4RQXA

Crystal structure of human peroxiredoxin 4(thioredoxin peroxidase) with mesna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
GTAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Cysteine Specific Targeting of the Functionally Distinct Peroxiredoxin and Glutaredoxin Proteins by the Investigational Disulfide BNP7787.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 166
sequence length 166
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4rqxA00
3CSJA 1YKCA 3GX0A 5IMFA 1A8YA 2FWFA 2HXKA 3FRCA 3C1RA 1X9WB 3L4NA 4FYCA 4MJEA 1X9MB 1BYEA 1GL8A 1ML6A 3U5RE 2DJ2A 1UN2A 2L6CA 2YWOA 2LJAA 1O8WA 2V6OA 2CAIA 3DD3A 1JZDA 5DDLA 2RM5A 2TRXA 2LS5A 3GNJA 4G19A 1UC7A 3TGZA 4BVYA 3ZYWA 4EXJA 3H93A 5EL8A 4G2EA 4OCFA 1TI1A 4L0WA 4TOPA 14GSA 1ACVA 3HJMA 2OE0A 3D21A 1VF2A 1AUCA 3LXTA 4JR4A 4YAVA 3L9SA 1S3AA 4HI7A 2JADA 1NSWA 5ECLB 3EWLA 2EIOA 2GT6A 1TJDA 3LWAA 2V2GA 4KH7A 2QSIA 1WRYA 2H71A 3VWWA 4Q5RA 1V58A 4KNDA 5HFGA 3VPQA 1V40A 1F2EA 5HR2A 4N0VA 1PX7A 1EGRA 4TXOA 5D73A 2DJ3A 1SYXA 2VLTA 2ON5A 4PQ1A 5L71A 1SJZA 1ZZYA 2JSYA 2YP6A 2L6DA 2O87A 4IGJA 5G2ZA 4MH2A 2L5OA 5IIZA 4TW5A 3VI5A 5IPHA 1GUHA 5EPFA 2WS2A 4ZL8A 2YWIA 5LNKe 1XW9A 1J08A 2PPTA 3D5JA 3CMIA 3IA1A 2CA8A 1HNAA 1IYIA 4F2IA 3M0FA 1OE7A 1TRVA 2VCQA 5DALA 1JLWA 2F8FA 4O5RA 4GQFA 1VF3A 1YF0A 3QR6A 2CX4A 2VCWA 1THOA 2PVOC 3I69A 1R7HA 2VUPA 3GURA 4WETA 1OC9A 4LL1B 3DYRA 2YJ7A 18GSA 2WDUA 5ECMB 3ZL5A 1KNGA 1FB0A 2OADA 1U6TA 1OKDA 1FOVA 1ABAA 4JRRA 4WXTA 2YN1A 3ZVJA 3GSTA 4KW6A 4DSQA 2ON7A 3FKFA 2CT6A 5B8BA 1SYRA 3ED3A 3G7IA 5D9TA 1SENA 1SL1B 3TJFA 1TKDB 2WJUA 1LJRA 3DWVA 5HR1A 5ECIB 1AQXA 1BQ7A 1VGLA 3CYNA 1M0UA 3IXRA 3RHBA 4Q5QA 3IBHA 4HZ4A 1GSDA 4MF7A 2B7JA 3DEXA 2FNOA 3KZQA 1XWKA 2H0IA 2MMNA 4OO5A 5IMZA 2N5BA 8GSSA 1X9SB 4F0BA 3UARA 1A8LA 2DSAA 3KGKA 3OR5A 6GSSA 3FZAA 1GTUA 2LJKA 1F3BA 5JCGA 4POMA 3GX8A 1O6JA 5D9VA 5ABRA 4I2UA 4K7OA 3HDCA 1M2BA 1X0RA 2GQLA 3QPMA 1Z7RA 2HYXA 3GL5A 2H70A 22GSA 5ECHB 2L5LA 3RDWA 1Q98A 5JWOB 1XBSA 2NTOA 2DIZA 1O73A 1PKWA 3VK9A 1XWGA 2LJRA 1GSQA 1MTCA 2HFDA 3E3EA 3WGDA 4HU9A 3KEBA 1PSQA 3KD0A 4QQ7A 2DIYA 2F51A 3L0HA 2C0GA 1SKRB 2XHFA 5DVBA 2XPDA 4HZ2A 2M80A 5FT3A 1E6BA 2HZEA 4HJ2A 3FK8A 1IYHA 6GSXA 3QFAC 2IPAA 3VWXA 1AQWA 5DCGA 3ME7A 5JWRB 3DKSA 5GAPD 3BCKA 4ACSA 2KUCA 1ZCPA 2LTKA 3UBLA 1JLVA 1K0AA 1Y25A 4RUVA 1ERUA 4NXIA 5INYA 3U6VA 2C3TA 4MCUA 4IJIA 3EE2A 2VCZA 5ELAA 3RPPA 3I9V2 1S3CA 1TRSA 2CAQA 2C3QA 3ZTLA 1OKTA 1PKZA 1XOBA 3MDKA 1G7OA 3HVVA 1M2AA 1ZOFA 3LG6A 4GRFA 4NV2A 4TXVA 4JU5A 4GXZA 3WD6A 1B8XA 2FGXA 5DCHA 4ZB8A 3H79A 3UEMA 1DE1A 3WT1A 13GSA 1WPIA 1FVJA 4GSNA 1YY7A 2VL3A 2FA4A 5AIVA 3IHQA 4EF0A 3F0IA 2YJHA 2REMA 1O8XA 1MD4A 2CVDA 1N8JA 5G30A 2PN8A 3TRPA 3TUEA 1O85A 2N5AA 3KP9A 1ZYEA 2DJKA 4XRDA 4EL1A 1XOAA 1JZOA 2PUKC 4TR1B 3TJBA 1PN9A 1XW6A 2IMEA 1CQGA 1QK8A 3G9BA 3A2VA 2N5FA 4YQVA 3P7XA 3A2WA 1G6WA 1PL2A 6GSWA 1EWXA 5HFIA 3GA4A 1PRXA 4D73B 1UA5A 2B5YA 4YQMA 4KE3A 2VM2A 5F0GA 4ZB9A 2K6VA 2CVBA 3VPTA 1HQOA 4GQCA 1QGVA 3ERFA 4ZBBA 1YKAA 2YV9A 1GNEA 4ISDA 1NM3A 3GV1A 3HCZA 4MK3A 3E9JB 2GT5A 2GVPA 1XW5A 2JACA 2H01A 5DQYA 1Z6NA 1XZOA 4RI6A 3UAPA 1Z7PA 2CZ2A 4N30A 3O76A 2H74A 3Q19A 1HNBA 2H76A 5D9WA 4MF6A 3MSZA 3J7Yk 2D2ZA 1F3AA 2H1DA 5IM9A 1MD3A 1ILOA 4PUAA 2NVLA 2C4JA 3VI7A 1WWJA 4F0CA 4HQZA 3WGEA 3BBYA 3L9UA 4GF0A 1WMJA 1YDKA 5ECKB 2HLSA 2H6ZA 1F37A 4NPBA 1V57A 2O89A 2FD3A 4MJBA 2ALBA 1NHYA 4BPYA 4MZCA 2E7PA 2YWMA 5LD0A 5IMDA 2PERA 3WYWA 2XPEA 5GZZB 1PA3A 1RW1A 11GSA 4P3YB 1XVQA 3GH9A 2E0QA 1TXXA 1R4WA 2KP2A 3ERWA 1YEXA 3KMNA 2C0FA 2FCHA 5ECSA 4ULXA 4KSMA 1TU8A 3GYKA 1T3BA 2H0HA 1MDJA 6GSYA 1YZXA 4V2NA 5ID2A 3BCIA 4GCIA 2GGTA 2OKAA 3HJPA 5A4UA 3A2XA 1K0OA 2LQOA 4RQXA 4YQUA 1GSUA 5JWQB 1X5EA 4EDZA 3KIJA 4MLYA 3BJ5A 2HT9A 3PH9A 2DJ0A 2GTUA 3GL3A 3GN3A 4MJAA 1H4OA 2KLXA 2L4CA 3BD2A 3ZLPA 1G0TA 3DRNA 4X1UA 4HJMA 4WKWA 2MBTA 2F8AA 4K0NA 6GSVA 4PURA 2AHEA 4ZB6A 4PNGA 4ECBA 2FHEA 3J7Yb 4IHUA 3GKNA 3QAWA 5AGYA 4TR0A 4LL4B 1AAZA 3N9JA 2RIIA 3ZZXA 4I6XA 2ES7A 1XPVA 3Q74A 1TP9A 4XRAA 2NBSA 2GSTA 2LRTA 2MZCA 4DSSB 3D22A 4MZWA 3UBKA 5JCUA 2IMIA 3A3TA 1O81A 1V2AA 2GQKA 3K8NA 4JBBA 3F3QA 3TJKA 2GSQA 5DAKB 1EOGA 2DMMA 2XBQA 2R2JA 3W6GA 1EGOA 3GKMA 1TK0B 1A2JA 5A4WA 1XCCA 3UVHA 2YNXA 1A2MA 3CXGA 3TRQA 3C73A 1ZL9A 2C1YA 4HS1A 1S3DA 1WOUA 4POKA 2B1KA 2AJQB 2K9FA 3EURA 3IR4A 4H86A 2IFQA 1GWCA 4V2MA 3TDGA 4O7HA 1GTAA 2PWJA 1GUMA 4OFTA 5CRHA 5AN1A 3RPNA 2P0GA 3M9JA 3LXZA 1K0DA 3VWUA 3M9KA 2YWNA 5DBQA 2B5XA 3EU3A 5E4WA 4PQHA 4IQ1A 1Z6MA 2WULA 3TKRA 3NOFA 1JZRA 5CRDA 2EC4A 1J0FA 3CRUA 3KTLA 5ECRB 2FLSA 4K7NA 5H5RA 3RBTA 1GLQA 2BMXA 4BVXA 3BOAA 3WT2A 3TCOA 1MEKA 1RQMA 4TVEA 12GSA 3FZ4A 3FZ5A 1O7UA 4NHWA 1XVWA 3TKQA 4ZILA 3NIVA 3DMLA 3FYGA 3VLNA 4L0UA 1G7EA 1K0CA 2YZUA 3GH6A 4K7IA 3RHCA 1XFLA 3C8EA 4I2TA 3QD9A 3ISOA 5FHIA 3CTGA 2HZFA 3EU4A 4ZL9A 1M7TA 4TXOB 4QL9A 2VL9A 5F06A 4LLRA 1SJIA 1AW9A 2FY6A 1W4VA 2AAWA 4CDOA 2FA8A 2X8HA 4WR4A 3TOUA 1EV9A 4IP6A 20GSA 3HA9A 3QMXA 5KN3A 5B6NA 2H6XA 5IQYA 1FHEA 4TR4A 3TKSC 2RUEA 4TR3A 1KEBA 5IMCA 1M9AA 2I4AA 2JZTA 1FG4A 3EVIA 1FO5A 1WJKA 4AJ7A 5IOXA 3GSSA 5DALB 2IIYA 1GRXA 4GLTA 4KCEA 2WRTA 2BTOT 1GSSA 3GFKA 2HSHA 1M9BA 3TB2A 4ZBDA 3KMOA 4PXOA 4ID0A 1J9BA 1GH2A 3F4SA 2GLRA 3TRXA 1SU9A 4K1FA 5CRGA 5H5SA 2LQQA 1ERWA 3CSIA 3APQA 1A24A 2WCIA 5EY6A 1AIUA 1HD2A 3ZITA 1Q4JA 1VF1A 1TW9A 5ECOB 3TJJA 2IMFA 3HXSA 1URMA 3F4RA 1H75A 5CYYA 4TN8A 1QUWA 2E2GA 2YANA 4NV5A 4O32A 2WGRA 1OC8A 2VCTA 1DE2A 2J23A 2VCXA 4XS1A 2H1AA 2OBKA 3D4TA 1TRWA 9GSSA 1T4YA 2G0FA 4JZQA 3IV4A 3HVSA 2ZCTA 2H19A 2HNLA 5ELGA 3DVWA 2JSZA 2CVKA 2WZ9A 1JFUA 3A5WA 4OFMA 2IL3A 2GS3A 5CRWA 1V98A 3IAM2 1M99A 5KN0A 1ZMAA 3LYKA 3G7YA 3HD5A 5HQPA 3HJOA 3L9VA 4ILFA 4K2DA 4PX1A 5CAXA 1Z5YE 4IELA 4L8EA 3ZFLA 2TIRA 2HRFA 1GTIA 4Z7XA 5C04A 4ML1A 1F9MA 4JE1A 4MA9A 4TRXA 2OE3A 3DIEA 3Q6OA 1V9WA 4WBRD 2XBIA 4MP4A 3KH7A 4GSTA 3GTUA 3R2QA 3LGCA 2GZPA 1BX9A 4AJ6A 2P5QA 2B3SA 2LEGA 1XXUA 3ZREA 1QFNA 1TI3A 4IQAA 2O85A 6GSUA 3VWVA 3GIXA 4KSOA 5IMVA 4LMWA 1LBKA 2YZHA 6GSTA 4EO3A 4JEDA 3PINA 5HR0A 1OAZA 3UVTA 3SBCA 2FUG2 2VAFA 2GZYA 2H75A 1ZYQB 2KP1A 2YOIA 4XS4A 2MMOA 3LSZA 1NW2A 2LKUA 2HZEB 1X5CA 1W89A 4WBJA 1AC1A 2IWTA 3KJYA 2JZRA 1AQVA 1E2YA 1DBYA 3ZRDA 1OVNA 1Z9HA 1FAAA 2IJYA 1K0MA 3APSA 3US3A 3C71A 4FO5A 3QCPA 3QDNA 4NHZA 2EIRA 3FZ9A 1ERVA 5ECQB 3F63A 1ZGNA 2DJ1A 4YH2A 1R26A 2L4QA 3ME8A 4ML6A 2VIMA 3EMXA 1XWCA 4RI7A 2FWHA 4K8MA 2R6KA 1WE0A 2AYTA 3IK7A 1WP0A 2VD1A 2WB9A 1I5GA 4RQRA 5F8BA 3PGTA 2DC5A 4IVFA 2JL4A 4HEA2 4V2LA 2VOCA 3LEFA 1PD21 1SD8A 3W8SA 1BJXA 4J2FA 4DVCA 2IMKA 3F3RA 5CO3A 1B9YC 5CP1A 4G9HA 2LRNA 2OE1A 4IP1A 4PNFA 3KTBA 2CX3A 2HRNA 2X64A 2HI7A 1PQNA 2LV3A 4AGSA 3ZFBA 3P2AA 4KAEA 5ECNB 4CW9A 4O92A 1X5DA 2H1GA 4MF5A 4MPFA 3KM6A 2R37A 4DSSA 1UVZA 2LNSA 1QMVA 2C8UA 7GSSA 4DSRA 2B6MA 2L57A 1KTEA 1YJ6A 3IOSA 2CV4A 5G5FA 3DVXA 1GULA 4OFNA 3E0UA 1EP8A 4NMUA 1K0NA 2Z9SA 5A5KA 4F82A 3N5OA 3SWLA 1QXHA 4OMVA 2XC2A 1Z3EA 3HY2A 3F4TA 4K9ZA 2J9HA 4I97A 1K3LA 1A23A 3D4MA 2YPMA 3UOMA 2VM1A 2ZNMA 3RAZA 2H8LA 4HOJA 3FW2A 2PBJA 2MMZA 4OWYA 4MMMA 2OA7A 3LQ7A 3G7JA 4LA1A 1PX6A 5J3RA 3O3TA 3FY7A 5ECPB 2K8SA 2X99A 3H8QA 1FB6A 3UMAA 1GSFA 2I1UA 3CSHA 3Q18A 1XIYA 1KBNA 2JU5A 1SD9A 2F9SA 2IMDA 5CNWA 4Q5FA 5D9XA 4F9ZA 2RUFA 4F03A 2C80A 2H1BA 2E2MA 5KN1A 1MDKA 3F6FA 5IMAA 3I43A 4ZL7A 1TK5B 4ZIJA 4V1Ap 1BEDA 2HE3A 2M46A 1MDIA 4FYUA 3TOTA 2MMAA 3QAVA 4BA7A 5G5EA 4BL7A 3TJGA 1T8EB 4XCSA 5FWGA 5GSSA 3QOUA 1GTBA 2F3MA 2PGTA 2DLXA 2CZ3A 1AXDA 4ZXGA 2VL2A 5JCWA 4IBPA 2GSSA 1EEJA 4KX4A 3AY8A 1U3IA 4IW9A 2GQMA 5AIXA 4CHSA 5ID2B 4ECCA 3I6AA 4MZBA 5J5NA 1YQ1A 2VCVA 2C0DA 3O6TA 1SK1A 1JHBA 2V41A 3H1NA 1TDIA 2MYGA 4KUNA 19GSA 1TU7A 3W8JA 5D93A 5G1LA 2I81A 4Q5NA 1SJ6A 4L5LA 17GSA 2DMLA 1B4PA 3S9FA 3TKSE 4MPGA 1JZWA 4ECIA 4EUYA 3L78A 5E59A 3MNGA 4FH8A 4G10A 4QL7A 3F9UA 2OJLA 4EKZA 1FW1A 2LSTA 2OACA 2A2SA 1TRUA 1OC3A 3PR8A 1GNWA 10GSA 3KCMA 4HU7A 4L5OA 2AB6A 1DUGA 5J9CA 1SKSB 2EIQA 3LORA 4ZBAA 1C72A 1T1VA 2H0GA 2GZZA 4ECJA 3QAGA 4PGTA 3ZVJD 3C7MA 4PQIA 1Y6EA 5EVOA 4OO4A 2R3XA 5B6MA 4I5QA 1EZKA 3F8UA 1GP1A 2GSRA 1ON4A 2ZUPA 4NWYA 2LRCA 3H4KA 4TKYA 1EEMA 5J4UA 4XS6A 5IPGA 2VLUA 2RM6A 4DEJA 3WGXA 3LJRA 1A2LA 3HZ4A 4EC0A 5IO0A 4WF4A 3FR9A 5G1KA 3TKPA 3DGQA 5KN2A 1DSBA 2B5EA 4PUFC 5F07A 5GSTA 2HSYA 1GSYA 5COHA 2IFQB 1OYJA 3NZNA 3CTFA 2V32A 2K18A 2TRCP 1TOFA 3P8WA 4K0GA 1SK0A 2YV7A 3UIWA 2P5RA 3P90A 3EC3A 5LCZA 3ERGA 1SK2A 3GMFA 4GSSA 2YCDA 4HUAA 5IO2A 3VURA 2CQ9A 3EMPA 4XTSA 1EV4A 3CRTA 3EYTA 1U3AA 3KXOA 4IN0A 3ZIVA 1OC9B 5J9BA 1RK4A 5AISA 1HYUA 2X8CA 5HR3A 4MH3A 4JR6A 1T7PB 2MBSA 1G6YA 2QC7A 3JCML 5DQSA 1VRSD 2VO4A 1ERTA 4I8BA 4TR1A 3V1WA 4IKHA 1SL2B 1XWBA 4N10A 4BWSA 1GLPA 1I9DA 2P31A 3QFBC 4D73A 1B9XC 2WFCA 4FIWA 4K6XA 1B4QA 1F6MC 1OE8A 3C1SA 4IS0A 1K0BA 2NPBA 5GAND 3LFLA 2V6KA 3HKRA 4KDUA 4N0ZA 2A4VA 1K3OA 2B1LA 4KDYA 3IK9A 1ST9A 4MDCA 2KOKA 3ZMKA 2DJJA 2NDOA 3UJ1A 2PVQA 3FHKA 4KA0A 1M2DA 4YAPA 2B7KA 4MABA 4IJ3A 3M3MA 1A0RP 5J41A 2L59A 2H66A 3APOA 4WF5A 2KHPA 4J57E 1THXA 4EDYA 4OCEA 3D0ZA 3GUSA 5ENUA 3HHVA 3FEUA 5CREA 2PU9C 4N11A 2DBCA 4EVMA 1USBA 3HZ8A 1U87A 2VL2C 1WIKA 3IPZA 2H72A 2I9HA 4AJ8A 1B48A 3F6DA 1TTZA 3VFIA 3GRXA 5KEJA 2H73A 2OBIA 1NHOA 2IN3A 5G31A 1EOHA 2O7KA 4X43A 1A0FA 3IC4A 2K8VA 4WR5A 2X8GA 4HDEA 16GSA 4EE0A 3LYPA 2M72A 2VLVA 5A4VA 4KB3A 1PGTA 1QQ2A 1T00A 5D96A 5F05A 4E8HA 4J56E 1HNCA 4OD7A 5DJMA 5DJLA 3GHAA 2QGVA 3IRAA 3FR6A 3GKKA 2O8VB 2VD0A 4GWRA 1PL1A 3ZIJA 2JZSA 4AF2A 4POLA 4MJCA 2A2RA 4KGIA 1YF1A 3GKXA 1GUKA 2C0EA 2BJXA 5IOWA 1LU4A 1YEPA 1R5PA 2R5GA 2H30A 1CQHA 3KH9A 4FYBA 3M8NA 5D8IA 3MWHA 2QKEA 2V1MA 3ZMLA 3D6IA 1R5AA 3HVXA 4WEYA 3CBUA 2LUSA 3KP8A 2FWGA 2I3YA 4HQSA 5B7CA 4GTUA 2LNTA 2R4VA 2RLIA 1EP7A 2AUVA 2AV4A 1SKWB 5HFKA 4KCAA 3FR3A 4XIHA 3GTUB 4X0XA 3HYPA 4BWQA 1K3YA 4LMVA 1TK8B 4V1Ag 1FVKA 1GSEA 1XWAA 2G2QA 3EINA 2H6YA 4E8EA 1U88A 1VF4A 4NAXA 1SL0B 4KDXA 1BAYA 3DXBA 4POBA 3TKSA 5B8AA 5H5QA 1BG5A 2PMTA 3M1GA 1PMTA 5DAKA 1T4ZA 3IDVA 4XHMA 2FWEA 4XS4B 2GDRA 3IE3A 2C3NA 1N2AA 3MAKA 3IAS2 3UL3A 5C00A
