CRD A;  1A8L A;  5AIS A;  1V2A A;  1OYJ A;  4GQC A;  4PQ1 A;  3HZ8 A;  3PPU A;  2OJL A;  4AJ8 A;  4ZBD A;  1JZR A;  2GZY A;  4ISD A;  2FCH A;  4RQX A;  4Q5R A;  4OFN A;  5ECM B;  1GRX A;  4ZXG A;  5CP1 A;  2RUF A;  3F0I A;  2YOI A;  3ZIJ A;  2VLT A;  4ILF A;  3GMF A;  1HD2 A;  4V2L A;  3C1R A;  4ECJ A;  2NPB A;  3FZA A;  2GQM A;  2OKA A;  1A8Y A;  5DCH A;  4L5O A;  3FZ9 A;  2O89 A;  3M0F A;  4MZW A;  4WBJ A;  1EOH A;  1SJ6 A;  2YWO A;  5IOX A;  4KAE A;  4POK A;  4G19 A;  2PWJ A;  4GLT A;  4L8E A;  4ZIJ A;  3FR6 A;  1PKZ A;  1EV9 A;  2VCT A;  2F51 A;  2ZNM A;  4D73 A;  2IMF A;  2L6C A;  4OCE A;  2HZE A;  4WET A;  2O85 A;  4K7O A;  1SKS B;  2H75 A;  4POL A;  3EYT A;  4MMM A;  3IOS A;  3RDW A;  2YZU A;  1PA3 A;  5A4W A;  1PSQ A;  3L0H A;  2RII A;  3H93 A;  3D0Z A;  4LLR A;  4A5P A;  1EP8 A;  3QFA C;  5AIV A;  4BVY A;  1ZMA A;  4WKW A;  5CRH A;  1BAY A;  2H76 A;  4L0U A;  5JCG A; 
#chains in the Genus database with same CATH homology
 2OAC A;  5DAL B;  2R0G A;  1UN2 A;  3CTF A;  3TKQ A;  2JAC A;  3CSJ A;  2JZS A;  2BMX A;  4OD7 A;  1GSS A;  5E59 A;  3F3R A;  4X1U A;  5IO0 A;  3C71 A;  5IPG A;  3VPT A;  1NHY A;  1FHE A;  1YY7 A;  1ERW A;  2QA2 A;  3I43 A;  2PVO C;  4MDC A;  3D5J A;  3FZ5 A;  3HZ4 A;  4EXJ A;  4O7H A;  4NHW A;  4IEL A;  4GXZ A;  4CHS A;  2TRX A;  2MMO A;  2MYG A;  4MF5 A;  1H75 A;  2I9H A;  5D9V A;  2XC2 A;  5D96 A;  1PL1 A;  2OBI A;  4RQR A;  1BQ7 A;  1HNA A;  1TXX A;  4ZL9 A;  3ME8 A;  2VD1 A;  1WE0 A;  5FWG A;  4WBR D;  1TK5 B;  5D9X A;  2A2R A;  2IMD A;  1ZYP A;  5ID2 A;  3ME7 A;  4XS1 A;  1M2B A;  4XRD A;  3IK9 A;  2AAW A;  2DJJ A;  3VWU A;  4DSS B;  3G7J A;  3J7Y k;  2H6Z A;  1GUM A;  4RI7 A;  1F9M A;  3IPZ A;  4K5S A;  1EGO A;  2PN8 A;  3GFK A;  4IP1 A;  2YV9 A;  2QKE A;  4YQM A;  3BCK A;  1K0A A;  1U88 A;  2VAF A;  1NW2 A;  2V32 A;  2V6K A;  2C80 A;  3MSZ A;  4LA1 A;  1ZL9 A;  4GSS A;  4EC0 A;  4DSR A;  3GTU A;  5ECQ B;  5ECO B;  3UL3 A;  5INY A;  1XCC A;  6GSY A;  4GQF A;  4MJE A;  4RI6 A;  2HZF A;  1RK4 A;  4G9H A;  1OE8 A;  1X5D A;  3C1S A;  3F4S A;  2DJK A;  1OE7 A;  1TJD A;  5D73 A;  5ECK B;  1M9B A;  1R7H A;  5DAK A;  5J5N A;  3H8Q A;  1TI3 A;  4ECC A;  1TK8 B;  2HSH A;  1XWK A;  1A2M A;  5J9C A;  