2VL2A

Oxidized and reduced forms of human peroxiredoxin 5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
162
structure length
161
Chain Sequence
SAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN-5
publication title The Crystal Structures of Oxidized Forms of Human Peroxiredoxin 5 with an Intramolecular Disulfide Bond Confirm the Proposed Enzymatic Mechanism for Atypical 2-Cys Peroxiredoxins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 50
structure length 161
sequence length 162
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vl2A00
5INYA 1C72A 4ZL9A 2EIQA 2FLSA 2WRTA 1I5GA 5DJMA 1U3AA 1XVQA 1DSBA 2YZUA 2IL3A 4EF0A 4FYBA 3GTUB 2B1KA 5HR0A 3HA9A 2YANA 3NIVA 3GUSA 2K18A 3ZMLA 2OE0A 4TR4A 3J7Yk 5E59A 5ECLB 4GSTA 3HZ8A 1PQNA 1TK5B 1XFLA 2K6VA 4MJEA 2F8FA 4V2MA 2V41A 1F3AA 16GSA 4WEYA 4NXIA 4OMVA 2LJRA 5KEJA 3G7JA 2M46A 5DAKA 3APSA 1TK8B 3ZMKA 3UVHA 2DJ0A 2P0GA 1K3OA 5CYYA 2YOIA 2MMZA 1I9DA 4O32A 2I3YA 4EDZA 1R5PA 5A4VA 4K2DA 2R6KA 3GX0A 2F3MA 4LLRA 3GKXA 1T1VA 2VOCA 1TRSA 2AHEA 3EU3A 4HI7A 3PR8A 3NZNA 4YQUA 3DVXA 3LGCA 1T00A 3QDNA 3L9VA 5KN3A 1TU8A 5CNWA 4AJ6A 3MDKA 2DC5A 3BBYA 5DALB 1GTUA 4I2TA 3P90A 1FAAA 5KN0A 1U87A 9GSSA 1B9XC 4ML6A 2HI7A 1DE2A 2X99A 4BVYA 2PBJA 4H86A 2IMEA 1V40A 1KEBA 2QSIA 3L4NA 3DIEA 3N5OA 4F2IA 1BEDA 3G9BA 3GSTA 1FVKA 4D73B 5HFGA 1V98A 1V2AA 2D2ZA 1YEXA 1EEMA 5IOXA 3ZRDA 1SK2A 4MH3A 5IMFA 3LQ7A 4NPBA 2WS2A 3KCMA 2P5RA 1PA3A 2K9FA 2CVDA 4FYUA 5G5EA 1W4VA 2HLSA 1ZMAA 3OR5A 2WFCA 5ID2A 3ISOA 1PKWA 5AN1A 4DSSA 5HR1A 2CV4A 1AC1A 2REMA 4NAXA 2KUCA 5G1KA 1FW1A 1SJIA 3GMFA 4NMUA 5A5KA 1O8XA 2XBIA 2L4CA 3E0UA 5CRDA 4GCIA 2LS5A 1ZYEA 5J9BA 2DLXA 1SYXA 3TKQA 2CX3A 2PMTA 1XXUA 2R37A 5J3RA 1B8XA 2AAWA 1O6JA 4TR3A 1GP1A 5AIVA 3GHAA 1UC7A 2YWNA 1TW9A 2CAQA 3M1GA 1UA5A 2RUFA 2C4JA 1JHBA 4YH2A 3KD0A 2HSYA 4ID0A 3IK9A 4I8BA 2GGTA 4IS0A 1A8LA 3F3RA 4KH7A 3HY2A 2H1DA 2DJ3A 4K7OA 2ES7A 4KDYA 2CAIA 1QUWA 5A4WA 1BQ7A 5DQYA 1FG4A 3ZL5A 4TXOA 3IC4A 3DVWA 5EL8A 4KW6A 1QMVA 3TRQA 1MD4A 3A2WA 2X8CA 3GURA 2AUVA 3BOAA 3RDWA 1OC3A 4NV5A 3ERGA 2OADA 5D96A 2IMIA 3Q18A 4I2UA 2V1MA 4MF5A 1A2JA 3R2QA 6GSXA 1FB6A 3TOUA 5JWOB 2ZCTA 3IK7A 4LL4B 2VLUA 4K0GA 1S3DA 1K0CA 4K9ZA 5C04A 1DE1A 2IMKA 2H01A 4EVMA 2H0HA 1MDJA 1DUGA 1SYRA 3HYPA 5DCHA 3GKKA 5IMDA 4DEJA 5GSSA 4ZXGA 1FOVA 4LL1B 1O7UA 2WJUA 2F51A 4XS4A 1TOFA 1LU4A 3D6IA 5FT3A 2NBSA 1A0FA 3KP8A 4MMMA 2J23A 3F4RA 4EL1A 2RIIA 5F0GA 5JWRB 3KJYA 2ZUPA 1YY7A 2B5EA 2P5QA 4ZL7A 4L5LA 2H1AA 1O73A 2C8UA 4XTSA 1K0OA 6GSYA 3TKPA 2YCDA 4MF6A 2GS3A 2FWGA 5B8BA 5CRWA 1YZXA 1XW6A 2VL2C 4MZCA 1OE7A 3FR3A 4KA0A 5H5QA 1TJDA 4O92A 1ST9A 2I1UA 5AGYA 3F63A 4BA7A 5GAND 2V6KA 1Z9HA 4TKYA 2H6XA 1HNBA 3KTBA 4HZ4A 4QL7A 2C0EA 5ECHB 4TXOB 2YWIA 4MZWA 4N11A 4BWSA 4GSNA 2IPAA 1ZCPA 2H6ZA 4XHMA 4GSSA 4G10A 2C3QA 4GF0A 4RUVA 5CRGA 3ED3A 3P7XA 1GUHA 1GSYA 2YV7A 3KH9A 1O81A 3HKRA 4I97A 5F8BA 4YQMA 2AJQB 3TJFA 1JFUA 2DJKA 4ZILA 2KP1A 3VI7A 3IXRA 4BWQA 5ECKB 4BVXA 2HZEA 2O89A 1U6TA 3F9UA 5LNKe 4TXVA 2X8GA 3GIXA 4E8EA 2H6YA 2M72A 3LSZA 4E8HA 1G6YA 3KXOA 1A8YA 3FKFA 1XWCA 3C8EA 5D9XA 2H66A 1GSDA 3UAPA 2DSAA 1RK4A 3UIWA 1XWAA 3F6FA 3UARA 5HR2A 2YP6A 2E2MA 2J9HA 1UVZA 2LSTA 2VCWA 4ISDA 2GT5A 1GTBA 1A2MA 1NSWA 4WF5A 3L78A 2JZSA 1FHEA 2YWMA 3HVXA 3UVTA 4V2NA 3GX8A 2LRNA 1GWCA 3ZIJA 3BCKA 5J5NA 3IE3A 3SWLA 4AGSA 3C7MA 4ZB9A 5B6NA 1SK0A 2HNLA 5CRHA 2MMNA 2R2JA 1F2EA 3QOUA 1VF2A 3EYTA 2VM1A 3TJGA 3VWXA 3ME8A 4FYCA 4ZB8A 3VPQA 1GULA 4ZL8A 1TK0B 4ECCA 4F0BA 1N2AA 4MF7A 1TU7A 2MBSA 3HD5A 3WD6A 4K8MA 1GSUA 1OE8A 1YKCA 5H5RA 2ZNMA 1ERTA 1FB0A 2LUSA 8GSSA 3VWWA 4X43A 3O3TA 6GSVA 2V32A 2LJAA 2YWOA 4GTUA 2E0QA 3M3MA 5GAPD 5D9VA 3Q19A 4HDEA 1GLQA 1EGRA 1TP9A 5EVOA 4FO5A 2OBKA 3ZLPA 4F03A 1EEJA 1ERVA 3FHKA 3ZREA 1PD21 4ZB6A 1S3CA 1WRYA 2V2GA 2LQOA 1YKAA 4K7IA 5ECNB 6GSUA 3IBHA 3GNJA 2HZEB 3UJ1A 3WT1A 4Q5FA 2NPBA 3EURA 6GSSA 1O85A 3I9V2 3CSJA 4G9HA 4OO4A 3N9JA 4TOPA 1K3YA 4IP1A 4PQIA 1T8EB 5LCZA 3DWVA 3ZZXA 1IYIA 5IMAA 2VLVA 5AIXA 1GUKA 2K8SA 1SL0B 1X5CA 4XS1A 4POMA 1WIKA 3QMXA 1NM3A 1H4OA 1SKRB 2E7PA 4LA1A 2H19A 5C00A 1G7OA 2A2RA 3QCPA 3D21A 5HFKA 1MDIA 3LFLA 1XBSA 1MD3A 3U5RE 2KHPA 2L6CA 4PURA 4F0CA 1PMTA 3J7Yb 1ERWA 5JCUA 1XWGA 3GKNA 2X8HA 3UOMA 1IYHA 3TOTA 2VIMA 4EXJA 2CQ9A 1XZOA 3IPZA 3KIJA 3FR6A 3KMNA 1MEKA 2VUPA 2HSHA 1JLVA 4TR1A 1UN2A 5DVBA 4JU5A 4Q5QA 1M2AA 2GZYA 3CMIA 3D4TA 1AQVA 3KGKA 2DJJA 2N5AA 1K3LA 3GSSA 1A0RP 3ERWA 2H70A 1TKDB 4IP6A 1F3BA 2JZTA 3TB2A 2IFQA 3CRTA 4V1Ag 5ECQB 3WGEA 3HCZA 3QD9A 3ERFA 3GN3A 3C73A 5ELAA 2H1GA 2PPTA 3H4KA 2CZ2A 2GQLA 3IRAA 2GTUA 2DBCA 1M0UA 3EC3A 1XPVA 1FVJA 4KCEA 2WGRA 2KP2A 5DQSA 2H30A 4MCUA 3FW2A 2B5YA 1YQ1A 3H79A 1XIYA 3WGDA 3ZIVA 4V2LA 2PUKC 1GUMA 1B48A 4RQXA 2H0IA 2RUEA 3Q6OA 4JEDA 2QGVA 4MZBA 3GRXA 2CVKA 2H74A 3O6TA 1OC9A 4KDUA 3CSIA 5DAKB 1OC8A 2LNSA 4MP4A 1GSEA 1X5DA 1R26A 2XHFA 4N10A 1WJKA 3EMXA 1PKZA 3EU4A 4K0NA 4Q5NA 3GL3A 2I9HA 4ZBBA 1T4YA 2QC7A 1WOUA 1M9AA 3VFIA 2FWEA 4NHWA 2DMLA 4MA9A 2VD0A 3VK9A 1SKWB 2C0DA 1XWKA 4ILFA 7GSSA 3LJRA 5IO2A 2FCHA 4F9ZA 3C1SA 4MLYA 3IR4A 3H8QA 2L6DA 4K7NA 4IGJA 1ZL9A 1A24A 3IHQA 5JCWA 14GSA 5FWGA 4L8EA 5ECRB 4J56E 3HDCA 1THXA 2WULA 1W89A 4PUAA 3EVIA 1T4ZA 3ZVJA 5IMCA 3MAKA 2HFDA 3I6AA 3F8UA 1KBNA 1SD9A 2NTOA 1YJ6A 3M9JA 2GSQA 1XW5A 1BAYA 1YEPA 4MJAA 2B1LA 1ERUA 2VCZA 3L9SA 1GSQA 1SK1A 3RHBA 1GNEA 1V58A 4HQSA 3CXGA 3TJJA 2R3XA 2I81A 2LRTA 1Z7PA 2IWTA 5IO0A 3VWVA 3KZQA 4HQZA 5IOWA 3HJOA 2C3TA 4IELA 1PX6A 4KNDA 1G6WA 1VF4A 4FH8A 1B9YC 5CREA 4YAVA 3HZ4A 3GV1A 5ID2B 3UBLA 4DSSB 1Z7RA 3A2XA 4OFNA 4N30A 1OC9B 1O8WA 1BX9A 2TRXA 2XPEA 3KEBA 3IV4A 4YAPA 1GNWA 2ON5A 5DCGA 2B7KA 1DBYA 1KTEA 2CZ3A 4G2EA 1MTCA 2JU5A 4J57E 1LJRA 4ECIA 2I4AA 4ZBDA 2LKUA 1TDIA 5IM9A 1R5AA 2XC2A 3KTLA 4IJ3A 1AIUA 1JZDA 2PWJA 6GSWA 2GZZA 4N0VA 3L0HA 1G7EA 1GSSA 3TKRA 1TTZA 1F9MA 1J0FA 5JCGA 4TN8A 3F3QA 1USBA 1EV9A 1Z3EA 4HEA2 4DSRA 3W8JA 4GLTA 2PVOC 3CYNA 1QQ2A 3EMPA 5J4UA 3TUEA 4HZ2A 2IN3A 2H1BA 3CBUA 2FHEA 1G0TA 1SU9A 3HJMA 2AB6A 2FWHA 1BG5A 2NDOA 1YF0A 2VO4A 4NV2A 1XVWA 4BPYA 1WWJA 3G7IA 4K1FA 1K0MA 4PGTA 2OACA 2X64A 2DIZA 4AJ7A 2FA8A 2H73A 2GSTA 4G19A 3CTGA 3GH9A 4POLA 1T3BA 3TRPA 1ZZYA 4I5QA 3VPTA 10GSA 4OCFA 1ABAA 3I69A 3APQA 2FD3A 2GLRA 3TDGA 1TI3A 5H5SA 5HR3A 1JZOA 1PN9A 5IQYA 3ZITA 3PH9A 3HHVA 4AF2A 3QR6A 2PGTA 5CO3A 3D22A 3FEUA 2K8VA 1K0AA 1PX7A 1QFNA 3WGXA 4MPGA 4XS4B 5CAXA 2C80A 4HJMA 2DJ1A 4XCSA 2LNTA 3W8SA 3V1WA 3LYPA 5G2ZA 2FNOA 1SJZA 2OA7A 1TRUA 3FZ4A 3LXZA 4OO5A 5AISA 3A3TA 3GTUA 2H72A 4K6XA 4IQAA 2A4VA 3SBCA 2C3NA 1GL8A 4KDXA 2V6OA 3ZFBA 4X1UA 1EOHA 2FA4A 4TVEA 2OBIA 3EWLA 1F6MC 2L57A 1XWBA 3QAVA 2YZHA 2YN1A 4IJIA 19GSA 3IAM2 2FWFA 4RI7A 4POKA 2M80A 3QAGA 3S9FA 2CVBA 2GQMA 4KGIA 2CA8A 2TIRA 3QFAC 3TKSE 1V9WA 5G30A 2LV3A 4GQFA 2VL2A 2MMAA 1ACVA 5B7CA 4QQ7A 3VI5A 4EUYA 2GDRA 2MBTA 3RPPA 1JZRA 1F37A 2EIRA 3TJKA 5D93A 1AUCA 1WPIA 1E2YA 3A5WA 2B3SA 5B8AA 2FUG2 4PQHA 4OFTA 1OVNA 2H71A 1U88A 4L0WA 3JCML 1T7PB 2CT6A 5KN2A 3IA1A 2HE3A 1FO5A 3FZAA 4IKHA 5J9CA 5G5FA 3PINA 4GWRA 2L5OA 5F06A 2C1YA 3DYRA 4V1Ap 18GSA 1M2DA 4CDOA 2H75A 5ECSA 2JZRA 5FHIA 4GRFA 4CW9A 2PU9C 3TGZA 1M9BA 3LXTA 3O76A 2DMMA 1GTAA 20GSA 1QXHA 1EZKA 1RW1A 1ZOFA 5DBQA 4YQVA 4D73A 2LJKA 1NHOA 1AAZA 3U6VA 2VLTA 5ECPB 3CRUA 2PVQA 2VL9A 2LEGA 4PNFA 1AXDA 4GXZA 2HZFA 2B6MA 4DSQA 3WT2A 3UL3A 4P3YB 2WZ9A 4KAEA 5J41A 5D73A 22GSA 3K8NA 4POBA 4X0XA 1EOGA 4HU9A 4KX4A 2HT9A 3GKMA 4KSMA 1Q98A 5G31A 2C0GA 3DRNA 2VAFA 2O8VB 1TXXA 2LTKA 1AW9A 1M7TA 4EDYA 5IMVA 1R7HA 5D9WA 4KCAA 3M9KA 3I43A 3TRXA 1VGLA 1X9WB 4XRDA 5ENUA 5IIZA 3FR9A 4GQCA 4MDCA 5COHA 1M99A 1K0BA 2GVPA 3KMOA 4IBPA 2G2QA 4O5RA 1OKTA 3US3A 2QKEA 4PXOA 1XW9A 5JWQB 5HFIA 17GSA 1ZYQB 5E4WA 4TRXA 2WDUA 3CTFA 1LBKA 3FY7A 3KH7A 3UMAA 4LMVA 3KP9A 3LWAA 4WXTA 1PRXA 4JR6A 2AYTA 2OKAA 2XPDA 2MZCA 1VF3A 1QK8A 4WR5A 1EWXA 3RBTA 3UEMA 4XRAA 3VLNA 3E9JB 1Z5YE 2OE3A 1Y6EA 2YNXA 3LYKA 3F6DA 5F07A 3TKSC 1B4PA 4OCEA 3IAS2 4I6XA 4TW5A 1H75A 4HUAA 3LEFA 3C71A 3QFBC 2EIOA 5KN1A 1B4QA 2VCQA 3M8NA 4HJ2A 1EP7A 4ZBAA 4EC0A 4JR4A 4IW9A 3DXBA 2F8AA 2Z9SA 1PL2A 1GTIA 2EC4A 2HRNA 2GQKA 1J08A 2H76A 4PUFC 1K0DA 1CQHA 3Q74A 4WBRD 3VWUA 4HS1A 1EV4A 4TR1B 3WYWA 3ZTLA 4HOJA 1K0NA 4IHUA 3EE2A 1A23A 1HYUA 1X0RA 2KOKA 1E6BA 2IFQB 4PX1A 5ECMB 1GH2A 5ELGA 1NHYA 2AV4A 3GA4A 3P8WA 1X9SB 4JE1A 4BL7A 5ABRA 1BJXA 4Z7XA 1A2LA 1GRXA 5IPHA 1YF1A 4ZIJA 5IPGA 2GT6A 2RM5A 5B6MA 1HNCA 1XCCA 3RHCA 4JBBA 3NOFA 1Y25A 1VF1A 1GLPA 2VCVA 2YPMA 3L9UA 1KNGA 2JADA 3GL5A 3C1RA 2N5BA 1JZWA 2MMOA 3DMLA 4RI6A 1WP0A 1R4WA 3F0IA 1SENA 3P2AA 1MDKA 4ECJA 2HXKA 1RQMA 3APOA 2H8LA 2L5LA 3BJ5A 3D4MA 4MABA 2P31A 4XIHA 2BTOT 1THOA 2C0FA 4CHSA 1XOAA 2TRCP 1PSQA 1WMJA 2DJ2A 4EE0A 1SL1B 1ON4A 4O7HA 1OYJA 4NHZA 1WE0A 1ZGNA 2GSRA 3MNGA 2G0FA 3IOSA 4MPFA 3TKSA 4MH2A 3H1NA 1HD2A 5ECOB 2LQQA 1SD8A 1SKSB 3DD3A 5A4UA 4LMWA 3VURA 2YV9A 2OE1A 3GFKA 3DKSA 2IMFA 5IMZA 6GSTA 5EY6A 1BYEA 2B5XA 1SL2B 2A2SA 5DJLA 2HRFA 1OAZA 4MK3A 3ZFLA 2KLXA 3LG6A 2B7JA 4NWYA 1ILOA 4KB3A 2ON7A 1Z6NA 4OFMA 2RLIA 4IQ1A 4N0ZA 2HYXA 4KSOA 4ML1A 4F82A 2PN8A 3TCOA 1URMA 4L5OA 1PGTA 3DEXA 11GSA 3D0ZA 1QGVA 1SJ6A 2OJLA 2NVLA 4AJ8A 2JSYA 2R4VA 1N8JA 3E3EA 2XBQA 1AQXA 4WKWA 4DVCA 3LORA 4WF4A 2FGXA 2O7KA 1OKDA 3HVSA 5GZZB 13GSA 2WB9A 1EGOA 1CQGA 3QPMA 1TI1A 3F4TA 2L4QA 4OD7A 3BCIA 3ZYWA 3DGQA 2CX4A 4TR0A 3HVVA 4J2FA 5DDLA 4WBJA 1YDKA 3GH6A 1XOBA 3FRCA 3QAWA 5HQPA 2BMXA 3EINA 3D5JA 2JACA 2O87A 2VCXA 2YJ7A 2VL3A 4IVFA 12GSA 4PNGA 2IJYA 3HJPA 4ECBA 5D9TA 2DIYA 2FY6A 3ME7A 3RAZA 2RM6A 1ML6A 5CP1A 2IMDA 4QL9A 4ULXA 4XS6A 3FZ5A 2IIYA 3CSHA 4JZQA 1HNAA 3M0FA 4RQRA 4FIWA 3KM6A 1U3IA 3IDVA 3HXSA 5LD0A 1Z6MA 2BJXA 3RPNA 2L59A 5G1LA 1J9BA 1S3AA 3MWHA 2N5FA 2LRCA 2PERA 1X5EA 2YJHA 4L0UA 4EKZA 2JSZA 4KUNA 3UBKA 2F9SA 5L71A 2E2GA 1TRVA 2O85A 2R5GA 1JLWA 3FZ9A 3GYKA 5EPFA 4JRRA 2GSSA 4MJCA 2WCIA 5D8IA 3PGTA 3FK8A 3G7YA 3F4SA 3ZVJD 3W6GA 3A2VA 1M2BA 1AQWA 1V57A 4EO3A 1Q4JA 4WR4A 5GSTA 1PL1A 1HQOA 2MYGA 2H0GA 1EP8A 4MJBA 4IN0A 3MSZA 3BD2A 5F05A 4OWYA 1NW2A 1GSFA 4KE3A 3H93A 1TRWA 2VD1A 2JL4A 4Q5RA 2VM2A 2ALBA 2VCTA 4WETA 4ACSA 3TJBA 5DALA 3AY8A 1X9MB 3FYGA 5ECIB 4HU7A 4PQ1A 1VRSD 2GZPA
