1QUWA

Solution structure of the thioredoxin from bacillus acidocaldarius
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
b'ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title NMR solution structure of a novel thioredoxin from Bacillus acidocaldarius possible determinants of protein stability.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
molecule tags Electron transport
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1quwA00
4TVEA 4DSSA 1ACVA 3CRTA 22GSA 4N11A 2YZHA 3BCKA 5JCWA 2O7KA 3FYGA 1I9DA 3ZRDA 1SENA 3D5JA 4ZIJA 1F37A 3ME7A 1OAZA 4AJ6A 5H5QA 3HHVA 1USBA 2H6YA 4EL1A 2KOKA 1SL2B 4KSOA 3DWVA 4GSNA 1Z3EA 2XPEA 1HNBA 4IHUA 2OE1A 3IPZA 3EMPA 1T4YA 2PERA 4Q5FA 6GSTA 3C73A 5ECRB 3TKSA 6GSYA 3IAM2 4TOPA 1F3AA 1T4ZA 2VL9A 3NZNA 2JADA 1ST9A 1GLQA 3QAWA 1GULA 4HQZA 1OE7A 4WEYA 3H93A 5KN1A 4ZL9A 1TU7A 4GLTA 1OC9A 1SU9A 2FNOA 4EDYA 1E6BA 5ELGA 3TUEA 2N5FA 4POBA 2YJ7A 3W8JA 5DAKA 2PPTA 3M0FA 1UN2A 3W8SA 1XVWA 3JCML 4NWYA 1XVQA 2WZ9A 1SYXA 1O81A 1PA3A 4GQFA 4HU9A 4HZ4A 2CA8A 3ZZXA 1U3IA 1O8XA 1BEDA 4XS4B 5A4VA 3L0HA 4TRXA 3TGZA 1K3OA 3LYKA 1QUWA 1K0MA 2A2SA 3DVWA 4PQIA 2L5OA 1SK0A 2LSTA 3ZFLA 4KX4A 2H74A 1EEJA 4MJAA 4GSTA 3O6TA 3G7YA 2E7PA 4MF6A 3N5OA 2H30A 1URMA 1A24A 1BG5A 4KGIA 1UA5A 3IDVA 1B9YC 3K8NA 4WR4A 2V32A 4OO5A 5AISA 1A23A 4N0VA 4F82A 3ZYWA 2C0EA 3HY2A 2LKUA 1PRXA 1XWBA 3LEFA 1BJXA 1Q98A 4Q5QA 1NHYA 1U87A 1WMJA 2TRCP 2MMOA 1GNWA 3FZ9A 2BJXA 4POMA 4IN0A 2LJAA 1PKWA 3GN3A 2F8AA 4X43A 3E0UA 5EY6A 1YDKA 1SL1B 4EF0A 5DCGA 1B48A 2VCZA 2HT9A 4PGTA 1M9BA 2X64A 3QAGA 1YKAA 5GAND 3N9JA 5G5EA 1JFUA 4RI7A 3A3TA 2ON5A 3OR5A 1GWCA 3TJJA 5CYYA 4X1UA 3ZIVA 1PN9A 2IFQB 2L59A 5CREA 1EGOA 3MWHA 4L8EA 5J5NA 2YPMA 1PSQA 2IL3A 2VO4A 3FHKA 4E8EA 4MPGA 4K7OA 2AHEA 2H6ZA 5ELAA 3GKMA 2B6MA 2FHEA 1V58A 1PD21 3MAKA 3VWWA 3GUSA 1M0UA 1XWAA 5HQPA 1XBSA 1FB6A 2CX4A 2KUCA 3GH9A 3FW2A 1QFNA 2R6KA 19GSA 1W4VA 3DXBA 4BL7A 4O5RA 3WT1A 1MDIA 3CSHA 4IP1A 3FEUA 3GTUB 4ZBDA 1YF1A 5ECPB 1S3AA 1LJRA 1FB0A 1SD8A 3EWLA 1S3DA 3EU4A 5DJMA 3ZVJD 2GDRA 1XWCA 3LYPA 2K8VA 3CTFA 2ZUPA 4RQXA 1K0NA 4HS1A 3D22A 5CO3A 2WFCA 4MJBA 2NVLA 2PBJA 3P90A 1LU4A 2HFDA 1OKDA 5A4WA 1AQXA 1XXUA 4J57E 2FWHA 5D9VA 1V2AA 1X9SB 2H0HA 2FY6A 3L9SA 1GTAA 