5DBQ A;  1M99 A;  3CSH A;  1EP7 A;  2NTO A;  2CQ9 A;  1PQN A;  3ZVJ A;  1X9W B;  2GT6 A;  4MCU A;  3D21 A;  5H5R A;  2FD3 A;  2OE0 A;  4TVE A;  1ERV A;  2H6X A;  8GSS A;  4HU7 A;  5KN2 A;  3D4T A;  4HJM A;  1OAZ A;  1G7O A;  2WDU A;  2FWF A;  3FZ4 A;  2J9H A;  3KZQ A;  3DGQ A;  3HHV A;  2RUE A;  1ZYE A;  5ELG A;  1AIU A;  1MDJ A;  5IPH A;  4TXO B;  2YNX A;  3TUE A;  2DKH A;  1QQ2 A;  4K8M A;  1M7T A;  2HLS A;  1ZCP A;  2AYT A;  2I3Y A;  1ZYN A;  2NBS A;  2GQL A;  1XWB A;  5IMC A;  4X43 A;  1T4Z A;  1FOV A;  3IRA A;  4OFT A;  2CZ2 A;  3QDN A;  5HFI A;  3ZIV A;  5LNK e;  2YZH A;  4NMU A;  3IE3 A;  4IN0 A;  2YN1 A;  2CA8 A;  2FY6 A;  5EPF A;  4JU5 A;  4PUA A;  1K0C A;  1U6T A;  4TXV A;  2B1K A;  2WUL A;  3R3E A;  1GTB A;  4AJ6 A;  1FB0 A;  4TOP A;  3UAR A;  3I6A A;  1F6M C;  2WCI A;  2H1D A;  3TKS A;  5DQS A;  1K0M A;  2IME A;  2R37 A;  3SWL A;  4TR1 A;  1LJR A;  4EE0 A;  4KGI A;  3CRU A;  1E2Y A;  2O7K A;  2GVP A;  4FO5 A;  2DJ0 A;  3MYD A;  4HUA A;  2CAI A;  2H66 A;  5C00 A;  1J08 A;  2AV4 A;  2RM6 A;  5HFK A;  5J3R A;  1HQO A;  2V2G A;  3OR5 A;  3KTB A;  1H4O A;  1OC8 A;  2ZCT A;  5D9T A;  1JZD A;  2PGT A;  2H1A A;  2KOK A;  2WFC A;  3TB2 A;  4BVY B;  5ECL B;  5KOX A;  1C72 A;  3M9J A;  2WB9 A;  1R26 A;  3D4M A;  1GSD A;  4I2T A;  1PN0 A;  1TDI A;  1MDK A;  4N11 A;  4I5Q A;  4WR5 A;  4JZQ A;  1JZO A;  3FKF A;  3KM6 A;  2TIR A;  5IMF A;  2CVD A;  2WS2 A;  2KP1 A;  3TJG A;  4MH3 A;  5EVO A;  3EPT A;  2G0F A;  1XWA A;  4XS4 A;  4IP6 A;  5B7C A;  4G0I A;  1AQV A;  2E0Q A;  3GUR A;  1SD8 A;  3VPQ A;  1SKW B;  2PPT A;  5CRW A;  4KSO A;  1EV4 A;  2G2Q A;  2CX4 A;  4IS0 A;  6GSS A;  2YJH A;  2XPD A;  3PGT A;  1E6B A;  3UJ1 A;  1AQX A;  1THX A;  2H6Y A;  3FW2 A;  2OA7 A;  4O5R A;  1UC7 A;  4IW9 A;  5GZZ B;  3QAV A;  3KH9 A;  4ML6 A;  3F4T A;  3TJB A;  3LXT A;  2ALB A;  5ID2 B;  2CVK A;  3EMP A;  4MJA A;  3M3M A;  4IJI A;  3TKS C;  3GYK A;  5ECS A;  4F9Z A;  1F3B A;  2NVL A;  2VL3 A;  3DWV A;  1TOF A;  2L4Q A;  4BPY A;  3KP8 A;  4HQZ A;  1JLW A;  4J57 E;  1ILO A;  1K0D A;  1UA5 A;  4BA7 A;  3O76 A;  4ML1 A;  4IJ3 A;  1HNB A;  3HJO A;  4GRF A;  3ZL5 A;  4NHZ A;  1QGV A;  3ZLP A;  2YJ7 A;  3EWL A;  4KDU A;  1TU7 A;  3CRT A;  3EUR A;  