chains in the Genus database with same CATH superfamily
5INYA 1C72A 4ZL9A 2EIQA 2FLSA 2WRTA 1I5GA 5DJMA 1U3AA 1XVQA 1DSBA 2YZUA 3IHGA 2IL3A 4EF0A 4FYBA 3GTUB 2B1KA 5HR0A 3HA9A 2YANA 3NIVA 3GUSA 2K18A 3ZMLA 2OE0A 4TR4A 3J7Yk 5E59A 5ECLB 4GSTA 3HZ8A 1PQNA 1TK5B 1XFLA 2K6VA 4MJEA 2F8FA 4V2MA 2V41A 1F3AA 16GSA 4WEYA 3FMWA 4NXIA 4OMVA 2LJRA 5KEJA 3G7JA 2M46A 5DAKA 3APSA 1TK8B 3ZMKA 3UVHA 2DJ0A 2P0GA 1K3OA 5CYYA 2YOIA 2MMZA 1I9DA 4O32A 2I3YA 4EDZA 1R5PA 5A4VA 4K2DA 3LW9A 2R6KA 3GX0A 2F3MA 4LLRA 3GKXA 1T1VA 2VOCA 1TRSA 2AHEA 3EU3A 4HI7A 3PR8A 3NZNA 4YQUA 4MNNA 3MYDA 3DVXA 3LGCA 1T00A 3QDNA 3L9VA 5KN3A 1TU8A 5CNWA 4AJ6A 3MDKA 2DC5A 1XG8A 3BBYA 5DALB 1GTUA 4I2TA 2R0PA 3P90A 1FAAA 5KN0A 1U87A 9GSSA 1B9XC 4ML6A 2HI7A 1DE2A 2X99A 4BVYA 2PBJA 4H86A 2IMEA 1V40A 1KEBA 2QSIA 3L4NA 3DIEA 4A5PA 3N5OA 4F2IA 1BEDA 3G9BA 3GSTA 1FVKA 4D73B 5HFGA 1V98A 1V2AA 2D2ZA 1YEXA 1EEMA 5IOXA 3ZRDA 1SK2A 4MH3A 5IMFA 3LQ7A 4NPBA 2WS2A 3KCMA 2P5RA 1PA3A 2K9FA 2CVDA 4FYUA 5G5EA 1W4VA 2HLSA 1ZMAA 3OR5A 2WFCA 5ID2A 3ISOA 1PKWA 5AN1A 4DSSA 5HR1A 2CV4A 1AC1A 2REMA 4NAXA 2KUCA 5G1KA 1FW1A 1SJIA 3GMFA 4NMUA 5A5KA 1O8XA 2XBIA 2L4CA 3E0UA 5CRDA 4GCIA 2LS5A 1ZYEA 5J9BA 2DLXA 1SYXA 3TKQA 2CX3A 2PMTA 1XXUA 2R37A 5J3RA 1B8XA 2AAWA 1O6JA 4TR3A 1GP1A 5AIVA 3GHAA 1UC7A 2YWNA 1TW9A 2CAQA 3M1GA 1UA5A 2RUFA 2C4JA 1JHBA 4YH2A 3KD0A 2HSYA 4ID0A 3IK9A 4I8BA 4Z2UA 2GGTA 4IS0A 1A8LA 3F3RA 4KH7A 2DKHA 3HY2A 2H1DA 2DJ3A 4G0LA 4K7OA 2ES7A 2R0CA 4KDYA 2CAIA 1QUWA 5A4WA 1BQ7A 5DQYA 1FG4A 3ZL5A 4TXOA 3IC4A 4USSA 3DVWA 2X4AA 5EL8A 4KW6A 1QMVA 3TRQA 1MD4A 3A2WA 2X8CA 3GURA 2AUVA 3BOAA 3RDWA 1OC3A 4NV5A 3ERGA 2OADA 5D96A 2IMIA 3Q18A 4I2UA 2V1MA 4MF5A 2QA1A 1A2JA 3R2QA 6GSXA 1FB6A 2HRKA 3TOUA 5JWOB 2ZCTA 3IK7A 4LL4B 2VLUA 4K0GA 1S3DA 1K0CA 4K9ZA 5C04A 1DE1A 2IMKA 2H01A 4EVMA 2H0HA 1MDJA 1DUGA 1SYRA 3HYPA 5DCHA 3GKKA 5IMDA 4DEJA 5GSSA 4ZXGA 1FOVA 4LL1B 1O7UA 2WJUA 2F51A 4XS4A 1TOFA 1LU4A 3D6IA 5FT3A 2NBSA 1A0FA 3KP8A 4MMMA 2J23A 3F4RA 4EL1A 2RIIA 5F0GA 5JWRB 3KJYA 4K5RA 2ZUPA 1YY7A 2B5EA 2P5QA 4ZL7A 4L5LA 2H1AA 1O73A 2C8UA 4XTSA 1K0OA 6GSYA 3TKPA 2YCDA 4MF6A 2GS3A 2FWGA 5B8BA 5CRWA 1YZXA 1XW6A 2VL2C 4MZCA 1OE7A 3FR3A 4KA0A 5H5QA 1TJDA 4O92A 1ST9A 2I1UA 5AGYA 4PTSA 3F63A 4BA7A 5GAND 2V6KA 1Z9HA 4TKYA 2H6XA 1HNBA 3KTBA 4HZ4A 4QL7A 2C0EA 5ECHB 4TXOB 2YWIA 4MZWA 4N11A 4BWSA 4GSNA 2IPAA 1ZCPA 2H6ZA 4XHMA 4GSSA 4G10A 2C3QA 4GF0A 4RUVA 5CRGA 3ED3A 1PN0A 3P7XA 1GUHA 1GSYA 2YV7A 3KH9A 1O81A 3HKRA 4I97A 5F8BA 4YQMA 2AJQB 3TJFA 1JFUA 2DJKA 4ZILA 2KP1A 3VI7A 3IXRA 4BWQA 5ECKB 4BVXA 2HZEA 2O89A 1U6TA 3F9UA 5LNKe 4TXVA 2X8GA 3GIXA 4E8EA 4G0KA 2H6YA 2M72A 3LSZA 4E8HA 1G6YA 3KXOA 1A8YA 3FKFA 1XWCA 3C8EA 5D9XA 2H66A 1GSDA 3UAPA 2DSAA 1RK4A 3UIWA 1XWAA 3F6FA 3UARA 5HR2A 2YP6A 2E2MA 2J9HA 1UVZA 3EPTA 2LSTA 2VCWA 4ISDA 2GT5A 1GTBA 1A2MA 1NSWA 4WF5A 3L78A 2JZSA 1FHEA 2YWMA 3HVXA 3UVTA 4V2NA 3GX8A 2LRNA 1GWCA 3ZIJA 3BCKA 5J5NA 3IE3A 3SWLA 4AGSA 3C7MA 4ZB9A 5KOXA 5B6NA 1SK0A 2HNLA 5CRHA 2MMNA 2R2JA 1F2EA 3QOUA 1VF2A 3EYTA 2VM1A 3TJGA 3VWXA 3ME8A 4FYCA 4ZB8A 3VPQA 1GULA 4ZL8A 1TK0B 4ECCA 4F0BA 1N2AA 4MF7A 1TU7A 2MBSA 3HD5A 3WD6A 4K8MA 1GSUA 1OE8A 1YKCA 5H5RA 2ZNMA 1ERTA 1FB0A 2LUSA 8GSSA 3VWWA 4X43A 3O3TA 6GSVA 2V32A 2LJAA 2YWOA 4GTUA 2E0QA 3M3MA 4YKGA 5GAPD 5D9VA 3Q19A 4HDEA 1GLQA 1EGRA 1TP9A 5EVOA 4FO5A 2OBKA 3ZLPA 4F03A 1EEJA 1ERVA 3FHKA 3ZREA 1PD21 4ZB6A 1S3CA 1WRYA 2V2GA 2LQOA 1YKAA 4K7IA 5ECNB 6GSUA 3IBHA 4ICYA 3GNJA 2HZEB 3UJ1A 3WT1A 4Q5FA 2NPBA 3EURA 6GSSA 1O85A 3I9V2 3CSJA 4G9HA 2QA2A 4OO4A 3N9JA 4TOPA 1K3YA 4IP1A 4PQIA 1T8EB 5LCZA 3DWVA 3ZZXA 1IYIA 5IMAA 2VLVA 5AIXA 1GUKA 2K8SA 1SL0B 1X5CA 4XS1A 4POMA 1WIKA 3QMXA 1NM3A 1H4OA 1SKRB 2E7PA 4LA1A 3PPUA 2H19A 5C00A 1G7OA 2A2RA 3QCPA 3D21A 5HFKA 1MDIA 3LFLA 1XBSA 1MD3A 4K5SA 3U5RE 2KHPA 2L6CA 4PURA 4F0CA 1PMTA 3J7Yb 1ERWA 5JCUA 1XWGA 3GKNA 2X8HA 3UOMA 1IYHA 3TOTA 2VIMA 4EXJA 2CQ9A 1XZOA 3IPZA 3KIJA 3FR6A 3KMNA 1MEKA 2VUPA 2HSHA 1JLVA 2R0GA 4TR1A 1UN2A 5DVBA 4JU5A 4Q5QA 1M2AA 2GZYA 3CMIA 3D4TA 1AQVA 3KGKA 1M3IA 2DJJA 2N5AA 1K3LA 3GSSA 1A0RP 3ERWA 2H70A 1TKDB 4IP6A 1F3BA 2JZTA 3TB2A 2IFQA 3CRTA 4V1Ag 5ECQB 3WGEA 3HCZA 3QD9A 3ERFA 3GN3A 3C73A 5ELAA 2H1GA 2PPTA 1S3RA 3H4KA 2CZ2A 2GQLA 3IRAA 2GTUA 2DBCA 1M0UA 3EC3A 1XPVA 1FVJA 4KCEA 2WGRA 2KP2A 5DQSA 2H30A 4MCUA 3FW2A 2B5YA 1YQ1A 3H79A 1XIYA 3WGDA 3ZIVA 4V2LA 2PUKC 1GUMA 1B48A 4RQXA 2H0IA 2RUEA 3Q6OA 4JEDA 2QGVA 4MZBA 3GRXA 2CVKA 2H74A 3O6TA 1OC9A 4KDUA 3CSIA 5DAKB 1OC8A 2LNSA 4MP4A 1GSEA 1X5DA 1R26A 2XHFA 4N10A 1WJKA 3EMXA 1PKZA 3EU4A 4K0NA 4Q5NA 3GL3A 2I9HA 4ZBBA 1T4YA 2QC7A 1WOUA 2HSMA 1M9AA 3VFIA 2FWEA 4NHWA 2DMLA 4MA9A 2VD0A 3VK9A 4K2XA 1SKWB 2C0DA 1XWKA 4ILFA 7GSSA 3LJRA 5IO2A 2FCHA 4F9ZA 3C1SA 4MLYA 3IR4A 3H8QA 2L6DA 4K7NA 4IGJA 1ZL9A 1A24A 3IHQA 5JCWA 14GSA 5FWGA 4L8EA 5ECRB 4J56E 3HDCA 1THXA 2WULA 1W89A 4PUAA 3EVIA 1T4ZA 3ZVJA 5IMCA 4BVYB 3MAKA 4G0IA 2HFDA 3I6AA 3F8UA 1KBNA 1SD9A 2NTOA 1YJ6A 3M9JA 2GSQA 1XW5A 1BAYA 1YEPA 4MJAA 2B1LA 1ERUA 2VCZA 3L9SA 1GSQA 1SK1A 3RHBA 1GNEA 1V58A 4HQSA 3CXGA 3TJJA 2R3XA 2I81A 2LRTA 5KOWA 1Z7PA 2IWTA 5IO0A 3VWVA 3KZQA 4HQZA 5IOWA 3HJOA 2C3TA 4IELA 1PX6A 4KNDA 1G6WA 1VF4A 4FH8A 1B9YC 5CREA 4YAVA 3HZ4A 3GV1A 5ID2B 3UBLA 4DSSB 1Z7RA 3A2XA 4OFNA 4N30A 1OC9B 1O8WA 1BX9A 2TRXA 2XPEA 3KEBA 3IV4A 4YAPA 1GNWA 2ON5A 5DCGA 2B7KA 1DBYA 1KTEA 2CZ3A 4G2EA 1MTCA 2JU5A 4J57E 1LJRA 4ECIA 2I4AA 4ZBDA 2LKUA 1TDIA 5IM9A 1R5AA 4CY8A 2XC2A 3KTLA 4IJ3A 1AIUA 1JZDA 2PWJA 6GSWA 2GZZA 4N0VA 3L0HA 1G7EA 3CQFA 1GSSA 3TKRA 1TTZA 1F9MA 1J0FA 3HVNA 5JCGA 4TN8A 3F3QA 1USBA 1EV9A 1Z3EA 4HEA2 4DSRA 3W8JA 4GLTA 2PVOC 3CYNA 1QQ2A 3EMPA 5J4UA 4CY6A 3TUEA 4HZ2A 2IN3A 2H1BA 3CBUA 2FHEA 1G0TA 1SU9A 3HJMA 2AB6A 2FWHA 1BG5A 2NDOA 1YF0A 2VO4A 4NV2A 1XVWA 4BPYA 1WWJA 3G7IA 4K1FA 1K0MA 4PGTA 2OACA 2X64A 2DIZA 4AJ7A 2FA8A 2H73A 2GSTA 4G19A 3CTGA 3GH9A 4POLA 1T3BA 3TRPA 1ZZYA 4I5QA 3VPTA 10GSA 4OCFA 1ABAA 3I69A 3APQA 2FD3A 2GLRA 3TDGA 1TI3A 5H5SA 5HR3A 1JZOA 1PN9A 5IQYA 3ZITA 3PH9A 3HHVA 4AF2A 3QR6A 2PGTA 5CO3A 3D22A 3FEUA 2K8VA 1K0AA 1PX7A 1QFNA 3WGXA 4MPGA 4XS4B 5CAXA 2C80A 4HJMA 2DJ1A 4XCSA 2LNTA 3W8SA 3V1WA 3LYPA 5G2ZA 2FNOA 1SJZA 2OA7A 1TRUA 3FZ4A 3LXZA 4OO5A 5AISA 3A3TA 3GTUA 2H72A 4K6XA 4IQAA 2A4VA 3SBCA 2C3NA 1GL8A 4KDXA 2V6OA 3ZFBA 4X1UA 1EOHA 2FA4A 4TVEA 2OBIA 3EWLA 1F6MC 2L57A 1XWBA 3QAVA 2YZHA 2YN1A 4IJIA 19GSA 3IAM2 2FWFA 4RI7A 4POKA 2M80A 2HRAA 3QAGA 3S9FA 2CVBA 2GQMA 4KGIA 2CA8A 2TIRA 3QFAC 3TKSE 1V9WA 5G30A 2LV3A 4GQFA 2VL2A 2MMAA 1ACVA 5B7CA 4QQ7A 3VI5A 4EUYA 2GDRA 2MBTA 3RPPA 1JZRA 1F37A 2EIRA 3TJKA 5D93A 1AUCA 1WPIA 1E2YA 3A5WA 2B3SA 5B8AA 2FUG2 4PQHA 4OFTA 1OVNA 2H71A 1U88A 4L0WA 2A2PA 3JCML 1T7PB 2CT6A 5KN2A 3IA1A 2HE3A 1FO5A 3FZAA 4IKHA 5J9CA 5G5FA 4BVXB 3PINA 4GWRA 2L5OA 5F06A 2C1YA 3DYRA 4V1Ap 18GSA 1M2DA 4CDOA 2H75A 5ECSA 2JZRA 5FHIA 4GRFA 4CW9A 2PU9C 3TGZA 1M9BA 3LXTA 3O76A 2DMMA 1GTAA 20GSA 1QXHA 1EZKA 1RW1A 1ZOFA 5DBQA 4YQVA 4D73A 2LJKA 1NHOA 1AAZA 3U6VA 4O5UA 2VLTA 5ECPB 3CRUA 2PVQA 2VL9A 2LEGA 4PNFA 1AXDA 4GXZA 2HZFA 4BIKA 2B6MA 4DSQA 3WT2A 3UL3A 5BRTA 4P3YB 2WZ9A 4KAEA 5J41A 5D73A 22GSA 3K8NA 4POBA 4X0XA 1EOGA 4HU9A 4KX4A 2HT9A 3GKMA 4KSMA 1Q98A 5G31A 2C0GA 3DRNA 2VAFA 2O8VB 1TXXA 2LTKA 1AW9A 1M7TA 4EDYA 5IMVA 1R7HA 5D9WA 4KCAA 3M9KA 3I43A 3TRXA 1VGLA 1X9WB 4XRDA 5ENUA 5IIZA 3FR9A 4GQCA 4MDCA 5COHA 1M99A 1K0BA 2GVPA 3KMOA 4IBPA 2G2QA 4O5RA 1OKTA 3US3A 2QKEA 4PXOA 1XW9A 5JWQB 5HFIA 17GSA 1ZYQB 5E4WA 4TRXA 2WDUA 3CTFA 1LBKA 3FY7A 3KH7A 3UMAA 4LMVA 3IC8A 3KP9A 3LWAA 4WXTA 1PRXA 4JR6A 2AYTA 2OKAA 1FOHA 2XPDA 2MZCA 1VF3A 1QK8A 4WR5A 1EWXA 3RBTA 3UEMA 4XRAA 3VLNA 3E9JB 1Z5YE 2OE3A 1Y6EA 2X49A 2YNXA 3LYKA 3F6DA 5F07A 3TKSC 1B4PA 4OCEA 3IAS2 4O5QA 4I6XA 4TW5A 1H75A 4HUAA 3LEFA 3C71A 3QFBC 2EIOA 5KN1A 1B4QA 2VCQA 3M8NA 4HJ2A 1EP7A 4ZBAA 4EC0A 4JR4A 4IW9A 3DXBA 2F8AA 2Z9SA 1PL2A 1GTIA 2EC4A 2HRNA 2GQKA 1J08A 2H76A 4PUFC 1K0DA 1CQHA 3Q74A 4WBRD 3VWUA 4HS1A 1EV4A 4TR1B 3WYWA 3ZTLA 4HOJA 1K0NA 4IHUA 3EE2A 1A23A 1HYUA 1X0RA 2KOKA 1E6BA 2IFQB 4PX1A 5ECMB 1GH2A 5ELGA 1NHYA 2AV4A 3GA4A 3P8WA 1X9SB 4JE1A 4BL7A 5ABRA 1BJXA 4Z7XA 1A2LA 1GRXA 5IPHA 1YF1A 4ZIJA 5IPGA 3MIXA 2GT6A 4Z2TA 2RM5A 5B6MA 2UZ8A 1HNCA 1XCCA 3RHCA 4JBBA 3NOFA 1Y25A 1VF1A 1GLPA 2VCVA 2YPMA 3L9UA 1KNGA 2JADA 3GL5A 3C1RA 2N5BA 1JZWA 2MMOA 3DMLA 4RI6A 1WP0A 1R4WA 3F0IA 1SENA 3P2AA 1MDKA 4ECJA 2HXKA 1RQMA 3APOA 2H8LA 2L5LA 3BJ5A 3D4MA 4MABA 2P31A 4XIHA 2BTOT 1THOA 2C0FA 4CHSA 1XOAA 2TRCP 1PSQA 1WMJA 2DJ2A 4EE0A 1SL1B 1ON4A 4O7HA 1OYJA 