chains in the Genus database with same CATH superfamily
3CSJA 1YKCA 3GX0A 5IMFA 1A8YA 2FWFA 2HXKA 3FRCA 3C1RA 1X9WB 3L4NA 4FYCA 4MJEA 1X9MB 1BYEA 1GL8A 1ML6A 3U5RE 2DJ2A 2UZ8A 1UN2A 2L6CA 2YWOA 2LJAA 1O8WA 2V6OA 2CAIA 3DD3A 1JZDA 5DDLA 2RM5A 2TRXA 2LS5A 3GNJA 4G19A 1UC7A 3TGZA 4BVYA 3ZYWA 4EXJA 3H93A 5EL8A 4G2EA 4OCFA 1TI1A 4L0WA 4TOPA 14GSA 1ACVA 3HJMA 2OE0A 3D21A 1VF2A 1AUCA 3LXTA 4JR4A 4YAVA 3L9SA 1S3AA 4HI7A 2JADA 1NSWA 5ECLB 3EWLA 2EIOA 2GT6A 1TJDA 3LWAA 2V2GA 4KH7A 2QSIA 1WRYA 2H71A 3VWWA 4Q5RA 1V58A 4KNDA 5HFGA 3VPQA 1V40A 1F2EA 5HR2A 4N0VA 1PX7A 1EGRA 4TXOA 5D73A 2DJ3A 1SYXA 2VLTA 2ON5A 4PQ1A 5L71A 1SJZA 1ZZYA 2JSYA 2YP6A 2L6DA 2O87A 4IGJA 5G2ZA 4CY8A 4MH2A 2L5OA 5IIZA 4TW5A 3VI5A 5IPHA 1GUHA 5EPFA 2WS2A 4ZL8A 2YWIA 5LNKe 1XW9A 1J08A 2PPTA 3D5JA 3CMIA 3IA1A 2CA8A 1HNAA 1IYIA 4F2IA 3M0FA 1OE7A 1TRVA 2VCQA 5DALA 1JLWA 2F8FA 4O5RA 4GQFA 1VF3A 1YF0A 3QR6A 2CX4A 2VCWA 1THOA 2PVOC 3I69A 1R7HA 2VUPA 3GURA 4WETA 2X4AA 1OC9A 4LL1B 3DYRA 2YJ7A 18GSA 2WDUA 5ECMB 3ZL5A 1KNGA 1FB0A 2OADA 1U6TA 1OKDA 2A2PA 1FOVA 1ABAA 4JRRA 4WXTA 2YN1A 3ZVJA 3GSTA 4FQUA 4KW6A 4DSQA 2ON7A 3FKFA 2CT6A 5B8BA 1SYRA 3ED3A 3G7IA 5D9TA 4YKGA 1SENA 4BL7B 1SL1B 5KOWA 3TJFA 1TKDB 2WJUA 1LJRA 3DWVA 5HR1A 5ECIB 1AQXA 1BQ7A 1VGLA 3CYNA 1M0UA 3IXRA 3RHBA 4Q5QA 3IBHA 4HZ4A 1GSDA 4MF7A 2B7JA 3DEXA 2FNOA 3R3EA 3KZQA 2A4HA 1XWKA 2H0IA 2MMNA 4OO5A 5IMZA 2N5BA 8GSSA 1X9SB 4F0BA 3UARA 1A8LA 2DSAA 3KGKA 3OR5A 6GSSA 2DKIA 3FZAA 1GTUA 2LJKA 1F3BA 5JCGA 4POMA 3GX8A 1O6JA 5D9VA 5ABRA 4I2UA 4K7OA 3HDCA 1M2BA 1X0RA 2GQLA 3QPMA 1Z7RA 2HYXA 3GL5A 2H70A 22GSA 2L5LA 5ECHB 3RDWA 1Q98A 5JWOB 4BVXB 1XBSA 4O5QA 2NTOA 2DIZA 1O73A 1PKWA 3VK9A 1XWGA 2LJRA 1GSQA 1MTCA 2HFDA 3E3EA 3WGDA 4HU9A 3KEBA 1PSQA 4Z2RA 3KD0A 4QQ7A 2DIYA 4HSCX 2F51A 3L0HA 2C0GA 1SKRB 2XHFA 5DVBA 2XPDA 4HZ2A 2M80A 5FT3A 1E6BA 2HZEA 4HJ2A 3FK8A 1IYHA 6GSXA 3QFAC 2IPAA 3VWXA 1AQWA 5DCGA 3ME7A 5JWRB 3DKSA 5GAPD 3BCKA 4ACSA 2KUCA 1ZCPA 2LTKA 3UBLA 1JLVA 1K0AA 1Y25A 4RUVA 1ERUA 4NXIA 5INYA 3U6VA 2C3TA 4MCUA 4IJIA 3EE2A 3EPTA 2VCZA 5ELAA 3RPPA 3I9V2 1S3CA 1TRSA 2CAQA 2C3QA 3ZTLA 1OKTA 1PKZA 1XOBA 3MDKA 1G7OA 3HVVA 1M2AA 1ZOFA 3LG6A 4GRFA 4NV2A 4TXVA 4JU5A 4GXZA 3WD6A 1B8XA 2FGXA 5DCHA 4ZB8A 3H79A 3UEMA 1DE1A 3WT1A 13GSA 1WPIA 1FVJA 4GSNA 1YY7A 2VL3A 2FA4A 5BMUA 5AIVA 1XG8A 3IHQA 4EF0A 3F0IA 2YJHA 2REMA 1O8XA 1MD4A 2CVDA 1N8JA 5G30A 2PN8A 3TRPA 3TUEA 1O85A 2N5AA 3KP9A 1ZYEA 2DJKA 4XRDA 4EL1A 1XOAA 1JZOA 2PUKC 4TR1B 3TJBA 1PN9A 1XW6A 2IMEA 1CQGA 3FMWA 1QK8A 3G9BA 3A2VA 2N5FA 4YQVA 3P7XA 3A2WA 1G6WA 1PL2A 6GSWA 1EWXA 5HFIA 4G0IA 3GA4A 1PRXA 4D73B 1UA5A 2B5YA 4YQMA 4KE3A 2VM2A 5F0GA 4ZB9A 2K6VA 2CVBA 3VPTA 1HQOA 4GQCA 1QGVA 3ERFA 4ZBBA 1YKAA 2YV9A 1GNEA 4ISDA 1NM3A 3GV1A 3HCZA 4MK3A 1ZYPA 3E9JB 2GT5A 2GVPA 1XW5A 2JACA 2H01A 5DQYA 1Z6NA 1XZOA 4RI6A 3UAPA 1Z7PA 2CZ2A 4N30A 3O76A 2H74A 3Q19A 2R0PA 1HNBA 3IHGA 2H76A 5D9WA 4MF6A 3MSZA 3J7Yk 2D2ZA 1F3AA 2H1DA 5IM9A 1MD3A 1ILOA 4PUAA 2NVLA 2C4JA 3VI7A 1WWJA 4F0CA 4HQZA 3WGEA 3BBYA 3L9UA 4GF0A 1WMJA 4ICYA 1YDKA 5ECKB 2HLSA 2H6ZA 1F37A 4NPBA 1V57A 2O89A 2FD3A 4MJBA 2ALBA 1NHYA 4BPYA 4MZCA 2E7PA 2YWMA 5LD0A 5IMDA 2PERA 2HRKA 3WYWA 2XPEA 5GZZB 1PA3A 1RW1A 11GSA 4P3YB 1XVQA 3GH9A 2E0QA 1TXXA 1R4WA 2KP2A 3ERWA 1YEXA 3KMNA 3A5IA 2C0FA 2FCHA 5ECSA 4ULXA 4KSMA 1TU8A 3GYKA 1T3BA 2H0HA 1MDJA 6GSYA 1YZXA 4V2NA 5ID2A 3BCIA 4GCIA 2GGTA 4MNNA 2OKAA 3HJPA 5A4UA 3A2XA 1K0OA 2LQOA 4RQXA 4YQUA 1GSUA 5JWQB 1X5EA 4EDZA 3KIJA 4MLYA 3BJ5A 2HT9A 3PH9A 2DJ0A 2GTUA 3GL3A 3GN3A 4MJAA 1H4OA 2KLXA 2L4CA 3BD2A 3ZLPA 1G0TA 3DRNA 4X1UA 4HJMA 4WKWA 2MBTA 2F8AA 4K0NA 6GSVA 1M3JA 4PURA 2AHEA 4ZB6A 4PNGA 4ECBA 2FHEA 3J7Yb 4IHUA 3GKNA 3QAWA 2QA1A 5AGYA 4TR0A 4LL4B 1AAZA 3N9JA 2RIIA 3ZZXA 4I6XA 2ES7A 1XPVA 3Q74A 1TP9A 4XRAA 2NBSA 2GSTA 2LRTA 2MZCA 4DSSB 3D22A 4MZWA 3UBKA 5JCUA 2IMIA 3A3TA 1O81A 1V2AA 2GQKA 3K8NA 4JBBA 3F3QA 3TJKA 2GSQA 5DAKB 1EOGA 2DMMA 2XBQA 2R2JA 3W6GA 1EGOA 3GKMA 1TK0B 1A2JA 5A4WA 1XCCA 3UVHA 2YNXA 1A2MA 3CXGA 3TRQA 4EIQA 3C73A 1ZL9A 2C1YA 4HS1A 1S3DA 1WOUA 4POKA 4X4JA 2B1KA 2AJQB 2K9FA 3EURA 3IR4A 4H86A 2IFQA 1GWCA 4V2MA 3TDGA 4O7HA 1GTAA 2PWJA 4G0LA 1GUMA 4OFTA 5CRHA 5AN1A 3RPNA 2P0GA 3M9JA 3LXZA 4PTSA 1K0DA 3VWUA 3M9KA 2YWNA 4BVYB 5DBQA 2B5XA 4K5RA 3EU3A 5E4WA 4PQHA 4IQ1A 1Z6MA 2WULA 3TKRA 3NOFA 1JZRA 5CRDA 2EC4A 3MIXA 1J0FA 3CRUA 3KTLA 5ECRB 2FLSA 4K7NA 5H5RA 3RBTA 1GLQA 2BMXA 4BVXA 3BOAA 3WT2A 3TCOA 1MEKA 1RQMA 4TVEA 12GSA 3FZ4A 3FZ5A 1O7UA 4NHWA 1XVWA 3TKQA 4ZILA 3NIVA 3DMLA 3FYGA 3VLNA 4L0UA 1G7EA 1K0CA 2YZUA 3GH6A 4K7IA 3RHCA 1XFLA 3C8EA 4I2TA 3QD9A 3ISOA 5FHIA 3CTGA 2HZFA 3EU4A 4ZL9A 1M7TA 4TXOB 4QL9A 2VL9A 5BRTA 5F06A 4LLRA 1SJIA 1AW9A 2FY6A 1W4VA 2AAWA 4CDOA 2FA8A 2X8HA 4WR4A 3TOUA 1EV9A 4IP6A 20GSA 3HA9A 3QMXA 5KN3A 5B6NA 2H6XA 5IQYA 1FHEA 4TR4A 3TKSC 2RUEA 4TR3A 1KEBA 4G0KA 5IMCA 1M9AA 2I4AA 2JZTA 1FG4A 3EVIA 1FO5A 1WJKA 4AJ7A 5IOXA 3GSSA 5DALB 2IIYA 1GRXA 4GLTA 4KCEA 2WRTA 2BTOT 4EIPA 1GSSA 3GFKA 2HSHA 1M9BA 3TB2A 4ZBDA 3KMOA 4PXOA 4ID0A 1J9BA 1GH2A 3F4SA 2GLRA 3TRXA 1SU9A 4K1FA 5CRGA 5H5SA 2LQQA 1ERWA 3CSIA 3APQA 1A24A 2WCIA 5EY6A 4CY6A 1AIUA 1HD2A 3ZITA 1Q4JA 1VF1A 1TW9A 5ECOB 3TJJA 2IMFA 3HXSA 1URMA 3F4RA 4YKFA 1H75A 5CYYA 4TN8A 1QUWA 2E2GA 2YANA 4NV5A 4O32A 2WGRA 1OC8A 2VCTA 1DE2A 2J23A 2VCXA 4XS1A 2H1AA 2OBKA 3D4TA 1TRWA 9GSSA 1T4YA 2G0FA 4JZQA 1S3RA 3IV4A 3HVSA 2ZCTA 2H19A 4Z2UA 2HNLA 5ELGA 3DVWA 2JSZA 2CVKA 2WZ9A 1JFUA 3A5WA 4OFMA 2IL3A 2GS3A 5CRWA 1V98A 3IAM2 1M99A 5KN0A 1ZMAA 2X49A 3LYKA 3G7YA 3HD5A 5HQPA 3HJOA 3L9VA 4ILFA 4K2DA 4PX1A 2DKHA 5CAXA 1Z5YE 4IELA 4L8EA 3ZFLA 2TIRA 2HRFA 1GTIA 4Z7XA 5C04A 4ML1A 1F9MA 4JE1A 4MA9A 4TRXA 2OE3A 3DIEA 3Q6OA 4A5PA 1V9WA 4WBRD 2XBIA 4MP4A 3KH7A 4GSTA 3GTUA 3R2QA 3LGCA 2GZPA 1BX9A 4AJ6A 2P5QA 2B3SA 2LEGA 1XXUA 3ZREA 1QFNA 1TI3A 4IQAA 2O85A 6GSUA 3VWVA 3GIXA 4KSOA 5IMVA 4LMWA 1LBKA 2YZHA 6GSTA 4EO3A 4JEDA 3PINA 5HR0A 1OAZA 3UVTA 3SBCA 2FUG2 2VAFA 2GZYA 2H75A 1ZYQB 2KP1A 2YOIA 4XS4A 1FOHA 2MMOA 3LSZA 1NW2A 2LKUA 2HZEB 1X5CA 1W89A 4WBJA 1AC1A 2IWTA 3KJYA 2JZRA 1AQVA 1E2YA 1DBYA 3ZRDA 1OVNA 1Z9HA 1FAAA 2IJYA 1K0MA 3APSA 4K5SA 3US3A 3C71A 4FO5A 3QCPA 3QDNA 4NHZA 2EIRA 3FZ9A 1ERVA 5ECQB 3F63A 1ZGNA 2DJ1A 4YH2A 1R26A 2L4QA 3ME8A 4ML6A 2VIMA 3EMXA 1XWCA 4RI7A 2FWHA 4K8MA 2R6KA 1WE0A 2AYTA 3IK7A 1WP0A 2VD1A 2WB9A 1I5GA 4RQRA 5F8BA 3PGTA 2DC5A 4IVFA 2JL4A 4HEA2 4V2LA 2VOCA 3LEFA 1PD21 1SD8A 3W8SA 1BJXA 4J2FA 4DVCA 2IMKA 3F3RA 5CO3A 1B9YC 5CP1A 4G9HA 2LRNA 2OE1A 4IP1A 4PNFA 3KTBA 2CX3A 2HRNA 2X64A 2HI7A 1PQNA 2LV3A 4AGSA 3ZFBA 3P2AA 4KAEA 5ECNB 4CW9A 4O92A 1X5DA 2H1GA 4MF5A 4MPFA 3KM6A 2R37A 4DSSA 1UVZA 2LNSA 1QMVA 2C8UA 7GSSA 4DSRA 2B6MA 2L57A 1KTEA 1YJ6A 3IOSA 2CV4A 5G5FA 3DVXA 1GULA 4OFNA 3E0UA 4K2XA 1EP8A 4NMUA 1K0NA 2Z9SA 5A5KA 4F82A 3N5OA 3CQFA 3SWLA 1QXHA 4OMVA 2XC2A 1Z3EA 3HY2A 3F4TA 4K9ZA 2J9HA 2R0GA 4I97A 1K3LA 1A23A 2QA2A 3D4MA 2YPMA 3UOMA 2VM1A 2ZNMA 3RAZA 2H8LA 4HOJA 3FW2A 2PBJA 2MMZA 4OWYA 4MMMA 2OA7A 3LQ7A 3G7JA 4LA1A 1PX6A 5J3RA 3O3TA 3FY7A 5ECPB 2K8SA 2HSMA 2X99A 3H8QA 1FB6A 3UMAA 1GSFA 2I1UA 3CSHA 3Q18A 1XIYA 1KBNA 2JU5A 1SD9A 2F9SA 2IMDA 5CNWA 4Q5FA 5D9XA 4F9ZA 2RUFA 4F03A 2C80A 2H1BA 2E2MA 5KN1A 1MDKA 3F6FA 5IMAA 3I43A 4ZL7A 1TK5B 4ZIJA 4V1Ap 1BEDA 2HE3A 2M46A 1MDIA 4FYUA 3TOTA 2MMAA 3QAVA 4BA7A 5G5EA 4BL7A 3TJGA 1T8EB 4XCSA 5FWGA 5GSSA 3QOUA 1GTBA 2F3MA 2PGTA 2DLXA 3PPUA 1PFOA 2CZ3A 1AXDA 4ZXGA 2VL2A 5JCWA 4IBPA 2GSSA 1EEJA 4KX4A 3AY8A 1U3IA 4IW9A 2GQMA 5AIXA 4CHSA 5ID2B 4ECCA 3I6AA 4MZBA 5J5NA 1YQ1A 2VCVA 2C0DA 3O6TA 1SK1A 1JHBA 2V41A 3H1NA 1TDIA 2MYGA 4KUNA 19GSA 1TU7A 3W8JA 5D93A 5G1LA 2I81A 4Q5NA 1SJ6A 4L5LA 17GSA 2DMLA 1B4PA 3S9FA 3TKSE 4MPGA 1JZWA 4ECIA 4EUYA 3L78A 5E59A 3MNGA 4FH8A 4G10A 4QL7A 3F9UA 2OJLA 4EKZA 2HRAA 1FW1A 2LSTA 1M3IA 2OACA 2A2SA 1TRUA 1OC3A 3PR8A 1GNWA 10GSA 3KCMA 4HU7A 4L5OA 2AB6A 1DUGA 5J9CA 1SKSB 2EIQA 3LORA 4ZBAA 1C72A 1T1VA 2H0GA 2GZZA 4ECJA 3QAGA 4PGTA 3ZVJD 3C7MA 4PQIA 1Y6EA 5EVOA 4OO4A 2R3XA 5B6MA 4I5QA 1EZKA 3F8UA 1GP1A 2GSRA 1ON4A 2ZUPA 4NWYA 2LRCA 3H4KA 4TKYA 1EEMA 5J4UA 4XS6A 5IPGA 2VLUA 2RM6A 4DEJA 3WGXA 3LJRA 1A2LA 3HZ4A 4EC0A 5IO0A 4WF4A 3FR9A 5G1KA 1PN0A 3TKPA 3DGQA 5KN2A 1DSBA 2B5EA 4PUFC 5F07A 5GSTA 2HSYA 1GSYA 5COHA 2IFQB 1OYJA 3NZNA 3CTFA 2V32A 2K18A 2TRCP 1TOFA 3P8WA 4K0GA 1SK0A 2YV7A 3UIWA 2P5RA 3P90A 3EC3A 5LCZA 3ERGA 1SK2A 3GMFA 4GSSA 2YCDA 4HUAA 5IO2A 3VURA 4Z2TA 2CQ9A 3LW9A 3EMPA 4XTSA 1EV4A 4BIKA 3CRTA 3EYTA 1U3AA 3KXOA 4IN0A 3ZIVA 1OC9B 5J9BA 1RK4A 5AISA 1HYUA 4USSA 2X8CA 3MYDA 5HR3A 4MH3A 4JR6A 1T7PB 2MBSA 5KOXA 1G6YA 2QC7A 3JCML 