1H75A 3L4NA 1A2LA 2R37A 2OJLA 1TRWA 4YH2A 5D9WA 2DLXA 1SKWB 4EDZA 1A0RP 3ZREA 3LJRA 2TIRA 3CXGA 4F0CA 3DMLA 3P8WA 5ECNB 4V1Ag 3GX8A 3RHCA 4IQAA 5ID2A 3NIVA 4OCEA 4NXIA 3HZ8A 2CVDA 3APSA 5GSTA 2FWFA 2ZNMA 3MSZA 4GTUA 4KNDA 1IYIA 3TRQA 4YQVA 4D73B 2JSZA 2VD1A 4V1Ap 5ECKB 2VM1A 2H66A 4G10A 3GV1A 2IWTA 3IOSA 3TKSC 2P5QA 1G0TA 3UVHA 3RBTA 2GTUA 1HNCA 4I6XA 2PWJA 4JE1A 1FG4A 4ZILA 4H86A 17GSA 2VL2A 2FWEA 2YWMA 1GSQA 5FWGA 4Z7XA 4YQUA 2GSRA 4OWYA 3KH9A 4DVCA 1JZDA 4POKA 2LEGA 4O92A 4RUVA 3C1SA 3KTBA 4LLRA 4LMWA 2X8HA 5HR1A 3HKRA 2DJJA 3KJYA 3GA4A 2FD3A 2LV3A 4ZXGA 5G5FA 4NV2A 1K0BA 1GTIA 5GZZB 4HOJA 3F9UA 4ZB6A 2DMMA 2RM6A 1AIUA 2JZTA 1V57A 4TR0A 2CVKA 4HJ2A 2FUG2 4GSSA 4MF7A 4ZB8A 3ED3A 2OBIA 4L0UA 1TKDB 3QPMA 2KHPA 4NHWA 1O73A 5H5RA 1Z5YE 2C0FA 3L78A 4GF0A 1GP1A 2VL3A 3LGCA 2LRTA 2I1UA 1EZKA 4I5QA 1LBKA 2L57A 5ECMB 1KTEA 4HUAA 2MBSA 4N10A 2IFQA 4JU5A 3IC4A 5D96A 3WYWA 2F9SA 3TDGA 4ILFA 2LNSA 3FR9A 2HYXA 4QL7A 3A2XA 5HFKA 5KEJA 1DSBA 2H76A 4MABA 3RHBA 2JSYA 4HDEA 3LORA 2HZEA 2DIYA 1TJDA 3IAS2 3GFKA 4AJ8A 1KBNA 4PURA 3S9FA 2JU5A 3TKPA 5B6NA 5B8AA 1TRUA 1YJ6A 3TKSE 2B5XA 1AC1A 2ZCTA 1PX6A 4TXOA 2F51A 1XCCA 2GT5A 2CZ3A 3J7Yk 3QFAC 1Z6NA 4ECCA 1YZXA 4PQHA 4K9ZA 2PVOC 3Q18A 4NAXA 5IMAA 4JR4A 1JZOA 2CV4A 2IMEA 5CRGA 3APOA 2DJ3A 3HJPA 3ZITA 3NOFA 3ERFA 4MJCA 3TJKA 3GNJA 4EE0A 4RQRA 1KNGA 1TK8B 4V2NA 1OVNA 1GNEA 2LRNA 3DYRA 4F0BA 3CSJA 2VLTA 4K6XA 3UMAA 4OFMA 3EE2A 4NPBA 3QOUA 5LCZA 2YZUA 3FKFA 2AB6A 2HZFA 2PUKC 4F2IA 3ME8A 4PUAA 5CAXA 1EV9A 1AW9A 3C8EA 5IMFA 3GMFA 3IBHA 5JCGA 2WGRA 2OKAA 3M9KA 2BMXA 2WCIA 2NPBA 3R2QA 1THOA 4MF5A 3ERGA 4K0NA 2MZCA 2HSYA 2WRTA 3WD6A 4FYUA 2L6CA 1QQ2A 2QKEA 3ZLPA 2C3TA 3C1RA 4D73A 4LA1A 5JWQB 5A4UA 2JZRA 4OFTA 3TOUA 1GSSA 2I4AA 2MMAA 3HJMA 2K18A 5CNWA 2IN3A 3GIXA 2B1LA 4AGSA 1YEPA 3WT2A 1VF3A 1QK8A 2L6DA 1FO5A 1M7TA 1XPVA 2PVQA 5COHA 3HVSA 2NBSA 2XBIA 5AN1A 2M80A 3FK8A 5JCUA 1GH2A 3M9JA 3A5WA 1TW9A 1M9AA 3EVIA 2O89A 2L4QA 2KLXA 14GSA 1I5GA 2G2QA 3UVTA 4ZL7A 4EO3A 2H75A 3WGDA 1AQVA 1GSDA 2DIZA 1T3BA 2GQLA 1EP7A 2MMZA 1OC3A 1QXHA 4CW9A 2DBCA 1MDKA 2P31A 2IPAA 2VCXA 1MEKA 3EMXA 3P7XA 4ACSA 1RK4A 5CP1A 1F6MC 4AF2A 5ECLB 3RDWA 2KP2A 1MTCA 2IMKA 4XRAA 4TKYA 2LRCA 4NHZA 4IP6A 1ZL9A 2IMFA 3UBKA 