4NHZA 1WE0A 1ZGNA 2GSRA 3MNGA 3R3EA 2G0FA 3IOSA 4MPFA 3TKSA 4MH2A 1ZYPA 3H1NA 1HD2A 5ECOB 2LQQA 1SD8A 1SKSB 3DD3A 5A4UA 4LMWA 3VURA 2YV9A 2OE1A 3GFKA 4YKFA 3DKSA 2IMFA 5IMZA 6GSTA 5EY6A 1BYEA 2B5XA 1SL2B 2A2SA 5DJLA 2HRFA 1OAZA 4MK3A 3ZFLA 2KLXA 3LG6A 2B7JA 4NWYA 1ILOA 4KB3A 2ON7A 1ZYNA 1Z6NA 4OFMA 2RLIA 4IQ1A 2DKIA 4N0ZA 2HYXA 4KSOA 4ML1A 4BL7B 4F82A 2PN8A 3TCOA 1URMA 4L5OA 1PGTA 4FQUA 3DEXA 11GSA 3D0ZA 1QGVA 1SJ6A 2OJLA 2NVLA 4AJ8A 2JSYA 2R4VA 1N8JA 3E3EA 2XBQA 1AQXA 4WKWA 4DVCA 3LORA 4WF4A 2FGXA 2O7KA 1OKDA 4HSCX 3HVSA 5GZZB 13GSA 2WB9A 1EGOA 3A5IA 1CQGA 3QPMA 1TI1A 3F4TA 2L4QA 4OD7A 3BCIA 4X4JA 3ZYWA 3DGQA 2CX4A 4TR0A 3HVVA 4J2FA 5DDLA 4WBJA 1YDKA 3GH6A 1XOBA 3FRCA 3QAWA 2A4HA 5HQPA 2BMXA 3EINA 3D5JA 2JACA 2O87A 2VCXA 2YJ7A 2VL3A 4IVFA 12GSA 4PNGA 2IJYA 3HJPA 4ECBA 5D9TA 4EIPA 2DIYA 2FY6A 3ME7A 3RAZA 2RM6A 1ML6A 5CP1A 2IMDA 4QL9A 4ULXA 4XS6A 3FZ5A 2IIYA 3CSHA 4JZQA 1HNAA 3M0FA 4RQRA 4FIWA 3KM6A 1U3IA 3IDVA 3HXSA 5LD0A 1Z6MA 2BJXA 3RPNA 2L59A 5G1LA 1J9BA 1S3AA 5BMUA 4KF9A 3MWHA 2N5FA 1PFOA 2LRCA 2PERA 1X5EA 2YJHA 4L0UA 4EKZA 2JSZA 4KUNA 3UBKA 2F9SA 5L71A 2E2GA 1TRVA 2O85A 2R5GA 1JLWA 3FZ9A 3GYKA 5EPFA 4JRRA 2GSSA 4MJCA 2WCIA 5D8IA 3PGTA 3FK8A 3G7YA 3F4SA 3ZVJD 3W6GA 3A2VA 1M2BA 1AQWA 1V57A 4EO3A 1Q4JA 4WR4A 5GSTA 4EIQA 1PL1A 1HQOA 2MYGA 2H0GA 1EP8A 4MJBA 4IN0A 3MSZA 3BD2A 5F05A 4OWYA 1NW2A 1GSFA 4KE3A 3H93A 1TRWA 2VD1A 2JL4A 4Q5RA 2VM2A 2ALBA 2VCTA 1M3JA 4Z2RA 4WETA 4ACSA 3TJBA 5DALA 3AY8A 1X9MB 3FYGA 5ECIB 4HU7A 4PQ1A 1VRSD 2GZPA
chains in the Genus database with same CATH topology
5INYA 1C72A 4ZL9A 2EIQA 2FLSA 2WRTA 1I5GA 5DJMA 1U3AA 1XVQA 1DSBA 2YZUA 3IHGA 2IL3A 4EF0A 4FYBA 3GTUB 2B1KA 5HR0A 3HA9A 2YANA 3NIVA 3GUSA 2K18A 3ZMLA 2OE0A 4TR4A 3J7Yk 5E59A 5ECLB 4GSTA 3HZ8A 1PQNA 1TK5B 1XFLA 2K6VA 4MJEA 2F8FA 4V2MA 2V41A 1F3AA 16GSA 4WEYA 3FMWA 4NXIA 4OMVA 2LJRA 5KEJA 3G7JA 2M46A 5DAKA 3APSA 1TK8B 3ZMKA 3UVHA 2DJ0A 2P0GA 1K3OA 5CYYA 2YOIA 2MMZA 1I9DA 4O32A 2I3YA 4EDZA 1R5PA 5A4VA 4K2DA 3LW9A 2R6KA 3GX0A 2F3MA 4LLRA 3GKXA 1T1VA 2VOCA 1TRSA 2AHEA 3EU3A 4HI7A 3PR8A 3NZNA 4YQUA 4MNNA 3MYDA 3DVXA 3LGCA 1T00A 3QDNA 3L9VA 5KN3A 1TU8A 5CNWA 4AJ6A 3MDKA 2DC5A 3BBYA 5DALB 1GTUA 4I2TA 2R0PA 3P90A 1FAAA 5KN0A 1U87A 9GSSA 1B9XC 4ML6A 2HI7A 1DE2A 2X99A 4BVYA 2PBJA 4H86A 2IMEA 1V40A 1KEBA 2QSIA 3L4NA 3DIEA 4A5PA 3N5OA 4F2IA 1BEDA 3G9BA 3GSTA 1FVKA 4D73B 5HFGA 1V98A 1V2AA 2D2ZA 1YEXA 1EEMA 5IOXA 3ZRDA 1SK2A 4MH3A 5IMFA 3LQ7A 4NPBA 2WS2A 3KCMA 2P5RA 1PA3A 2K9FA 2CVDA 4FYUA 5G5EA 1W4VA 2HLSA 1ZMAA 3OR5A 2WFCA 5ID2A 3ISOA 1PKWA 5AN1A 4DSSA 5HR1A 2CV4A 1AC1A 2REMA 4NAXA 2KUCA 5G1KA 1FW1A 1SJIA 3GMFA 4NMUA 5A5KA 1O8XA 2XBIA 2L4CA 3E0UA 5CRDA 4GCIA 2LS5A 1ZYEA 5J9BA 2DLXA 1SYXA 3TKQA 2CX3A 2PMTA 1XXUA 2R37A 5J3RA 1B8XA 2AAWA 1O6JA 4TR3A 1GP1A 5AIVA 3GHAA 1UC7A 2YWNA 1TW9A 2CAQA 3M1GA 1UA5A 2RUFA 2C4JA 1JHBA 4YH2A 3KD0A 2HSYA 4ID0A 3IK9A 4I8BA 4Z2UA 2GGTA 4IS0A 1A8LA 3F3RA 4KH7A 2DKHA 3HY2A 2H1DA 2DJ3A 4G0LA 4K7OA 2ES7A 2R0CA 4KDYA 2CAIA 1QUWA 5A4WA 1BQ7A 5DQYA 1FG4A 3ZL5A 4TXOA 3IC4A 4USSA 3DVWA 2X4AA 5EL8A 4KW6A 1QMVA 3TRQA 1MD4A 3A2WA 2X8CA 3GURA 2AUVA 3BOAA 3RDWA 1OC3A 4NV5A 3ERGA 2OADA 5D96A 2IMIA 3Q18A 4I2UA 2V1MA 4MF5A 2QA1A 1A2JA 3R2QA 6GSXA 1FB6A 2HRKA 3TOUA 5JWOB 2ZCTA 3IK7A 4LL4B 2VLUA 4K0GA 1S3DA 1K0CA 4K9ZA 5C04A 1DE1A 2IMKA 2H01A 4EVMA 2H0HA 1MDJA 1DUGA 1SYRA 3HYPA 5DCHA 3GKKA 5IMDA 4DEJA 5GSSA 4ZXGA 1FOVA 4LL1B 1O7UA 2WJUA 2F51A 4XS4A 1TOFA 1LU4A 3D6IA 5FT3A 2NBSA 1A0FA 3KP8A 4MMMA 2J23A 3F4RA 4EL1A 2RIIA 5F0GA 5JWRB 3KJYA 4K5RA 2ZUPA 1YY7A 2B5EA 2P5QA 4ZL7A 4L5LA 2H1AA 1O73A 2C8UA 4XTSA 1K0OA 6GSYA 3TKPA 2YCDA 4MF6A 2GS3A 2FWGA 5B8BA 5CRWA 1YZXA 1XW6A 2VL2C 4MZCA 1OE7A 3FR3A 4KA0A 5H5QA 1TJDA 4O92A 1ST9A 2I1UA 5AGYA 4PTSA 3F63A 4BA7A 5GAND 2V6KA 1Z9HA 4TKYA 2H6XA 1HNBA 3KTBA 4HZ4A 4QL7A 2C0EA 5ECHB 4TXOB 2YWIA 4MZWA 4N11A 4BWSA 4GSNA 2IPAA 1ZCPA 2H6ZA 4XHMA 4GSSA 4G10A 2C3QA 4GF0A 4RUVA 5CRGA 3ED3A 1PN0A 3P7XA 1GUHA 1GSYA 2YV7A 3KH9A 1O81A 3HKRA 4I97A 5F8BA 4YQMA 2AJQB 3TJFA 1JFUA 2DJKA 4ZILA 2KP1A 3VI7A 3IXRA 4BWQA 5ECKB 4BVXA 2HZEA 2O89A 1U6TA 3F9UA 5LNKe 4TXVA 2X8GA 3GIXA 4E8EA 4G0KA 2H6YA 2M72A 3LSZA 4E8HA 1G6YA 3KXOA 1A8YA 3FKFA 1XWCA 3C8EA 5D9XA 2H66A 1GSDA 3UAPA 2DSAA 1RK4A 3UIWA 1XWAA 3F6FA 3UARA 5HR2A 2YP6A 2E2MA 2J9HA 1UVZA 3EPTA 2LSTA 2VCWA 4ISDA 2GT5A 1GTBA 1A2MA 1NSWA 4WF5A 3L78A 2JZSA 1FHEA 2YWMA 3HVXA 3UVTA 4V2NA 3GX8A 2LRNA 1GWCA 3ZIJA 3BCKA 5J5NA 3IE3A 3SWLA 4AGSA 3C7MA 4ZB9A 5KOXA 5B6NA 1SK0A 2HNLA 5CRHA 2MMNA 2R2JA 1F2EA 3QOUA 1VF2A 3EYTA 2VM1A 3TJGA 3VWXA 3ME8A 4FYCA 4ZB8A 3VPQA 1GULA 4ZL8A 1TK0B 4ECCA 4F0BA 1N2AA 4MF7A 1TU7A 2MBSA 3HD5A 3WD6A 4K8MA 1GSUA 1OE8A 1YKCA 5H5RA 2ZNMA 1ERTA 1FB0A 2LUSA 8GSSA 3VWWA 4X43A 3O3TA 6GSVA 2V32A 2LJAA 2YWOA 4GTUA 2E0QA 3M3MA 4YKGA 5GAPD 5D9VA 3Q19A 4HDEA 1GLQA 1EGRA 1TP9A 5EVOA 4FO5A 2OBKA 3ZLPA 4F03A 1EEJA 1ERVA 3FHKA 3ZREA 1PD21 4ZB6A 1S3CA 1WRYA 2V2GA 2LQOA 1YKAA 4K7IA 5ECNB 6GSUA 3IBHA 4ICYA 3GNJA 2HZEB 3UJ1A 3WT1A 4Q5FA 2NPBA 3EURA 6GSSA 1O85A 3I9V2 3CSJA 4G9HA 2QA2A 4OO4A 3N9JA 4TOPA 1K3YA 4IP1A 4PQIA 1T8EB 5LCZA 3DWVA 3ZZXA 1IYIA 5IMAA 2VLVA 5AIXA 1GUKA 2K8SA 1SL0B 1X5CA 4XS1A 4POMA 1WIKA 3QMXA 1NM3A 1H4OA 1SKRB 2E7PA 4LA1A 3PPUA 2H19A 5C00A 1G7OA 2A2RA 3QCPA 3D21A 5HFKA 1MDIA 3LFLA 1XBSA 1MD3A 4K5SA 3U5RE 2KHPA 2L6CA 4PURA 4F0CA 1PMTA 3J7Yb 1ERWA 5JCUA 1XWGA 3GKNA 2X8HA 3UOMA 1IYHA 3TOTA 2VIMA 4EXJA 2CQ9A 1XZOA 3IPZA 3KIJA 3FR6A 3KMNA 1MEKA 2VUPA 2HSHA 1JLVA 2R0GA 4TR1A 1UN2A 5DVBA 4JU5A 4Q5QA 1M2AA 2GZYA 3CMIA 3D4TA 1AQVA 3KGKA 2DJJA 2N5AA 1K3LA 3GSSA 1A0RP 3ERWA 2H70A 1TKDB 4IP6A 1F3BA 2JZTA 3TB2A 2IFQA 3CRTA 4V1Ag 5ECQB 3WGEA 3HCZA 3QD9A 3ERFA 3GN3A 3C73A 5ELAA 2H1GA 2PPTA 3H4KA 2CZ2A 2GQLA 3IRAA 2GTUA 2DBCA 1M0UA 3EC3A 1XPVA 1FVJA 4KCEA 2WGRA 2KP2A 5DQSA 2H30A 4MCUA 3FW2A 2B5YA 1YQ1A 3H79A 1XIYA 3WGDA 3ZIVA 4V2LA 2PUKC 1GUMA 1B48A 4RQXA 2H0IA 2RUEA 3Q6OA 4JEDA 2QGVA 4MZBA 3GRXA 2CVKA 2H74A 3O6TA 1OC9A 4KDUA 3CSIA 5DAKB 1OC8A 2LNSA 4MP4A 1GSEA 1X5DA 1R26A 2XHFA 4N10A 1WJKA 3EMXA 1PKZA 3EU4A 4K0NA 4Q5NA 3GL3A 2I9HA 4ZBBA 1T4YA 2QC7A 1WOUA 2HSMA 1M9AA 3VFIA 2FWEA 4NHWA 2DMLA 4MA9A 2VD0A 3VK9A 4K2XA 1SKWB 2C0DA 1XWKA 4ILFA 7GSSA 3LJRA 5IO2A 2FCHA 4F9ZA 3C1SA 4MLYA 3IR4A 3H8QA 2L6DA 4K7NA 4IGJA 1ZL9A 1A24A 3IHQA 5JCWA 14GSA 5FWGA 4L8EA 5ECRB 4J56E 3HDCA 1THXA 2WULA 1W89A 4PUAA 3EVIA 1T4ZA 3ZVJA 5IMCA 4BVYB 3MAKA 4G0IA 2HFDA 3I6AA 3F8UA 1KBNA 1SD9A 2NTOA 1YJ6A 3M9JA 2GSQA 1XW5A 1BAYA 1YEPA 4MJAA 2B1LA 1ERUA 2VCZA 3L9SA 1GSQA 1SK1A 3RHBA 1GNEA 1V58A 4HQSA 3CXGA 3TJJA 2R3XA 2I81A 2LRTA 5KOWA 1Z7PA 2IWTA 5IO0A 3VWVA 3KZQA 4HQZA 5IOWA 3HJOA 2C3TA 4IELA 1PX6A 4KNDA 1G6WA 1VF4A 4FH8A 1B9YC 5CREA 4YAVA 3HZ4A 3GV1A 5ID2B 3UBLA 4DSSB 1Z7RA 3A2XA 4OFNA 4N30A 1OC9B 1O8WA 1BX9A 2TRXA 2XPEA 3KEBA 3IV4A 4YAPA 1GNWA 2ON5A 5DCGA 2B7KA 1DBYA 1KTEA 2CZ3A 4G2EA 1MTCA 2JU5A 4J57E 1LJRA 4ECIA 2I4AA 4ZBDA 2LKUA 1TDIA 5IM9A 1R5AA 4CY8A 2XC2A 3KTLA 4IJ3A 1AIUA 1JZDA 2PWJA 6GSWA 2GZZA 4N0VA 3L0HA 1G7EA 1GSSA 3TKRA 1TTZA 1F9MA 1J0FA 5JCGA 4TN8A 3F3QA 1USBA 1EV9A 1Z3EA 4HEA2 4DSRA 3W8JA 4GLTA 2PVOC 3CYNA 1QQ2A 3EMPA 5J4UA 4CY6A 3TUEA 4HZ2A 2IN3A 2H1BA 3CBUA 2FHEA 1G0TA 1SU9A 3HJMA 2AB6A 2FWHA 1BG5A 2NDOA 1YF0A 2VO4A 4NV2A 1XVWA 4BPYA 1WWJA 3G7IA 4K1FA 1K0MA 4PGTA 2OACA 2X64A 2DIZA 4AJ7A 2FA8A 2H73A 2GSTA 4G19A 3CTGA 3GH9A 4POLA 1T3BA 3TRPA 1ZZYA 4I5QA 3VPTA 10GSA 4OCFA 1ABAA 3I69A 3APQA 2FD3A 2GLRA 3TDGA 1TI3A 5H5SA 5HR3A 1JZOA 1PN9A 5IQYA 3ZITA 3PH9A 3HHVA 4AF2A 3QR6A 2PGTA 5CO3A 3D22A 3FEUA 2K8VA 1K0AA 1PX7A 1QFNA 3WGXA 4MPGA 4XS4B 5CAXA 2C80A 4HJMA 2DJ1A 4XCSA 2LNTA 3W8SA 3V1WA 3LYPA 5G2ZA 2FNOA 1SJZA 2OA7A 1TRUA 3FZ4A 3LXZA 4OO5A 5AISA 3A3TA 3GTUA 2H72A 4K6XA 4IQAA 2A4VA 3SBCA 2C3NA 1GL8A 4KDXA 2V6OA 3ZFBA 4X1UA 1EOHA 2FA4A 4TVEA 2OBIA 3EWLA 1F6MC 2L57A 1XWBA 3QAVA 2YZHA 2YN1A 4IJIA 19GSA 3IAM2 2FWFA 4RI7A 4POKA 2M80A 2HRAA 3QAGA 3S9FA 2CVBA 2GQMA 4KGIA 2CA8A 2TIRA 3QFAC 3TKSE 1V9WA 5G30A 2LV3A 4GQFA 2VL2A 2MMAA 1ACVA 5B7CA 4QQ7A 3VI5A 4EUYA 2GDRA 2MBTA 3RPPA 1JZRA 1F37A 2EIRA 3TJKA 5D93A 1AUCA 1WPIA 1E2YA 3A5WA 2B3SA 5B8AA 2FUG2 4PQHA 4OFTA 1OVNA 2H71A 1U88A 4L0WA 2A2PA 3JCML 1T7PB 2CT6A 5KN2A 3IA1A 2HE3A 1FO5A 3FZAA 4IKHA 5J9CA 5G5FA 4BVXB 3PINA 4GWRA 2L5OA 5F06A 2C1YA 3DYRA 4V1Ap 18GSA 1M2DA 4CDOA 2H75A 5ECSA 2JZRA 5FHIA 4GRFA 4CW9A 2PU9C 3TGZA 1M9BA 3LXTA 3O76A 2DMMA 1GTAA 20GSA 1QXHA 1EZKA 1RW1A 1ZOFA 5DBQA 4YQVA 4D73A 2LJKA 1NHOA 1AAZA 3U6VA 4O5UA 2VLTA 5ECPB 3CRUA 2PVQA 2VL9A 2LEGA 4PNFA 1AXDA 4GXZA 2HZFA 2B6MA 4DSQA 3WT2A 3UL3A 5BRTA 4P3YB 2WZ9A 4KAEA 5J41A 5D73A 22GSA 3K8NA 4POBA 4X0XA 1EOGA 4HU9A 4KX4A 2HT9A 3GKMA 4KSMA 1Q98A 5G31A 2C0GA 3DRNA 2VAFA 2O8VB 1TXXA 2LTKA 1AW9A 1M7TA 4EDYA 5IMVA 1R7HA 5D9WA 4KCAA 3M9KA 3I43A 3TRXA 1VGLA 1X9WB 4XRDA 5ENUA 5IIZA 3FR9A 4GQCA 4MDCA 5COHA 1M99A 1K0BA 2GVPA 3KMOA 4IBPA 2G2QA 4O5RA 1OKTA 3US3A 2QKEA 4PXOA 1XW9A 5JWQB 5HFIA 17GSA 1ZYQB 5E4WA 4TRXA 2WDUA 3CTFA 1LBKA 3FY7A 3KH7A 3UMAA 4LMVA 3IC8A 3KP9A 3LWAA 4WXTA 1PRXA 4JR6A 2AYTA 2OKAA 1FOHA 2XPDA 2MZCA 1VF3A 1QK8A 4WR5A 1EWXA 3RBTA 3UEMA 4XRAA 3VLNA 3E9JB 1Z5YE 2OE3A 1Y6EA 2X49A 2YNXA 3LYKA 3F6DA 5F07A 3TKSC 1B4PA 4OCEA 3IAS2 4O5QA 4I6XA 4TW5A 1H75A 4HUAA 3LEFA 3C71A 3QFBC 2EIOA 5KN1A 1B4QA 2VCQA 3M8NA 4HJ2A 1EP7A 4ZBAA 4EC0A 4JR4A 4IW9A 