5DQSA 1VRSD 2VO4A 1ERTA 4I8BA 4TR1A 3V1WA 4IKHA 1SL2B 1XWBA 4N10A 4BWSA 1GLPA 1I9DA 2P31A 3QFBC 4D73A 1B9XC 2WFCA 4FIWA 1ZYNA 4K6XA 1B4QA 1F6MC 1OE8A 3C1SA 4IS0A 1K0BA 2NPBA 5GAND 3LFLA 2V6KA 3HKRA 4KDUA 4N0ZA 2A4VA 1K3OA 2B1LA 4KDYA 3IK9A 1ST9A 4MDCA 2KOKA 3ZMKA 2DJJA 2NDOA 3UJ1A 2PVQA 3FHKA 4KA0A 1M2DA 4YAPA 2B7KA 4MABA 4IJ3A 3M3MA 1A0RP 2R0CA 5J41A 2L59A 2H66A 3APOA 4WF5A 2KHPA 4J57E 1THXA 4EDYA 4OCEA 3D0ZA 3GUSA 5ENUA 3HHVA 3FEUA 5CREA 2PU9C 4N11A 2DBCA 4EVMA 1USBA 3HZ8A 1U87A 2VL2C 1WIKA 3IPZA 4KF9A 2H72A 2I9HA 4AJ8A 1B48A 3F6DA 1TTZA 3VFIA 3GRXA 5KEJA 2H73A 2OBIA 1NHOA 2IN3A 5G31A 3IC8A 1EOHA 2O7KA 4X43A 1A0FA 3IC4A 2K8VA 4WR5A 2X8GA 3HVNA 4HDEA 16GSA 4EE0A 3LYPA 2M72A 2VLVA 5A4VA 4KB3A 1PGTA 1QQ2A 1T00A 5D96A 5F05A 4E8HA 4J56E 1HNCA 4OD7A 5DJMA 5DJLA 3GHAA 2QGVA 3IRAA 3FR6A 3GKKA 2O8VB 2VD0A 4GWRA 1PL1A 3ZIJA 2JZSA 4AF2A 4POLA 4MJCA 2A2RA 4KGIA 1YF1A 3GKXA 1GUKA 2C0EA 2BJXA 5IOWA 1LU4A 1YEPA 1R5PA 2R5GA 2H30A 1CQHA 3KH9A 4FYBA 3M8NA 5D8IA 3MWHA 2QKEA 2V1MA 3ZMLA 3D6IA 1R5AA 3HVXA 4WEYA 3CBUA 2LUSA 3KP8A 2FWGA 2I3YA 4HQSA 5B7CA 4GTUA 2LNTA 2R4VA 2RLIA 1EP7A 2AUVA 2AV4A 1SKWB 5HFKA 4KCAA 3FR3A 4O5UA 4XIHA 3GTUB 4X0XA 3HYPA 4BWQA 1K3YA 4LMVA 1TK8B 4V1Ag 1FVKA 1GSEA 1XWAA 2G2QA 3EINA 2H6YA 4E8EA 1U88A 1VF4A 4NAXA 1SL0B 4KDXA 1BAYA 3DXBA 4POBA 3TKSA 5B8AA 5H5QA 1BG5A 2PMTA 3M1GA 1PMTA 5DAKA 1T4ZA 3IDVA 4XHMA 2FWEA 4XS4B 2GDRA 3IE3A 2C3NA 1N2AA 3MAKA 3IAS2 3UL3A 5C00A
chains in the Genus database with same CATH topology
3CSJA 1YKCA 3GX0A 5IMFA 1A8YA 2FWFA 2HXKA 3FRCA 3C1RA 1X9WB 3L4NA 4FYCA 4MJEA 1X9MB 1BYEA 1GL8A 1ML6A 3U5RE 2DJ2A 2UZ8A 1UN2A 2L6CA 2YWOA 2LJAA 1O8WA 2V6OA 2CAIA 3DD3A 1JZDA 5DDLA 2RM5A 2TRXA 2LS5A 3GNJA 4G19A 1UC7A 3TGZA 4BVYA 3ZYWA 4EXJA 3H93A 5EL8A 4G2EA 4OCFA 1TI1A 4L0WA 4TOPA 14GSA 1ACVA 3HJMA 2OE0A 3D21A 1VF2A 1AUCA 3LXTA 4JR4A 4YAVA 3L9SA 1S3AA 4HI7A 2JADA 1NSWA 5ECLB 3EWLA 2EIOA 2GT6A 1TJDA 3LWAA 2V2GA 4KH7A 2QSIA 1WRYA 2H71A 3VWWA 4Q5RA 1V58A 4KNDA 5HFGA 3VPQA 1V40A 1F2EA 5HR2A 4N0VA 1PX7A 1EGRA 4TXOA 5D73A 2DJ3A 1SYXA 2VLTA 2ON5A 4PQ1A 5L71A 1SJZA 1ZZYA 2JSYA 2YP6A 2L6DA 2O87A 4IGJA 5G2ZA 4CY8A 4MH2A 2L5OA 5IIZA 4TW5A 3VI5A 5IPHA 1GUHA 5EPFA 2WS2A 4ZL8A 2YWIA 5LNKe 1XW9A 1J08A 2PPTA 3D5JA 3CMIA 3IA1A 2CA8A 1HNAA 1IYIA 4F2IA 3M0FA 1OE7A 1TRVA 2VCQA 5DALA 1JLWA 2F8FA 4O5RA 4GQFA 1VF3A 1YF0A 3QR6A 2CX4A 2VCWA 1THOA 2PVOC 3I69A 1R7HA 2VUPA 3GURA 4WETA 2X4AA 1OC9A 4LL1B 3DYRA 2YJ7A 18GSA 2WDUA 5ECMB 3ZL5A 1KNGA 1FB0A 2OADA 1U6TA 1OKDA 2A2PA 1FOVA 1ABAA 4JRRA 4WXTA 2YN1A 3ZVJA 3GSTA 4FQUA 4KW6A 4DSQA 2ON7A 3FKFA 2CT6A 5B8BA 1SYRA 3ED3A 3G7IA 5D9TA 4YKGA 1SENA 4BL7B 1SL1B 5KOWA 3TJFA 1TKDB 2WJUA 1LJRA 3DWVA 5HR1A 5ECIB 1AQXA 1BQ7A 1VGLA 3CYNA 1M0UA 3IXRA 3RHBA 4Q5QA 3IBHA 4HZ4A 1GSDA 4MF7A 2B7JA 3DEXA 2FNOA 3R3EA 3KZQA 2A4HA 1XWKA 2H0IA 2MMNA 4OO5A 5IMZA 2N5BA 8GSSA 1X9SB 4F0BA 3UARA 1A8LA 2DSAA 3KGKA 3OR5A 6GSSA 2DKIA 3FZAA 1GTUA 2LJKA 1F3BA 5JCGA 4POMA 3GX8A 1O6JA 5D9VA 5ABRA 4I2UA 4K7OA 3HDCA 1M2BA 1X0RA 2GQLA 3QPMA 1Z7RA 2HYXA 3GL5A 2H70A 22GSA 2L5LA 5ECHB 3RDWA 1Q98A 5JWOB 4BVXB 1XBSA 4O5QA 2NTOA 2DIZA 1O73A 1PKWA 3VK9A 1XWGA 2LJRA 1GSQA 1MTCA 2HFDA 3E3EA 3WGDA 4HU9A 3KEBA 1PSQA 4Z2RA 3KD0A 4QQ7A 2DIYA 2F51A 3L0HA 2C0GA 1SKRB 2XHFA 5DVBA 2XPDA 4HZ2A 2M80A 5FT3A 1E6BA 2HZEA 4HJ2A 3FK8A 1IYHA 6GSXA 3QFAC 2IPAA 3VWXA 1AQWA 5DCGA 3ME7A 5JWRB 3DKSA 5GAPD 3BCKA 4ACSA 2KUCA 1ZCPA 2LTKA 3UBLA 1JLVA 1K0AA 1Y25A 4RUVA 1ERUA 4NXIA 5INYA 3U6VA 2C3TA 4MCUA 4IJIA 3EE2A 3EPTA 2VCZA 5ELAA 3RPPA 3I9V2 1S3CA 1TRSA 2CAQA 2C3QA 3ZTLA 1OKTA 1PKZA 1XOBA 3MDKA 1G7OA 3HVVA 1M2AA 1ZOFA 3LG6A 4GRFA 4NV2A 4TXVA 4JU5A 4GXZA 3WD6A 1B8XA 2FGXA 5DCHA 4ZB8A 3H79A 3UEMA 1DE1A 3WT1A 13GSA 1WPIA 1FVJA 4GSNA 1YY7A 2VL3A 2FA4A 5BMUA 5AIVA 3IHQA 4EF0A 3F0IA 2YJHA 2REMA 1O8XA 1MD4A 2CVDA 1N8JA 5G30A 2PN8A 3TRPA 3TUEA 1O85A 2N5AA 3KP9A 1ZYEA 2DJKA 4XRDA 4EL1A 1XOAA 1JZOA 2PUKC 4TR1B 3TJBA 1PN9A 1XW6A 2IMEA 1CQGA 3FMWA 1QK8A 3G9BA 3A2VA 2N5FA 4YQVA 3P7XA 3A2WA 1G6WA 1PL2A 6GSWA 1EWXA 5HFIA 4G0IA 3GA4A 1PRXA 4D73B 1UA5A 2B5YA 4YQMA 4KE3A 2VM2A 5F0GA 4ZB9A 2K6VA 2CVBA 3VPTA 1HQOA 4GQCA 1QGVA 3ERFA 4ZBBA 1YKAA 2YV9A 1GNEA 4ISDA 1NM3A 3GV1A 3HCZA 4MK3A 1ZYPA 3E9JB 2GT5A 2GVPA 1XW5A 2JACA 2H01A 5DQYA 1Z6NA 1XZOA 4RI6A 3UAPA 1Z7PA 2CZ2A 4N30A 3O76A 2H74A 3Q19A 2R0PA 1HNBA 3IHGA 2H76A 5D9WA 4MF6A 3MSZA 3J7Yk 2D2ZA 1F3AA 2H1DA 5IM9A 1MD3A 1ILOA 4PUAA 2NVLA 2C4JA 3VI7A 1WWJA 4F0CA 4HQZA 3WGEA 3BBYA 3L9UA 4GF0A 1WMJA 4ICYA 1YDKA 5ECKB 2HLSA 2H6ZA 1F37A 4NPBA 1V57A 2O89A 2FD3A 4MJBA 2ALBA 1NHYA 4BPYA 4MZCA 2E7PA 2YWMA 5LD0A 5IMDA 2PERA 2HRKA 3WYWA 2XPEA 5GZZB 1PA3A 1RW1A 11GSA 4P3YB 1XVQA 3GH9A 2E0QA 1TXXA 1R4WA 2KP2A 3ERWA 1YEXA 3KMNA 3A5IA 2C0FA 2FCHA 5ECSA 4ULXA 4KSMA 1TU8A 3GYKA 1T3BA 2H0HA 1MDJA 6GSYA 1YZXA 4V2NA 5ID2A 3BCIA 4GCIA 2GGTA 4MNNA 2OKAA 3HJPA 5A4UA 3A2XA 1K0OA 2LQOA 4RQXA 4YQUA 1GSUA 5JWQB 1X5EA 4EDZA 3KIJA 4MLYA 3BJ5A 2HT9A 3PH9A 2DJ0A 2GTUA 3GL3A 3GN3A 4MJAA 1H4OA 2KLXA 2L4CA 3BD2A 3ZLPA 1G0TA 3DRNA 4X1UA 4HJMA 4WKWA 2MBTA 2F8AA 4K0NA 6GSVA 4PURA 2AHEA 4ZB6A 4PNGA 4ECBA 2FHEA 3J7Yb 4IHUA 3GKNA 3QAWA 2QA1A 5AGYA 4TR0A 4LL4B 1AAZA 3N9JA 2RIIA 3ZZXA 4I6XA 2ES7A 1XPVA 3Q74A 1TP9A 4XRAA 2NBSA 2GSTA 2LRTA 2MZCA 4DSSB 3D22A 4MZWA 3UBKA 5JCUA 2IMIA 3A3TA 1O81A 1V2AA 2GQKA 3K8NA 4JBBA 3F3QA 3TJKA 2GSQA 5DAKB 1EOGA 2DMMA 2XBQA 2R2JA 3W6GA 1EGOA 3GKMA 1TK0B 1A2JA 5A4WA 1XCCA 3UVHA 2YNXA 1A2MA 3CXGA 3TRQA 4EIQA 3C73A 1ZL9A 2C1YA 4HS1A 1S3DA 1WOUA 4POKA 4X4JA 2B1KA 2AJQB 2K9FA 3EURA 3IR4A 4H86A 2IFQA 1GWCA 4V2MA 3TDGA 4O7HA 1GTAA 2PWJA 4G0LA 1GUMA 4OFTA 5CRHA 5AN1A 3RPNA 2P0GA 3M9JA 3LXZA 4PTSA 1K0DA 3VWUA 3M9KA 2YWNA 4BVYB 5DBQA 2B5XA 4K5RA 3EU3A 5E4WA 4PQHA 4IQ1A 1Z6MA 2WULA 3TKRA 3NOFA 1JZRA 5CRDA 2EC4A 3MIXA 1J0FA 3CRUA 3KTLA 5ECRB 2FLSA 4K7NA 5H5RA 3RBTA 1GLQA 2BMXA 4BVXA 3BOAA 3WT2A 3TCOA 1MEKA 1RQMA 4TVEA 12GSA 3FZ4A 3FZ5A 1O7UA 4NHWA 1XVWA 3TKQA 4ZILA 3NIVA 3DMLA 3FYGA 3VLNA 4L0UA 1G7EA 1K0CA 2YZUA 3GH6A 4K7IA 3RHCA 1XFLA 3C8EA 4I2TA 3QD9A 3ISOA 5FHIA 3CTGA 2HZFA 3EU4A 4ZL9A 1M7TA 4TXOB 4QL9A 2VL9A 5BRTA 5F06A 4LLRA 1SJIA 1AW9A 2FY6A 1W4VA 2AAWA 4CDOA 2FA8A 2X8HA 4WR4A 3TOUA 1EV9A 4IP6A 20GSA 3HA9A 3QMXA 5KN3A 5B6NA 2H6XA 5IQYA 1FHEA 4TR4A 3TKSC 2RUEA 4TR3A 1KEBA 4G0KA 5IMCA 1M9AA 2I4AA 2JZTA 1FG4A 3EVIA 1FO5A 1WJKA 4AJ7A 5IOXA 3GSSA 5DALB 2IIYA 1GRXA 4GLTA 4KCEA 2WRTA 2BTOT 4EIPA 1GSSA 3GFKA 2HSHA 1M9BA 3TB2A 4ZBDA 3KMOA 4PXOA 4ID0A 1J9BA 1GH2A 3F4SA 2GLRA 3TRXA 1SU9A 4K1FA 5CRGA 5H5SA 2LQQA 1ERWA 3CSIA 3APQA 1A24A 2WCIA 5EY6A 4CY6A 1AIUA 1HD2A 3ZITA 1Q4JA 1VF1A 1TW9A 5ECOB 3TJJA 2IMFA 3HXSA 1URMA 3F4RA 4YKFA 1H75A 5CYYA 4TN8A 1QUWA 2E2GA 2YANA 4NV5A 4O32A 2WGRA 1OC8A 2VCTA 1DE2A 2J23A 2VCXA 4XS1A 2H1AA 2OBKA 3D4TA 1TRWA 9GSSA 1T4YA 2G0FA 4JZQA 3IV4A 3HVSA 2ZCTA 2H19A 4Z2UA 2HNLA 5ELGA 3DVWA 2JSZA 2CVKA 2WZ9A 1JFUA 3A5WA 4OFMA 2IL3A 2GS3A 5CRWA 1V98A 3IAM2 1M99A 5KN0A 1ZMAA 2X49A 3LYKA 3G7YA 3HD5A 5HQPA 3HJOA 3L9VA 4ILFA 4K2DA 4PX1A 2DKHA 5CAXA 1Z5YE 4IELA 4L8EA 3ZFLA 2TIRA 2HRFA 1GTIA 4Z7XA 5C04A 4ML1A 1F9MA 4JE1A 4MA9A 4TRXA 2OE3A 3DIEA 3Q6OA 4A5PA 1V9WA 4WBRD 2XBIA 4MP4A 3KH7A 4GSTA 3GTUA 3R2QA 3LGCA 2GZPA 1BX9A 4AJ6A 2P5QA 2B3SA 2LEGA 1XXUA 3ZREA 1QFNA 1TI3A 4IQAA 2O85A 6GSUA 3VWVA 3GIXA 4KSOA 5IMVA 4LMWA 1LBKA 2YZHA 6GSTA 4EO3A 4JEDA 3PINA 5HR0A 1OAZA 3UVTA 3SBCA 2FUG2 2VAFA 2GZYA 2H75A 1ZYQB 2KP1A 2YOIA 4XS4A 1FOHA 2MMOA 3LSZA 1NW2A 2LKUA 2HZEB 1X5CA 1W89A 4WBJA 1AC1A 2IWTA 3KJYA 2JZRA 1AQVA 1E2YA 1DBYA 3ZRDA 1OVNA 1Z9HA 1FAAA 2IJYA 1K0MA 3APSA 4K5SA 3US3A 3C71A 4FO5A 3QCPA 3QDNA 4NHZA 2EIRA 3FZ9A 1ERVA 5ECQB 3F63A 1ZGNA 2DJ1A 4YH2A 1R26A 2L4QA 3ME8A 4ML6A 2VIMA 3EMXA 1XWCA 4RI7A 2FWHA 4K8MA 2R6KA 1WE0A 2AYTA 3IK7A 1WP0A 2VD1A 2WB9A 1I5GA 4RQRA 5F8BA 3PGTA 2DC5A 4IVFA 2JL4A 4HEA2 4V2LA 2VOCA 3LEFA 1PD21 1SD8A 3W8SA 1BJXA 4J2FA 4DVCA 2IMKA 3F3RA 5CO3A 1B9YC 5CP1A 4G9HA 2LRNA 2OE1A 4IP1A 4PNFA 3KTBA 2CX3A 2HRNA 2X64A 2HI7A 1PQNA 2LV3A 4AGSA 3ZFBA 3P2AA 4KAEA 5ECNB 4CW9A 4O92A 1X5DA 2H1GA 4MF5A 4MPFA 3KM6A 2R37A 4DSSA 1UVZA 2LNSA 1QMVA 2C8UA 7GSSA 4DSRA 2B6MA 2L57A 1KTEA 1YJ6A 3IOSA 2CV4A 5G5FA 3DVXA 1GULA 4OFNA 3E0UA 4K2XA 1EP8A 4NMUA 1K0NA 2Z9SA 5A5KA 4F82A 3N5OA 3SWLA 1QXHA 4OMVA 2XC2A 1Z3EA 3HY2A 3F4TA 4K9ZA 2J9HA 2R0GA 4I97A 1K3LA 1A23A 2QA2A 3D4MA 2YPMA 3UOMA 2VM1A 2ZNMA 3RAZA 2H8LA 4HOJA 3FW2A 2PBJA 2MMZA 4OWYA 4MMMA 2OA7A 3LQ7A 3G7JA 4LA1A 1PX6A 5J3RA 3O3TA 3FY7A 5ECPB 2K8SA 2HSMA 2X99A 3H8QA 1FB6A 3UMAA 1GSFA 2I1UA 3CSHA 3Q18A 1XIYA 1KBNA 2JU5A 1SD9A 2F9SA 2IMDA 5CNWA 4Q5FA 5D9XA 4F9ZA 2RUFA 4F03A 2C80A 2H1BA 2E2MA 5KN1A 1MDKA 3F6FA 5IMAA 3I43A 4ZL7A 1TK5B 4ZIJA 4V1Ap 1BEDA 2HE3A 2M46A 1MDIA 4FYUA 3TOTA 2MMAA 3QAVA 4BA7A 5G5EA 4BL7A 3TJGA 1T8EB 4XCSA 5FWGA 5GSSA 3QOUA 1GTBA 2F3MA 2PGTA 2DLXA 3PPUA 2CZ3A 1AXDA 4ZXGA 2VL2A 5JCWA 4IBPA 2GSSA 1EEJA 4KX4A 3AY8A 1U3IA 4IW9A 2GQMA 5AIXA 4CHSA 5ID2B 4ECCA 3I6AA 4MZBA 5J5NA 1YQ1A 2VCVA 2C0DA 3O6TA 1SK1A 1JHBA 2V41A 3H1NA 1TDIA 2MYGA 4KUNA 19GSA 1TU7A 3W8JA 5D93A 5G1LA 2I81A 4Q5NA 1SJ6A 4L5LA 17GSA 2DMLA 1B4PA 3S9FA 3TKSE 4MPGA 1JZWA 4ECIA 4EUYA 3L78A 5E59A 3MNGA 4FH8A 4G10A 4QL7A 3F9UA 2OJLA 4EKZA 2HRAA 1FW1A 2LSTA 2OACA 2A2SA 1TRUA 1OC3A 3PR8A 1GNWA 10GSA 3KCMA 4HU7A 4L5OA 2AB6A 1DUGA 5J9CA 1SKSB 2EIQA 3LORA 4ZBAA 1C72A 