4YKF A;  2LQQ A;  1XZO A;  1ZGN A;  2H8L A;  1XOB A;  3F9U A;  3QOU A;  3O6T A;  4MJC A;  4K0G A;  5G30 A;  4TKY A;  2NDO A;  4OO4 A;  4KDX A;  2YV7 A;  1JFU A;  2Z9S A;  4F2I A;  2LNS A;  2GT5 A;  2VCX A;  5DAK B;  2R6K A;  4JED A;  2PER A;  4JBB A;  4PUF C;  3DML A;  4RUV A;  2M46 A;  5H5S A;  4EF0 A;  2HI7 A;  1XW6 A;  4KH7 A;  3E0U A;  4YAP A;  1AQW A;  2REM A;  3VK9 A;  3V1W A;  3QR6 A;  5COH A;  5AIX A;  3CSI A;  2LJA A;  2MBS A;  5KOW A;  4OFM A;  4ACS A;  1NSW A;  3ISO A;  1ZYQ B;  3KCM A;  3IAS 2;  5HQP A;  1GWC A;  2ZUP A;  2A4V A;  4HZ4 A;  3ZRD A;  4N0Z A;  3ZYW A;  3KJY A;  2DKI A;  1OKT A;  3U5R E;  4AGS A;  2L5O A;  4MAB A;  1MDI A;  3QAW A;  1YF1 A;  2D2Z A;  17GS A;  4CY6 A;  2H0I A;  1YEX A;  3F63 A;  2VCW A;  2XHF A;  3PR8 A;  1Z6N A;  2P5Q A;  3E3E A;  1K0O A;  3KMO A;  3TJF A;  5J41 A;  2P31 A;  4EUY A;  2JSY A;  1DSB A;  1T00 A;  3ZIT A;  1QK8 A;  5FT3 A;  1GL8 A;  5G31 A;  1GTA A;  4POM A;  3L9S A;  2MMA A;  1MTC A;  2VO4 A;  2LJR A;  4TR1 B;  4MH2 A;  2ON7 A;  1S3A A;  4ECB A;  4QL7 A;  3HVV A;  1U3I A;  3GL3 A;  1XVQ A;  2GST A;  5F0G A;  3MAK A;  2CX3 A;  2I81 A;  3F4R A;  3P90 A;  5D8I A;  2LV3 A;  3L9U A;  1WP0 A;  1B9Y C;  1GTI A;  3TRP A;  4PNG A;  1Z7R A;  2A4H A;  1R5A A;  2QA1 A;  3IXR A;  3APO A;  4Z7X A;  1GSE A;  2CAQ A;  2MBT A;  1XWC A;  3ZZX A;  1J9B A;  2C4J A;  2FA4 A;  3KD0 A;  4NXI A;  4I8B A;  4PTS A;  4I6X A;  3Q18 A;  4GSN A;  2DMM A;  2RLI A;  1B9X C;  1F3A A;  3GKM A;  2VL9 A;  1WOU A;  2EIO A;  2JAD A;  16GS A;  3UOM A;  4FYC A;  1OC9 A;  5CRE A;  4IQA A;  2OBK A;  6GST A;  1SYX A;  3L9V A;  5ECR B;  2X49 A;  3ERW A;  2X8C A;  1GTU A;  3F6F A;  3DXB A;  2JSZ A;  1A2J A;  4FQU A;  3WGX A;  4IHU A;  4V2M A;  4XS4 B;  1Q98 A;  1GSF A;  4JRR A;  3QFB C;  2XBI A;  1U87 A;  3QD9 A;  2QC7 A;  1XW9 A;  2R0C A;  2KUC A;  2FUG 2;  2N5B A;  4IGJ A;  6GSX A;  4N0V A;  3FHK A;  2DBC A;  5G5F A;  6GSV A;  1G6W A;  4WEY A;  2GGT A;  1V57 A;  10GS A;  4KUN A;  1YQ1 A;  2YWM A;  3ZRE A;  4X4J A;  4E8H A;  2EC4 A;  2B7J A;  5HR3 A;  3LGC A;  3FYG A;  2HT9 A;  1EEM A;  5F07 A;  5G5E A;  2C3N A;  2IIY A;  5IM9 A;  3SBC A;  2K9F A;  2CZ3 A;  2LNT A;  1SJZ A;  4G0K A;  2IFQ B;  1M2A A;  3EMX A;  