3DXBA 2F8AA 2Z9SA 1PL2A 1GTIA 2EC4A 2HRNA 2GQKA 1J08A 2H76A 4PUFC 1K0DA 1CQHA 3Q74A 4WBRD 3VWUA 4HS1A 1EV4A 4TR1B 3WYWA 3ZTLA 4HOJA 1K0NA 4IHUA 3EE2A 1A23A 1HYUA 1X0RA 2KOKA 1E6BA 2IFQB 4PX1A 5ECMB 1GH2A 5ELGA 1NHYA 2AV4A 3GA4A 3P8WA 1X9SB 4JE1A 4BL7A 5ABRA 1BJXA 4Z7XA 1A2LA 1GRXA 5IPHA 1YF1A 4ZIJA 5IPGA 3MIXA 2GT6A 4Z2TA 2RM5A 5B6MA 2UZ8A 1HNCA 1XCCA 3RHCA 4JBBA 3NOFA 1Y25A 1VF1A 1GLPA 2VCVA 2YPMA 3L9UA 1KNGA 2JADA 3GL5A 3C1RA 2N5BA 1JZWA 2MMOA 3DMLA 4RI6A 1WP0A 1R4WA 3F0IA 1SENA 3P2AA 1MDKA 4ECJA 2HXKA 1RQMA 3APOA 2H8LA 2L5LA 3BJ5A 3D4MA 4MABA 2P31A 4XIHA 2BTOT 1THOA 2C0FA 4CHSA 1XOAA 2TRCP 1PSQA 1WMJA 2DJ2A 4EE0A 1SL1B 1ON4A 4O7HA 1OYJA 4NHZA 1WE0A 1ZGNA 2GSRA 3MNGA 3R3EA 2G0FA 3IOSA 4MPFA 3TKSA 4MH2A 1ZYPA 3H1NA 1HD2A 5ECOB 2LQQA 1SD8A 1SKSB 3DD3A 5A4UA 4LMWA 3VURA 2YV9A 2OE1A 3GFKA 4YKFA 3DKSA 2IMFA 5IMZA 6GSTA 5EY6A 1BYEA 2B5XA 1SL2B 2A2SA 5DJLA 2HRFA 1OAZA 4MK3A 3ZFLA 2KLXA 3LG6A 2B7JA 4NWYA 1ILOA 4KB3A 2ON7A 1ZYNA 1Z6NA 4OFMA 2RLIA 4IQ1A 2DKIA 4N0ZA 2HYXA 4KSOA 4ML1A 4BL7B 4F82A 2PN8A 3TCOA 1URMA 4L5OA 1PGTA 4FQUA 3DEXA 11GSA 3D0ZA 1QGVA 1SJ6A 2OJLA 2NVLA 4AJ8A 2JSYA 2R4VA 1N8JA 3E3EA 2XBQA 1AQXA 4WKWA 4DVCA 3LORA 4WF4A 2FGXA 2O7KA 1OKDA 3HVSA 5GZZB 13GSA 2WB9A 1EGOA 3A5IA 1CQGA 3QPMA 1TI1A 3F4TA 2L4QA 4OD7A 3BCIA 4X4JA 3ZYWA 3DGQA 2CX4A 4TR0A 3HVVA 4J2FA 5DDLA 4WBJA 1YDKA 3GH6A 1XOBA 3FRCA 3QAWA 2A4HA 5HQPA 2BMXA 3EINA 3D5JA 2JACA 2O87A 2VCXA 2YJ7A 2VL3A 4IVFA 12GSA 4PNGA 2IJYA 3HJPA 4ECBA 5D9TA 4EIPA 2DIYA 2FY6A 3ME7A 3RAZA 2RM6A 1ML6A 5CP1A 2IMDA 4QL9A 4ULXA 4XS6A 3FZ5A 2IIYA 3CSHA 4JZQA 1HNAA 3M0FA 4RQRA 4FIWA 3KM6A 1U3IA 3IDVA 3HXSA 5LD0A 1Z6MA 2BJXA 3RPNA 2L59A 5G1LA 1J9BA 1S3AA 5BMUA 4KF9A 3MWHA 2N5FA 2LRCA 2PERA 1X5EA 2YJHA 4L0UA 4EKZA 2JSZA 4KUNA 3UBKA 2F9SA 5L71A 2E2GA 1TRVA 2O85A 2R5GA 1JLWA 3FZ9A 3GYKA 5EPFA 4JRRA 2GSSA 4MJCA 2WCIA 5D8IA 3PGTA 3FK8A 3G7YA 3F4SA 3ZVJD 3W6GA 3A2VA 1M2BA 1AQWA 1V57A 4EO3A 1Q4JA 4WR4A 5GSTA 4EIQA 1PL1A 1HQOA 2MYGA 2H0GA 1EP8A 4MJBA 4IN0A 3MSZA 3BD2A 5F05A 4OWYA 1NW2A 1GSFA 4KE3A 3H93A 1TRWA 2VD1A 2JL4A 4Q5RA 2VM2A 2ALBA 2VCTA 4Z2RA 4WETA 4ACSA 3TJBA 5DALA 3AY8A 1X9MB 3FYGA 5ECIB 4HU7A 4PQ1A 1VRSD 2GZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5INY A;  1C72 A;  4ZL9 A;  2EIQ A;  2FLS A;  2WRT A;  1I5G A;  5DJM A;  1U3A A;  1XVQ A;  1DSB A;  2YZU A;  2IL3 A;  4EF0 A;  4FYB A;  3GTU B;  2B1K A;  5HR0 A;  3HA9 A;  2YAN A;  3NIV A;  3GUS A;  2K18 A;  3ZML A;  2OE0 A;  4TR4 A;  3J7Y k;  5E59 A;  5ECL B;  4GST A;  3HZ8 A;  1PQN A;  1TK5 B;  1XFL A;  2K6V A;  4MJE A;  2F8F A;  4V2M A;  2V41 A;  1F3A A;  16GS A;  4WEY A;  4NXI A;  4OMV A;  2LJR A;  5KEJ A;  3G7J A;  2M46 A;  5DAK A;  3APS A;  1TK8 B;  3ZMK A;  3UVH A;  2DJ0 A;  2P0G A;  1K3O A;  5CYY A;  2YOI A;  2MMZ A;  1I9D A;  4O32 A;  2I3Y A;  4EDZ A;  1R5P A;  5A4V A;  4K2D A;  2R6K A;  3GX0 A;  2F3M A;  4LLR A;  3GKX A;  1T1V A;  2VOC A;  1TRS A;  2AHE A;  3EU3 A;  4HI7 A;  3PR8 A;  3NZN A;  4YQU A;  3DVX A;  3LGC A;  1T00 A;  3QDN A;  3L9V A;  5KN3 A;  1TU8 A;  5CNW A;  4AJ6 A;  3MDK A;  2DC5 A;  3BBY A;  5DAL B;  1GTU A;  4I2T A;  3P90 A;  1FAA A;  5KN0 A;  1U87 A;  9GSS A;  1B9X C;  4ML6 A;  2HI7 A;  1DE2 A;  2X99 A;  4BVY A;  2PBJ A;  4H86 A;  2IME A;  1V40 A;  1KEB A;  2QSI A;  3L4N A;  3DIE A;  3N5O A;  4F2I A;  1BED A;  3G9B A;  3GST A;  1FVK A;  4D73 B;  5HFG A;  1V98 A;  1V2A A;  2D2Z A;  1YEX A;  1EEM A;  5IOX A;  3ZRD A;  1SK2 A;  4MH3 A;  5IMF A;  3LQ7 A;  4NPB A;  2WS2 A;  3KCM A;  2P5R A;  1PA3 A;  2K9F A;  2CVD A;  4FYU A;  5G5E A;  1W4V A;  2HLS A;  1ZMA A;  3OR5 A;  2WFC A;  5ID2 A;  3ISO A;  1PKW A;  5AN1 A;  4DSS A;  5HR1 A;  2CV4 A;  1AC1 A;  2REM A;  4NAX A;  2KUC A;  5G1K A;  1FW1 A;  1SJI A;  3GMF A;  4NMU A;  5A5K A;  1O8X A;  2XBI A;  2L4C A;  3E0U A;  5CRD A;  4GCI A;  2LS5 A;  1ZYE A;  5J9B A;  2DLX A;  1SYX A;  3TKQ A;  2CX3 A;  2PMT A;  1XXU A;  2R37 A;  5J3R A;  1B8X A;  2AAW A;  1O6J A;  4TR3 A;  1GP1 A;  5AIV A;  3GHA A;  1UC7 A;  2YWN A;  1TW9 A;  2CAQ A;  3M1G A;  1UA5 A;  2RUF A;  2C4J A;  1JHB A;  4YH2 A;  3KD0 A;  2HSY A;  4ID0 A;  3IK9 A;  4I8B A;  2GGT A;  4IS0 A;  1A8L A;  3F3R A;  4KH7 A;  3HY2 A;  2H1D A;  2DJ3 A;  4K7O A;  2ES7 A;  4KDY A;  2CAI A;  1QUW A;  5A4W A;  1BQ7 A;  5DQY A;  1FG4 A;  3ZL5 A;  4TXO A;  3IC4 A;  3DVW A;  5EL8 A;  4KW6 A;  1QMV A;  3TRQ A;  1MD4 A;  3A2W A;  2X8C A;  3GUR A;  2AUV A;  3BOA A;  3RDW A;  1OC3 A;  4NV5 A;  3ERG A;  2OAD A;  5D96 A;  2IMI A;  3Q18 A;  4I2U A;  2V1M A;  4MF5 A;  1A2J A;  3R2Q A;  6GSX A;  1FB6 A;  3TOU A;  5JWO B;  2ZCT A;  3IK7 A;  4LL4 B;  2VLU A;  4K0G A;  1S3D A;  1K0C A;  4K9Z A;  5C04 A;  1DE1 A;  2IMK A;  2H01 A;  4EVM A;  2H0H A;  1MDJ A;  1DUG A;  1SYR A;  3HYP A;  5DCH A;  3GKK A;  5IMD A;  4DEJ A;  5GSS A;  4ZXG A;  1FOV A;  4LL1 B;  1O7U A;  2WJU A;  2F51 A;  4XS4 A;  1TOF A;  1LU4 A;  3D6I A;  5FT3 A;  2NBS A;  1A0F A;  3KP8 A;  4MMM A;  2J23 A;  3F4R A;  4EL1 A;  2RII A;  5F0G A;  5JWR B;  3KJY A;  2ZUP A;  1YY7 A;  2B5E A;  2P5Q A;  4ZL7 A;  4L5L A;  2H1A A;  1O73 A;  2C8U A;  4XTS A;  1K0O A;  6GSY A;  3TKP A;  2YCD A;  4MF6 A;  2GS3 A;  2FWG A;  5B8B A;  5CRW A;  1YZX A;  1XW6 A;  2VL2 C;  4MZC A;  1OE7 A;  3FR3 A;  4KA0 A;  5H5Q A;  1TJD A;  4O92 A;  1ST9 A;  2I1U A;  5AGY A;  3F63 A;  4BA7 A;  5GAN D;  2V6K A;  1Z9H A;  4TKY A;  2H6X A;  1HNB A;  3KTB A;  4HZ4 A;  4QL7 A;  2C0E A;  5ECH B;  4TXO B;  2YWI A;  4MZW A;  4N11 A;  4BWS A;  4GSN A;  2IPA A;  1ZCP A;  2H6Z A;  4XHM A;  4GSS A;  4G10 A;  2C3Q A;  4GF0 A;  4RUV A;  5CRG A;  3ED3 A;  3P7X A;  1GUH A;  1GSY A;  2YV7 A;  3KH9 A;  1O81 A;  3HKR A;  4I97 A;  5F8B A;  4YQM A;  2AJQ B;  3TJF A;  1JFU A;  2DJK A;  4ZIL A;  2KP1 A;  3VI7 A;  3IXR A;  4BWQ A;  5ECK B;  4BVX A;  2HZE A;  2O89 A;  1U6T A;  3F9U A;  5LNK e;  4TXV A;  2X8G A;  3GIX A;  4E8E A;  2H6Y A;  2M72 A;  3LSZ A;  4E8H A;  1G6Y A;  3KXO A;  1A8Y A;  3FKF A;  1XWC A;  3C8E A;  5D9X A;  2H66 A;  1GSD A;  3UAP A;  2DSA A;  1RK4 A;  3UIW A;  1XWA A;  3F6F A;  3UAR A;  5HR2 A;  2YP6 A;  2E2M A;  2J9H A;  1UVZ A;  2LST A;  2VCW A;  4ISD A;  2GT5 A;  1GTB A;  1A2M A;  1NSW A;  4WF5 A;  3L78 A;  2JZS A;  1FHE A;  2YWM A;  3HVX A;  3UVT A;  4V2N A;  3GX8 A;  2LRN A;  1GWC A;  3ZIJ A;  3BCK A;  5J5N A;  3IE3 A;  3SWL A;  4AGS A;  3C7M A;  4ZB9 A;  5B6N A;  1SK0 A;  2HNL A;  5CRH A;  2MMN A;  2R2J A;  1F2E A;  3QOU A;  1VF2 A;  3EYT A;  2VM1 A;  3TJG A;  3VWX A;  3ME8 A;  4FYC A;  4ZB8 A;  3VPQ A;  1GUL A;  4ZL8 A;  1TK0 B;  4ECC A;  4F0B A;  1N2A A;  4MF7 A;  1TU7 A;  2MBS A;  3HD5 A;  3WD6 A;  4K8M A;  1GSU A;  1OE8 A;  1YKC A;  5H5R A;  2ZNM A;  1ERT A;  1FB0 A;  2LUS A;  8GSS A;  3VWW A;  4X43 A;  3O3T A;  6GSV A;  2V32 A;  2LJA A;  2YWO A;  4GTU A;  2E0Q A;  3M3M A;  5GAP D;  5D9V A;  3Q19 A;  4HDE A;  1GLQ A;  1EGR A;  1TP9 A;  5EVO A;  4FO5 A;  2OBK A;  3ZLP A;  4F03 A;  1EEJ A;  1ERV A;  3FHK A;  3ZRE A;  1PD2 1;  4ZB6 A;  1S3C A;  1WRY A;  2V2G A;  2LQO A;  1YKA A;  4K7I A;  5ECN B;  6GSU A;  3IBH A;  3GNJ A;  2HZE B;  3UJ1 A;  3WT1 A;  4Q5F A;  2NPB A;  3EUR A;  6GSS A;  1O85 A;  3I9V 2;  3CSJ A;  4G9H A;  4OO4 A;  3N9J A;  4TOP A;  1K3Y A;  4IP1 A;  4PQI A;  1T8E B;  5LCZ A;  3DWV A;  3ZZX A;  1IYI A;  5IMA A;  2VLV A;  5AIX A;  1GUK A;  2K8S A;  1SL0 B;  1X5C A;  4XS1 A;  4POM A;  1WIK A;  3QMX A;  1NM3 A;  1H4O A;  1SKR B;  2E7P A;  4LA1 A;  2H19 A;  5C00 A;  1G7O A;  2A2R A;  3QCP A;  3D21 A;  5HFK A;  1MDI A;  3LFL A;  1XBS A;  1MD3 A;  3U5R E;  2KHP A;  2L6C A;  4PUR A;  4F0C A;  1PMT A;  3J7Y b;  1ERW A;  5JCU A;  1XWG A;  3GKN A;  2X8H A;  3UOM A;  1IYH A;  3TOT A;  2VIM A;  4EXJ A;  2CQ9 A;  1XZO A;  3IPZ A;  3KIJ A;  3FR6 A;  3KMN A;  1MEK A;  2VUP A;  2HSH A;  1JLV A;  4TR1 A;  1UN2 A;  5DVB A;  4JU5 A;  4Q5Q A;  1M2A A;  2GZY A;  3CMI A;  3D4T A;  1AQV A;  3KGK A;  2DJJ A;  2N5A A;  1K3L A;  3GSS A;  1A0R P;  3ERW A;  2H70 A;  1TKD B;  4IP6 A;  1F3B A;  2JZT A;  3TB2 A;  2IFQ A;  3CRT A;  4V1A g;  5ECQ B;  3WGE A;  3HCZ A;  3QD9 A;  3ERF A;  3GN3 A;  3C73 A;  5ELA A;  2H1G A;  2PPT A;  3H4K A;  2CZ2 A;  2GQL A;  3IRA A;  2GTU A;  2DBC A;  1M0U A;  3EC3 A;  1XPV A;  1FVJ A;  4KCE A;  2WGR A;  2KP2 A;  5DQS A;  2H30 A;  4MCU A;  3FW2 A;  2B5Y A;  1YQ1 A;  3H79 A;  1XIY A;  3WGD A;  3ZIV A;  4V2L A;  2PUK C;  1GUM A;  1B48 A;  4RQX A;  2H0I A;  2RUE A;  3Q6O A;  4JED A;  2QGV A;  4MZB A;  3GRX A;  2CVK A;  2H74 A;  3O6T A;  1OC9 A;  4KDU A;  3CSI A;  5DAK B;  1OC8 A;  2LNS A;  4MP4 A;  1GSE A;  1X5D A;  1R26 A;  2XHF A;  4N10 A;  1WJK A;  3EMX A;  1PKZ A;  3EU4 A;  4K0N A;  4Q5N A;  3GL3 A;  2I9H A;  4ZBB A;  1T4Y A;  2QC7 A;  1WOU A;  1M9A A;  3VFI A;  2FWE A;  4NHW A;  2DML A;  4MA9 A;  2VD0 A;  3VK9 A;  1SKW B;  2C0D A;  1XWK A;  4ILF A;  7GSS A;  3LJR A;  5IO2 A;  2FCH A;  4F9Z A;  3C1S A;  4MLY A;  3IR4 A;  3H8Q A;  2L6D A;  4K7N A;  4IGJ A;  1ZL9 A;  1A24 A;  3IHQ A;  5JCW A;  14GS A;  5FWG A;  4L8E A;  5ECR B;  4J56 E;  3HDC A;  1THX A;  2WUL A;  1W89 A;  4PUA A;  3EVI A;  1T4Z A;  3ZVJ A;  5IMC A;  3MAK A;  2HFD A;  3I6A A;  3F8U A;  1KBN A;  1SD9 A;  2NTO A;  1YJ6 A;  3M9J A;  2GSQ A;  1XW5 A;  1BAY A;  1YEP A;  4MJA