1T1VA 2H0GA 2GZZA 4ECJA 3QAGA 4PGTA 3ZVJD 3C7MA 4PQIA 1Y6EA 5EVOA 4OO4A 2R3XA 5B6MA 4I5QA 1EZKA 3F8UA 1GP1A 2GSRA 1ON4A 2ZUPA 4NWYA 2LRCA 3H4KA 4TKYA 1EEMA 5J4UA 4XS6A 5IPGA 2VLUA 2RM6A 4DEJA 3WGXA 3LJRA 1A2LA 3HZ4A 4EC0A 5IO0A 4WF4A 3FR9A 5G1KA 1PN0A 3TKPA 3DGQA 5KN2A 1DSBA 2B5EA 4PUFC 5F07A 5GSTA 2HSYA 1GSYA 5COHA 2IFQB 1OYJA 3NZNA 3CTFA 2V32A 2K18A 2TRCP 1TOFA 3P8WA 4K0GA 1SK0A 2YV7A 3UIWA 2P5RA 3P90A 3EC3A 5LCZA 3ERGA 1SK2A 3GMFA 4GSSA 2YCDA 4HUAA 5IO2A 3VURA 4Z2TA 2CQ9A 3LW9A 3EMPA 4XTSA 1EV4A 3CRTA 3EYTA 1U3AA 3KXOA 4IN0A 3ZIVA 1OC9B 5J9BA 1RK4A 5AISA 1HYUA 4USSA 2X8CA 3MYDA 5HR3A 4MH3A 4JR6A 1T7PB 2MBSA 5KOXA 1G6YA 2QC7A 3JCML 5DQSA 1VRSD 2VO4A 1ERTA 4I8BA 4TR1A 3V1WA 4IKHA 1SL2B 1XWBA 4N10A 4BWSA 1GLPA 1I9DA 2P31A 3QFBC 4D73A 1B9XC 2WFCA 4FIWA 1ZYNA 4K6XA 1B4QA 1F6MC 1OE8A 3C1SA 4IS0A 1K0BA 2NPBA 5GAND 3LFLA 2V6KA 3HKRA 4KDUA 4N0ZA 2A4VA 1K3OA 2B1LA 4KDYA 3IK9A 1ST9A 4MDCA 2KOKA 3ZMKA 2DJJA 2NDOA 3UJ1A 2PVQA 3FHKA 4KA0A 1M2DA 4YAPA 2B7KA 4MABA 4IJ3A 3M3MA 1A0RP 2R0CA 5J41A 2L59A 2H66A 3APOA 4WF5A 2KHPA 4J57E 1THXA 4EDYA 4OCEA 3D0ZA 3GUSA 5ENUA 3HHVA 3FEUA 5CREA 2PU9C 4N11A 2DBCA 4EVMA 1USBA 3HZ8A 1U87A 2VL2C 1WIKA 3IPZA 4KF9A 2H72A 2I9HA 4AJ8A 1B48A 3F6DA 1TTZA 3VFIA 3GRXA 5KEJA 2H73A 2OBIA 1NHOA 2IN3A 5G31A 3IC8A 1EOHA 2O7KA 4X43A 1A0FA 3IC4A 2K8VA 4WR5A 2X8GA 4HDEA 16GSA 4EE0A 3LYPA 2M72A 2VLVA 5A4VA 4KB3A 1PGTA 1QQ2A 1T00A 5D96A 5F05A 4E8HA 4J56E 1HNCA 4OD7A 5DJMA 5DJLA 3GHAA 2QGVA 3IRAA 3FR6A 3GKKA 2O8VB 2VD0A 4GWRA 1PL1A 3ZIJA 2JZSA 4AF2A 4POLA 4MJCA 2A2RA 4KGIA 1YF1A 3GKXA 1GUKA 2C0EA 2BJXA 5IOWA 1LU4A 1YEPA 1R5PA 2R5GA 2H30A 1CQHA 3KH9A 4FYBA 3M8NA 5D8IA 3MWHA 2QKEA 2V1MA 3ZMLA 3D6IA 1R5AA 3HVXA 4WEYA 3CBUA 2LUSA 3KP8A 2FWGA 2I3YA 4HQSA 5B7CA 4GTUA 2LNTA 2R4VA 2RLIA 1EP7A 2AUVA 2AV4A 1SKWB 5HFKA 4KCAA 3FR3A 4O5UA 4XIHA 3GTUB 4X0XA 3HYPA 4BWQA 1K3YA 4LMVA 1TK8B 4V1Ag 1FVKA 1GSEA 1XWAA 2G2QA 3EINA 2H6YA 4E8EA 1U88A 1VF4A 4NAXA 1SL0B 4KDXA 1BAYA 3DXBA 4POBA 3TKSA 5B8AA 5H5QA 1BG5A 2PMTA 3M1GA 1PMTA 5DAKA 1T4ZA 3IDVA 4XHMA 2FWEA 4XS4B 2GDRA 3IE3A 2C3NA 1N2AA 3MAKA 3IAS2 3UL3A 5C00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CSJ A;  1YKC A;  3GX0 A;  5IMF A;  1A8Y A;  2FWF A;  2HXK A;  3FRC A;  3C1R A;  1X9W B;  3L4N A;  4FYC A;  4MJE A;  1X9M B;  1BYE A;  1GL8 A;  1ML6 A;  3U5R E;  2DJ2 A;  1UN2 A;  2L6C A;  2YWO A;  2LJA A;  1O8W A;  2V6O A;  2CAI A;  3DD3 A;  1JZD A;  5DDL A;  2RM5 A;  2TRX A;  2LS5 A;  3GNJ A;  4G19 A;  1UC7 A;  3TGZ A;  4BVY A;  3ZYW A;  4EXJ A;  3H93 A;  5EL8 A;  4G2E A;  4OCF A;  1TI1 A;  4L0W A;  4TOP A;  14GS A;  1ACV A;  3HJM A;  2OE0 A;  3D21 A;  1VF2 A;  1AUC A;  3LXT A;  4JR4 A;  4YAV A;  3L9S A;  1S3A A;  4HI7 A;  2JAD A;  1NSW A;  5ECL B;  3EWL A;  2EIO A;  2GT6 A;  1TJD A;  3LWA A;  2V2G A;  4KH7 A;  2QSI A;  1WRY A;  2H71 A;  3VWW A;  4Q5R A;  1V58 A;  4KND A;  5HFG A;  3VPQ A;  1V40 A;  1F2E A;  5HR2 A;  4N0V A;  1PX7 A;  1EGR A;  4TXO A;  5D73 A;  2DJ3 A;  1SYX A;  2VLT A;  2ON5 A;  4PQ1 A;  5L71 A;  1SJZ A;  1ZZY A;  2JSY A;  2YP6 A;  2L6D A;  2O87 A;  4IGJ A;  5G2Z A;  4MH2 A;  2L5O A;  5IIZ A;  4TW5 A;  3VI5 A;  5IPH A;  1GUH A;  5EPF A;  2WS2 A;  4ZL8 A;  2YWI A;  5LNK e;  1XW9 A;  1J08 A;  2PPT A;  3D5J A;  3CMI A;  3IA1 A;  2CA8 A;  1HNA A;  1IYI A;  4F2I A;  3M0F A;  1OE7 A;  1TRV A;  2VCQ A;  5DAL A;  1JLW A;  2F8F A;  4O5R A;  4GQF A;  1VF3 A;  1YF0 A;  3QR6 A;  2CX4 A;  2VCW A;  1THO A;  2PVO C;  3I69 A;  1R7H A;  2VUP A;  3GUR A;  4WET A;  1OC9 A;  4LL1 B;  3DYR A;  2YJ7 A;  18GS A;  2WDU A;  5ECM B;  3ZL5 A;  1KNG A;  1FB0 A;  2OAD A;  1U6T A;  1OKD A;  1FOV A;  1ABA A;  4JRR A;  4WXT A;  2YN1 A;  3ZVJ A;  3GST A;  4KW6 A;  4DSQ A;  2ON7 A;  3FKF A;  2CT6 A;  5B8B A;  1SYR A;  3ED3 A;  3G7I A;  5D9T A;  1SEN A;  1SL1 B;  3TJF A;  1TKD B;  2WJU A;  1LJR A;  3DWV A;  5HR1 A;  5ECI B;  1AQX A;  1BQ7 A;  1VGL A;  3CYN A;  1M0U A;  3IXR A;  3RHB A;  4Q5Q A;  3IBH A;  4HZ4 A;  1GSD A;  4MF7 A;  2B7J A;  3DEX A;  2FNO A;  3KZQ A;  1XWK A;  2H0I A;  2MMN A;  4OO5 A;  5IMZ A;  2N5B A;  8GSS A;  1X9S B;  4F0B A;  3UAR A;  1A8L A;  2DSA A;  3KGK A;  3OR5 A;  6GSS A;  3FZA A;  1GTU A;  2LJK A;  1F3B A;  5JCG A;  4POM A;  3GX8 A;  1O6J A;  5D9V A;  5ABR A;  4I2U A;  4K7O A;  3HDC A;  1M2B A;  1X0R A;  2GQL A;  3QPM A;  1Z7R A;  2HYX A;  3GL5 A;  2H70 A;  22GS A;  5ECH B;  2L5L A;  3RDW A;  1Q98 A;  5JWO B;  1XBS A;  2NTO A;  2DIZ A;  1O73 A;  1PKW A;  3VK9 A;  1XWG A;  2LJR A;  1GSQ A;  1MTC A;  2HFD A;  3E3E A;  3WGD A;  4HU9 A;  3KEB A;  1PSQ A;  3KD0 A;  4QQ7 A;  2DIY A;  2F51 A;  3L0H A;  2C0G A;  1SKR B;  2XHF A;  5DVB A;  2XPD A;  4HZ2 A;  2M80 A;  5FT3 A;  1E6B A;  2HZE A;  4HJ2 A;  3FK8 A;  1IYH A;  6GSX A;  3QFA C;  2IPA A;  3VWX A;  1AQW A;  5DCG A;  3ME7 A;  5JWR B;  3DKS A;  5GAP D;  3BCK A;  4ACS A;  2KUC A;  1ZCP A;  2LTK A;  3UBL A;  1JLV A;  1K0A A;  1Y25 A;  4RUV A;  1ERU A;  4NXI A;  5INY A;  3U6V A;  2C3T A;  4MCU A;  4IJI A;  3EE2 A;  2VCZ A;  5ELA A;  3RPP A;  3I9V 2;  1S3C A;  1TRS A;  2CAQ A;  2C3Q A;  3ZTL A;  1OKT A;  1PKZ A;  1XOB A;  3MDK A;  1G7O A;  3HVV A;  1M2A A;  1ZOF A;  3LG6 A;  4GRF A;  4NV2 A;  4TXV A;  4JU5 A;  4GXZ A;  3WD6 A;  1B8X A;  2FGX A;  5DCH A;  4ZB8 A;  3H79 A;  3UEM A;  1DE1 A;  3WT1 A;  13GS A;  1WPI A;  1FVJ A;  4GSN A;  1YY7 A;  2VL3 A;  2FA4 A;  5AIV A;  3IHQ A;  4EF0 A;  3F0I A;  2YJH A;  2REM A;  1O8X A;  1MD4 A;  2CVD A;  1N8J A;  5G30 A;  2PN8 A;  3TRP A;  3TUE A;  1O85 A;  2N5A A;  3KP9 A;  1ZYE A;  2DJK A;  4XRD A;  4EL1 A;  1XOA A;  1JZO A;  2PUK C;  4TR1 B;  3TJB A;  1PN9 A;  1XW6 A;  2IME A;  1CQG A;  1QK8 A;  3G9B A;  3A2V A;  2N5F A;  4YQV A;  3P7X A;  3A2W A;  1G6W A;  1PL2 A;  6GSW A;  1EWX A;  5HFI A;  3GA4 A;  1PRX A;  4D73 B;  1UA5 A;  2B5Y A;  4YQM A;  4KE3 A;  2VM2 A;  5F0G A;  4ZB9 A;  2K6V A;  2CVB A;  3VPT A;  1HQO A;  4GQC A;  1QGV A;  3ERF A;  4ZBB A;  1YKA A;  2YV9 A;  1GNE A;  4ISD A;  1NM3 A;  3GV1 A;  3HCZ A;  4MK3 A;  3E9J B;  2GT5 A;  2GVP A;  1XW5 A;  2JAC A;  2H01 A;  5DQY A;  1Z6N A;  1XZO A;  4RI6 A;  3UAP A;  1Z7P A;  2CZ2 A;  4N30 A;  3O76 A;  2H74 A;  3Q19 A;  1HNB A;  2H76 A;  5D9W A;  4MF6 A;  3MSZ A;  3J7Y k;  2D2Z A;  1F3A A;  2H1D A;  5IM9 A;  1MD3 A;  1ILO A;  4PUA A;  2NVL A;  2C4J A;  3VI7 A;  1WWJ A;  4F0C A;  4HQZ A;  3WGE A;  3BBY A;  3L9U A;  4GF0 A;  1WMJ A;  1YDK A;  5ECK B;  2HLS A;  2H6Z A;  1F37 A;  4NPB A;  1V57 A;  2O89 A;  2FD3 A;  4MJB A;  2ALB A;  1NHY A;  4BPY A;  4MZC A;  2E7P A;  2YWM A;  5LD0 A;  5IMD A;  2PER A;  3WYW A;  2XPE A;  5GZZ B;  1PA3 A;  1RW1 A;  11GS A;  4P3Y B;  1XVQ A;  3GH9 A;  2E0Q A;  1TXX A;  1R4W A;  2KP2 A;  3ERW A;  1YEX A;  3KMN A;  2C0F A;  2FCH A;  5ECS A;  4ULX A;  4KSM A;  1TU8 A;  3GYK A;  1T3B A;  2H0H A;  1MDJ A;  6GSY A;  1YZX A;  4V2N A;  5ID2 A;  3BCI A;  4GCI A;  2GGT A;  2OKA A;  3HJP A;  5A4U A;  3A2X A;  1K0O A;  2LQO A;  4RQX A;  4YQU A;  1GSU A;  5JWQ B;  1X5E A;  4EDZ A;  3KIJ A;  4MLY A;  3BJ5 A;  2HT9 A;  3PH9 A;  2DJ0 A;  2GTU A;  3GL3 A;  3GN3 A;  4MJA A;  1H4O A;  2KLX A;  2L4C A;  3BD2 A;  3ZLP A;  1G0T A;  3DRN A;  4X1U A;  4HJM A;  4WKW A;  2MBT A;  2F8A A;  4K0N A;  6GSV A;  4PUR A;  2AHE A;  4ZB6 A;  4PNG A;  4ECB A;  2FHE A;  3J7Y b;  4IHU A;  3GKN A;  3QAW A;  5AGY A;  4TR0 A;  4LL4 B;  1AAZ A;  3N9J A;  2RII A;  3ZZX A;  4I6X A;  2ES7 A;  1XPV A;  3Q74 A;  1TP9 A;  4XRA A;  2NBS A;  2GST A;  2LRT A;  2MZC A;  4DSS B;  3D22 A;  4MZW A;  3UBK A;  5JCU A;  2IMI A;  3A3T A;  1O81 A;  1V2A A;  2GQK A;  3K8N A;  4JBB A;  3F3Q A;  3TJK A;  2GSQ A;  5DAK B;  1EOG A;  2DMM A;  2XBQ A;  2R2J A;  3W6G A;  1EGO A;  3GKM A;  1TK0 B;  1A2J A;  5A4W A;  1XCC A;  3UVH A;  2YNX A;  1A2M A;  3CXG A;  3TRQ A;  3C73 A;  1ZL9 A;  2C1Y A;  4HS1 A;  1S3D A;  1WOU A;  4POK A;  2B1K A;  2AJQ B;  2K9F A;  3EUR A;  3IR4 A;  4H86 A;  2IFQ A;  1GWC A;  4V2M A;  3TDG A;  4O7H A;  1GTA A;  2PWJ A;  1GUM A;  4OFT A;  5CRH A;  5AN1 A;  3RPN A;  2P0G A;  3M9J A;  3LXZ A;  1K0D A;  3VWU A;  3M9K A;  2YWN A;  5DBQ A;  2B5X A;  3EU3 A;  5E4W A;  4PQH A;  4IQ1 A;  1Z6M A;  2WUL A;  3TKR A;  3NOF A;  1JZR A;  5CRD A;  2EC4 A;  1J0F A;  3CRU A;  3KTL A;  5ECR B;  2FLS A;  4K7N A;  5H5R A;  3RBT A;  1GLQ A;  2BMX A;  4BVX A;  3BOA A;  3WT2 A;  3TCO A;  1MEK A;  1RQM A;  4TVE A;  12GS A;  3FZ4 A;  3FZ5 A;  1O7U A;  4NHW A;  1XVW A;  3TKQ A;  4ZIL A;  3NIV A;  3DML A;  3FYG A;  3VLN A;  4L0U A;  1G7E A;  1K0C A;  2YZU A;  3GH6 A;  4K7I A;  3RHC A;  1XFL A;  3C8E A;  4I2T A;  3QD9 A;  3ISO A;  5FHI A;  3CTG A;  2HZF A;  3EU4 A;  4ZL9 A;  1M7T A;  4TXO B;  4QL9 A;  2VL9 A;  5F06 A;  4LLR A;  1SJI A;  1AW9 A;  2FY6 A;  1W4V A;  2AAW A;  4CDO A;  2FA8 A;  2X8H A;  4WR4 A;  3TOU A;  1EV9 A;  4IP6 A;  20GS A;  3HA9 A;  3QMX A;  5KN3 A;  5B6N A;  2H6X A;  5IQY A;  1FHE A;  4TR4 A;  3TKS C;  2RUE A;  4TR3 A;  1KEB A;  5IMC A;  1M9A A;  2I4A A;  2JZT A;  1FG4 A;  3EVI A;  1FO5 A;  1WJK A;  4AJ7 A;  5IOX A;  3GSS A;  5DAL B;  2IIY A;  1GRX A;  4GLT A;  4KCE A;  2WRT A;  2BTO T;  1GSS A;  3GFK A;  2HSH A;  1M9B A;  3TB2 A;  4ZBD A;  3KMO A;  4PXO A;  4ID0 A;  1J9B A;  1GH2 A;  3F4S A;  2GLR