4BL7 B;  3MNG A;  4QQ7 A;  1Q4J A;  2OAD A;  3VWV A;  2IMI A;  5JWR B;  1YJ6 A;  4HZ2 A;  4KDY A;  4ECI A;  2X8G A;  2H30 A;  2VM2 A;  2VUP A;  1QFN A;  4XCS A;  4ZB9 A;  4V1A g;  1Z6M A;  4JE1 A;  2L57 A;  3ERF A;  3A5W A;  2C0E A;  1DUG A;  4DEJ A;  2IPA A;  2KP2 A;  3P2A A;  1Y25 A;  2B7K A;  2I1U A;  1GNW A;  2DIY A;  2R3X A;  1UVZ A;  1YKA A;  1M9A A;  4DVC A;  4EDY A;  1WPI A;  3I9V 2;  5ELA A;  1NM3 A;  3G7Y A;  1A2L A;  4XTS A;  4EO3 A;  1SU9 A;  1F37 A;  2HRK A;  2VD0 A;  3D22 A;  2H1G A;  4XIH A;  4KCA A;  3EE2 A;  4O92 A;  4IVF A;  2AB6 A;  2C1Y A;  3IAM 2;  4MK3 A;  3ZTL A;  3IBH A;  4Z2U A;  3U6V A;  3ZFL A;  5CO3 A;  1QUW A;  2WZ9 A;  4HQS A;  1AUC A;  3N9J A;  1EGR A;  1SEN A;  1AAZ A;  3DEX A;  3LYK A;  22GS A;  1OKD A;  1EZK A;  3GKK A;  3DD3 A;  4BWS A;  3FR9 A;  2B5Y A;  4K1F A;  4K7N A;  2GDR A;  4K2X A;  5GAN D;  1U3A A;  2QSI A;  3ZVJ D;  2H0H A;  1ABA A;  2KHP A;  2FGX A;  4K5R A;  1FVK A;  4Q5N A;  4USS A;  5KN3 A;  1KEB A;  4CDO A;  2B6M A;  4YQU A;  2HRF A;  3GNJ A;  3GKX A;  5ECH B;  3IR4 A;  1QXH A;  4O32 A;  3CXG A;  4D73 B;  4EIP A;  3TDG A;  1X5C A;  4MPG A;  2HZE B;  2I4A A;  3IK7 A;  5DAL A;  3PH9 A;  4G0L A;  4ZB8 A;  5AN1 A;  3QCP A;  4HDE A;  3FK8 A;  4EKZ A;  2X8H A;  3DVX A;  1VF1 A;  1YKC A;  12GS A;  1EOG A;  3GL5 A;  2MMN A;  4N10 A;  4J56 E;  4XS6 A;  1XFL A;  3L4N A;  3KMN A;  2CV4 A;  1XOA A;  2CT6 A;  2XBQ A;  1JLV A;  1SL1 B;  3H1N A;  3F3Q A;  3M9K A;  4K2D A;  5DVB A;  3HD5 A;  11GS A;  3KIJ A;  4P3Y B;  1T8E B;  2HRA A;  4HOJ A;  2VCZ A;  1GSY A;  2PMT A;  3DRN A;  4HJ2 A;  4LMV A;  2WRT A;  3E9J B;  5E4W A;  1AC1 A;  3UBL A;  1FW1 A;  3EVI A;  3HDC A;  1LU4 A;  1GUL A;  2WJU A;  1ST9 A;  1USB A;  3A2V A;  3TCO A;  1PX7 A;  3C73 A;  3VI5 A;  2YWN A;  2DJ2 A;  20GS A;  5A4U A;  3N5O A;  3CMI A;  3Q6O A;  3IHG A;  1WWJ A;  4PNF A;  4XHM A;  1W4V A;  3A3T A;  3RHC A;  1HYU A;  4KB3 A;  3APS A;  1VRS D;  4K9Z A;  4ULX A;  2V1M A;  2AUV A;  2YP6 A;  3WYW A;  3M8N A;  4MNN A;  3HVS A;  2P5R A;  1OC9 B;  3VUR A;  3VWW A;  4YH2 A;  2FWE A;  3PIN A;  3TRQ A;  3IDV A;  3LQ7 A;  3GX8 A;  4MZB A;  1GSQ A;  4EDZ A;  2LST A;  1K3O A;  4QL9 A;  3CTG A;  2K8S A;  4GCI A;  5CRG A;  1Z3E