1SD9A 1H4OA 1QMVA 3LXZA 5IMDA 1SL0B 3GKKA 2R4VA 5IPGA 4X0XA 1BAYA 2VL2C 2A2RA 4I8BA 1EP8A 5F07A 3APQA 2EC4A 4Q5NA 1AQWA 1M2BA 4JZQA 4IBPA 4J56E 2JZSA 1O8WA 2NTOA 1WWJA 5HFIA 1TTZA 5J9BA 1MD4A 1T7PB 4CDOA 2GT6A 2GQKA 1GSEA 2XBQA 1EGRA 2LQOA 4PX1A 3G7IA 4KDUA 3DKSA 3HCZA 4KUNA 2M46A 1ON4A 1XFLA 2H01A 1SKRB 3FR6A 4KCEA 4FYBA 1TI3A 2AAWA 2FGXA 4O32A 3QAVA 4ML1A 1MD3A 4O7HA 3IXRA 3IR4A 4KB3A 4OD7A 1TXXA 2H0GA 4MPFA 3IRAA 3QD9A 4GQCA 5AGYA 3H8QA 3QDNA 4KCAA 4PXOA 1Z7PA 5F8BA 5IOXA 9GSSA 1B4PA 1GTBA 3P2AA 3ERWA 4PUFC 1B9XC 1TI1A 1VF1A 3MDKA 2VUPA 2K9FA 2F8FA 3G7JA 4FH8A 2MYGA 1JLWA 2VAFA 5KN2A 1A8YA 18GSA 1YQ1A 3FZAA 4YAVA 1J9BA 3LSZA 1GL8A 2H1DA 3L9VA 3WGXA 4K2DA 5C00A 1ERTA 4HI7A 3KTLA 3GHAA 4HJMA 1SYRA 4KE3A 1K3LA 1F2EA 3QMXA 1NSWA 3SWLA 1T8EB 1GRXA 3LFLA 2YCDA 3HDCA 3F4SA 3IE3A 2B5EA 4G9HA 4KDYA 1TU8A 5DQYA 1RQMA 5F06A 4XTSA 1X5CA 2H8LA 5FHIA 3U5RE 3HXSA 1K0AA 5DALB 2VLUA 3UL3A 1FHEA 4FO5A 1WOUA 3KD0A 2OE0A 1XIYA 2B7KA 2FA8A 5DCHA 5ECQB 1A8LA 3A2WA 2DJ1A 4MJEA 12GSA 3ZIJA 5JWOB 2F3MA 2VOCA 3QFBC 1ERWA 2DMLA 2NDOA 1R5AA 3ZL5A 3GSTA 3O76A 2J23A 4MK3A 4K7IA 4GXZA 2GS3A 1ERUA 4DSRA 2M72A 2VD0A 2EIRA 5ECSA 5E4WA 2LJKA 6GSVA 1ZZYA 6GSXA 3TOTA 2FWGA 2WDUA 4XS4A 5HR2A 3TJFA 2AV4A 3KCMA 4ZL8A 1VF4A 1NW2A 2AUVA 1X9WB 1ZGNA 2Z9SA 2O87A 1OC9B 3DIEA 3H4KA 2C1YA 3HJOA 3F4RA 4KA0A 3CYNA 3BOAA 3KZQA 3M3MA 4IS0A 3VWUA 2YANA 2G0FA 1A0FA 5J4UA 1ZOFA 1PMTA 2VCQA 4ID0A 5AIVA 1YEXA 1XWGA 3KP9A 5KN3A 3RAZA 2LNTA 2V6KA 2YP6A 4ZBBA 1M2DA 4HEA2 1WE0A 3BBYA 3GYKA 2I9HA 3V1WA 2FA4A 1VGLA 4FYCA 3TKRA 2C0GA 7GSSA 4XRDA 1FVKA 2IMDA 2DC5A 5IO0A 3A2VA 4P3YB 2LS5A 5L71A 5A5KA 5D9TA 4I97A 2K6VA 3IHQA 1B8XA 1X5EA 5CRHA 1OC8A 4JR6A 1TDIA 3LQ7A 3UJ1A 2WULA 3HZ4A 4WR5A 2KP1A 1GUKA 5B6MA 1TK0B 4YAPA 2J9HA 2H70A 1Z9HA 3D21A 5GAPD 1PL2A 3PGTA 2VCWA 4MLYA 1X5DA 1K0CA 3KP8A 1ABAA 3CTGA 5ABRA 3HVVA 1YY7A 4IVFA 3LWAA 2I81A 5D93A 3F4TA 6GSWA 1K0DA 4MMMA 2H73A 3PH9A 2IJYA 2WS2A 1O6JA 4TR3A 3GTUA 2CVBA 2B3SA 1XWKA 1IYHA 3VURA 4L5LA 2JACA 2V1MA 1FW1A 3I43A 3VI5A 2GSSA 2R2JA 2V2GA 1EEMA 2I3YA 3D6IA 3BCIA 2ALBA 3O3TA 4MH3A 2CX3A 2H6XA 3UIWA 3CSIA 5IM9A 4WETA 4V2LA 5G1LA 1G7EA 1SJZA 4OO4A 6GSSA 3F63A 4PNFA 1OYJA 5DBQA 4WBRD 2GVPA 2RM5A 2YV7A 3FZ4A 2R3XA 1EOGA 4IW9A 