A;  2B1L A;  1ERU A;  2VCZ A;  3L9S A;  1GSQ A;  1SK1 A;  3RHB A;  1GNE A;  1V58 A;  4HQS A;  3CXG A;  3TJJ A;  2R3X A;  2I81 A;  2LRT A;  1Z7P A;  2IWT A;  5IO0 A;  3VWV A;  3KZQ A;  4HQZ A;  5IOW A;  3HJO A;  2C3T A;  4IEL A;  1PX6 A;  4KND A;  1G6W A;  1VF4 A;  4FH8 A;  1B9Y C;  5CRE A;  4YAV A;  3HZ4 A;  3GV1 A;  5ID2 B;  3UBL A;  4DSS B;  1Z7R A;  3A2X A;  4OFN A;  4N30 A;  1OC9 B;  1O8W A;  1BX9 A;  2TRX A;  2XPE A;  3KEB A;  3IV4 A;  4YAP A;  1GNW A;  2ON5 A;  5DCG A;  2B7K A;  1DBY A;  1KTE A;  2CZ3 A;  4G2E A;  1MTC A;  2JU5 A;  4J57 E;  1LJR A;  4ECI A;  2I4A A;  4ZBD A;  2LKU A;  1TDI A;  5IM9 A;  1R5A A;  2XC2 A;  3KTL A;  4IJ3 A;  1AIU A;  1JZD A;  2PWJ A;  6GSW A;  2GZZ A;  4N0V A;  3L0H A;  1G7E A;  1GSS A;  3TKR A;  1TTZ A;  1F9M A;  1J0F A;  5JCG A;  4TN8 A;  3F3Q A;  1USB A;  1EV9 A;  1Z3E A;  4HEA 2;  4DSR A;  3W8J A;  4GLT A;  2PVO C;  3CYN A;  1QQ2 A;  3EMP A;  5J4U A;  3TUE A;  4HZ2 A;  2IN3 A;  2H1B A;  3CBU A;  2FHE A;  1G0T A;  1SU9 A;  3HJM A;  2AB6 A;  2FWH A;  1BG5 A;  2NDO A;  1YF0 A;  2VO4 A;  4NV2 A;  1XVW A;  4BPY A;  1WWJ A;  3G7I A;  4K1F A;  1K0M A;  4PGT A;  2OAC A;  2X64 A;  2DIZ A;  4AJ7 A;  2FA8 A;  2H73 A;  2GST A;  4G19 A;  3CTG A;  3GH9 A;  4POL A;  1T3B A;  3TRP A;  1ZZY A;  4I5Q A;  3VPT A;  10GS A;  4OCF A;  1ABA A;  3I69 A;  3APQ A;  2FD3 A;  2GLR A;  3TDG A;  1TI3 A;  5H5S A;  5HR3 A;  1JZO A;  1PN9 A;  5IQY A;  3ZIT A;  3PH9 A;  3HHV A;  4AF2 A;  3QR6 A;  2PGT A;  5CO3 A;  3D22 A;  3FEU A;  2K8V A;  1K0A A;  1PX7 A;  1QFN A;  3WGX A;  4MPG A;  4XS4 B;  5CAX A;  2C80 A;  4HJM A;  2DJ1 A;  4XCS A;  2LNT A;  3W8S A;  3V1W A;  3LYP A;  5G2Z A;  2FNO A;  1SJZ A;  2OA7 A;  1TRU A;  3FZ4 A;  3LXZ A;  4OO5 A;  5AIS A;  3A3T A;  3GTU A;  2H72 A;  4K6X A;  4IQA A;  2A4V A;  3SBC A;  2C3N A;  1GL8 A;  4KDX A;  2V6O A;  3ZFB A;  4X1U A;  1EOH A;  2FA4 A;  4TVE A;  2OBI A;  3EWL A;  1F6M C;  2L57 A;  1XWB A;  3QAV A;  2YZH A;  2YN1 A;  4IJI A;  19GS A;  3IAM 2;  2FWF A;  4RI7 A;  4POK A;  2M80 A;  3QAG A;  3S9F A;  2CVB A;  2GQM A;  4KGI A;  2CA8 A;  2TIR A;  3QFA C;  3TKS E;  1V9W A;  5G30 A;  2LV3 A;  4GQF A;  2VL2 A;  2MMA A;  1ACV A;  5B7C A;  4QQ7 A;  3VI5 A;  4EUY A;  2GDR A;  2MBT A;  3RPP A;  1JZR A;  1F37 A;  2EIR A;  3TJK A;  5D93 A;  1AUC A;  1WPI A;  1E2Y A;  3A5W A;  2B3S A;  5B8A A;  2FUG 2;  4PQH A;  4OFT A;  1OVN A;  2H71 A;  1U88 A;  4L0W A;  3JCM L;  1T7P B;  2CT6 A;  5KN2 A;  3IA1 A;  2HE3 A;  1FO5 A;  3FZA A;  4IKH A;  5J9C A;  5G5F A;  3PIN A;  4GWR A;  2L5O A;  5F06 A;  2C1Y A;  3DYR A;  4V1A p;  18GS A;  1M2D A;  4CDO A;  2H75 A;  5ECS A;  2JZR A;  5FHI A;  4GRF A;  4CW9 A;  2PU9 C;  3TGZ A;  1M9B A;  3LXT A;  3O76 A;  2DMM A;  1GTA A;  20GS A;  1QXH A;  1EZK A;  1RW1 A;  1ZOF A;  5DBQ A;  4YQV A;  4D73 A;  2LJK A;  1NHO A;  1AAZ A;  3U6V A;  2VLT A;  5ECP B;  3CRU A;  2PVQ A;  2VL9 A;  2LEG A;  4PNF A;  1AXD A;  4GXZ A;  2HZF A;  2B6M A;  4DSQ A;  3WT2 A;  3UL3 A;  4P3Y B;  2WZ9 A;  4KAE A;  5J41 A;  5D73 A;  22GS A;  3K8N A;  4POB A;  4X0X A;  1EOG A;  4HU9 A;  4KX4 A;  2HT9 A;  3GKM A;  4KSM A;  1Q98 A;  5G31 A;  2C0G A;  3DRN A;  2VAF A;  2O8V B;  1TXX A;  2LTK A;  1AW9 A;  1M7T A;  4EDY A;  5IMV A;  1R7H A;  5D9W A;  4KCA A;  3M9K A;  3I43 A;  3TRX A;  1VGL A;  1X9W B;  4XRD A;  5ENU A;  5IIZ A;  3FR9 A;  4GQC A;  4MDC A;  5COH A;  1M99 A;  1K0B A;  2GVP A;  3KMO A;  4IBP A;  2G2Q A;  4O5R A;  1OKT A;  3US3 A;  2QKE A;  4PXO A;  1XW9 A;  5JWQ B;  5HFI A;  17GS A;  1ZYQ B;  5E4W A;  4TRX A;  2WDU A;  3CTF A;  1LBK A;  3FY7 A;  3KH7 A;  3UMA A;  4LMV A;  3KP9 A;  3LWA A;  4WXT A;  1PRX A;  4JR6 A;  2AYT A;  2OKA A;  2XPD A;  2MZC A;  1VF3 A;  1QK8 A;  4WR5 A;  1EWX A;  3RBT A;  3UEM A;  4XRA A;  3VLN A;  3E9J B;  1Z5Y E;  2OE3 A;  1Y6E A;  2YNX A;  3LYK A;  3F6D A;  5F07 A;  3TKS C;  1B4P A;  4OCE A;  3IAS 2;  4I6X A;  4TW5 A;  1H75 A;  4HUA A;  3LEF A;  3C71 A;  3QFB C;  2EIO A;  5KN1 A;  1B4Q A;  2VCQ A;  3M8N A;  4HJ2 A;  1EP7 A;  4ZBA A;  4EC0 A;  4JR4 A;  4IW9 A;  3DXB A;  2F8A A;  2Z9S A;  1PL2 A;  1GTI A;  2EC4 A;  2HRN A;  2GQK A;  1J08 A;  2H76 A;  4PUF C;  1K0D A;  1CQH A;  3Q74 A;  4WBR D;  3VWU A;  4HS1 A;  1EV4 A;  4TR1 B;  3WYW A;  3ZTL A;  4HOJ A;  1K0N A;  4IHU A;  3EE2 A;  1A23 A;  1HYU A;  1X0R A;  2KOK A;  1E6B A;  2IFQ B;  4PX1 A;  5ECM B;  1GH2 A;  5ELG A;  1NHY A;  2AV4 A;  3GA4 A;  3P8W A;  1X9S B;  4JE1 A;  4BL7 A;  5ABR A;  1BJX A;  4Z7X A;  1A2L A;  1GRX A;  5IPH A;  1YF1 A;  4ZIJ A;  5IPG A;  2GT6 A;  2RM5 A;  5B6M A;  1HNC A;  1XCC A;  3RHC A;  4JBB A;  3NOF A;  1Y25 A;  1VF1 A;  1GLP A;  2VCV A;  2YPM A;  3L9U A;  1KNG A;  2JAD A;  3GL5 A;  3C1R A;  2N5B A;  1JZW A;  2MMO A;  3DML A;  4RI6 A;  1WP0 A;  1R4W A;  3F0I A;  1SEN A;  3P2A A;  1MDK A;  4ECJ A;  2HXK A;  1RQM A;  3APO A;  2H8L A;  2L5L A;  3BJ5 A;  3D4M A;  4MAB A;  2P31 A;  4XIH A;  2BTO T;  1THO A;  2C0F A;  4CHS A;  1XOA A;  2TRC P;  1PSQ A;  1WMJ A;  2DJ2 A;  4EE0 A;  1SL1 B;  1ON4 A;  4O7H A;  1OYJ A;  4NHZ A;  1WE0 A;  1ZGN A;  2GSR A;  3MNG A;  2G0F A;  3IOS A;  4MPF A;  3TKS A;  4MH2 A;  3H1N A;  1HD2 A;  5ECO B;  2LQQ A;  1SD8 A;  1SKS B;  3DD3 A;  5A4U A;  4LMW A;  3VUR A;  2YV9 A;  2OE1 A;  3GFK A;  3DKS A;  2IMF A;  5IMZ A;  6GST A;  5EY6 A;  1BYE A;  2B5X A;  1SL2 B;  2A2S A;  5DJL A;  2HRF A;  1OAZ A;  4MK3 A;  3ZFL A;  2KLX A;  3LG6 A;  2B7J A;  4NWY A;  1ILO A;  4KB3 A;  2ON7 A;  1Z6N A;  4OFM A;  2RLI A;  4IQ1 A;  4N0Z A;  2HYX A;  4KSO A;  4ML1 A;  4F82 A;  2PN8 A;  3TCO A;  1URM A;  4L5O A;  1PGT A;  3DEX A;  11GS A;  3D0Z A;  1QGV A;  1SJ6 A;  2OJL A;  2NVL A;  4AJ8 A;  2JSY A;  2R4V A;  1N8J A;  3E3E A;  2XBQ A;  1AQX A;  4WKW A;  4DVC A;  3LOR A;  4WF4 A;  2FGX A;  2O7K A;  1OKD A;  3HVS A;  5GZZ B;  13GS A;  2WB9 A;  1EGO A;  1CQG A;  3QPM A;  1TI1 A;  3F4T A;  2L4Q A;  4OD7 A;  3BCI A;  3ZYW A;  3DGQ A;  2CX4 A;  4TR0 A;  3HVV A;  4J2F A;  5DDL A;  4WBJ A;  1YDK A;  3GH6 A;  1XOB A;  3FRC A;  3QAW A;  5HQP A;  2BMX A;  3EIN A;  3D5J A;  2JAC A;  2O87 A;  2VCX A;  2YJ7 A;  2VL3 A;  4IVF A;  12GS A;  4PNG A;  2IJY A;  3HJP A;  4ECB A;  5D9T A;  2DIY A;  2FY6 A;  3ME7 A;  3RAZ A;  2RM6 A;  1ML6 A;  5CP1 A;  2IMD A;  4QL9 A;  4ULX A;  4XS6 A;  3FZ5 A;  2IIY A;  3CSH A;  4JZQ A;  1HNA A;  3M0F A;  4RQR A;  4FIW A;  3KM6 A;  1U3I A;  3IDV A;  3HXS A;  5LD0 A;  1Z6M A;  2BJX A;  3RPN A;  2L59 A;  5G1L A;  1J9B A;  1S3A A;  3MWH A;  2N5F A;  2LRC A;  2PER A;  1X5E A;  2YJH A;  4L0U A;  4EKZ A;  2JSZ A;  4KUN A;  3UBK A;  2F9S A;  5L71 A;  2E2G A;  1TRV A;  2O85 A;  2R5G A;  1JLW A;  3FZ9 A;  3GYK A;  5EPF A;  4JRR A;  2GSS A;  4MJC A;  2WCI A;  5D8I A;  3PGT A;  3FK8 A;  3G7Y A;  3F4S A;  3ZVJ D;  3W6G A;  3A2V A;  1M2B A;  1AQW A;  1V57 A;  4EO3 A;  1Q4J A;  4WR4 A;  5GST A;  1PL1 A;  1HQO A;  2MYG A;  2H0G A;  1EP8 A;  4MJB A;  4IN0 A;  3MSZ A;  3BD2 A;  5F05 A;  4OWY A;  1NW2 A;  1GSF A;  4KE3 A;  3H93 A;  1TRW A;  2VD1 A;  2JL4 A;  4Q5R A;  2VM2 A;  2ALB A;  2VCT A;  4WET A;  4ACS A;  3TJB A;  5DAL A;  3AY8 A;  1X9M B;  3FYG A;  5ECI B;  4HU7 A;  4PQ1 A;  1VRS D;  2GZP A; 
#chains in the Genus database with same CATH topology
 5INY A;  1C72 A;  4ZL9 A;  2EIQ A;  2FLS A;  2WRT A;  1I5G A;  5DJM A;  1U3A A;  1XVQ A;  1DSB A;  2YZU A;  3IHG A;  2IL3 A;  4EF0 A;  4FYB A;  3GTU B;  2B1K A;  5HR0 A;  3HA9 A;  2YAN A;  3NIV A;  3GUS A;  2K18 A;  3ZML A;  2OE0 A;  4TR4 A;  3J7Y k;  5E59 A;  5ECL B;  4GST A;  3HZ8 A;  1PQN A;  1TK5 B;  1XFL A;  2K6V A;  4MJE A;  2F8F A;  4V2M A;  2V41 A;  1F3A A;  16GS A;  4WEY A;  3FMW A;  4NXI A;  4OMV A;  2LJR A;  5KEJ A;  3G7J A;  2M46 A;  5DAK A;  3APS A;  1TK8 B;  3ZMK A;  3UVH A;  2DJ0 A;  2P0G A;  1K3O A;  5CYY A;  2YOI A;  2MMZ A;  1I9D A;  4O32 A;  2I3Y A;  4EDZ A;  1R5P A;  5A4V A;  4K2D A;  3LW9 A;  2R6K A;  3GX0 A;  2F3M A;  4LLR A;  3GKX A;  1T1V A;  2VOC A;  1TRS A;  2AHE A;  3EU3 A;  4HI7 A;  3PR8 A;  3NZN A;  4YQU A;  4MNN A;  3MYD A;  3DVX A;  3LGC A;  1T00 A;  3QDN A;  3L9V A;  5KN3 A;  1TU8 A;  5CNW A;  4AJ6 A;  3MDK A;  2DC5 A;  1XG8 A;  3BBY A;  5DAL B;  1GTU A;  4I2T A;  2R0P A;  3P90 A;  1FAA A;  5KN0 A;  1U87 A;  9GSS A;  1B9X C;  4ML6 A;  2HI7 A;  1DE2 A;  2X99 A;  4BVY A;  2PBJ A;  4H86 A;  2IME A;  1V40 A;  1KEB A;  2QSI A;  3L4N A;  3DIE A;  4A5P A;  3N5O A;  4F2I A;  1BED A;  3G9B A;  3GST A;  1FVK A;  4D73 B;  5HFG A;  1V98 A;  1V2A A;  2D2Z A;  1YEX A;  1EEM A;  5IOX A;  3ZRD A;  1SK2 A;  4MH3 A;  5IMF A;  3LQ7 A;  4NPB A;  2WS2 A;  3KCM A;  2P5R A;  1PA3 A;  2K9F A;  2CVD A;  4FYU A;  5G5E A;  1W4V A;  2HLS A;  1ZMA A;  3OR5 A;  2WFC A;  5ID2 A;  3ISO A;  1PKW A;  5AN1 A;  4DSS A;  5HR1 A;  2CV4 A;  1AC1 A;  2REM A;  4NAX A;  2KUC A;  5G1K A;  1FW1 A;  1SJI A;  3GMF A;  4NMU A;  5A5K A;  1O8X A;  2XBI A;  2L4C A;  3E0U A;  5CRD A;  4GCI A;  2LS5 A;  1ZYE A;  5J9B A;  2DLX A;  1SYX A;  3TKQ A;  2CX3 A;  2PMT A;  1XXU A;  2R37 A;  5J3R A;  1B8X A;  2AAW A;  1O6J A;  4TR3 A;  1GP1 A;  5AIV A;  3GHA A;  1UC7 A;  2YWN A;  1TW9 A;  2CAQ A;  3M1G A;  1UA5 A;  2RUF A;  2C4J A;  1JHB A;  4YH2 A;  3KD0 A;  2HSY A;  4ID0 A;  3IK9 A;  4I8B A;  4Z2U A;  2GGT