A;  2K8V A;  2JZR A;  2PVQ A;  4NV5 A;  4XRA A;  5BRT A;  3ED3 A;  3S9F A;  6GSU A;  4PXO A;  1SJI A;  1V58 A;  2C3T A;  3G9B A;  1I5G A;  2GLR A;  3ERG A;  1XIY A;  4IBP A;  1K3L A;  1M2D A;  2VL2 C;  3LJR A;  2FLS A;  5CYY A;  1T4Y A;  1T7P B;  3BJ5 A;  1CQG A;  5B6N A;  5D9W A;  3GTU B;  1TW9 A;  1S3C A;  2H1B A;  3L78 A;  4PQI A;  3TGZ A;  5G2Z A;  1TRW A;  4KA0 A;  1V98 A;  5HR2 A;  3GH6 A;  1FG4 A;  3RHB A;  2GSS A;  2PUK C;  2YWI A;  5GST A;  1YF0 A;  3WD6 A;  2LEG A;  2IL3 A;  3HXS A;  5G1K A;  13GS A;  2DJ1 A;  2E2G A;  1Z7P A;  4BWQ A;  1V9W A;  3P8W A;  3HY2 A;  3UVT A;  3BOA A;  1AXD A;  5B8B A;  18GS A;  3EU4 A;  4ZIL A;  2XPE A;  3W8J A;  1GH2 A;  1O8W A;  1X0R A;  4EVM A;  5D93 A;  3US3 A;  2LQO A;  5DJL A;  1SL2 B;  5IMA A;  2GSR A;  4POB A;  2AJQ B;  3MWH A;  2DSA A;  2B3S A;  3LSZ A;  4OMV A;  4DSQ A;  3JCM L;  4WF5 A;  4O5U A;  1BG5 A;  3TOT A;  4L0W A;  4WF4 A;  1K0N A;  4Q5F A;  2MMZ A;  2C3Q A;  4WXT A;  5B6M A;  1BJX A;  3LG6 A;  3O3T A;  4BVX A;  3GHA A;  4GTU A;  4G10 A;  5DQY A;  1FVJ A;  5KN0 A;  1ZZY A;  5A5K A;  5DCG A;  1VF2 A;  2YPM A;  1O85 A;  4MF7 A;  4V1A p;  4NPB A;  1A0F A;  4OO5 A;  3HA9 A;  3DKS A;  1V40 A;  2BTO T;  4TR4 A;  3GIX A;  2DLX A;  3F6D A;  2GZZ A;  4PX1 A;  1GUH A;  5LCZ A;  5DDL A;  3MIX A;  2DC5 A;  1X9M B;  3UVH A;  1T1V A;  1MD4 A;  1DE1 A;  4O5Q A;  1B4Q A;  2PU9 C;  1WJK A;  2L59 A;  3IA1 A;  2LUS A;  3H4K A;  5HR1 A;  3A5I A;  1GLQ A;  4JR4 A;  3FR3 A;  2HXK A;  2A2P A;  1AW9 A;  4F82 A;  5IMD A;  5JWQ B;  3DYR A;  1PN9 A;  2LKU A;  4GST A;  1W89 A;  1A24 A;  2R4V A;  3TJJ A;  5EY6 A;  1EWX A;  4OCF A;  5J9B A;  2C0F A;  3IC4 A;  3TKP A;  2GS3 A;  4FIW A;  1PRX A;  2BJX A;  3FY7 A;  5ECP B;  3HYP A;  3EIN A;  2C0D A;  1FB6 A;  3MDK A;  1TKD B;  1TTZ A;  1R5P A;  4MZC A;  3HKR A;  6GSW A;  4KND A;  2GZP A;  1KTE A;  3GH9 A;  1G7E A;  3Q74 A;  1MD3 A;  4ZL8 A;  4KX4 A;  2FHE A;  2IWT A;  3KEB A;  3HJP A;  2RM5 A;  4J2F A;  2YAN A;  2VIM A;  1G6Y A;  5DJM A;  2H19 A;  4YQV A;  1SYR A;  1WMJ A;  3TKR A;  2R5G A;  4HU9 A;  3D6I A;  3WT1 A;  2H73 A;  4I97 A;  4TR3 A;  5AGY A;  2LRC A;  2YCD A;  3BBY A;  5LD0 A;  1BED A;  1O6J A;  3FMW A;  4FH8 A;  4K7I A;  1FAA A;  1GUK