A;  3TRX A;  1SU9 A;  4K1F A;  5CRG A;  5H5S A;  2LQQ A;  1ERW A;  3CSI A;  3APQ A;  1A24 A;  2WCI A;  5EY6 A;  1AIU A;  1HD2 A;  3ZIT A;  1Q4J A;  1VF1 A;  1TW9 A;  5ECO B;  3TJJ A;  2IMF A;  3HXS A;  1URM A;  3F4R A;  1H75 A;  5CYY A;  4TN8 A;  1QUW A;  2E2G A;  2YAN A;  4NV5 A;  4O32 A;  2WGR A;  1OC8 A;  2VCT A;  1DE2 A;  2J23 A;  2VCX A;  4XS1 A;  2H1A A;  2OBK A;  3D4T A;  1TRW A;  9GSS A;  1T4Y A;  2G0F A;  4JZQ A;  3IV4 A;  3HVS A;  2ZCT A;  2H19 A;  2HNL A;  5ELG A;  3DVW A;  2JSZ A;  2CVK A;  2WZ9 A;  1JFU A;  3A5W A;  4OFM A;  2IL3 A;  2GS3 A;  5CRW A;  1V98 A;  3IAM 2;  1M99 A;  5KN0 A;  1ZMA A;  3LYK A;  3G7Y A;  3HD5 A;  5HQP A;  3HJO A;  3L9V A;  4ILF A;  4K2D A;  4PX1 A;  5CAX A;  1Z5Y E;  4IEL A;  4L8E A;  3ZFL A;  2TIR A;  2HRF A;  1GTI A;  4Z7X A;  5C04 A;  4ML1 A;  1F9M A;  4JE1 A;  4MA9 A;  4TRX A;  2OE3 A;  3DIE A;  3Q6O A;  1V9W A;  4WBR D;  2XBI A;  4MP4 A;  3KH7 A;  4GST A;  3GTU A;  3R2Q A;  3LGC A;  2GZP A;  1BX9 A;  4AJ6 A;  2P5Q A;  2B3S A;  2LEG A;  1XXU A;  3ZRE A;  1QFN A;  1TI3 A;  4IQA A;  2O85 A;  6GSU A;  3VWV A;  3GIX A;  4KSO A;  5IMV A;  4LMW A;  1LBK A;  2YZH A;  6GST A;  4EO3 A;  4JED A;  3PIN A;  5HR0 A;  1OAZ A;  3UVT A;  3SBC A;  2FUG 2;  2VAF A;  2GZY A;  2H75 A;  1ZYQ B;  2KP1 A;  2YOI A;  4XS4 A;  2MMO A;  3LSZ A;  1NW2 A;  2LKU A;  2HZE B;  1X5C A;  1W89 A;  4WBJ A;  1AC1 A;  2IWT A;  3KJY A;  2JZR A;  1AQV A;  1E2Y A;  1DBY A;  3ZRD A;  1OVN A;  1Z9H A;  1FAA A;  2IJY A;  1K0M A;  3APS A;  3US3 A;  3C71 A;  4FO5 A;  3QCP A;  3QDN A;  4NHZ A;  2EIR A;  3FZ9 A;  1ERV A;  5ECQ B;  3F63 A;  1ZGN A;  2DJ1 A;  4YH2 A;  1R26 A;  2L4Q A;  3ME8 A;  4ML6 A;  2VIM A;  3EMX A;  1XWC A;  4RI7 A;  2FWH A;  4K8M A;  2R6K A;  1WE0 A;  2AYT A;  3IK7 A;  1WP0 A;  2VD1 A;  2WB9 A;  1I5G A;  4RQR A;  5F8B A;  3PGT A;  2DC5 A;  4IVF A;  2JL4 A;  4HEA 2;  4V2L A;  2VOC A;  3LEF A;  1PD2 1;  1SD8 A;  3W8S A;  1BJX A;  4J2F A;  4DVC A;  2IMK A;  3F3R A;  5CO3 A;  1B9Y C;  5CP1 A;  4G9H A;  2LRN A;  2OE1 A;  4IP1 A;  4PNF A;  3KTB A;  2CX3 A;  2HRN A;  2X64 A;  2HI7 A;  1PQN A;  2LV3 A;  4AGS A;  3ZFB A;  3P2A A;  4KAE A;  5ECN B;  4CW9 A;  4O92 A;  1X5D A;  2H1G A;  4MF5 A;  4MPF A;  3KM6 A;  2R37 A;  4DSS A;  1UVZ A;  2LNS A;  1QMV A;  2C8U A;  7GSS A;  4DSR A;  2B6M A;  2L57 A;  1KTE A;  1YJ6 A;  3IOS A;  2CV4 A;  5G5F A;  3DVX A;  1GUL A;  4OFN A;  3E0U A;  1EP8 A;  4NMU A;  1K0N A;  2Z9S A;  5A5K A;  4F82 A;  3N5O A;  3SWL A;  1QXH A;  4OMV A;  2XC2 A;  1Z3E A;  3HY2 A;  3F4T A;  4K9Z A;  2J9H A;  4I97 A;  1K3L A;  1A23 A;  3D4M A;  2YPM A;  3UOM A;  2VM1 A;  2ZNM A;  3RAZ A;  2H8L A;  4HOJ A;  3FW2 A;  2PBJ A;  2MMZ A;  4OWY A;  4MMM A;  2OA7 A;  3LQ7 A;  3G7J A;  4LA1 A;  1PX6 A;  5J3R A;  3O3T A;  3FY7 A;  5ECP B;  2K8S A;  2X99 A;  3H8Q A;  1FB6 A;  3UMA A;  1GSF A;  2I1U A;  3CSH A;  3Q18 A;  1XIY A;  1KBN A;  2JU5 A;  1SD9 A;  2F9S A;  2IMD A;  5CNW A;  4Q5F A;  5D9X A;  4F9Z A;  2RUF A;  4F03 A;  2C80 A;  2H1B A;  2E2M A;  5KN1 A;  1MDK A;  3F6F A;  5IMA A;  3I43 A;  4ZL7 A;  1TK5 B;  4ZIJ A;  4V1A p;  1BED A;  2HE3 A;  2M46 A;  1MDI A;  4FYU A;  3TOT A;  2MMA A;  3QAV A;  4BA7 A;  5G5E A;  4BL7 A;  3TJG A;  1T8E B;  4XCS A;  5FWG A;  5GSS A;  3QOU A;  1GTB A;  2F3M A;  2PGT A;  2DLX A;  2CZ3 A;  1AXD A;  4ZXG A;  2VL2 A;  5JCW A;  4IBP A;  2GSS A;  1EEJ A;  4KX4 A;  3AY8 A;  1U3I A;  4IW9 A;  2GQM A;  5AIX A;  4CHS A;  5ID2 B;  4ECC A;  3I6A A;  4MZB A;  5J5N A;  1YQ1 A;  2VCV A;  2C0D A;  3O6T A;  1SK1 A;  1JHB A;  2V41 A;  3H1N A;  1TDI A;  2MYG A;  4KUN A;  19GS A;  1TU7 A;  3W8J A;  5D93 A;  5G1L A;  2I81 A;  4Q5N A;  1SJ6 A;  4L5L A;  17GS A;  2DML A;  1B4P A;  3S9F A;  3TKS E;  4MPG A;  1JZW A;  4ECI A;  4EUY A;  3L78 A;  5E59 A;  3MNG A;  4FH8 A;  4G10 A;  4QL7 A;  3F9U A;  2OJL A;  4EKZ A;  1FW1 A;  2LST A;  2OAC A;  2A2S A;  1TRU A;  1OC3 A;  3PR8 A;  1GNW A;  10GS A;  3KCM A;  4HU7 A;  4L5O A;  2AB6 A;  1DUG A;  5J9C A;  1SKS B;  2EIQ A;  3LOR A;  4ZBA A;  1C72 A;  1T1V A;  2H0G A;  2GZZ A;  4ECJ A;  3QAG A;  4PGT A;  3ZVJ D;  3C7M A;  4PQI A;  1Y6E A;  5EVO A;  4OO4 A;  2R3X A;  5B6M A;  4I5Q A;  1EZK A;  3F8U A;  1GP1 A;  2GSR A;  1ON4 A;  2ZUP A;  4NWY A;  2LRC A;  3H4K A;  4TKY A;  1EEM A;  5J4U A;  4XS6 A;  5IPG A;  2VLU A;  2RM6 A;  4DEJ A;  3WGX A;  3LJR A;  1A2L A;  3HZ4 A;  4EC0 A;  5IO0 A;  4WF4 A;  3FR9 A;  5G1K A;  3TKP A;  3DGQ A;  5KN2 A;  1DSB A;  2B5E A;  4PUF C;  5F07 A;  5GST A;  2HSY A;  1GSY A;  5COH A;  2IFQ B;  1OYJ A;  3NZN A;  3CTF A;  2V32 A;  2K18 A;  2TRC P;  1TOF A;  3P8W A;  4K0G A;  1SK0 A;  2YV7 A;  3UIW A;  2P5R A;  3P90 A;  3EC3 A;  5LCZ A;  3ERG A;  1SK2 A;  3GMF A;  4GSS A;  2YCD A;  4HUA A;  5IO2 A;  3VUR A;  2CQ9 A;  3EMP A;  4XTS A;  1EV4 A;  3CRT A;  3EYT A;  1U3A A;  3KXO A;  4IN0 A;  3ZIV A;  1OC9 B;  5J9B A;  1RK4 A;  5AIS A;  1HYU A;  2X8C A;  5HR3 A;  4MH3 A;  4JR6 A;  1T7P B;  2MBS A;  1G6Y A;  2QC7 A;  3JCM L;  5DQS A;  1VRS D;  2VO4 A;  1ERT A;  4I8B A;  4TR1 A;  3V1W A;  4IKH A;  1SL2 B;  1XWB A;  4N10 A;  4BWS A;  1GLP A;  1I9D A;  2P31 A;  3QFB C;  4D73 A;  1B9X C;  2WFC A;  4FIW A;  4K6X A;  1B4Q A;  1F6M C;  1OE8 A;  3C1S A;  4IS0 A;  1K0B A;  2NPB A;  5GAN D;  3LFL A;  2V6K A;  3HKR A;  4KDU A;  4N0Z A;  2A4V A;  1K3O A;  2B1L A;  4KDY A;  3IK9 A;  1ST9 A;  4MDC A;  2KOK A;  3ZMK A;  2DJJ A;  2NDO A;  3UJ1 A;  2PVQ A;  3FHK A;  4KA0 A;  1M2D A;  4YAP A;  2B7K A;  4MAB A;  4IJ3 A;  3M3M A;  1A0R P;  5J41 A;  2L59 A;  2H66 A;  3APO A;  4WF5 A;  2KHP A;  4J57 E;  1THX A;  4EDY A;  4OCE A;  3D0Z A;  3GUS A;  5ENU A;  3HHV A;  3FEU A;  5CRE A;  2PU9 C;  4N11 A;  2DBC A;  4EVM A;  1USB A;  3HZ8 A;  1U87 A;  2VL2 C;  1WIK A;  3IPZ A;  2H72 A;  2I9H A;  4AJ8 A;  1B48 A;  3F6D A;  1TTZ A;  3VFI A;  3GRX A;  5KEJ A;  2H73 A;  2OBI A;  1NHO A;  2IN3 A;  5G31 A;  1EOH A;  2O7K A;  4X43 A;  1A0F A;  3IC4 A;  2K8V A;  4WR5 A;  2X8G A;  4HDE A;  16GS A;  4EE0 A;  3LYP A;  2M72 A;  2VLV A;  5A4V A;  4KB3 A;  1PGT A;  1QQ2 A;  1T00 A;  5D96 A;  5F05 A;  4E8H A;  4J56 E;  1HNC A;  4OD7 A;  5DJM A;  5DJL A;  3GHA A;  2QGV A;  3IRA A;  3FR6 A;  3GKK A;  2O8V B;  2VD0 A;  4GWR A;  1PL1 A;  3ZIJ A;  2JZS A;  4AF2 A;  4POL A;  4MJC A;  2A2R A;  4KGI A;  1YF1 A;  3GKX A;  1GUK A;  2C0E A;  2BJX A;  5IOW A;  1LU4 A;  1YEP A;  1R5P A;  2R5G A;  2H30 A;  1CQH A;  3KH9 A;  4FYB A;  3M8N A;  5D8I A;  3MWH A;  2QKE A;  2V1M A;  3ZML A;  3D6I A;  1R5A A;  3HVX A;  4WEY A;  3CBU A;  2LUS A;  3KP8 A;  2FWG A;  2I3Y A;  4HQS A;  5B7C A;  4GTU A;  2LNT A;  2R4V A;  2RLI A;  1EP7 A;  2AUV A;  2AV4 A;  1SKW B;  5HFK A;  4KCA A;  3FR3 A;  4XIH A;  3GTU B;  4X0X A;  3HYP A;  4BWQ A;  1K3Y A;  4LMV A;  1TK8 B;  4V1A g;  1FVK A;  1GSE A;  1XWA A;  2G2Q A;  3EIN A;  2H6Y A;  4E8E A;  1U88 A;  1VF4 A;  4NAX A;  1SL0 B;  4KDX A;  1BAY A;  3DXB A;  4POB A;  3TKS A;  5B8A A;  5H5Q A;  1BG5 A;  2PMT A;  3M1G A;  1PMT A;  5DAK A;  1T4Z A;  3IDV A;  4XHM A;  2FWE A;  4XS4 B;  2GDR A;  3IE3 A;  2C3N A;  1N2A A;  3MAK A;  3IAS 2;  3UL3 A;  5C00 A; 
#chains in the Genus database with same CATH topology
 3CSJ A;  1YKC A;  3GX0 A;  5IMF A;  1A8Y A;  2FWF A;  2HXK A;  3FRC A;  3C1R A;  1X9W B;  3L4N A;  4FYC A;  4MJE A;  1X9M B;  1BYE A;  1GL8 A;  1ML6 A;  3U5R E;  2DJ2 A;  2UZ8 A;  1UN2 A;  2L6C A;  2YWO A;  2LJA A;  1O8W A;  2V6O A;  2CAI A;  3DD3 A;  1JZD A;  5DDL A;  2RM5 A;  2TRX A;  2LS5 A;  3GNJ A;  4G19 A;  1UC7 A;  3TGZ A;  4BVY A;  3ZYW A;  4EXJ A;  3H93 A;  5EL8 A;  4G2E A;  4OCF A;  1TI1 A;  4L0W A;  4TOP A;  14GS A;  1ACV A;  3HJM A;  2OE0 A;  3D21 A;  1VF2 A;  1AUC A;  3LXT A;  4JR4 A;  4YAV A;  3L9S A;  1S3A A;  4HI7 A;  2JAD A;  1NSW A;  5ECL B;  3EWL A;  2EIO A;  2GT6 A;  1TJD A;  3LWA A;  2V2G A;  4KH7 A;  2QSI A;  1WRY A;  2H71 A;  3VWW A;  4Q5R A;  1V58 A;  4KND A;  5HFG A;  3VPQ A;  1V40 A;  1F2E A;  5HR2 A;  4N0V A;  1PX7 A;  1EGR A;  4TXO A;  5D73 A;  2DJ3 A;  1SYX A;  2VLT A;  2ON5 A;  4PQ1 A;  5L71 A;  1SJZ A;  1ZZY A;  2JSY A;  2YP6 A;  2L6D A;  2O87 A;  4IGJ A;  5G2Z A;  4CY8 A;  4MH2 A;  2L5O A;  5IIZ A;  4TW5 A;  3VI5 A;  5IPH A;  1GUH A;  5EPF A;  2WS2 A;  4ZL8 A;  2YWI A;  5LNK e;  1XW9 A;  1J08 A;  2PPT A;  3D5J A;  3CMI A;  3IA1 A;  2CA8 A;  1HNA A;  1IYI A;  4F2I A;  3M0F A;  1OE7 A;  1TRV A;  2VCQ A;  5DAL A;  1JLW A;  2F8F A;  4O5R A;  4GQF A;  1VF3 A;  1YF0 A;  3QR6 A;  2CX4 A;  2VCW A;  1THO A;  2PVO C;  3I69 A;  1R7H A;  2VUP A;  3GUR A;  4WET A;  2X4A A;  1OC9 A;  4LL1 B;  3DYR A;  2YJ7 A;  18GS A;  2WDU A;  5ECM B;  3ZL5 A;  1KNG A;  1FB0 A;  2OAD A;  1U6T A;  1OKD A;  2A2P A;  1FOV A;  1ABA A;  4JRR A;  4WXT A;  2YN1 A;  3ZVJ A;  3GST A;  4FQU A;  4KW6 A;  4DSQ A;  2ON7 A;  3FKF A;  2CT6 A;  5B8B A;  1SYR A;  3ED3 A;  3G7I A;  5D9T A;  4YKG A;  1SEN A;  4BL7 B;  1SL1 B;  5KOW A;  3TJF A;  1TKD B;  2WJU A;  1LJR A;  3DWV A;  5HR1 A;  5ECI B;  1AQX A;  1BQ7 A;  1VGL A;  3CYN A;  1M0U A;  3IXR A;  3RHB A;  4Q5Q A;  3IBH A;  4HZ4 A;  1GSD A;  4MF7 A;  2B7J A;  3DEX A;  2FNO A;  3R3E A;  3KZQ A;  2A4H A;  1XWK A;  2H0I A;  2MMN A;  4OO5 A;  5IMZ A;  2N5B A;  8GSS A;  1X9S B;  4F0B