1R4WA 2RUFA 3TRPA 4J2FA 1U88A 2E2MA 4QL9A 1G6WA 3J7Yb 3GSSA 3ZVJA 4ECJA 2HRFA 4I2UA 1ZMAA 4RI6A 5G2ZA 1K0OA 1XOBA 2HXKA 5CRDA 2YOIA 1GSYA 1QGVA 5JWRB 6GSUA 1FOVA 3KGKA 2HRNA 1GSFA 4ISDA 2CAQA 4KDXA 2PMTA 5ENUA 3HVXA 4TR4A 3TJBA 3KEBA 5J9CA 5IMCA 1ERVA 1OE8A 2XHFA 1SK2A 5DALA 3C7MA 3CMIA 3TRXA 1TOFA 2YWOA 4K1FA 1DUGA 2E0QA 4MCUA 4TN8A 1DE1A 2K8SA 1A2MA 3GKNA 5F05A 1AUCA 1Q4JA 4IQ1A 2C80A 1TP9A 4L0WA 3D0ZA 3BD2A 1M2AA 5AIXA 4JBBA 4KH7A 3ZTLA 1V40A 3UBLA 4BPYA 1R26A 2O8VB 3UARA 1XW5A 3DVXA 2WJUA 4KAEA 4K8MA 1VF2A 3Q6OA 4OCFA 3GL3A 5ECOB 2H1GA 4E8HA 3VI7A 1HNAA 2LQQA 1PL1A 2YV9A 3D4MA 4NV5A 5ID2B 4BA7A 1N8JA 4MH2A 5INYA 5J3RA 1HD2A 2H1AA 1RW1A 5ECHB 4F03A 4DEJA 2IMIA 1DBYA 3GURA 5KN0A 1AXDA 1W89A 4OMVA 3ZMLA 2C3QA 4IGJA 2OE3A 4HQSA 1SK1A 1ML6A 1SJIA 2L5LA 2HNLA 4K7NA 1C72A 3KMOA 4BVYA 2GSQA 2HI7A 1S3CA 4IJ3A 5LNKe 2GLRA 1Y25A 20GSA 2HSHA 1THXA 3EURA 2YWNA 4WF4A 1R7HA 4EVMA 3DGQA 3G9BA 4LL4B 2OADA 1GSUA 1SJ6A 3SBCA 2RLIA 3DRNA 3VPTA 2XPDA 2OBKA 4XS6A 16GSA 4PQ1A 4MP4A 1F9MA 1XOAA 5IO2A 2YN1A 3EC3A 3IK9A 3F3RA 2TRXA 3C71A 1CQGA 3RPPA 5IOWA 2CT6A 4IJIA 3W6GA 3DEXA 5DDLA 4K0GA 2E2GA 2A4VA 3IA1A 2B7JA 5C04A 1XZOA 5GSSA 5IQYA 1O7UA 4XS1A 2V6OA 1J0FA 3EU3A 3KIJA 2X8CA 2B5YA 1XW9A 3GKXA 3I9V2 2DJKA 2JL4A 2X8GA 1CQHA 1DE2A 1XW6A 2XC2A 4TXVA 3UEMA 3U6VA 1Z6MA 2RUEA 3GRXA 3QCPA 3F0IA 2HZEB 3Q19A 1FAAA 3PR8A 1PX7A 1JHBA 2EIOA 2VLVA 4MZBA 4EKZA 2HE3A 4WBJA 1TRVA 4WF5A 3AY8A 1YF0A 2GZPA 2WB9A 2P0GA 4ULXA 4TXOB 2RIIA 1T00A 5F0GA 2EIQA 3GL5A 1GUHA 5H5SA 4POLA 4WKWA 1WIKA 2L4CA 4YQMA 2C0DA 2P5RA 1ZYEA 5D8IA 4FIWA 1JLVA 3QR6A 3HA9A 4TR1B 2AJQB 5EVOA 1X9MB 3ZMKA 2QSIA 2C3NA 3US3A 5D9XA 1ILOA 3TJGA 5EPFA 2HLSA 2CZ2A 2PGTA 1BQ7A 2GZYA 3VWXA 2DSAA 8GSSA 13GSA 4BWSA 2R5GA 1AAZA 1G7OA 3Q74A 4N30A 3E9JB 3LG6A 4G2EA 3UAPA 4LMVA 4DSSB 2YWIA 2H1BA 4MDCA 3FRCA 4MA9A 2DJ2A 1T1VA 3EINA 2QGVA 4MZWA 1VRSD 2QC7A 4XHMA 2VCVA 4G19A 1ZYQB 4ZBAA 4XCSA 3KMNA 1GLPA 3VLNA 3WGEA 4WXTA 2C4JA 2H0IA 1PQNA 4NMUA 1J08A 1BYEA 1U3AA 1A2JA 3E3EA 4XIHA 1V9WA 3KM6A 5G1KA 4F9ZA 1KEBA 2CQ9A 3ZFBA 3H1NA 4I2TA 1K3YA 3I6AA 2OACA 2REMA 1ZCPA 1F3BA 1GUMA 4IKHA 2ES7A 1GTUA 2YJHA 3F3QA 4KSMA 1JZWA 2H19A 1V98A 3F6DA 1HYUA 3IK7A 1WPIA 5DAKB 2VM2A 2GQMA 3IV4A 2LUSA 3BJ5A 3FY7A 