A;  4IS0 A;  1A8L A;  3F3R A;  4KH7 A;  2DKH A;  3HY2 A;  2H1D A;  2DJ3 A;  4G0L A;  4K7O A;  2ES7 A;  2R0C A;  4KDY A;  2CAI A;  1QUW A;  5A4W A;  1BQ7 A;  5DQY A;  1FG4 A;  3ZL5 A;  4TXO A;  3IC4 A;  4USS A;  3DVW A;  2X4A A;  5EL8 A;  4KW6 A;  1QMV A;  3TRQ A;  1MD4 A;  3A2W A;  2X8C A;  3GUR A;  2AUV A;  3BOA A;  3RDW A;  1OC3 A;  4NV5 A;  3ERG A;  2OAD A;  5D96 A;  2IMI A;  3Q18 A;  4I2U A;  2V1M A;  4MF5 A;  2QA1 A;  1A2J A;  3R2Q A;  6GSX A;  1FB6 A;  2HRK A;  3TOU A;  5JWO B;  2ZCT A;  3IK7 A;  4LL4 B;  2VLU A;  4K0G A;  1S3D A;  1K0C A;  4K9Z A;  5C04 A;  1DE1 A;  2IMK A;  2H01 A;  4EVM A;  2H0H A;  1MDJ A;  1DUG A;  1SYR A;  3HYP A;  5DCH A;  3GKK A;  5IMD A;  4DEJ A;  5GSS A;  4ZXG A;  1FOV A;  4LL1 B;  1O7U A;  2WJU A;  2F51 A;  4XS4 A;  1TOF A;  1LU4 A;  3D6I A;  5FT3 A;  2NBS A;  1A0F A;  3KP8 A;  4MMM A;  2J23 A;  3F4R A;  4EL1 A;  2RII A;  5F0G A;  5JWR B;  3KJY A;  4K5R A;  2ZUP A;  1YY7 A;  2B5E A;  2P5Q A;  4ZL7 A;  4L5L A;  2H1A A;  1O73 A;  2C8U A;  4XTS A;  1K0O A;  6GSY A;  3TKP A;  2YCD A;  4MF6 A;  2GS3 A;  2FWG A;  5B8B A;  5CRW A;  1YZX A;  1XW6 A;  2VL2 C;  4MZC A;  1OE7 A;  3FR3 A;  4KA0 A;  5H5Q A;  1TJD A;  4O92 A;  1ST9 A;  2I1U A;  5AGY A;  4PTS A;  3F63 A;  4BA7 A;  5GAN D;  2V6K A;  1Z9H A;  4TKY A;  2H6X A;  1HNB A;  3KTB A;  4HZ4 A;  4QL7 A;  2C0E A;  5ECH B;  4TXO B;  2YWI A;  4MZW A;  4N11 A;  4BWS A;  4GSN A;  2IPA A;  1ZCP A;  2H6Z A;  4XHM A;  4GSS A;  4G10 A;  2C3Q A;  4GF0 A;  4RUV A;  5CRG A;  3ED3 A;  1PN0 A;  3P7X A;  1GUH A;  1GSY A;  2YV7 A;  3KH9 A;  1O81 A;  3HKR A;  4I97 A;  5F8B A;  4YQM A;  2AJQ B;  3TJF A;  1JFU A;  2DJK A;  4ZIL A;  2KP1 A;  3VI7 A;  3IXR A;  4BWQ A;  5ECK B;  4BVX A;  2HZE A;  2O89 A;  1U6T A;  3F9U A;  5LNK e;  4TXV A;  2X8G A;  3GIX A;  4E8E A;  4G0K A;  2H6Y A;  2M72 A;  3LSZ A;  4E8H A;  1G6Y A;  3KXO A;  1A8Y A;  3FKF A;  1XWC A;  3C8E A;  5D9X A;  2H66 A;  1GSD A;  3UAP A;  2DSA A;  1RK4 A;  3UIW A;  1XWA A;  3F6F A;  3UAR A;  5HR2 A;  2YP6 A;  2E2M A;  2J9H A;  1UVZ A;  3EPT A;  2LST A;  2VCW A;  4ISD A;  2GT5 A;  1GTB A;  1A2M A;  1NSW A;  4WF5 A;  3L78 A;  2JZS A;  1FHE A;  2YWM A;  3HVX A;  3UVT A;  4V2N A;  3GX8 A;  2LRN A;  1GWC A;  3ZIJ A;  3BCK A;  5J5N A;  3IE3 A;  3SWL A;  4AGS A;  3C7M A;  4ZB9 A;  5KOX A;  5B6N A;  1SK0 A;  2HNL A;  5CRH A;  2MMN A;  2R2J A;  1F2E A;  3QOU A;  1VF2 A;  3EYT A;  2VM1 A;  3TJG A;  3VWX A;  3ME8 A;  4FYC A;  4ZB8 A;  3VPQ A;  1GUL A;  4ZL8 A;  1TK0 B;  4ECC A;  4F0B A;  1N2A A;  4MF7 A;  1TU7 A;  2MBS A;  3HD5 A;  3WD6 A;  4K8M A;  1GSU A;  1OE8 A;  1YKC A;  5H5R A;  2ZNM A;  1ERT A;  1FB0 A;  2LUS A;  8GSS A;  3VWW A;  4X43 A;  3O3T A;  6GSV A;  2V32 A;  2LJA A;  2YWO A;  4GTU A;  2E0Q A;  3M3M A;  4YKG A;  5GAP D;  5D9V A;  3Q19 A;  4HDE A;  1GLQ A;  1EGR A;  1TP9 A;  5EVO A;  4FO5 A;  2OBK A;  3ZLP A;  4F03 A;  1EEJ A;  1ERV A;  3FHK A;  3ZRE A;  1PD2 1;  4ZB6 A;  1S3C A;  1WRY A;  2V2G A;  2LQO A;  1YKA A;  4K7I A;  5ECN B;  6GSU A;  3IBH A;  4ICY A;  3GNJ A;  2HZE B;  3UJ1 A;  3WT1 A;  4Q5F A;  2NPB A;  3EUR A;  6GSS A;  1O85 A;  3I9V 2;  3CSJ A;  4G9H A;  2QA2 A;  4OO4 A;  3N9J A;  4TOP A;  1K3Y A;  4IP1 A;  4PQI A;  1T8E B;  5LCZ A;  3DWV A;  3ZZX A;  1IYI A;  5IMA A;  2VLV A;  5AIX A;  1GUK A;  2K8S A;  1SL0 B;  1X5C A;  4XS1 A;  4POM A;  1WIK A;  3QMX A;  1NM3 A;  1H4O A;  1SKR B;  2E7P A;  4LA1 A;  3PPU A;  2H19 A;  5C00 A;  1G7O A;  2A2R A;  3QCP A;  3D21 A;  5HFK A;  1MDI A;  3LFL A;  1XBS A;  1MD3 A;  4K5S A;  3U5R E;  2KHP A;  2L6C A;  4PUR A;  4F0C A;  1PMT A;  3J7Y b;  1ERW A;  5JCU A;  1XWG A;  3GKN A;  2X8H A;  3UOM A;  1IYH A;  3TOT A;  2VIM A;  4EXJ A;  2CQ9 A;  1XZO A;  3IPZ A;  3KIJ A;  3FR6 A;  3KMN A;  1MEK A;  2VUP A;  2HSH A;  1JLV A;  2R0G A;  4TR1 A;  1UN2 A;  5DVB A;  4JU5 A;  4Q5Q A;  1M2A A;  2GZY A;  3CMI A;  3D4T A;  1AQV A;  3KGK A;  1M3I A;  2DJJ A;  2N5A A;  1K3L A;  3GSS A;  1A0R P;  3ERW A;  2H70 A;  1TKD B;  4IP6 A;  1F3B A;  2JZT A;  3TB2 A;  2IFQ A;  3CRT A;  4V1A g;  5ECQ B;  3WGE A;  3HCZ A;  3QD9 A;  3ERF A;  3GN3 A;  3C73 A;  5ELA A;  2H1G A;  2PPT A;  1S3R A;  3H4K A;  2CZ2 A;  2GQL A;  3IRA A;  2GTU A;  2DBC A;  1M0U A;  3EC3 A;  1XPV A;  1FVJ A;  4KCE A;  2WGR A;  2KP2 A;  5DQS A;  2H30 A;  4MCU A;  3FW2 A;  2B5Y A;  1YQ1 A;  3H79 A;  1XIY A;  3WGD A;  3ZIV A;  4V2L A;  2PUK C;  1GUM A;  1B48 A;  4RQX A;  2H0I A;  2RUE A;  3Q6O A;  4JED A;  2QGV A;  4MZB A;  3GRX A;  2CVK A;  2H74 A;  3O6T A;  1OC9 A;  4KDU A;  3CSI A;  5DAK B;  1OC8 A;  2LNS A;  4MP4 A;  1GSE A;  1X5D A;  1R26 A;  2XHF A;  4N10 A;  1WJK A;  3EMX A;  1PKZ A;  3EU4 A;  4K0N A;  4Q5N A;  3GL3 A;  2I9H A;  4ZBB A;  1T4Y A;  2QC7 A;  1WOU A;  2HSM A;  1M9A A;  3VFI A;  2FWE A;  4NHW A;  2DML A;  4MA9 A;  2VD0 A;  3VK9 A;  4K2X A;  1SKW B;  2C0D A;  1XWK A;  4ILF A;  7GSS A;  3LJR A;  5IO2 A;  2FCH A;  4F9Z A;  3C1S A;  4MLY A;  3IR4 A;  3H8Q A;  2L6D A;  4K7N A;  4IGJ A;  1ZL9 A;  1A24 A;  3IHQ A;  5JCW A;  14GS A;  5FWG A;  4L8E A;  5ECR B;  4J56 E;  3HDC A;  1THX A;  2WUL A;  1W89 A;  4PUA A;  3EVI A;  1T4Z A;  3ZVJ A;  5IMC A;  4BVY B;  3MAK A;  4G0I A;  2HFD A;  3I6A A;  3F8U A;  1KBN A;  1SD9 A;  2NTO A;  1YJ6 A;  3M9J A;  2GSQ A;  1XW5 A;  1BAY A;  1YEP A;  4MJA A;  2B1L A;  1ERU A;  2VCZ A;  3L9S A;  1GSQ A;  1SK1 A;  3RHB A;  1GNE A;  1V58 A;  4HQS A;  3CXG A;  3TJJ A;  2R3X A;  2I81 A;  2LRT A;  5KOW A;  1Z7P A;  2IWT A;  5IO0 A;  3VWV A;  3KZQ A;  4HQZ A;  5IOW A;  3HJO A;  2C3T A;  4IEL A;  1PX6 A;  4KND A;  1G6W A;  1VF4 A;  4FH8 A;  1B9Y C;  5CRE A;  4YAV A;  3HZ4 A;  3GV1 A;  5ID2 B;  3UBL A;  4DSS B;  1Z7R A;  3A2X A;  4OFN A;  4N30 A;  1OC9 B;  1O8W A;  1BX9 A;  2TRX A;  2XPE A;  3KEB A;  3IV4 A;  4YAP A;  1GNW A;  2ON5 A;  5DCG A;  2B7K A;  1DBY A;  1KTE A;  2CZ3 A;  4G2E A;  1MTC A;  2JU5 A;  4J57 E;  1LJR A;  4ECI A;  2I4A A;  4ZBD A;  2LKU A;  1TDI A;  5IM9 A;  1R5A A;  4CY8 A;  2XC2 A;  3KTL A;  4IJ3 A;  1AIU A;  1JZD A;  2PWJ A;  6GSW A;  2GZZ A;  4N0V A;  3L0H A;  1G7E A;  3CQF A;  1GSS A;  3TKR A;  1TTZ A;  1F9M A;  1J0F A;  3HVN A;  5JCG A;  4TN8 A;  3F3Q A;  1USB A;  1EV9 A;  1Z3E A;  4HEA 2;  4DSR A;  3W8J A;  4GLT A;  2PVO C;  3CYN A;  1QQ2 A;  3EMP A;  5J4U A;  4CY6 A;  3TUE A;  4HZ2 A;  2IN3 A;  2H1B A;  3CBU A;  2FHE A;  1G0T A;  1SU9 A;  3HJM A;  2AB6 A;  2FWH A;  1BG5 A;  2NDO A;  1YF0 A;  2VO4 A;  4NV2 A;  1XVW A;  4BPY A;  1WWJ A;  3G7I A;  4K1F A;  1K0M A;  4PGT A;  2OAC A;  2X64 A;  2DIZ A;  4AJ7 A;  2FA8 A;  2H73 A;  2GST A;  4G19 A;  3CTG A;  3GH9 A;  4POL A;  1T3B A;  3TRP A;  1ZZY A;  4I5Q A;  3VPT A;  10GS A;  4OCF A;  1ABA A;  3I69 A;  3APQ A;  2FD3 A;  2GLR A;  3TDG A;  1TI3 A;  5H5S A;  5HR3 A;  1JZO A;  1PN9 A;  5IQY A;  3ZIT A;  3PH9 A;  3HHV A;  4AF2 A;  3QR6 A;  2PGT A;  5CO3 A;  3D22 A;  3FEU A;  2K8V A;  1K0A A;  1PX7 A;  1QFN A;  3WGX A;  4MPG A;  4XS4 B;  5CAX A;  2C80 A;  4HJM A;  2DJ1 A;  4XCS A;  2LNT A;  3W8S A;  3V1W A;  3LYP A;  5G2Z A;  2FNO A;  1SJZ A;  2OA7 A;  1TRU A;  3FZ4 A;  3LXZ A;  4OO5 A;  5AIS A;  3A3T A;  3GTU A;  2H72 A;  4K6X A;  4IQA A;  2A4V A;  3SBC A;  2C3N A;  1GL8 A;  4KDX A;  2V6O A;  3ZFB A;  4X1U A;  1EOH A;  2FA4 A;  4TVE A;  2OBI A;  3EWL A;  1F6M C;  2L57 A;  1XWB A;  3QAV A;  2YZH A;  2YN1 A;  4IJI A;  19GS A;  3IAM 2;  2FWF A;  4RI7 A;  4POK A;  2M80 A;  2HRA A;  3QAG A;  3S9F A;  2CVB A;  2GQM A;  4KGI A;  2CA8 A;  2TIR A;  3QFA C;  3TKS E;  1V9W A;  5G30 A;  2LV3 A;  4GQF A;  2VL2 A;  2MMA A;  1ACV A;  5B7C A;  4QQ7 A;  3VI5 A;  4EUY A;  2GDR A;  2MBT A;  3RPP A;  1JZR A;  1F37 A;  2EIR A;  3TJK A;  5D93 A;  1AUC A;  1WPI A;  1E2Y A;  3A5W A;  2B3S A;  5B8A A;  2FUG 2;  4PQH A;  4OFT A;  1OVN A;  2H71 A;  1U88 A;  4L0W A;  2A2P A;  3JCM L;  1T7P B;  2CT6 A;  5KN2 A;  3IA1 A;  2HE3 A;  1FO5 A;  3FZA A;  4IKH A;  5J9C A;  5G5F A;  4BVX B;  3PIN A;  4GWR A;  2L5O A;  5F06 A;  2C1Y A;  3DYR A;  4V1A p;  18GS A;  1M2D A;  4CDO A;  2H75 A;  5ECS A;  2JZR A;  5FHI A;  4GRF A;  4CW9 A;  2PU9 C;  3TGZ A;  1M9B A;  3LXT A;  3O76 A;  2DMM A;  1GTA A;  20GS A;  1QXH A;  1EZK A;  1RW1 A;  1ZOF A;  5DBQ A;  4YQV A;  4D73 A;  2LJK A;  1NHO A;  1AAZ A;  3U6V A;  4O5U A;  2VLT A;  5ECP B;  3CRU A;  2PVQ A;  2VL9 A;  2LEG A;  4PNF A;  1AXD A;  4GXZ A;  2HZF A;  4BIK A;  2B6M A;  4DSQ A;  3WT2 A;  3UL3 A;  5BRT A;  4P3Y B;  2WZ9 A;  4KAE A;  5J41 A;  5D73 A;  22GS A;  3K8N A;  4POB A;  4X0X A;  1EOG A;  4HU9 A;  4KX4 A;  2HT9 A;  3GKM A;  4KSM A;  1Q98 A;  5G31 A;  2C0G A;  3DRN A;  2VAF A;  2O8V B;  1TXX A;  2LTK A;  1AW9 A;  1M7T A;  4EDY A;  5IMV A;  1R7H A;  5D9W A;  4KCA A;  3M9K A;  3I43 A;  3TRX A;  1VGL A;  1X9W B;  4XRD A;  5ENU A;  5IIZ A;  3FR9 A;  4GQC A;  4MDC A;  5COH A;  1M99 A;  1K0B A;  2GVP A;  3KMO A;  4IBP A;  2G2Q A;  4O5R A;  1OKT A;  3US3 A;  2QKE A;  4PXO A;  1XW9 A;  5JWQ B;  5HFI A;  17GS A;  1ZYQ B;  5E4W A;  4TRX A;  2WDU A;  3CTF A;  1LBK A;  3FY7 A;  3KH7 A;  3UMA A;  4LMV A;  3IC8 A;  3KP9 A;  3LWA A;  4WXT A;  1PRX A;  4JR6 A;  2AYT A;  2OKA A;  1FOH A;  2XPD A;  2MZC A;  1VF3 A;  1QK8 A;  4WR5 A;  1EWX A;  3RBT A;  3UEM A;  4XRA A;  3VLN