A;  3UAR A;  1A8L A;  2DSA A;  3KGK A;  3OR5 A;  6GSS A;  2DKI A;  3FZA A;  1GTU A;  2LJK A;  1F3B A;  5JCG A;  4POM A;  3GX8 A;  1O6J A;  5D9V A;  5ABR A;  4I2U A;  4K7O A;  3HDC A;  1M2B A;  1X0R A;  2GQL A;  3QPM A;  1Z7R A;  2HYX A;  3GL5 A;  2H70 A;  22GS A;  2L5L A;  5ECH B;  3RDW A;  1Q98 A;  5JWO B;  4BVX B;  1XBS A;  4O5Q A;  2NTO A;  2DIZ A;  1O73 A;  1PKW A;  3VK9 A;  1XWG A;  2LJR A;  1GSQ A;  1MTC A;  2HFD A;  3E3E A;  3WGD A;  4HU9 A;  3KEB A;  1PSQ A;  4Z2R A;  3KD0 A;  4QQ7 A;  2DIY A;  4HSC X;  2F51 A;  3L0H A;  2C0G A;  1SKR B;  2XHF A;  5DVB A;  2XPD A;  4HZ2 A;  2M80 A;  5FT3 A;  1E6B A;  2HZE A;  4HJ2 A;  3FK8 A;  1IYH A;  6GSX A;  3QFA C;  2IPA A;  3VWX A;  1AQW A;  5DCG A;  3ME7 A;  5JWR B;  3DKS A;  5GAP D;  3BCK A;  4ACS A;  2KUC A;  1ZCP A;  2LTK A;  3UBL A;  1JLV A;  1K0A A;  1Y25 A;  4RUV A;  1ERU A;  4NXI A;  5INY A;  3U6V A;  2C3T A;  4MCU A;  4IJI A;  3EE2 A;  3EPT A;  2VCZ A;  5ELA A;  3RPP A;  3I9V 2;  1S3C A;  1TRS A;  2CAQ A;  2C3Q A;  3ZTL A;  1OKT A;  1PKZ A;  1XOB A;  3MDK A;  1G7O A;  3HVV A;  1M2A A;  1ZOF A;  3LG6 A;  4GRF A;  4NV2 A;  4TXV A;  4JU5 A;  4GXZ A;  3WD6 A;  1B8X A;  2FGX A;  5DCH A;  4ZB8 A;  3H79 A;  3UEM A;  1DE1 A;  3WT1 A;  13GS A;  1WPI A;  1FVJ A;  4GSN A;  1YY7 A;  2VL3 A;  2FA4 A;  5BMU A;  5AIV A;  1XG8 A;  3IHQ A;  4EF0 A;  3F0I A;  2YJH A;  2REM A;  1O8X A;  1MD4 A;  2CVD A;  1N8J A;  5G30 A;  2PN8 A;  3TRP A;  3TUE A;  1O85 A;  2N5A A;  3KP9 A;  1ZYE A;  2DJK A;  4XRD A;  4EL1 A;  1XOA A;  1JZO A;  2PUK C;  4TR1 B;  3TJB A;  1PN9 A;  1XW6 A;  2IME A;  1CQG A;  3FMW A;  1QK8 A;  3G9B A;  3A2V A;  2N5F A;  4YQV A;  3P7X A;  3A2W A;  1G6W A;  1PL2 A;  6GSW A;  1EWX A;  5HFI A;  4G0I A;  3GA4 A;  1PRX A;  4D73 B;  1UA5 A;  2B5Y A;  4YQM A;  4KE3 A;  2VM2 A;  5F0G A;  4ZB9 A;  2K6V A;  2CVB A;  3VPT A;  1HQO A;  4GQC A;  1QGV A;  3ERF A;  4ZBB A;  1YKA A;  2YV9 A;  1GNE A;  4ISD A;  1NM3 A;  3GV1 A;  3HCZ A;  4MK3 A;  1ZYP A;  3E9J B;  2GT5 A;  2GVP A;  1XW5 A;  2JAC A;  2H01 A;  5DQY A;  1Z6N A;  1XZO A;  4RI6 A;  3UAP A;  1Z7P A;  2CZ2 A;  4N30 A;  3O76 A;  2H74 A;  3Q19 A;  2R0P A;  1HNB A;  3IHG A;  2H76 A;  5D9W A;  4MF6 A;  3MSZ A;  3J7Y k;  2D2Z A;  1F3A A;  2H1D A;  5IM9 A;  1MD3 A;  1ILO A;  4PUA A;  2NVL A;  2C4J A;  3VI7 A;  1WWJ A;  4F0C A;  4HQZ A;  3WGE A;  3BBY A;  3L9U A;  4GF0 A;  1WMJ A;  4ICY A;  1YDK A;  5ECK B;  2HLS A;  2H6Z A;  1F37 A;  4NPB A;  1V57 A;  2O89 A;  2FD3 A;  4MJB A;  2ALB A;  1NHY A;  4BPY A;  4MZC A;  2E7P A;  2YWM A;  5LD0 A;  5IMD A;  2PER A;  2HRK A;  3WYW A;  2XPE A;  5GZZ B;  1PA3 A;  1RW1 A;  11GS A;  4P3Y B;  1XVQ A;  3GH9 A;  2E0Q A;  1TXX A;  1R4W A;  2KP2 A;  3ERW A;  1YEX A;  3KMN A;  3A5I A;  2C0F A;  2FCH A;  5ECS A;  4ULX A;  4KSM A;  1TU8 A;  3GYK A;  1T3B A;  2H0H A;  1MDJ A;  6GSY A;  1YZX A;  4V2N A;  5ID2 A;  3BCI A;  4GCI A;  2GGT A;  4MNN A;  2OKA A;  3HJP A;  5A4U A;  3A2X A;  1K0O A;  2LQO A;  4RQX A;  4YQU A;  1GSU A;  5JWQ B;  1X5E A;  4EDZ A;  3KIJ A;  4MLY A;  3BJ5 A;  2HT9 A;  3PH9 A;  2DJ0 A;  2GTU A;  3GL3 A;  3GN3 A;  4MJA A;  1H4O A;  2KLX A;  2L4C A;  3BD2 A;  3ZLP A;  1G0T A;  3DRN A;  4X1U A;  4HJM A;  4WKW A;  2MBT A;  2F8A A;  4K0N A;  6GSV A;  1M3J A;  4PUR A;  2AHE A;  4ZB6 A;  4PNG A;  4ECB A;  2FHE A;  3J7Y b;  4IHU A;  3GKN A;  3QAW A;  2QA1 A;  5AGY A;  4TR0 A;  4LL4 B;  1AAZ A;  3N9J A;  2RII A;  3ZZX A;  4I6X A;  2ES7 A;  1XPV A;  3Q74 A;  1TP9 A;  4XRA A;  2NBS A;  2GST A;  2LRT A;  2MZC A;  4DSS B;  3D22 A;  4MZW A;  3UBK A;  5JCU A;  2IMI A;  3A3T A;  1O81 A;  1V2A A;  2GQK A;  3K8N A;  4JBB A;  3F3Q A;  3TJK A;  2GSQ A;  5DAK B;  1EOG A;  2DMM A;  2XBQ A;  2R2J A;  3W6G A;  1EGO A;  3GKM A;  1TK0 B;  1A2J A;  5A4W A;  1XCC A;  3UVH A;  2YNX A;  1A2M A;  3CXG A;  3TRQ A;  4EIQ A;  3C73 A;  1ZL9 A;  2C1Y A;  4HS1 A;  1S3D A;  1WOU A;  4POK A;  4X4J A;  2B1K A;  2AJQ B;  2K9F A;  3EUR A;  3IR4 A;  4H86 A;  2IFQ A;  1GWC A;  4V2M A;  3TDG A;  4O7H A;  1GTA A;  2PWJ A;  4G0L A;  1GUM A;  4OFT A;  5CRH A;  5AN1 A;  3RPN A;  2P0G A;  3M9J A;  3LXZ A;  4PTS A;  1K0D A;  3VWU A;  3M9K A;  2YWN A;  4BVY B;  5DBQ A;  2B5X A;  4K5R A;  3EU3 A;  5E4W A;  4PQH A;  4IQ1 A;  1Z6M A;  2WUL A;  3TKR A;  3NOF A;  1JZR A;  5CRD A;  2EC4 A;  3MIX A;  1J0F A;  3CRU A;  3KTL A;  5ECR B;  2FLS A;  4K7N A;  5H5R A;  3RBT A;  1GLQ A;  2BMX A;  4BVX A;  3BOA A;  3WT2 A;  3TCO A;  1MEK A;  1RQM A;  4TVE A;  12GS A;  3FZ4 A;  3FZ5 A;  1O7U A;  4NHW A;  1XVW A;  3TKQ A;  4ZIL A;  3NIV A;  3DML A;  3FYG A;  3VLN A;  4L0U A;  1G7E A;  1K0C A;  2YZU A;  3GH6 A;  4K7I A;  3RHC A;  1XFL A;  3C8E A;  4I2T A;  3QD9 A;  3ISO A;  5FHI A;  3CTG A;  2HZF A;  3EU4 A;  4ZL9 A;  1M7T A;  4TXO B;  4QL9 A;  2VL9 A;  5BRT A;  5F06 A;  4LLR A;  1SJI A;  1AW9 A;  2FY6 A;  1W4V A;  2AAW A;  4CDO A;  2FA8 A;  2X8H A;  4WR4 A;  3TOU A;  1EV9 A;  4IP6 A;  20GS A;  3HA9 A;  3QMX A;  5KN3 A;  5B6N A;  2H6X A;  5IQY A;  1FHE A;  4TR4 A;  3TKS C;  2RUE A;  4TR3 A;  1KEB A;  4G0K A;  5IMC A;  1M9A A;  2I4A A;  2JZT A;  1FG4 A;  3EVI A;  1FO5 A;  1WJK A;  4AJ7 A;  5IOX A;  3GSS A;  5DAL B;  2IIY A;  1GRX A;  4GLT A;  4KCE A;  2WRT A;  2BTO T;  4EIP A;  1GSS A;  3GFK A;  2HSH A;  1M9B A;  3TB2 A;  4ZBD A;  3KMO A;  4PXO A;  4ID0 A;  1J9B A;  1GH2 A;  3F4S A;  2GLR A;  3TRX A;  1SU9 A;  4K1F A;  5CRG A;  5H5S A;  2LQQ A;  1ERW A;  3CSI A;  3APQ A;  1A24 A;  2WCI A;  5EY6 A;  4CY6 A;  1AIU A;  1HD2 A;  3ZIT A;  1Q4J A;  1VF1 A;  1TW9 A;  5ECO B;  3TJJ A;  2IMF A;  3HXS A;  1URM A;  3F4R A;  4YKF A;  1H75 A;  5CYY A;  4TN8 A;  1QUW A;  2E2G A;  2YAN A;  4NV5 A;  4O32 A;  2WGR A;  1OC8 A;  2VCT A;  1DE2 A;  2J23 A;  2VCX A;  4XS1 A;  2H1A A;  2OBK A;  3D4T A;  1TRW A;  9GSS A;  1T4Y A;  2G0F A;  4JZQ A;  1S3R A;  3IV4 A;  3HVS A;  2ZCT A;  2H19 A;  4Z2U A;  2HNL A;  5ELG A;  3DVW A;  2JSZ A;  2CVK A;  2WZ9 A;  1JFU A;  3A5W A;  4OFM A;  2IL3 A;  2GS3 A;  5CRW A;  1V98 A;  3IAM 2;  1M99 A;  5KN0 A;  1ZMA A;  2X49 A;  3LYK A;  3G7Y A;  3HD5 A;  5HQP A;  3HJO A;  3L9V A;  4ILF A;  4K2D A;  4PX1 A;  2DKH A;  5CAX A;  1Z5Y E;  4IEL A;  4L8E A;  3ZFL A;  2TIR A;  2HRF A;  1GTI A;  4Z7X A;  5C04 A;  4ML1 A;  1F9M A;  4JE1 A;  4MA9 A;  4TRX A;  2OE3 A;  3DIE A;  3Q6O A;  4A5P A;  1V9W A;  4WBR D;  2XBI A;  4MP4 A;  3KH7 A;  4GST A;  3GTU A;  3R2Q A;  3LGC A;  2GZP A;  1BX9 A;  4AJ6 A;  2P5Q A;  2B3S A;  2LEG A;  1XXU A;  3ZRE A;  1QFN A;  1TI3 A;  4IQA A;  2O85 A;  6GSU A;  3VWV A;  3GIX A;  4KSO A;  5IMV A;  4LMW A;  1LBK A;  2YZH A;  6GST A;  4EO3 A;  4JED A;  3PIN A;  5HR0 A;  1OAZ A;  3UVT A;  3SBC A;  2FUG 2;  2VAF A;  2GZY A;  2H75 A;  1ZYQ B;  2KP1 A;  2YOI A;  4XS4 A;  1FOH A;  2MMO A;  3LSZ A;  1NW2 A;  2LKU A;  2HZE B;  1X5C A;  1W89 A;  4WBJ A;  1AC1 A;  2IWT A;  3KJY A;  2JZR A;  1AQV A;  1E2Y A;  1DBY A;  3ZRD A;  1OVN A;  1Z9H A;  1FAA A;  2IJY A;  1K0M A;  3APS A;  4K5S A;  3US3 A;  3C71 A;  4FO5 A;  3QCP A;  3QDN A;  4NHZ A;  2EIR A;  3FZ9 A;  1ERV A;  5ECQ B;  3F63 A;  1ZGN A;  2DJ1 A;  4YH2 A;  1R26 A;  2L4Q A;  3ME8 A;  4ML6 A;  2VIM A;  3EMX A;  1XWC A;  4RI7 A;  2FWH A;  4K8M A;  2R6K A;  1WE0 A;  2AYT A;  3IK7 A;  1WP0 A;  2VD1 A;  2WB9 A;  1I5G A;  4RQR A;  5F8B A;  3PGT A;  2DC5 A;  4IVF A;  2JL4 A;  4HEA 2;  4V2L A;  2VOC A;  3LEF A;  1PD2 1;  1SD8 A;  3W8S A;  1BJX A;  4J2F A;  4DVC A;  2IMK A;  3F3R A;  5CO3 A;  1B9Y C;  5CP1 A;  4G9H A;  2LRN A;  2OE1 A;  4IP1 A;  4PNF A;  3KTB A;  2CX3 A;  2HRN A;  2X64 A;  2HI7 A;  1PQN A;  2LV3 A;  4AGS A;  3ZFB A;  3P2A A;  4KAE A;  5ECN B;  4CW9 A;  4O92 A;  1X5D A;  2H1G A;  4MF5 A;  4MPF A;  3KM6 A;  2R37 A;  4DSS A;  1UVZ A;  2LNS A;  1QMV A;  2C8U A;  7GSS A;  4DSR A;  2B6M A;  2L57 A;  1KTE A;  1YJ6 A;  3IOS A;  2CV4 A;  5G5F A;  3DVX A;  1GUL A;  4OFN A;  3E0U A;  4K2X A;  1EP8 A;  4NMU A;  1K0N A;  2Z9S A;  5A5K A;  4F82 A;  3N5O A;  3CQF A;  3SWL A;  1QXH A;  4OMV A;  2XC2 A;  1Z3E A;  3HY2 A;  3F4T A;  4K9Z A;  2J9H A;  2R0G A;  4I97 A;  1K3L A;  1A23 A;  2QA2 A;  3D4M A;  2YPM A;  3UOM A;  2VM1 A;  2ZNM A;  3RAZ A;  2H8L A;  4HOJ A;  3FW2 A;  2PBJ A;  2MMZ A;  4OWY A;  4MMM A;  2OA7 A;  3LQ7 A;  3G7J A;  4LA1 A;  1PX6 A;  5J3R A;  3O3T A;  3FY7 A;  5ECP B;  2K8S A;  2HSM A;  2X99 A;  3H8Q A;  1FB6 A;  3UMA A;  1GSF A;  2I1U A;  3CSH A;  3Q18 A;  1XIY A;  1KBN A;  2JU5 A;  1SD9 A;  2F9S A;  2IMD A;  5CNW A;  4Q5F A;  5D9X A;  4F9Z A;  2RUF A;  4F03 A;  2C80 A;  2H1B A;  2E2M A;  5KN1 A;  1MDK A;  3F6F A;  5IMA A;  3I43 A;  4ZL7 A;  1TK5 B;  4ZIJ A;  4V1A p;  1BED A;  2HE3 A;  2M46 A;  1MDI A;  4FYU A;  3TOT A;  2MMA A;  3QAV A;  4BA7 A;  5G5E A;  4BL7 A;  3TJG A;  1T8E B;  4XCS A;  5FWG A;  5GSS A;  3QOU A;  1GTB A;  2F3M A;  2PGT A;  2DLX A;  3PPU A;  1PFO A;  2CZ3 A;  1AXD A;  4ZXG A;  2VL2 A;  5JCW A;  4IBP A;  2GSS A;  1EEJ A;  4KX4 A;  3AY8 A;  1U3I A;  4IW9 A;  2GQM A;  5AIX A;  4CHS A;  5ID2 B;  4ECC A;  3I6A A;  4MZB A;  5J5N A;  1YQ1 A;  2VCV A;  2C0D A;  3O6T A;  1SK1 A;  1JHB A;  2V41 A;  3H1N A;  1TDI A;  2MYG A;  4KUN A;  19GS A;  1TU7 A;  3W8J A;  5D93 A;  5G1L A;  2I81 A;  4Q5N A;  1SJ6 A;  