1EWXA 1OKTA 3CBUA 1HQOA 4CHSA 3L9UA 2C8UA 3PINA 4GWRA 4JRRA 1NHOA 2GGTA 1O85A 4JEDA 5HFGA 1PGTA 2YNXA 4HU7A 3UOMA 5IMZA 4TW5A 1Z7RA 3F8UA 1U6TA 1EOHA 3ISOA 2H71A 3RPNA 2VCTA 1SKSB 4BVXA 2MBTA 5IPHA 5G31A 1EV4A 2LJRA 11GSA 4DSQA 4EXJA 3H79A 4MZCA 2BTOT 3VPQA 5D73A 4V2MA 3HD5A 4N0ZA 5FT3A 2GSTA 1TK5B 1YKCA 2D2ZA 4KW6A 4L5OA 2IIYA 4EUYA 3FZ5A 1FVJA 3KXOA 3I69A 1BX9A 4LL1B 2GZZA 4ECBA 3TB2A 5B8BA 5HR3A 3TKQA 2FCHA 4OFNA 1TRSA 2AYTA 2B1KA 5EL8A 5LD0A 1N2AA 4HZ2A 2N5AA 4ML6A 1B4QA 1MDJA 10GSA 5DJLA 3D4TA 4ECIA 1WP0A 4GRFA 1NM3A 4ZB9A 1PKZA 3CRUA 5DVBA 2FLSA 1WJKA 4AJ7A 2V41A 2N5BA 1WRYA 2MMNA 3EYTA 3GX0A 2ON7A 3DD3A 3M8NA 4PNGA 5E59A 3VK9A 1UC7A 2X99A 3MNGA 5IMVA 2DJ0A 5CRWA 1R5PA 1X0RA 3M1GA 5G30A 5B7CA 2VIMA 2PU9C 3VFIA 3F6FA 4QQ7A 4Q5RA 2OA7A 3TCOA 3HYPA 4IELA 2PN8A 2CAIA 1JZRA 2LTKA 5J41A 4TR1A 4GCIA 1E2YA 4EC0A 2H72A 5HR0A 3LXTA 2O85A 1UVZA 1G6YA 3GH6A 1Y6EA 3KH7A 3VWVA 5IIZA 5DQSA 4BWQA 1M99A 5ECIB 3FR3A
chains in the Genus database with same CATH superfamily
4TVEA 4DSSA 2R0PA 1ACVA 3CRTA 22GSA 5KOWA 4N11A 2YZHA 3BCKA 5JCWA 2O7KA 3FYGA 1I9DA 3ZRDA 1SENA 3D5JA 4ZIJA 1F37A 3ME7A 1OAZA 4AJ6A 5H5QA 3HHVA 1USBA 2H6YA 4EL1A 2KOKA 1SL2B 4KSOA 3DWVA 4GSNA 1Z3EA 2XPEA 1HNBA 4IHUA 2OE1A 3IPZA 3EMPA 1T4YA 2PERA 4Q5FA 6GSTA 3C73A 5ECRB 3TKSA 6GSYA 3IAM2 4TOPA 1F3AA 1T4ZA 2VL9A 3NZNA 2JADA 1ST9A 1GLQA 3QAWA 1GULA 4HQZA 1OE7A 4WEYA 3H93A 5KN1A 4ZL9A 1TU7A 4GLTA 1OC9A 1SU9A 2FNOA 4EDYA 1E6BA 5ELGA 3TUEA 2N5FA 4POBA 2YJ7A 3W8JA 5DAKA 2PPTA 1M3JA 3M0FA 1UN2A 3W8SA 1XVWA 3JCML 4NWYA 1XVQA 2WZ9A 1SYXA 1O81A 1PA3A 4GQFA 4HU9A 4HZ4A 2CA8A 3ZZXA 1U3IA 1O8XA 1BEDA 4XS4B 5A4VA 4FQUA 3L0HA 4TRXA 3TGZA 1K3OA 3LYKA 1QUWA 1K0MA 2A2SA 3DVWA 4PQIA 2L5OA 1SK0A 2LSTA 3ZFLA 4KX4A 2H74A 1EEJA 4MJAA 4GSTA 3O6TA 3G7YA 2E7PA 4MF6A 3N5OA 2H30A 4Z2RA 1URMA 1A24A 1BG5A 4KGIA 1UA5A 3IDVA 1B9YC 3K8NA 4WR4A 2V32A 4OO5A 5AISA 1A23A 4N0VA 4ICYA 4F82A 3ZYWA 5BMUA 2C0EA 3HY2A 2LKUA 1PRXA 1XWBA 3LEFA 1BJXA 4G0KA 1Q98A 4Q5QA 1NHYA 1U87A 1WMJA 2TRCP 2MMOA 1GNWA 3FZ9A 2BJXA 4POMA 4IN0A 2LJAA 1PKWA 3GN3A 2F8AA 4X43A 3E0UA 5EY6A 3IHGA 1YDKA 1SL1B 4EF0A 5DCGA 1B48A 2VCZA 2HT9A 4PGTA 1M9BA 2X64A 3QAGA 1YKAA 5GAND 3N9JA 5G5EA 1JFUA 4RI7A 3A3TA 2ON5A 3OR5A 1GWCA 