A;  3E9J B;  1Z5Y E;  2OE3 A;  1Y6E A;  2X49 A;  2YNX A;  3LYK A;  3F6D A;  5F07 A;  3TKS C;  1B4P A;  4OCE A;  3IAS 2;  4O5Q A;  4I6X A;  4TW5 A;  1H75 A;  4HUA A;  3LEF A;  3C71 A;  3QFB C;  2EIO A;  5KN1 A;  1B4Q A;  2VCQ A;  3M8N A;  4HJ2 A;  1EP7 A;  4ZBA A;  4EC0 A;  4JR4 A;  4IW9 A;  3DXB A;  2F8A A;  2Z9S A;  1PL2 A;  1GTI A;  2EC4 A;  2HRN A;  2GQK A;  1J08 A;  2H76 A;  4PUF C;  1K0D A;  1CQH A;  3Q74 A;  4WBR D;  3VWU A;  4HS1 A;  1EV4 A;  4TR1 B;  3WYW A;  3ZTL A;  4HOJ A;  1K0N A;  4IHU A;  3EE2 A;  1A23 A;  1HYU A;  1X0R A;  2KOK A;  1E6B A;  2IFQ B;  4PX1 A;  5ECM B;  1GH2 A;  5ELG A;  1NHY A;  2AV4 A;  3GA4 A;  3P8W A;  1X9S B;  4JE1 A;  4BL7 A;  5ABR A;  1BJX A;  4Z7X A;  1A2L A;  1GRX A;  5IPH A;  1YF1 A;  4ZIJ A;  5IPG A;  3MIX A;  2GT6 A;  4Z2T A;  2RM5 A;  5B6M A;  2UZ8 A;  1HNC A;  1XCC A;  3RHC A;  4JBB A;  3NOF A;  1Y25 A;  1VF1 A;  1GLP A;  2VCV A;  2YPM A;  3L9U A;  1KNG A;  2JAD A;  3GL5 A;  3C1R A;  2N5B A;  1JZW A;  2MMO A;  3DML A;  4RI6 A;  1WP0 A;  1R4W A;  3F0I A;  1SEN A;  3P2A A;  1MDK A;  4ECJ A;  2HXK A;  1RQM A;  3APO A;  2H8L A;  2L5L A;  3BJ5 A;  3D4M A;  4MAB A;  2P31 A;  4XIH A;  2BTO T;  1THO A;  2C0F A;  4CHS A;  1XOA A;  2TRC P;  1PSQ A;  1WMJ A;  2DJ2 A;  4EE0 A;  1SL1 B;  1ON4 A;  4O7H A;  1OYJ A;  4NHZ A;  1WE0 A;  1ZGN A;  2GSR A;  3MNG A;  3R3E A;  2G0F A;  3IOS A;  4MPF A;  3TKS A;  4MH2 A;  1ZYP A;  3H1N A;  1HD2 A;  5ECO B;  2LQQ A;  1SD8 A;  1SKS B;  3DD3 A;  5A4U A;  4LMW A;  3VUR A;  2YV9 A;  2OE1 A;  3GFK A;  4YKF A;  3DKS A;  2IMF A;  5IMZ A;  6GST A;  5EY6 A;  1BYE A;  2B5X A;  1SL2 B;  2A2S A;  5DJL A;  2HRF A;  1OAZ A;  4MK3 A;  3ZFL A;  2KLX A;  3LG6 A;  2B7J A;  4NWY A;  1ILO A;  4KB3 A;  2ON7 A;  1ZYN A;  1Z6N A;  4OFM A;  2RLI A;  4IQ1 A;  2DKI A;  4N0Z A;  2HYX A;  4KSO A;  4ML1 A;  4BL7 B;  4F82 A;  2PN8 A;  3TCO A;  1URM A;  4L5O A;  1PGT A;  4FQU A;  3DEX A;  11GS A;  3D0Z A;  1QGV A;  1SJ6 A;  2OJL A;  2NVL A;  4AJ8 A;  2JSY A;  2R4V A;  1N8J A;  3E3E A;  2XBQ A;  1AQX A;  4WKW A;  4DVC A;  3LOR A;  4WF4 A;  2FGX A;  2O7K A;  1OKD A;  4HSC X;  3HVS A;  5GZZ B;  13GS A;  2WB9 A;  1EGO A;  3A5I A;  1CQG A;  3QPM A;  1TI1 A;  3F4T A;  2L4Q A;  4OD7 A;  3BCI A;  4X4J A;  3ZYW A;  3DGQ A;  2CX4 A;  4TR0 A;  3HVV A;  4J2F A;  5DDL A;  4WBJ A;  1YDK A;  3GH6 A;  1XOB A;  3FRC A;  3QAW A;  2A4H A;  5HQP A;  2BMX A;  3EIN A;  3D5J A;  2JAC A;  2O87 A;  2VCX A;  2YJ7 A;  2VL3 A;  4IVF A;  12GS A;  4PNG A;  2IJY A;  3HJP A;  4ECB A;  5D9T A;  4EIP A;  2DIY A;  2FY6 A;  3ME7 A;  3RAZ A;  2RM6 A;  1ML6 A;  5CP1 A;  2IMD A;  4QL9 A;  4ULX A;  4XS6 A;  3FZ5 A;  2IIY A;  3CSH A;  4JZQ A;  1HNA A;  3M0F A;  4RQR A;  4FIW A;  3KM6 A;  1U3I A;  3IDV A;  3HXS A;  5LD0 A;  1Z6M A;  2BJX A;  3RPN A;  2L59 A;  5G1L A;  1J9B A;  1S3A A;  5BMU A;  4KF9 A;  3MWH A;  2N5F A;  1PFO A;  2LRC A;  2PER A;  1X5E A;  2YJH A;  4L0U A;  4EKZ A;  2JSZ A;  4KUN A;  3UBK A;  2F9S A;  5L71 A;  2E2G A;  1TRV A;  2O85 A;  2R5G A;  1JLW A;  3FZ9 A;  3GYK A;  5EPF A;  4JRR A;  2GSS A;  4MJC A;  2WCI A;  5D8I A;  3PGT A;  3FK8 A;  3G7Y A;  3F4S A;  3ZVJ D;  3W6G A;  3A2V A;  1M2B A;  1AQW A;  1V57 A;  4EO3 A;  1Q4J A;  4WR4 A;  5GST A;  4EIQ A;  1PL1 A;  1HQO A;  2MYG A;  2H0G A;  1EP8 A;  4MJB A;  4IN0 A;  3MSZ A;  3BD2 A;  5F05 A;  4OWY A;  1NW2 A;  1GSF A;  4KE3 A;  3H93 A;  1TRW A;  2VD1 A;  2JL4 A;  4Q5R A;  2VM2 A;  2ALB A;  2VCT A;  1M3J A;  4Z2R A;  4WET A;  4ACS A;  3TJB A;  5DAL A;  3AY8 A;  1X9M B;  3FYG A;  5ECI B;  4HU7 A;  4PQ1 A;  1VRS D;  2GZP A; 
#chains in the Genus database with same CATH homology
 5INY A;  1C72 A;  4ZL9 A;  2EIQ A;  2FLS A;  2WRT A;  1I5G A;  5DJM A;  1U3A A;  1XVQ A;  1DSB A;  2YZU A;  3IHG A;  2IL3 A;  4EF0 A;  4FYB A;  3GTU B;  2B1K A;  5HR0 A;  3HA9 A;  2YAN A;  3NIV A;  3GUS A;  2K18 A;  3ZML A;  2OE0 A;  4TR4 A;  3J7Y k;  5E59 A;  5ECL B;  4GST A;  3HZ8 A;  1PQN A;  1TK5 B;  1XFL A;  2K6V A;  4MJE A;  2F8F A;  4V2M A;  2V41 A;  1F3A A;  16GS A;  4WEY A;  3FMW A;  4NXI A;  4OMV A;  2LJR A;  5KEJ A;  3G7J A;  2M46 A;  5DAK A;  3APS A;  1TK8 B;  3ZMK A;  3UVH A;  2DJ0 A;  2P0G A;  1K3O A;  5CYY A;  2YOI A;  2MMZ A;  1I9D A;  4O32 A;  2I3Y A;  4EDZ A;  1R5P A;  5A4V A;  4K2D A;  3LW9 A;  2R6K A;  3GX0 A;  2F3M A;  4LLR A;  3GKX A;  1T1V A;  2VOC A;  1TRS A;  2AHE A;  3EU3 A;  4HI7 A;  3PR8 A;  3NZN A;  4YQU A;  4MNN A;  3MYD A;  3DVX A;  3LGC A;  1T00 A;  3QDN A;  3L9V A;  5KN3 A;  1TU8 A;  5CNW A;  4AJ6 A;  3MDK A;  2DC5 A;  3BBY A;  5DAL B;  1GTU A;  4I2T A;  2R0P A;  3P90 A;  1FAA A;  5KN0 A;  1U87 A;  9GSS A;  1B9X C;  4ML6 A;  2HI7 A;  1DE2 A;  2X99 A;  4BVY A;  2PBJ A;  4H86 A;  2IME A;  1V40 A;  1KEB A;  2QSI A;  3L4N A;  3DIE A;  4A5P A;  3N5O A;  4F2I A;  1BED A;  3G9B A;  3GST A;  1FVK A;  4D73 B;  5HFG A;  1V98 A;  1V2A A;  2D2Z A;  1YEX A;  1EEM A;  5IOX A;  3ZRD A;  1SK2 A;  4MH3 A;  5IMF A;  3LQ7 A;  4NPB A;  2WS2 A;  3KCM A;  2P5R A;  1PA3 A;  2K9F A;  2CVD A;  4FYU A;  5G5E A;  1W4V A;  2HLS A;  1ZMA A;  3OR5 A;  2WFC A;  5ID2 A;  3ISO A;  1PKW A;  5AN1 A;  4DSS A;  5HR1 A;  2CV4 A;  1AC1 A;  2REM A;  4NAX A;  2KUC A;  5G1K A;  1FW1 A;  1SJI A;  3GMF A;  4NMU A;  5A5K A;  1O8X A;  2XBI A;  2L4C A;  3E0U A;  5CRD A;  4GCI A;  2LS5 A;  1ZYE A;  5J9B A;  2DLX A;  1SYX A;  3TKQ A;  2CX3 A;  2PMT A;  1XXU A;  2R37 A;  5J3R A;  1B8X A;  2AAW A;  1O6J A;  4TR3 A;  1GP1 A;  5AIV A;  3GHA A;  1UC7 A;  2YWN A;  1TW9 A;  2CAQ A;  3M1G A;  1UA5 A;  2RUF A;  2C4J A;  1JHB A;  4YH2 A;  3KD0 A;  2HSY A;  4ID0 A;  3IK9 A;  4I8B A;  4Z2U A;  2GGT A;  4IS0 A;  1A8L A;  3F3R A;  4KH7 A;  2DKH A;  3HY2 A;  2H1D A;  2DJ3 A;  4G0L A;  4K7O A;  2ES7 A;  2R0C A;  4KDY A;  2CAI A;  1QUW A;  5A4W A;  1BQ7 A;  5DQY A;  1FG4 A;  3ZL5 A;  4TXO A;  3IC4 A;  4USS A;  3DVW A;  2X4A A;  5EL8 A;  4KW6 A;  1QMV A;  3TRQ A;  1MD4 A;  3A2W A;  2X8C A;  3GUR A;  2AUV A;  3BOA A;  3RDW A;  1OC3 A;  4NV5 A;  3ERG A;  2OAD A;  5D96 A;  2IMI A;  3Q18 A;  4I2U A;  2V1M A;  4MF5 A;  2QA1 A;  1A2J A;  3R2Q A;  6GSX A;  1FB6 A;  2HRK A;  3TOU A;  5JWO B;  2ZCT A;  3IK7 A;  4LL4 B;  2VLU A;  4K0G A;  1S3D A;  1K0C A;  4K9Z A;  5C04 A;  1DE1 A;  2IMK A;  2H01 A;  4EVM A;  2H0H A;  1MDJ A;  1DUG A;  1SYR A;  3HYP A;  5DCH A;  3GKK A;  5IMD A;  4DEJ A;  5GSS A;  4ZXG A;  1FOV A;  4LL1 B;  1O7U A;  2WJU A;  2F51 A;  4XS4 A;  1TOF A;  1LU4 A;  3D6I A;  5FT3 A;  2NBS A;  1A0F A;  3KP8 A;  4MMM A;  2J23 A;  3F4R A;  4EL1 A;  2RII A;  5F0G A;  5JWR B;  3KJY A;  4K5R A;  2ZUP A;  1YY7 A;  2B5E A;  2P5Q A;  4ZL7 A;  4L5L A;  2H1A A;  1O73 A;  2C8U A;  4XTS A;  1K0O A;  6GSY A;  3TKP A;  2YCD A;  4MF6 A;  2GS3 A;  2FWG A;  5B8B A;  5CRW A;  1YZX A;  1XW6 A;  2VL2 C;  4MZC A;  1OE7 A;  3FR3 A;  4KA0 A;  5H5Q A;  1TJD A;  4O92 A;  1ST9 A;  2I1U A;  5AGY A;  4PTS A;  3F63 A;  4BA7 A;  5GAN D;  2V6K A;  1Z9H A;  4TKY A;  2H6X A;  1HNB A;  3KTB A;  4HZ4 A;  4QL7 A;  2C0E A;  5ECH B;  4TXO B;  2YWI A;  4MZW A;  4N11 A;  4BWS A;  4GSN A;  2IPA A;  1ZCP A;  2H6Z A;  4XHM A;  4GSS A;  4G10 A;  2C3Q A;  4GF0 A;  4RUV A;  5CRG A;  3ED3 A;  1PN0 A;  3P7X A;  1GUH A;  1GSY A;  2YV7 A;  3KH9 A;  1O81 A;  3HKR A;  4I97 A;  5F8B A;  4YQM A;  2AJQ B;  3TJF A;  1JFU A;  2DJK A;  4ZIL A;  2KP1 A;  3VI7 A;  3IXR A;  4BWQ A;  5ECK B;  4BVX A;  2HZE A;  2O89 A;  1U6T A;  3F9U A;  5LNK e;  4TXV A;  2X8G A;  3GIX A;  4E8E A;  4G0K A;  2H6Y A;  2M72 A;  3LSZ A;  4E8H A;  1G6Y A;  3KXO A;  1A8Y A;  3FKF A;  1XWC A;  3C8E A;  5D9X A;  2H66 A;  1GSD A;  3UAP A;  2DSA A;  1RK4 A;  3UIW A;  1XWA A;  3F6F A;  3UAR A;  5HR2 A;  2YP6 A;  2E2M A;  2J9H A;  1UVZ A;  3EPT A;  2LST A;  2VCW A;  4ISD A;  2GT5 A;  1GTB A;  1A2M A;  1NSW A;  4WF5 A;  3L78 A;  2JZS A;  1FHE A;  2YWM A;  3HVX A;  3UVT A;  4V2N A;  3GX8 A;  2LRN A;  1GWC A;  3ZIJ A;  3BCK A;  5J5N A;  3IE3 A;  3SWL A;  4AGS A;  3C7M A;  4ZB9 A;  5KOX A;  5B6N A;  1SK0 A;  2HNL A;  5CRH A;  2MMN A;  2R2J A;  1F2E A;  3QOU A;  1VF2 A;  3EYT A;  2VM1 A;  3TJG A;  3VWX A;  3ME8 A;  4FYC A;  4ZB8 A;  3VPQ A;  1GUL A;  4ZL8 A;  1TK0 B;  4ECC A;  4F0B A;  1N2A A;  4MF7 A;  1TU7 A;  2MBS A;  3HD5 A;  3WD6 A;  4K8M A;  1GSU A;  1OE8 A;  1YKC A;  5H5R A;  2ZNM A;  1ERT A;  1FB0 A;  2LUS A;  8GSS A;  3VWW A;  4X43 A;  3O3T A;  6GSV A;  2V32 A;  2LJA A;  2YWO A;  4GTU A;  2E0Q A;  3M3M A;  4YKG A;  5GAP D;  5D9V A;  3Q19 A;  4HDE A;  1GLQ A;  1EGR A;  1TP9 A;  5EVO A;  4FO5 A;  2OBK A;  3ZLP A;  4F03 A;  1EEJ A;  1ERV A;  3FHK A;  3ZRE A;  1PD2 1;  4ZB6 A;  1S3C A;  1WRY A;  2V2G A;  2LQO A;  1YKA A;  4K7I A;  5ECN B;  6GSU A;  3IBH A;  4ICY A;  3GNJ A;  2HZE B;  3UJ1 A;  3WT1 A;  4Q5F A;  2NPB A;  3EUR A;  6GSS A;  1O85 A;  3I9V 2;  3CSJ A;  4G9H A;  2QA2 A;  4OO4 A;  3N9J A;  4TOP A;  1K3Y A;  4IP1 A;  4PQI A;  1T8E B;  5LCZ A;  3DWV A;  3ZZX A;  1IYI A;  5IMA A;  2VLV A;  5AIX A;  1GUK A;  2K8S A;  1SL0 B;  1X5C A;  4XS1 A;  4POM A;  1WIK A;  3QMX A;  1NM3 A;  1H4O A;  1SKR B;  2E7P A;  4LA1 A;  3PPU A;  2H19 A;  5C00 A;  1G7O A;  2A2R A;  3QCP A;  3D21 A;  5HFK A;  1MDI A;  3LFL A;  1XBS A;  1MD3 A;  4K5S A;  3U5R E;  2KHP A;  2L6C