4L5L A;  17GS A;  2DML A;  1B4P A;  3S9F A;  3TKS E;  4MPG A;  1JZW A;  4ECI A;  4EUY A;  3L78 A;  5E59 A;  3MNG A;  4FH8 A;  4G10 A;  4QL7 A;  3F9U A;  2OJL A;  4EKZ A;  2HRA A;  1FW1 A;  2LST A;  1M3I A;  2OAC A;  2A2S A;  1TRU A;  1OC3 A;  3PR8 A;  1GNW A;  10GS A;  3KCM A;  4HU7 A;  4L5O A;  2AB6 A;  1DUG A;  5J9C A;  1SKS B;  2EIQ A;  3LOR A;  4ZBA A;  1C72 A;  1T1V A;  2H0G A;  2GZZ A;  4ECJ A;  3QAG A;  4PGT A;  3ZVJ D;  3C7M A;  4PQI A;  1Y6E A;  5EVO A;  4OO4 A;  2R3X A;  5B6M A;  4I5Q A;  1EZK A;  3F8U A;  1GP1 A;  2GSR A;  1ON4 A;  2ZUP A;  4NWY A;  2LRC A;  3H4K A;  4TKY A;  1EEM A;  5J4U A;  4XS6 A;  5IPG A;  2VLU A;  2RM6 A;  4DEJ A;  3WGX A;  3LJR A;  1A2L A;  3HZ4 A;  4EC0 A;  5IO0 A;  4WF4 A;  3FR9 A;  5G1K A;  1PN0 A;  3TKP A;  3DGQ A;  5KN2 A;  1DSB A;  2B5E A;  4PUF C;  5F07 A;  5GST A;  2HSY A;  1GSY A;  5COH A;  2IFQ B;  1OYJ A;  3NZN A;  3CTF A;  2V32 A;  2K18 A;  2TRC P;  1TOF A;  3P8W A;  4K0G A;  1SK0 A;  2YV7 A;  3UIW A;  2P5R A;  3P90 A;  3EC3 A;  5LCZ A;  3ERG A;  1SK2 A;  3GMF A;  4GSS A;  2YCD A;  4HUA A;  5IO2 A;  3VUR A;  4Z2T A;  2CQ9 A;  3LW9 A;  3EMP A;  4XTS A;  1EV4 A;  4BIK A;  3CRT A;  3EYT A;  1U3A A;  3KXO A;  4IN0 A;  3ZIV A;  1OC9 B;  5J9B A;  1RK4 A;  5AIS A;  1HYU A;  4USS A;  2X8C A;  3MYD A;  5HR3 A;  4MH3 A;  4JR6 A;  1T7P B;  2MBS A;  5KOX A;  1G6Y A;  2QC7 A;  3JCM L;  5DQS A;  1VRS D;  2VO4 A;  1ERT A;  4I8B A;  4TR1 A;  3V1W A;  4IKH A;  1SL2 B;  1XWB A;  4N10 A;  4BWS A;  1GLP A;  1I9D A;  2P31 A;  3QFB C;  4D73 A;  1B9X C;  2WFC A;  4FIW A;  1ZYN A;  4K6X A;  1B4Q A;  1F6M C;  1OE8 A;  3C1S A;  4IS0 A;  1K0B A;  2NPB A;  5GAN D;  3LFL A;  2V6K A;  3HKR A;  4KDU A;  4N0Z A;  2A4V A;  1K3O A;  2B1L A;  4KDY A;  3IK9 A;  1ST9 A;  4MDC A;  2KOK A;  3ZMK A;  2DJJ A;  2NDO A;  3UJ1 A;  2PVQ A;  3FHK A;  4KA0 A;  1M2D A;  4YAP A;  2B7K A;  4MAB A;  4IJ3 A;  3M3M A;  1A0R P;  2R0C A;  5J41 A;  2L59 A;  2H66 A;  3APO A;  4WF5 A;  2KHP A;  4J57 E;  1THX A;  4EDY A;  4OCE A;  3D0Z A;  3GUS A;  5ENU A;  3HHV A;  3FEU A;  5CRE A;  2PU9 C;  4N11 A;  2DBC A;  4EVM A;  1USB A;  3HZ8 A;  1U87 A;  2VL2 C;  1WIK A;  3IPZ A;  4KF9 A;  2H72 A;  2I9H A;  4AJ8 A;  1B48 A;  3F6D A;  1TTZ A;  3VFI A;  3GRX A;  5KEJ A;  2H73 A;  2OBI A;  1NHO A;  2IN3 A;  5G31 A;  3IC8 A;  1EOH A;  2O7K A;  4X43 A;  1A0F A;  3IC4 A;  2K8V A;  4WR5 A;  2X8G A;  3HVN A;  4HDE A;  16GS A;  4EE0 A;  3LYP A;  2M72 A;  2VLV A;  5A4V A;  4KB3 A;  1PGT A;  1QQ2 A;  1T00 A;  5D96 A;  5F05 A;  4E8H A;  4J56 E;  1HNC A;  4OD7 A;  5DJM A;  5DJL A;  3GHA A;  2QGV A;  3IRA A;  3FR6 A;  3GKK A;  2O8V B;  2VD0 A;  4GWR A;  1PL1 A;  3ZIJ A;  2JZS A;  4AF2 A;  4POL A;  4MJC A;  2A2R A;  4KGI A;  1YF1 A;  3GKX A;  1GUK A;  2C0E A;  2BJX A;  5IOW A;  1LU4 A;  1YEP A;  1R5P A;  2R5G A;  2H30 A;  1CQH A;  3KH9 A;  4FYB A;  3M8N A;  5D8I A;  3MWH A;  2QKE A;  2V1M A;  3ZML A;  3D6I A;  1R5A A;  3HVX A;  4WEY A;  3CBU A;  2LUS A;  3KP8 A;  2FWG A;  2I3Y A;  4HQS A;  5B7C A;  4GTU A;  2LNT A;  2R4V A;  2RLI A;  1EP7 A;  2AUV A;  2AV4 A;  1SKW B;  5HFK A;  4KCA A;  3FR3 A;  4O5U A;  4XIH A;  3GTU B;  4X0X A;  3HYP A;  4BWQ A;  1K3Y A;  4LMV A;  1TK8 B;  4V1A g;  1FVK A;  1GSE A;  1XWA A;  2G2Q A;  3EIN A;  2H6Y A;  4E8E A;  1U88 A;  1VF4 A;  4NAX A;  1SL0 B;  4KDX A;  1BAY A;  3DXB A;  4POB A;  3TKS A;  5B8A A;  5H5Q A;  1BG5 A;  2PMT A;  3M1G A;  1PMT A;  5DAK A;  1T4Z A;  3IDV A;  4XHM A;  2FWE A;  4XS4 B;  2GDR A;  3IE3 A;  2C3N A;  1N2A A;  3MAK A;  3IAS 2;  3UL3 A;  5C00 A; 
#chains in the Genus database with same CATH homology
 3CSJ A;  1YKC A;  3GX0 A;  5IMF A;  1A8Y A;  2FWF A;  2HXK A;  3FRC A;  3C1R A;  1X9W B;  3L4N A;  4FYC A;  4MJE A;  1X9M B;  1BYE A;  1GL8 A;  1ML6 A;  3U5R E;  2DJ2 A;  2UZ8 A;  1UN2 A;  2L6C A;  2YWO A;  2LJA A;  1O8W A;  2V6O A;  2CAI A;  3DD3 A;  1JZD A;  5DDL A;  2RM5 A;  2TRX A;  2LS5 A;  3GNJ A;  4G19 A;  1UC7 A;  3TGZ A;  4BVY A;  3ZYW A;  4EXJ A;  3H93 A;  5EL8 A;  4G2E A;  4OCF A;  1TI1 A;  4L0W A;  4TOP A;  14GS A;  1ACV A;  3HJM A;  2OE0 A;  3D21 A;  1VF2 A;  1AUC A;  3LXT A;  4JR4 A;  4YAV A;  3L9S A;  1S3A A;  4HI7 A;  2JAD A;  1NSW A;  5ECL B;  3EWL A;  2EIO A;  2GT6 A;  1TJD A;  3LWA A;  2V2G A;  4KH7 A;  2QSI A;  1WRY A;  2H71 A;  3VWW A;  4Q5R A;  1V58 A;  4KND A;  5HFG A;  3VPQ A;  1V40 A;  1F2E A;  5HR2 A;  4N0V A;  1PX7 A;  1EGR A;  4TXO A;  5D73 A;  2DJ3 A;  1SYX A;  2VLT A;  2ON5 A;  4PQ1 A;  5L71 A;  1SJZ A;  1ZZY A;  2JSY A;  2YP6 A;  2L6D A;  2O87 A;  4IGJ A;  5G2Z A;  4CY8 A;  4MH2 A;  2L5O A;  5IIZ A;  4TW5 A;  3VI5 A;  5IPH A;  1GUH A;  5EPF A;  2WS2 A;  4ZL8 A;  2YWI A;  5LNK e;  1XW9 A;  1J08 A;  2PPT A;  3D5J A;  3CMI A;  3IA1 A;  2CA8 A;  1HNA A;  1IYI A;  4F2I A;  3M0F A;  1OE7 A;  1TRV A;  2VCQ A;  5DAL A;  1JLW A;  2F8F A;  4O5R A;  4GQF A;  1VF3 A;  1YF0 A;  3QR6 A;  2CX4 A;  2VCW A;  1THO A;  2PVO C;  3I69 A;  1R7H A;  2VUP A;  3GUR A;  4WET A;  2X4A A;  1OC9 A;  4LL1 B;  3DYR A;  2YJ7 A;  18GS A;  2WDU A;  5ECM B;  3ZL5 A;  1KNG A;  1FB0 A;  2OAD A;  1U6T A;  1OKD A;  2A2P A;  1FOV A;  1ABA A;  4JRR A;  4WXT A;  2YN1 A;  3ZVJ A;  3GST A;  4FQU A;  4KW6 A;  4DSQ A;  2ON7 A;  3FKF A;  2CT6 A;  5B8B A;  1SYR A;  3ED3 A;  3G7I A;  5D9T A;  4YKG A;  1SEN A;  4BL7 B;  1SL1 B;  5KOW A;  3TJF A;  1TKD B;  2WJU A;  1LJR A;  3DWV A;  5HR1 A;  5ECI B;  1AQX A;  1BQ7 A;  1VGL A;  3CYN A;  1M0U A;  3IXR A;  3RHB A;  4Q5Q A;  3IBH A;  4HZ4 A;  1GSD A;  4MF7 A;  2B7J A;  3DEX A;  2FNO A;  3R3E A;  3KZQ A;  2A4H A;  1XWK A;  2H0I A;  2MMN A;  4OO5 A;  5IMZ A;  2N5B A;  8GSS A;  1X9S B;  4F0B A;  3UAR A;  1A8L A;  2DSA A;  3KGK A;  3OR5 A;  6GSS A;  2DKI A;  3FZA A;  1GTU A;  2LJK A;  1F3B A;  5JCG A;  4POM A;  3GX8 A;  1O6J A;  5D9V A;  5ABR A;  4I2U A;  4K7O A;  3HDC A;  1M2B A;  1X0R A;  2GQL A;  3QPM A;  1Z7R A;  2HYX A;  3GL5 A;  2H70 A;  22GS A;  2L5L A;  5ECH B;  3RDW A;  1Q98 A;  5JWO B;  4BVX B;  1XBS A;  4O5Q A;  2NTO A;  2DIZ A;  1O73 A;  1PKW A;  3VK9 A;  1XWG A;  2LJR A;  1GSQ A;  1MTC A;  2HFD A;  3E3E A;  3WGD A;  4HU9 A;  3KEB A;  1PSQ A;  4Z2R A;  3KD0 A;  4QQ7 A;  2DIY A;  2F51 A;  3L0H A;  2C0G A;  1SKR B;  2XHF A;  5DVB A;  2XPD A;  4HZ2 A;  2M80 A;  5FT3 A;  1E6B A;  2HZE A;  4HJ2 A;  3FK8 A;  1IYH A;  6GSX A;  3QFA C;  2IPA A;  3VWX A;  1AQW A;  5DCG A;  3ME7 A;  5JWR B;  3DKS A;  5GAP D;  3BCK A;  4ACS A;  2KUC A;  1ZCP A;  2LTK A;  3UBL A;  1JLV A;  1K0A A;  1Y25 A;  4RUV A;  1ERU A;  4NXI A;  5INY A;  3U6V A;  2C3T A;  4MCU A;  4IJI A;  3EE2 A;  3EPT A;  2VCZ A;  5ELA A;  3RPP A;  3I9V 2;  1S3C A;  1TRS A;  2CAQ A;  2C3Q A;  3ZTL A;  1OKT A;  1PKZ A;  1XOB A;  3MDK A;  1G7O A;  3HVV A;  1M2A A;  1ZOF A;  3LG6 A;  4GRF A;  4NV2 A;  4TXV A;  4JU5 A;  4GXZ A;  3WD6 A;  1B8X A;  2FGX A;  5DCH A;  4ZB8 A;  3H79 A;  3UEM A;  1DE1 A;  3WT1 A;  13GS A;  1WPI A;  1FVJ A;  4GSN A;  1YY7 A;  2VL3 A;  2FA4 A;  5BMU A;  5AIV A;  3IHQ A;  4EF0 A;  3F0I A;  2YJH A;  2REM A;  1O8X A;  1MD4 A;  2CVD A;  1N8J A;  5G30 A;  2PN8 A;  3TRP A;  3TUE A;  1O85 A;  2N5A A;  3KP9 A;  1ZYE A;  2DJK A;  4XRD A;  4EL1 A;  1XOA A;  1JZO A;  2PUK C;  4TR1 B;  3TJB A;  1PN9 A;  1XW6 A;  2IME A;  1CQG A;  3FMW A;  1QK8 A;  3G9B A;  3A2V A;  2N5F A;  4YQV A;  3P7X A;  3A2W A;  1G6W A;  1PL2 A;  6GSW A;  1EWX A;  5HFI A;  4G0I A;  3GA4 A;  1PRX A;  4D73 B;  1UA5 A;  2B5Y A;  4YQM A;  4KE3 A;  2VM2 A;  5F0G A;  4ZB9 A;  2K6V A;  2CVB A;  3VPT A;  1HQO A;  4GQC A;  1QGV A;  3ERF A;  4ZBB A;  1YKA A;  2YV9 A;  1GNE A;  4ISD A;  1NM3 A;  3GV1 A;  3HCZ A;  4MK3 A;  1ZYP A;  3E9J B;  2GT5 A;  2GVP A;  1XW5 A;  2JAC A;  2H01 A;  5DQY A;  1Z6N A;  1XZO A;  4RI6 A;  3UAP A;  1Z7P A;  2CZ2 A;  4N30 A;  3O76 A;  2H74 A;  3Q19 A;  2R0P A;  1HNB A;  3IHG A;  2H76 A;  5D9W A;  4MF6 A;  3MSZ A;  3J7Y k;  2D2Z A;  1F3A A;  2H1D A;  5IM9 A;  1MD3 A;  1ILO A;  4PUA A;  2NVL A;  2C4J A;  3VI7 A;  1WWJ A;  4F0C A;  4HQZ A;  3WGE A;  3BBY A;  3L9U A;  4GF0 A;  1WMJ A;  4ICY A;  1YDK A;  5ECK B;  2HLS A;  2H6Z A;  1F37 A;  4NPB A;  1V57 A;  2O89 A;  2FD3 A;  4MJB A;  2ALB A;  1NHY A;  4BPY A;  4MZC A;  2E7P A;  2YWM A;  5LD0 A;  5IMD A;  2PER A;  2HRK A;  3WYW A;  2XPE A;  5GZZ B;  1PA3 A;  1RW1 A;  11GS A;  4P3Y B;  1XVQ A;  3GH9 A;  2E0Q A;  1TXX A;  1R4W A;  2KP2 A;  3ERW A;  1YEX A;  3KMN A;  3A5I A;  2C0F A;  2FCH A;  5ECS A;  4ULX A;  4KSM A;  1TU8 A;  3GYK A;  1T3B A;  2H0H A;  1MDJ A;  6GSY A;  1YZX A;  4V2N A;  5ID2 A;  3BCI A;  4GCI A;  2GGT A;  4MNN A;  2OKA A;  3HJP A;  5A4U A;  3A2X A;  1K0O A;  2LQO A;  4RQX A;  4YQU A;  1GSU A;  5JWQ B;  1X5E A;  4EDZ A;  3KIJ A;  4MLY A;  3BJ5 A;  2HT9 A;  3PH9 A;  2DJ0 A;  2GTU A;  3GL3 A;  3GN3 A;  4MJA A;  1H4O A;  2KLX A;  2L4C A;  3BD2 A;  3ZLP A;  1G0T A;  3DRN A;  4X1U A;  4HJM A;  4WKW A;  2MBT A;  2F8A A;  4K0N A;  6GSV A;  4PUR A;  2AHE A;  4ZB6 A;  4PNG A;  4ECB A;  2FHE A;  3J7Y b;  4IHU A;  3GKN A;  3QAW A;  2QA1 A;  5AGY A;  4TR0 A;  4LL4 B;  1AAZ A;  3N9J A;  2RII A;  3ZZX A;  4I6X A;  2ES7 A;  1XPV A;  3Q74 A;  1TP9 A;  4XRA A;  2NBS A;  2GST A;  2LRT A;  2MZC A;  4DSS B;  3D22 A;  4MZW A;  