A;  1O81 A;  2J23 A;  3LEF A;  2OE3 A;  2X99 A;  2UZ8 A;  2DIZ A;  3Q19 A;  4TW5 A;  2IJY A;  2WGR A;  2F3M A;  1ZOF A;  1THO A;  2AHE A;  7GSS A;  1SK2 A;  2X64 A;  4NAX A;  5B8A A;  1GLP A;  1DBY A;  3FEU A;  2GSQ A;  4EL1 A;  3KXO A;  3QMX A;  4KCE A;  1SKR B;  4F0B A;  4MLY A;  4PGT A;  3IC8 A;  2L6D A;  2C0G A;  2JU5 A;  5CAX A;  4FYU A;  2M80 A;  1PD2 1;  2VCV A;  4MA9 A;  1OC3 A;  3W6G A;  4CY8 A;  2FA8 A;  2ES7 A;  4YAV A;  3K8N A;  3CBU A;  1TP9 A;  2LRT A;  3GN3 A;  1VF3 A;  3LW9 A;  4X0X A;  3W8S A;  4MF6 A;  5C04 A;  3KTL A;  2E2M A;  1O7U A;  4TR0 A;  3C8E A;  4AJ7 A;  2FNO A;  5ECN B;  2KLX A;  2V6O A;  4KE3 A;  2LJK A;  1Y6E A;  3TJK A;  1SL0 B;  2EIR A;  2H01 A;  2H71 A;  3GSS A;  5A4V A;  5JCU A;  2B1L A;  1JZW A;  5FHI A;  2C8U A;  5HR0 A;  5H5Q A;  2QGV A;  2B5X A;  2HYX A;  2VM1 A;  4HS1 A;  3H79 A;  1XXU A;  4K6X A;  1SD9 A;  5IIZ A;  3QPM A;  1SK1 A;  2IMK A;  2V41 A;  2GQK A;  4N30 A;  5IOW A;  3IHQ A;  5EL8 A;  2L4C A;  5F8B A;  4Q5Q A;  1KNG A;  5IMV A;  4F0C A;  1TRS A;  2O8V B;  4LL4 B;  5GAP D;  1URM A;  1EEJ A;  1A23 A;  2H0G A;  1GP1 A;  4PUR A;  2FWH A;  4IKH A;  3LFL A;  2VLU A;  1GNE A;  3LOR A;  1ERT A;  3QAG A;  1TRU A;  1CQH A;  4L5L A;  4V2N A;  1VGL A;  3RAZ A;  1A0R P;  1GSU A;  2IN3 A;  2E7P A;  4HI7 A;  1PMT A;  4YKG A;  1XPV A;  1XBS A;  2N5A A;  2FWG A;  2MZC A;  3RPP A;  1XWG A;  4BVX B;  1HNC A;  1YEP A;  1ACV A;  4ZL7 A;  3M1G A;  2P0G A;  1I9D A;  3GRX A;  4OWY A;  4TRX A;  1RW1 A;  1Z5Y E;  1FO5 A;  4I2U A;  3GV1 A;  3NIV A;  3BD2 A;  1DE2 A;  4Z2R A;  5IO2 A;  1PKW A;  2VL2 A;  5JCW A;  5ENU A;  3ZFB A;  1LBK A;  5G1L A;  2F8A A;  5IQY A;  3LYP A;  4EIQ A;  1PL2 A;  2N5F A;  2DJ3 A;  4Z2T A;  1TK0 B;  4NV2 A;  5J4U A;  3IV4 A;  3VI7 A;  3ZML A;  3VFI A;  3G7I A;  4PQH A;  3DVW A;  1XW5 A;  3I69 A;  1PGT A;  4KW6 A;  2TRC P;  4FYB A;  3GX0 A;  1BX9 A;  1B8X A;  3AY8 A;  1B48 A;  3UBK A;  4KSM A;  2HSM A;  1N2A A;  3RBT A;  1X9S B;  3EC3 A;  3A2W A;  3P7X A;  1IYH A;  3DIE A;  4GWR A;  3GA4 A;  3CYN A;  4LL1 B;  4E8E A;  5JWO B;  1G0T A;  3GUS A;  5L71 A;  3VLN A;  1R4W A;  5KEJ A;  3RPN A;  1BYE A;  2ON5 A;  1X5E A;  3LWA A;  3KH7 A;  1B4P A;  2JL4 A;  1NHO A;  2LTK A;  3GKN