3TJJA 5CYYA 4X1UA 3ZIVA 1PN9A 2IFQB 2L59A 2HSMA 5CREA 1EGOA 3MWHA 4L8EA 5J5NA 2YPMA 1PSQA 2IL3A 2VO4A 3FHKA 4E8EA 4MPGA 4K7OA 2AHEA 2H6ZA 5ELAA 3GKMA 2B6MA 2FHEA 1V58A 1PD21 3MAKA 3VWWA 3GUSA 1M0UA 1XWAA 5HQPA 1XBSA 1FB6A 2CX4A 2KUCA 3GH9A 3FW2A 1QFNA 2R6KA 19GSA 1W4VA 3DXBA 4BL7A 4O5RA 2UZ8A 3WT1A 1MDIA 3CSHA 4IP1A 3FEUA 3GTUB 4ZBDA 1YF1A 5ECPB 1S3AA 1LJRA 1FB0A 1SD8A 3EWLA 1S3DA 3MIXA 3EU4A 5DJMA 3ZVJD 2GDRA 1XWCA 3LYPA 2K8VA 3CTFA 2ZUPA 4RQXA 1K0NA 4HS1A 3D22A 5CO3A 2WFCA 4MJBA 2NVLA 2PBJA 3P90A 1LU4A 1ZYNA 2HFDA 1OKDA 5A4WA 1AQXA 1XXUA 4J57E 2FWHA 5D9VA 1V2AA 3A5IA 1X9SB 2H0HA 2FY6A 3L9SA 1GTAA 1H75A 3L4NA 1A2LA 2R37A 2OJLA 1TRWA 4YH2A 5D9WA 2DLXA 1SKWB 4EDZA 1A0RP 3ZREA 3LJRA 2TIRA 3CXGA 4F0CA 3DMLA 3P8WA 1FOHA 5ECNB 4V1Ag 3GX8A 3RHCA 4IQAA 5ID2A 3NIVA 4OCEA 4NXIA 3HZ8A 2CVDA 3APSA 5GSTA 2FWFA 2ZNMA 3LW9A 3MSZA 4GTUA 4KNDA 1IYIA 3TRQA 4YQVA 4D73B 2JSZA 2VD1A 4V1Ap 5ECKB 2VM1A 3FMWA 2H66A 4HSCX 4G10A 3GV1A 2IWTA 3IOSA 3TKSC 2P5QA 1G0TA 3UVHA 3RBTA 2GTUA 4G0IA 1HNCA 4I6XA 2PWJA 4JE1A 1FG4A 4ZILA 4H86A 4YKGA 17GSA 2VL2A 2FWEA 2YWMA 1GSQA 5FWGA 4Z7XA 4YQUA 2GSRA 4OWYA 3KH9A 4DVCA 1JZDA 4POKA 2LEGA 4O92A 4RUVA 3C1SA 3KTBA 4LLRA 4LMWA 2X8HA 5HR1A 3HKRA 2DJJA 3KJYA 3GA4A 2FD3A 2LV3A 4ZXGA 5G5FA 4NV2A 1K0BA 1GTIA 5GZZB 4HOJA 3F9UA 4ZB6A 2DMMA 2RM6A 1AIUA 2JZTA 1V57A 4TR0A 2CVKA 4HJ2A 2FUG2 4GSSA 4MF7A 4ZB8A 3ED3A 2OBIA 4L0UA 1TKDB 3QPMA 2KHPA 4NHWA 1O73A 5H5RA 1Z5YE 2C0FA 3L78A 4K2XA 4GF0A 1GP1A 2VL3A 3LGCA 2LRTA 2I1UA 1EZKA 4I5QA 1LBKA 2L57A 5ECMB 1KTEA 4HUAA 2MBSA 4N10A 2IFQA 4JU5A 3IC4A 5D96A 5ECIB 3WYWA 2F9SA 3TDGA 4ILFA 2LNSA 3FR9A 2HYXA 4QL7A 3A2XA 5HFKA 5KEJA 1DSBA 2H76A 4MABA 3RHBA 2JSYA 4HDEA 3LORA 2HZEA 2DIYA 1TJDA 3IAS2 3GFKA 4AJ8A 1KBNA 4PURA 3S9FA 2JU5A 3TKPA 5B6NA 5B8AA 1TRUA 1YJ6A 3TKSE 2B5XA 1AC1A 2ZCTA 1PX6A 4TXOA 2F51A 1XCCA 2GT5A 2CZ3A 3J7Yk 3QFAC 1Z6NA 4ECCA 1YZXA 4PQHA 2DKIA 4K9ZA 2PVOC 3Q18A 4NAXA 5IMAA 4JR4A 1JZOA 2CV4A 2IMEA 5CRGA 3APOA 2DJ3A 2X49A 4Z2UA 3HJPA 3ZITA 3NOFA 3ERFA 4MJCA 4Z2TA 3TJKA 3GNJA 4EE0A 4RQRA 1KNGA 1TK8B 4V2NA 1OVNA 1GNEA 2LRNA 3DYRA 4F0BA 3CSJA 2VLTA 4K6XA 3UMAA 4OFMA 3EE2A 4NPBA 3QOUA 5LCZA 2YZUA 3FKFA 2AB6A 2HZFA 2PUKC 4F2IA 3ME8A 4PUAA 5CAXA 1EV9A 2QA2A 1AW9A 3C8EA 