3UBK A;  5JCU A;  2IMI A;  3A3T A;  1O81 A;  1V2A A;  2GQK A;  3K8N A;  4JBB A;  3F3Q A;  3TJK A;  2GSQ A;  5DAK B;  1EOG A;  2DMM A;  2XBQ A;  2R2J A;  3W6G A;  1EGO A;  3GKM A;  1TK0 B;  1A2J A;  5A4W A;  1XCC A;  3UVH A;  2YNX A;  1A2M A;  3CXG A;  3TRQ A;  4EIQ A;  3C73 A;  1ZL9 A;  2C1Y A;  4HS1 A;  1S3D A;  1WOU A;  4POK A;  4X4J A;  2B1K A;  2AJQ B;  2K9F A;  3EUR A;  3IR4 A;  4H86 A;  2IFQ A;  1GWC A;  4V2M A;  3TDG A;  4O7H A;  1GTA A;  2PWJ A;  4G0L A;  1GUM A;  4OFT A;  5CRH A;  5AN1 A;  3RPN A;  2P0G A;  3M9J A;  3LXZ A;  4PTS A;  1K0D A;  3VWU A;  3M9K A;  2YWN A;  4BVY B;  5DBQ A;  2B5X A;  4K5R A;  3EU3 A;  5E4W A;  4PQH A;  4IQ1 A;  1Z6M A;  2WUL A;  3TKR A;  3NOF A;  1JZR A;  5CRD A;  2EC4 A;  3MIX A;  1J0F A;  3CRU A;  3KTL A;  5ECR B;  2FLS A;  4K7N A;  5H5R A;  3RBT A;  1GLQ A;  2BMX A;  4BVX A;  3BOA A;  3WT2 A;  3TCO A;  1MEK A;  1RQM A;  4TVE A;  12GS A;  3FZ4 A;  3FZ5 A;  1O7U A;  4NHW A;  1XVW A;  3TKQ A;  4ZIL A;  3NIV A;  3DML A;  3FYG A;  3VLN A;  4L0U A;  1G7E A;  1K0C A;  2YZU A;  3GH6 A;  4K7I A;  3RHC A;  1XFL A;  3C8E A;  4I2T A;  3QD9 A;  3ISO A;  5FHI A;  3CTG A;  2HZF A;  3EU4 A;  4ZL9 A;  1M7T A;  4TXO B;  4QL9 A;  2VL9 A;  5BRT A;  5F06 A;  4LLR A;  1SJI A;  1AW9 A;  2FY6 A;  1W4V A;  2AAW A;  4CDO A;  2FA8 A;  2X8H A;  4WR4 A;  3TOU A;  1EV9 A;  4IP6 A;  20GS A;  3HA9 A;  3QMX A;  5KN3 A;  5B6N A;  2H6X A;  5IQY A;  1FHE A;  4TR4 A;  3TKS C;  2RUE A;  4TR3 A;  1KEB A;  4G0K A;  5IMC A;  1M9A A;  2I4A A;  2JZT A;  1FG4 A;  3EVI A;  1FO5 A;  1WJK A;  4AJ7 A;  5IOX A;  3GSS A;  5DAL B;  2IIY A;  1GRX A;  4GLT A;  4KCE A;  2WRT A;  2BTO T;  4EIP A;  1GSS A;  3GFK A;  2HSH A;  1M9B A;  3TB2 A;  4ZBD A;  3KMO A;  4PXO A;  4ID0 A;  1J9B A;  1GH2 A;  3F4S A;  2GLR A;  3TRX A;  1SU9 A;  4K1F A;  5CRG A;  5H5S A;  2LQQ A;  1ERW A;  3CSI A;  3APQ A;  1A24 A;  2WCI A;  5EY6 A;  4CY6 A;  1AIU A;  1HD2 A;  3ZIT A;  1Q4J A;  1VF1 A;  1TW9 A;  5ECO B;  3TJJ A;  2IMF A;  3HXS A;  1URM A;  3F4R A;  4YKF A;  1H75 A;  5CYY A;  4TN8 A;  1QUW A;  2E2G A;  2YAN A;  4NV5 A;  4O32 A;  2WGR A;  1OC8 A;  2VCT A;  1DE2 A;  2J23 A;  2VCX A;  4XS1 A;  2H1A A;  2OBK A;  3D4T A;  1TRW A;  9GSS A;  1T4Y A;  2G0F A;  4JZQ A;  3IV4 A;  3HVS A;  2ZCT A;  2H19 A;  4Z2U A;  2HNL A;  5ELG A;  3DVW A;  2JSZ A;  2CVK A;  2WZ9 A;  1JFU A;  3A5W A;  4OFM A;  2IL3 A;  2GS3 A;  5CRW A;  1V98 A;  3IAM 2;  1M99 A;  5KN0 A;  1ZMA A;  2X49 A;  3LYK A;  3G7Y A;  3HD5 A;  5HQP A;  3HJO A;  3L9V A;  4ILF A;  4K2D A;  4PX1 A;  2DKH A;  5CAX A;  1Z5Y E;  4IEL A;  4L8E A;  3ZFL A;  2TIR A;  2HRF A;  1GTI A;  4Z7X A;  5C04 A;  4ML1 A;  1F9M A;  4JE1 A;  4MA9 A;  4TRX A;  2OE3 A;  3DIE A;  3Q6O A;  4A5P A;  1V9W A;  4WBR D;  2XBI A;  4MP4 A;  3KH7 A;  4GST A;  3GTU A;  3R2Q A;  3LGC A;  2GZP A;  1BX9 A;  4AJ6 A;  2P5Q A;  2B3S A;  2LEG A;  1XXU A;  3ZRE A;  1QFN A;  1TI3 A;  4IQA A;  2O85 A;  6GSU A;  3VWV A;  3GIX A;  4KSO A;  5IMV A;  4LMW A;  1LBK A;  2YZH A;  6GST A;  4EO3 A;  4JED A;  3PIN A;  5HR0 A;  1OAZ A;  3UVT A;  3SBC A;  2FUG 2;  2VAF A;  2GZY A;  2H75 A;  1ZYQ B;  2KP1 A;  2YOI A;  4XS4 A;  1FOH A;  2MMO A;  3LSZ A;  1NW2 A;  2LKU A;  2HZE B;  1X5C A;  1W89 A;  4WBJ A;  1AC1 A;  2IWT A;  3KJY A;  2JZR A;  1AQV A;  1E2Y A;  1DBY A;  3ZRD A;  1OVN A;  1Z9H A;  1FAA A;  2IJY A;  1K0M A;  3APS A;  4K5S A;  3US3 A;  3C71 A;  4FO5 A;  3QCP A;  3QDN A;  4NHZ A;  2EIR A;  3FZ9 A;  1ERV A;  5ECQ B;  3F63 A;  1ZGN A;  2DJ1 A;  4YH2 A;  1R26 A;  2L4Q A;  3ME8 A;  4ML6 A;  2VIM A;  3EMX A;  1XWC A;  4RI7 A;  2FWH A;  4K8M A;  2R6K A;  1WE0 A;  2AYT A;  3IK7 A;  1WP0 A;  2VD1 A;  2WB9 A;  1I5G A;  4RQR A;  5F8B A;  3PGT A;  2DC5 A;  4IVF A;  2JL4 A;  4HEA 2;  4V2L A;  2VOC A;  3LEF A;  1PD2 1;  1SD8 A;  3W8S A;  1BJX A;  4J2F A;  4DVC A;  2IMK A;  3F3R A;  5CO3 A;  1B9Y C;  5CP1 A;  4G9H A;  2LRN A;  2OE1 A;  4IP1 A;  4PNF A;  3KTB A;  2CX3 A;  2HRN A;  2X64 A;  2HI7 A;  1PQN A;  2LV3 A;  4AGS A;  3ZFB A;  3P2A A;  4KAE A;  5ECN B;  4CW9 A;  4O92 A;  1X5D A;  2H1G A;  4MF5 A;  4MPF A;  3KM6 A;  2R37 A;  4DSS A;  1UVZ A;  2LNS A;  1QMV A;  2C8U A;  7GSS A;  4DSR A;  2B6M A;  2L57 A;  1KTE A;  1YJ6 A;  3IOS A;  2CV4 A;  5G5F A;  3DVX A;  1GUL A;  4OFN A;  3E0U A;  4K2X A;  1EP8 A;  4NMU A;  1K0N A;  2Z9S A;  5A5K A;  4F82 A;  3N5O A;  3SWL A;  1QXH A;  4OMV A;  2XC2 A;  1Z3E A;  3HY2 A;  3F4T A;  4K9Z A;  2J9H A;  2R0G A;  4I97 A;  1K3L A;  1A23 A;  2QA2 A;  3D4M A;  2YPM A;  3UOM A;  2VM1 A;  2ZNM A;  3RAZ A;  2H8L A;  4HOJ A;  3FW2 A;  2PBJ A;  2MMZ A;  4OWY A;  4MMM A;  2OA7 A;  3LQ7 A;  3G7J A;  4LA1 A;  1PX6 A;  5J3R A;  3O3T A;  3FY7 A;  5ECP B;  2K8S A;  2HSM A;  2X99 A;  3H8Q A;  1FB6 A;  3UMA A;  1GSF A;  2I1U A;  3CSH A;  3Q18 A;  1XIY A;  1KBN A;  2JU5 A;  1SD9 A;  2F9S A;  2IMD A;  5CNW A;  4Q5F A;  5D9X A;  4F9Z A;  2RUF A;  4F03 A;  2C80 A;  2H1B A;  2E2M A;  5KN1 A;  1MDK A;  3F6F A;  5IMA A;  3I43 A;  4ZL7 A;  1TK5 B;  4ZIJ A;  4V1A p;  1BED A;  2HE3 A;  2M46 A;  1MDI A;  4FYU A;  3TOT A;  2MMA A;  3QAV A;  4BA7 A;  5G5E A;  4BL7 A;  3TJG A;  1T8E B;  4XCS A;  5FWG A;  5GSS A;  3QOU A;  1GTB A;  2F3M A;  2PGT A;  2DLX A;  3PPU A;  2CZ3 A;  1AXD A;  4ZXG A;  2VL2 A;  5JCW A;  4IBP A;  2GSS A;  1EEJ A;  4KX4 A;  3AY8 A;  1U3I A;  4IW9 A;  2GQM A;  5AIX A;  4CHS A;  5ID2 B;  4ECC A;  3I6A A;  4MZB A;  5J5N A;  1YQ1 A;  2VCV A;  2C0D A;  3O6T A;  1SK1 A;  1JHB A;  2V41 A;  3H1N A;  1TDI A;  2MYG A;  4KUN A;  19GS A;  1TU7 A;  3W8J A;  5D93 A;  5G1L A;  2I81 A;  4Q5N A;  1SJ6 A;  4L5L A;  17GS A;  2DML A;  1B4P A;  3S9F A;  3TKS E;  4MPG A;  1JZW A;  4ECI A;  4EUY A;  3L78 A;  5E59 A;  3MNG A;  4FH8 A;  4G10 A;  4QL7 A;  3F9U A;  2OJL A;  4EKZ A;  2HRA A;  1FW1 A;  2LST A;  2OAC A;  2A2S A;  1TRU A;  1OC3 A;  3PR8 A;  1GNW A;  10GS A;  3KCM A;  4HU7 A;  4L5O A;  2AB6 A;  1DUG A;  5J9C A;  1SKS B;  2EIQ A;  3LOR A;  4ZBA A;  1C72 A;  1T1V A;  2H0G A;  2GZZ A;  4ECJ A;  3QAG A;  4PGT A;  3ZVJ D;  3C7M A;  4PQI A;  1Y6E A;  5EVO A;  4OO4 A;  2R3X A;  5B6M A;  4I5Q A;  1EZK A;  3F8U A;  1GP1 A;  2GSR A;  1ON4 A;  2ZUP A;  4NWY A;  2LRC A;  3H4K A;  4TKY A;  1EEM A;  5J4U A;  4XS6 A;  5IPG A;  2VLU A;  2RM6 A;  4DEJ A;  3WGX A;  3LJR A;  1A2L A;  3HZ4 A;  4EC0 A;  5IO0 A;  4WF4 A;  3FR9 A;  5G1K A;  1PN0 A;  3TKP A;  3DGQ A;  5KN2 A;  1DSB A;  2B5E A;  4PUF C;  5F07 A;  5GST A;  2HSY A;  1GSY A;  5COH A;  2IFQ B;  1OYJ A;  3NZN A;  3CTF A;  2V32 A;  2K18 A;  2TRC P;  1TOF A;  3P8W A;  4K0G A;  1SK0 A;  2YV7 A;  3UIW A;  2P5R A;  3P90 A;  3EC3 A;  5LCZ A;  3ERG A;  1SK2 A;  3GMF A;  4GSS A;  2YCD A;  4HUA A;  5IO2 A;  3VUR A;  4Z2T A;  2CQ9 A;  3LW9 A;  3EMP A;  4XTS A;  1EV4 A;  3CRT A;  3EYT A;  1U3A A;  3KXO A;  4IN0 A;  3ZIV A;  1OC9 B;  5J9B A;  1RK4 A;  5AIS A;  1HYU A;  4USS A;  2X8C A;  3MYD A;  5HR3 A;  4MH3 A;  4JR6 A;  1T7P B;  2MBS A;  5KOX A;  1G6Y A;  2QC7 A;  3JCM L;  5DQS A;  1VRS D;  2VO4 A;  1ERT A;  4I8B A;  4TR1 A;  3V1W A;  4IKH A;  1SL2 B;  1XWB A;  4N10 A;  4BWS A;  1GLP A;  1I9D A;  2P31 A;  3QFB C;  4D73 A;  1B9X C;  2WFC A;  4FIW A;  1ZYN A;  4K6X A;  1B4Q A;  1F6M C;  1OE8 A;  3C1S A;  4IS0 A;  1K0B A;  2NPB A;  5GAN D;  3LFL A;  2V6K A;  3HKR A;  4KDU A;  4N0Z A;  2A4V A;  1K3O A;  2B1L A;  4KDY A;  3IK9 A;  1ST9 A;  4MDC A;  2KOK A;  3ZMK A;  2DJJ A;  2NDO A;  3UJ1 A;  2PVQ A;  3FHK A;  4KA0 A;  1M2D A;  4YAP A;  2B7K A;  4MAB A;  4IJ3 A;  3M3M A;  1A0R P;  2R0C A;  5J41 A;  2L59 A;  2H66 A;  3APO A;  4WF5 A;  2KHP A;  4J57 E;  1THX A;  4EDY A;  4OCE A;  3D0Z A;  3GUS A;  5ENU A;  3HHV A;  3FEU A;  5CRE A;  2PU9 C;  4N11 A;  2DBC A;  4EVM A;  1USB A;  3HZ8 A;  1U87 A;  2VL2 C;  1WIK A;  3IPZ A;  4KF9 A;  2H72 A;  2I9H A;  4AJ8 A;  1B48 A;  3F6D A;  1TTZ A;  3VFI A;  3GRX A;  5KEJ A;  2H73 A;  2OBI A;  1NHO A;  2IN3 A;  5G31 A;  3IC8 A;  1EOH A;  2O7K A;  4X43 A;  1A0F A;  3IC4 A;  2K8V A;  4WR5 A;  2X8G A;  4HDE A;  16GS A;  4EE0 A;  3LYP A;  2M72 A;  2VLV A;  5A4V A;  4KB3 A;  1PGT A;  1QQ2 A;  1T00 A;  5D96 A;  5F05 A;  4E8H A;  4J56 E;  1HNC A;  4OD7 A;  5DJM A;  5DJL A;  3GHA A;  2QGV A;  3IRA A;  3FR6 A;  3GKK A;  2O8V B;  2VD0 A;  4GWR A;  1PL1 A;  3ZIJ A;  2JZS A;  4AF2 A;  4POL A;  4MJC A;  2A2R A;  4KGI A;  1YF1 A;  3GKX A;  1GUK A;  2C0E A;  2BJX A;  5IOW A;  1LU4 A;  1YEP A;  1R5P A;  2R5G A;  2H30 A;  1CQH A;  3KH9 A;  4FYB A;  3M8N A;  5D8I A;  3MWH A;  2QKE A;  2V1M A;  3ZML A;  3D6I A;  1R5A A;  3HVX A;  4WEY A;  3CBU A;  2LUS A;  3KP8 A;  2FWG A;  2I3Y A;  4HQS A;  5B7C A;  4GTU A;  2LNT A;  2R4V A;  2RLI A;  1EP7 A;  2AUV A;  2AV4 A;  1SKW B;  5HFK A;  4KCA A;  3FR3 A;  4O5U A;  4XIH A;  3GTU B;  4X0X A;  3HYP A;  4BWQ A;  1K3Y A;  4LMV A;  1TK8 B;  4V1A g;  1FVK A;  1GSE A;  1XWA A;  2G2Q A;  3EIN A;  2H6Y A;  4E8E A;  1U88 A;  1VF4 A;  4NAX A;  1SL0 B;  4KDX A;  1BAY A;  3DXB A;  4POB A;  3TKS A;  5B8A A;  5H5Q A;  1BG5 A;  2PMT A;  3M1G A;  1PMT A;  5DAK A;  1T4Z A;  3IDV A;  4XHM A;  2FWE A;  4XS4 B;  2GDR A;  3IE3 A;  2C3N A;  1N2A A;  3MAK A;  3IAS 2;  3UL3 A;  5C00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...