A;  4CW9 A;  3UEM A;  1WRY A;  1K0B A;  3GST A;  3LXZ A;  4MJB A;  3HCZ A;  2K6V A;  2LRN A;  4AF2 A;  4GF0 A;  4DSS A;  3KP9 A;  2HSY A;  1O8X A;  1IYI A;  3A2X A;  1VF4 A;  1OVN A;  1ERU A;  1YZX A;  3EU3 A;  3NZN A;  5F06 A;  2HRN A;  3UMA A;  3BCI A;  3UIW A;  2F8F A;  1KBN A;  1N8J A;  4ZBA A;  2HE3 A;  4TN8 A;  3APQ A;  3UAP A;  3HJM A;  1Z9H A;  19GS A;  2F9S A;  1RQM A;  2CVB A;  3WGE A;  1O73 A;  4MP4 A;  4ICY A;  4JR6 A;  2B5E A;  5ECI B;  1J0F A;  5GSS A;  4MPF A;  3TRX A;  3F8U A;  2VOC A;  1T3B A;  5KN1 A;  4F03 A;  2OE1 A;  2A2S A;  3KGK A;  4NWY A;  2IFQ A;  2R2J A;  3VWX A;  4BL7 A;  4H86 A;  5HFG A;  14GS A;  1TU8 A;  1XVW A;  2HFD A;  4IQ1 A;  5ABR A;  3WGD A;  2HNL A;  2H72 A;  9GSS A;  2H70 A;  1SK0 A;  3TOU A;  2GTU A;  3ZMK A;  2K18 A;  2PBJ A;  1FOH A;  4KF9 A;  1JHB A;  2O87 A;  1QMV A;  4K0N A;  1F2E A;  3FRC A;  3WT2 A;  3C7M A;  2VLV A;  1WIK A;  1ML6 A;  4ID0 A;  1S3D A;  2R0P A;  5CNW A;  1PX6 A;  5BMU A;  1K3Y A;  1ON4 A;  2DML A;  5F05 A;  4LMW A;  5IMZ A;  3NOF A;  4TXO A;  2JZT A;  4ZBB A;  4G2E A;  4WR4 A;  4HEA 2;  1MEK A;  2H74 A;  2EIQ A;  3J7Y b;  3R2Q A;  1TRV A;  2L5L A;  1TI1 A;  2X4A A;  1M0U A;  3HVX A;  3TKS E;  4ZB6 A;  2VCQ A;  2M72 A;  1YDK A;  2LS5 A;  5CRD A;  1A8L A;  5AIS A;  1V2A A;  1OYJ A;  4GQC A;  4PQ1 A;  3HZ8 A;  3PPU A;  2OJL A;  4AJ8 A;  4ZBD A;  1JZR A;  2GZY A;  4ISD A;  2FCH A;  4RQX A;  4Q5R A;  4OFN A;  5ECM B;  1GRX A;  4ZXG A;  5CP1 A;  2RUF A;  3F0I A;  2YOI A;  3ZIJ A;  2VLT A;  4ILF A;  3GMF A;  1HD2 A;  4V2L A;  3C1R A;  4ECJ A;  2NPB A;  3FZA A;  2GQM A;  2OKA A;  1A8Y A;  5DCH A;  4L5O A;  3FZ9 A;  2O89 A;  3M0F A;  4MZW A;  4WBJ A;  1EOH A;  1SJ6 A;  2YWO A;  5IOX A;  4KAE A;  4POK A;  4G19 A;  2PWJ A;  4GLT A;  4L8E A;  4ZIJ A;  3FR6 A;  1PKZ A;  1EV9 A;  2VCT A;  2F51 A;  2ZNM A;  4D73 A;  2IMF A;  2L6C A;  4OCE A;  2HZE A;  4WET A;  2O85 A;  4K7O A;  1SKS B;  2H75 A;  4POL A;  3EYT A;  4MMM A;  3IOS A;  3RDW A;  2YZU A;  1PA3 A;  5A4W A;  1PSQ A;  3L0H A;  2RII A;  3H93 A;  3D0Z A;  4LLR A;  4A5P A;  1EP8 A;  3QFA C;  5AIV A;  4BVY A;  1ZMA A;  4WKW A;  5CRH A;  1BAY A;  2H76 A;  4L0U A;  5JCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...