3EPTA 5IMFA 3GMFA 3IBHA 5JCGA 2WGRA 2OKAA 3M9KA 2BMXA 2WCIA 2NPBA 3R2QA 1THOA 4MF5A 3ERGA 4K0NA 2MZCA 2HSYA 2WRTA 3WD6A 4FYUA 2L6CA 1QQ2A 2QKEA 3ZLPA 2C3TA 3C1RA 4D73A 4LA1A 5JWQB 5A4UA 2JZRA 4OFTA 3TOUA 1GSSA 2I4AA 2MMAA 3HJMA 2K18A 5CNWA 2IN3A 3GIXA 2B1LA 4AGSA 1YEPA 3WT2A 2HRKA 1VF3A 1QK8A 2L6DA 1FO5A 1M7TA 1XPVA 2PVQA 5COHA 3HVSA 2NBSA 2XBIA 5AN1A 2M80A 3FK8A 5JCUA 1GH2A 3M9JA 3A5WA 1TW9A 1M9AA 3EVIA 2O89A 2L4QA 2KLXA 14GSA 1I5GA 2G2QA 3UVTA 4ZL7A 4EO3A 2H75A 3WGDA 1AQVA 1GSDA 2DIZA 1T3BA 2GQLA 1EP7A 2MMZA 1OC3A 1QXHA 4CW9A 2DBCA 1MDKA 2P31A 2IPAA 2VCXA 1MEKA 3EMXA 3P7XA 4ACSA 1RK4A 5CP1A 1F6MC 4AF2A 5ECLB 3RDWA 2KP2A 1MTCA 2IMKA 4XRAA 4TKYA 2LRCA 4NHZA 4IP6A 1ZL9A 4K5SA 2IMFA 3UBKA 1SD9A 1H4OA 1QMVA 3LXZA 5IMDA 3HVNA 1SL0B 3GKKA 4EIQA 2R4VA 5IPGA 4X0XA 1BAYA 2VL2C 2A2PA 2A2RA 4I8BA 1EP8A 5F07A 3APQA 2EC4A 4Q5NA 1AQWA 1M2BA 4JZQA 4IBPA 4J56E 2JZSA 1O8WA 2NTOA 1WWJA 5HFIA 1TTZA 5J9BA 1MD4A 1T7PB 4CDOA 2GT6A 2GQKA 1GSEA 2XBQA 1EGRA 2LQOA 4PX1A 3G7IA 4KDUA 3DKSA 3HCZA 4KUNA 2M46A 4K5RA 1ON4A 1XFLA 2H01A 1SKRB 3FR6A 4KCEA 4FYBA 1TI3A 2AAWA 2FGXA 4O32A 3QAVA 4ML1A 1MD3A 4O7HA 3IXRA 3IR4A 4KB3A 4OD7A 1TXXA 2H0GA 4MPFA 3IRAA 3QD9A 4GQCA 5AGYA 3H8QA 3QDNA 4KCAA 4PXOA 1Z7PA 5F8BA 5IOXA 9GSSA 1B4PA 1GTBA 3P2AA 3ERWA 4PUFC 1B9XC 1TI1A 1VF1A 3MDKA 2VUPA 2K9FA 4KF9A 2F8FA 3G7JA 4FH8A 2MYGA 1JLWA 2VAFA 5KN2A 1A8YA 18GSA 1YQ1A 3FZAA 4YAVA 1J9BA 3LSZA 1GL8A 2H1DA 3L9VA 3WGXA 4K2DA 5C00A 1ERTA 4HI7A 3KTLA 3GHAA 4HJMA 1SYRA 4KE3A 1K3LA 1F2EA 3QMXA 1NSWA 1PN0A 3SWLA 1T8EB 1GRXA 3LFLA 4G0LA 2YCDA 3HDCA 3F4SA 3IE3A 2B5EA 4G9HA 4KDYA 1TU8A 5DQYA 4PTSA 4CY6A 1RQMA 5F06A 4XTSA 1X5CA 2H8LA 5FHIA 3U5RE 3HXSA 1K0AA 5DALB 2VLUA 3UL3A 1FHEA 4FO5A 1WOUA 3KD0A 2OE0A 4CY8A 1XIYA 2B7KA 2FA8A 5DCHA 5ECQB 1A8LA 3A2WA 2DJ1A 4MJEA 12GSA 3ZIJA 5JWOB 2F3MA 2VOCA 3QFBC 1ERWA 2DMLA 2NDOA 1R5AA 3ZL5A 3GSTA 3O76A 2J23A 4MK3A 4K7IA 4GXZA 2GS3A 1ERUA 4DSRA 2M72A 2VD0A 2EIRA 5ECSA 5E4WA 2LJKA 6GSVA 1ZZYA 6GSXA 3TOTA 2FWGA 2WDUA 4XS4A 5HR2A 3TJFA 4YKFA 2AV4A 3KCMA 4ZL8A 1VF4A 1NW2A 2AUVA 4BIKA 1X9WB 1ZGNA 2Z9SA 2O87A 1OC9B 3DIEA 3H4KA 2C1YA 3HJOA 3F4RA 4KA0A 3CYNA 3BOAA 3KZQA 3M3MA 4IS0A 3VWUA 2YANA 2G0FA 1A0FA 5J4UA 1ZOFA 1PMTA 2VCQA 4ID0A 5AIVA 