A;  4PUR A;  4F0C A;  1PMT A;  3J7Y b;  1ERW A;  5JCU A;  1XWG A;  3GKN A;  2X8H A;  3UOM A;  1IYH A;  3TOT A;  2VIM A;  4EXJ A;  2CQ9 A;  1XZO A;  3IPZ A;  3KIJ A;  3FR6 A;  3KMN A;  1MEK A;  2VUP A;  2HSH A;  1JLV A;  2R0G A;  4TR1 A;  1UN2 A;  5DVB A;  4JU5 A;  4Q5Q A;  1M2A A;  2GZY A;  3CMI A;  3D4T A;  1AQV A;  3KGK A;  2DJJ A;  2N5A A;  1K3L A;  3GSS A;  1A0R P;  3ERW A;  2H70 A;  1TKD B;  4IP6 A;  1F3B A;  2JZT A;  3TB2 A;  2IFQ A;  3CRT A;  4V1A g;  5ECQ B;  3WGE A;  3HCZ A;  3QD9 A;  3ERF A;  3GN3 A;  3C73 A;  5ELA A;  2H1G A;  2PPT A;  3H4K A;  2CZ2 A;  2GQL A;  3IRA A;  2GTU A;  2DBC A;  1M0U A;  3EC3 A;  1XPV A;  1FVJ A;  4KCE A;  2WGR A;  2KP2 A;  5DQS A;  2H30 A;  4MCU A;  3FW2 A;  2B5Y A;  1YQ1 A;  3H79 A;  1XIY A;  3WGD A;  3ZIV A;  4V2L A;  2PUK C;  1GUM A;  1B48 A;  4RQX A;  2H0I A;  2RUE A;  3Q6O A;  4JED A;  2QGV A;  4MZB A;  3GRX A;  2CVK A;  2H74 A;  3O6T A;  1OC9 A;  4KDU A;  3CSI A;  5DAK B;  1OC8 A;  2LNS A;  4MP4 A;  1GSE A;  1X5D A;  1R26 A;  2XHF A;  4N10 A;  1WJK A;  3EMX A;  1PKZ A;  3EU4 A;  4K0N A;  4Q5N A;  3GL3 A;  2I9H A;  4ZBB A;  1T4Y A;  2QC7 A;  1WOU A;  2HSM A;  1M9A A;  3VFI A;  2FWE A;  4NHW A;  2DML A;  4MA9 A;  2VD0 A;  3VK9 A;  4K2X A;  1SKW B;  2C0D A;  1XWK A;  4ILF A;  7GSS A;  3LJR A;  5IO2 A;  2FCH A;  4F9Z A;  3C1S A;  4MLY A;  3IR4 A;  3H8Q A;  2L6D A;  4K7N A;  4IGJ A;  1ZL9 A;  1A24 A;  3IHQ A;  5JCW A;  14GS A;  5FWG A;  4L8E A;  5ECR B;  4J56 E;  3HDC A;  1THX A;  2WUL A;  1W89 A;  4PUA A;  3EVI A;  1T4Z A;  3ZVJ A;  5IMC A;  4BVY B;  3MAK A;  4G0I A;  2HFD A;  3I6A A;  3F8U A;  1KBN A;  1SD9 A;  2NTO A;  1YJ6 A;  3M9J A;  2GSQ A;  1XW5 A;  1BAY A;  1YEP A;  4MJA A;  2B1L A;  1ERU A;  2VCZ A;  3L9S A;  1GSQ A;  1SK1 A;  3RHB A;  1GNE A;  1V58 A;  4HQS A;  3CXG A;  3TJJ A;  2R3X A;  2I81 A;  2LRT A;  5KOW A;  1Z7P A;  2IWT A;  5IO0 A;  3VWV A;  3KZQ A;  4HQZ A;  5IOW A;  3HJO A;  2C3T A;  4IEL A;  1PX6 A;  4KND A;  1G6W A;  1VF4 A;  4FH8 A;  1B9Y C;  5CRE A;  4YAV A;  3HZ4 A;  3GV1 A;  5ID2 B;  3UBL A;  4DSS B;  1Z7R A;  3A2X A;  4OFN A;  4N30 A;  1OC9 B;  1O8W A;  1BX9 A;  2TRX A;  2XPE A;  3KEB A;  3IV4 A;  4YAP A;  1GNW A;  2ON5 A;  5DCG A;  2B7K A;  1DBY A;  1KTE A;  2CZ3 A;  4G2E A;  1MTC A;  2JU5 A;  4J57 E;  1LJR A;  4ECI A;  2I4A A;  4ZBD A;  2LKU A;  1TDI A;  5IM9 A;  1R5A A;  4CY8 A;  2XC2 A;  3KTL A;  4IJ3 A;  1AIU A;  1JZD A;  2PWJ A;  6GSW A;  2GZZ A;  4N0V A;  3L0H A;  1G7E A;  1GSS A;  3TKR A;  1TTZ A;  1F9M A;  1J0F A;  5JCG A;  4TN8 A;  3F3Q A;  1USB A;  1EV9 A;  1Z3E A;  4HEA 2;  4DSR A;  3W8J A;  4GLT A;  2PVO C;  3CYN A;  1QQ2 A;  3EMP A;  5J4U A;  4CY6 A;  3TUE A;  4HZ2 A;  2IN3 A;  2H1B A;  3CBU A;  2FHE A;  1G0T A;  1SU9 A;  3HJM A;  2AB6 A;  2FWH A;  1BG5 A;  2NDO A;  1YF0 A;  2VO4 A;  4NV2 A;  1XVW A;  4BPY A;  1WWJ A;  3G7I A;  4K1F A;  1K0M A;  4PGT A;  2OAC A;  2X64 A;  2DIZ A;  4AJ7 A;  2FA8 A;  2H73 A;  2GST A;  4G19 A;  3CTG A;  3GH9 A;  4POL A;  1T3B A;  3TRP A;  1ZZY A;  4I5Q A;  3VPT A;  10GS A;  4OCF A;  1ABA A;  3I69 A;  3APQ A;  2FD3 A;  2GLR A;  3TDG A;  1TI3 A;  5H5S A;  5HR3 A;  1JZO A;  1PN9 A;  5IQY A;  3ZIT A;  3PH9 A;  3HHV A;  4AF2 A;  3QR6 A;  2PGT A;  5CO3 A;  3D22 A;  3FEU A;  2K8V A;  1K0A A;  1PX7 A;  1QFN A;  3WGX A;  4MPG A;  4XS4 B;  5CAX A;  2C80 A;  4HJM A;  2DJ1 A;  4XCS A;  2LNT A;  3W8S A;  3V1W A;  3LYP A;  5G2Z A;  2FNO A;  1SJZ A;  2OA7 A;  1TRU A;  3FZ4 A;  3LXZ A;  4OO5 A;  5AIS A;  3A3T A;  3GTU A;  2H72 A;  4K6X A;  4IQA A;  2A4V A;  3SBC A;  2C3N A;  1GL8 A;  4KDX A;  2V6O A;  3ZFB A;  4X1U A;  1EOH A;  2FA4 A;  4TVE A;  2OBI A;  3EWL A;  1F6M C;  2L57 A;  1XWB A;  3QAV A;  2YZH A;  2YN1 A;  4IJI A;  19GS A;  3IAM 2;  2FWF A;  4RI7 A;  4POK A;  2M80 A;  2HRA A;  3QAG A;  3S9F A;  2CVB A;  2GQM A;  4KGI A;  2CA8 A;  2TIR A;  3QFA C;  3TKS E;  1V9W A;  5G30 A;  2LV3 A;  4GQF A;  2VL2 A;  2MMA A;  1ACV A;  5B7C A;  4QQ7 A;  3VI5 A;  4EUY A;  2GDR A;  2MBT A;  3RPP A;  1JZR A;  1F37 A;  2EIR A;  3TJK A;  5D93 A;  1AUC A;  1WPI A;  1E2Y A;  3A5W A;  2B3S A;  5B8A A;  2FUG 2;  4PQH A;  4OFT A;  1OVN A;  2H71 A;  1U88 A;  4L0W A;  2A2P A;  3JCM L;  1T7P B;  2CT6 A;  5KN2 A;  3IA1 A;  2HE3 A;  1FO5 A;  3FZA A;  4IKH A;  5J9C A;  5G5F A;  4BVX B;  3PIN A;  4GWR A;  2L5O A;  5F06 A;  2C1Y A;  3DYR A;  4V1A p;  18GS A;  1M2D A;  4CDO A;  2H75 A;  5ECS A;  2JZR A;  5FHI A;  4GRF A;  4CW9 A;  2PU9 C;  3TGZ A;  1M9B A;  3LXT A;  3O76 A;  2DMM A;  1GTA A;  20GS A;  1QXH A;  1EZK A;  1RW1 A;  1ZOF A;  5DBQ A;  4YQV A;  4D73 A;  2LJK A;  1NHO A;  1AAZ A;  3U6V A;  4O5U A;  2VLT A;  5ECP B;  3CRU A;  2PVQ A;  2VL9 A;  2LEG A;  4PNF A;  1AXD A;  4GXZ A;  2HZF A;  2B6M A;  4DSQ A;  3WT2 A;  3UL3 A;  5BRT A;  4P3Y B;  2WZ9 A;  4KAE A;  5J41 A;  5D73 A;  22GS A;  3K8N A;  4POB A;  4X0X A;  1EOG A;  4HU9 A;  4KX4 A;  2HT9 A;  3GKM A;  4KSM A;  1Q98 A;  5G31 A;  2C0G A;  3DRN A;  2VAF A;  2O8V B;  1TXX A;  2LTK A;  1AW9 A;  1M7T A;  4EDY A;  5IMV A;  1R7H A;  5D9W A;  4KCA A;  3M9K A;  3I43 A;  3TRX A;  1VGL A;  1X9W B;  4XRD A;  5ENU A;  5IIZ A;  3FR9 A;  4GQC A;  4MDC A;  5COH A;  1M99 A;  1K0B A;  2GVP A;  3KMO A;  4IBP A;  2G2Q A;  4O5R A;  1OKT A;  3US3 A;  2QKE A;  4PXO A;  1XW9 A;  5JWQ B;  5HFI A;  17GS A;  1ZYQ B;  5E4W A;  4TRX A;  2WDU A;  3CTF A;  1LBK A;  3FY7 A;  3KH7 A;  3UMA A;  4LMV A;  3IC8 A;  3KP9 A;  3LWA A;  4WXT A;  1PRX A;  4JR6 A;  2AYT A;  2OKA A;  1FOH A;  2XPD A;  2MZC A;  1VF3 A;  1QK8 A;  4WR5 A;  1EWX A;  3RBT A;  3UEM A;  4XRA A;  3VLN A;  3E9J B;  1Z5Y E;  2OE3 A;  1Y6E A;  2X49 A;  2YNX A;  3LYK A;  3F6D A;  5F07 A;  3TKS C;  1B4P A;  4OCE A;  3IAS 2;  4O5Q A;  4I6X A;  4TW5 A;  1H75 A;  4HUA A;  3LEF A;  3C71 A;  3QFB C;  2EIO A;  5KN1 A;  1B4Q A;  2VCQ A;  3M8N A;  4HJ2 A;  1EP7 A;  4ZBA A;  4EC0 A;  4JR4 A;  4IW9 A;  3DXB A;  2F8A A;  2Z9S A;  1PL2 A;  1GTI A;  2EC4 A;  2HRN A;  2GQK A;  1J08 A;  2H76 A;  4PUF C;  1K0D A;  1CQH A;  3Q74 A;  4WBR D;  3VWU A;  4HS1 A;  1EV4 A;  4TR1 B;  3WYW A;  3ZTL A;  4HOJ A;  1K0N A;  4IHU A;  3EE2 A;  1A23 A;  1HYU A;  1X0R A;  2KOK A;  1E6B A;  2IFQ B;  4PX1 A;  5ECM B;  1GH2 A;  5ELG A;  1NHY A;  2AV4 A;  3GA4 A;  3P8W A;  1X9S B;  4JE1 A;  4BL7 A;  5ABR A;  1BJX A;  4Z7X A;  1A2L A;  1GRX A;  5IPH A;  1YF1 A;  4ZIJ A;  5IPG A;  3MIX A;  2GT6 A;  4Z2T A;  2RM5 A;  5B6M A;  2UZ8 A;  1HNC A;  1XCC A;  3RHC A;  4JBB A;  3NOF A;  1Y25 A;  1VF1 A;  1GLP A;  2VCV A;  2YPM A;  3L9U A;  1KNG A;  2JAD A;  3GL5 A;  3C1R A;  2N5B A;  1JZW A;  2MMO A;  3DML A;  4RI6 A;  1WP0 A;  1R4W A;  3F0I A;  1SEN A;  3P2A A;  1MDK A;  4ECJ A;  2HXK A;  1RQM A;  3APO A;  2H8L A;  2L5L A;  3BJ5 A;  3D4M A;  4MAB A;  2P31 A;  4XIH A;  2BTO T;  1THO A;  2C0F A;  4CHS A;  1XOA A;  2TRC P;  1PSQ A;  1WMJ A;  2DJ2 A;  4EE0 A;  1SL1 B;  1ON4 A;  4O7H A;  1OYJ A;  4NHZ A;  1WE0 A;  1ZGN A;  2GSR A;  3MNG A;  3R3E A;  2G0F A;  3IOS A;  4MPF A;  3TKS A;  4MH2 A;  1ZYP A;  3H1N A;  1HD2 A;  5ECO B;  2LQQ A;  1SD8 A;  1SKS B;  3DD3 A;  5A4U A;  4LMW A;  3VUR A;  2YV9 A;  2OE1 A;  3GFK A;  4YKF A;  3DKS A;  2IMF A;  5IMZ A;  6GST A;  5EY6 A;  1BYE A;  2B5X A;  1SL2 B;  2A2S A;  5DJL A;  2HRF A;  1OAZ A;  4MK3 A;  3ZFL A;  2KLX A;  3LG6 A;  2B7J A;  4NWY A;  1ILO A;  4KB3 A;  2ON7 A;  1ZYN A;  1Z6N A;  4OFM A;  2RLI A;  4IQ1 A;  2DKI A;  4N0Z A;  2HYX A;  4KSO A;  4ML1 A;  4BL7 B;  4F82 A;  2PN8 A;  3TCO A;  1URM A;  4L5O A;  1PGT A;  4FQU A;  3DEX A;  11GS A;  3D0Z A;  1QGV A;  1SJ6 A;  2OJL A;  2NVL A;  4AJ8 A;  2JSY A;  2R4V A;  1N8J A;  3E3E A;  2XBQ A;  1AQX A;  4WKW A;  4DVC A;  3LOR A;  4WF4 A;  2FGX A;  2O7K A;  1OKD A;  3HVS A;  5GZZ B;  13GS A;  2WB9 A;  1EGO A;  3A5I A;  1CQG A;  3QPM A;  1TI1 A;  3F4T A;  2L4Q A;  4OD7 A;  3BCI A;  4X4J A;  3ZYW A;  3DGQ A;  2CX4 A;  4TR0 A;  3HVV A;  4J2F A;  5DDL A;  4WBJ A;  1YDK A;  3GH6 A;  1XOB A;  3FRC A;  3QAW A;  2A4H A;  5HQP A;  2BMX A;  3EIN A;  3D5J A;  2JAC A;  2O87 A;  2VCX A;  2YJ7 A;  2VL3 A;  4IVF A;  12GS A;  4PNG A;  2IJY A;  3HJP A;  4ECB A;  5D9T A;  4EIP A;  2DIY A;  2FY6 A;  3ME7 A;  3RAZ A;  2RM6 A;  1ML6 A;  5CP1 A;  2IMD A;  4QL9 A;  4ULX A;  4XS6 A;  3FZ5 A;  2IIY A;  3CSH A;  4JZQ A;  1HNA A;  3M0F A;  4RQR A;  4FIW A;  3KM6 A;  1U3I A;  3IDV A;  3HXS A;  5LD0 A;  1Z6M A;  2BJX A;  3RPN A;  2L59 A;  5G1L A;  1J9B A;  1S3A A;  5BMU A;  4KF9 A;  3MWH A;  2N5F A;  2LRC A;  2PER A;  1X5E A;  2YJH A;  4L0U A;  4EKZ A;  2JSZ A;  4KUN A;  3UBK A;  2F9S A;  5L71 A;  2E2G A;  1TRV A;  2O85 A;  2R5G A;  1JLW A;  3FZ9 A;  3GYK A;  5EPF A;  4JRR A;  2GSS A;  4MJC A;  2WCI A;  5D8I A;  3PGT A;  3FK8 A;  3G7Y A;  3F4S A;  3ZVJ D;  3W6G A;  3A2V A;  1M2B A;  1AQW A;  1V57 A;  4EO3 A;  1Q4J A;  4WR4 A;  5GST A;  4EIQ A;  1PL1 A;  1HQO A;  2MYG A;  2H0G A;  1EP8 A;  4MJB A;  4IN0 A;  3MSZ A;  3BD2 A;  5F05 A;  4OWY A;  1NW2 A;  1GSF A;  4KE3 A;  3H93 A;  1TRW A;  2VD1 A;  2JL4 A;  4Q5R A;  2VM2 A;  2ALB A;  2VCT A;  4Z2R A;  4WET A;  4ACS A;  3TJB A;  5DAL A;  3AY8 A;  1X9M B;  3FYG A;  5ECI B;  4HU7 A;  4PQ1 A;  1VRS D;  2GZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...