1YEXA 1XWGA 3KP9A 5KN3A 3RAZA 2LNTA 2V6KA 2YP6A 4ZBBA 1M2DA 4HEA2 1WE0A 3BBYA 3GYKA 2I9HA 3V1WA 2FA4A 1VGLA 4FYCA 3TKRA 2C0GA 7GSSA 4XRDA 4BVYB 1FVKA 2IMDA 2DC5A 5IO0A 3A2VA 4P3YB 2LS5A 5L71A 5A5KA 2A4HA 5D9TA 4I97A 2K6VA 3IHQA 1B8XA 1X5EA 5CRHA 1OC8A 4JR6A 1TDIA 3LQ7A 3UJ1A 2WULA 3HZ4A 4WR5A 2KP1A 1GUKA 5B6MA 1TK0B 4YAPA 2J9HA 2H70A 1Z9HA 3D21A 5GAPD 1PL2A 3PGTA 2VCWA 4MLYA 1X5DA 1K0CA 3KP8A 1ABAA 3CTGA 5ABRA 3HVVA 1YY7A 4IVFA 3LWAA 2I81A 5D93A 3F4TA 6GSWA 1K0DA 4MMMA 2H73A 3PH9A 2IJYA 2WS2A 1O6JA 4TR3A 3GTUA 2CVBA 2B3SA 4O5UA 1XWKA 1IYHA 3VURA 4L5LA 2JACA 2V1MA 1FW1A 3I43A 3VI5A 2GSSA 2R2JA 2V2GA 1EEMA 2I3YA 3D6IA 3BCIA 2ALBA 3O3TA 4MH3A 2CX3A 2H6XA 3UIWA 3CSIA 5IM9A 4WETA 4V2LA 5G1LA 1G7EA 1SJZA 4OO4A 6GSSA 3F63A 4PNFA 1OYJA 5DBQA 4WBRD 2GVPA 2RM5A 2YV7A 3FZ4A 2R3XA 1EOGA 4IW9A 1R4WA 2RUFA 3TRPA 4J2FA 4BL7B 1U88A 2HRAA 2E2MA 4QL9A 1G6WA 3J7Yb 3GSSA 3ZVJA 4ECJA 2HRFA 4I2UA 1ZMAA 4RI6A 5G2ZA 1K0OA 1XOBA 2HXKA 5CRDA 2YOIA 1GSYA 1QGVA 5JWRB 6GSUA 1FOVA 3KGKA 2HRNA 1GSFA 4ISDA 2QA1A 2CAQA 4KDXA 2PMTA 5ENUA 3HVXA 4TR4A 3TJBA 3KEBA 5J9CA 5IMCA 1ERVA 1OE8A 2XHFA 1SK2A 5DALA 3C7MA 3CMIA 3TRXA 1TOFA 2YWOA 4K1FA 1DUGA 2E0QA 4MCUA 4TN8A 1DE1A 2K8SA 1A2MA 3GKNA 5F05A 1AUCA 1Q4JA 4IQ1A 2C80A 1TP9A 4L0WA 3D0ZA 3BD2A 1M2AA 1ZYPA 5AIXA 4JBBA 4KH7A 3ZTLA 1V40A 3UBLA 4BPYA 1R26A 2O8VB 3UARA 1XW5A 3DVXA 2WJUA 4KAEA 4K8MA 1VF2A 3Q6OA 4OCFA 3GL3A 5ECOB 2H1GA 4E8HA 3VI7A 1HNAA 2LQQA 1PL1A 2YV9A 3D4MA 4NV5A 5ID2B 4BA7A 1N8JA 4MH2A 5INYA 5J3RA 1HD2A 2H1AA 1RW1A 5ECHB 4F03A 4DEJA 2IMIA 1DBYA 3GURA 5KN0A 1AXDA 1W89A 4O5QA 4OMVA 3ZMLA 2C3QA 4IGJA 2OE3A 4HQSA 1SK1A 1ML6A 1SJIA 2L5LA 2HNLA 4K7NA 1C72A 3KMOA 4BVYA 2GSQA 2HI7A 1S3CA 4IJ3A 5LNKe 2GLRA 1Y25A 20GSA 2HSHA 1THXA 3EURA 2YWNA 4WF4A 1R7HA 4EVMA 3DGQA 3G9BA 4LL4B 2OADA 1GSUA 1SJ6A 3SBCA 2RLIA 3DRNA 3VPTA 2XPDA 2OBKA 4XS6A 16GSA 4PQ1A 4BVXB 4MP4A 1F9MA 1XOAA 5IO2A 2YN1A 3EC3A 3IK9A 3F3RA 2TRXA 3C71A 1CQGA 3RPPA 5IOWA 1XG8A 2CT6A 4IJIA 3W6GA 3DEXA 5DDLA 4K0GA 2E2GA 2A4VA 3IA1A 2B7JA 5C04A 1XZOA 5GSSA 5IQYA 1O7UA 4XS1A 2V6OA 1J0FA 3EU3A 3KIJA 2X8CA 2B5YA 1XW9A 3GKXA 3I9V2 2DJKA 2JL4A 4A5PA 2X8GA 1CQHA 1DE2A 1XW6A 2XC2A 4TXVA 3UEMA 3U6VA 1Z6MA 2RUEA 3GRXA 3QCPA 3F0IA 2HZEB 3Q19A 1FAAA 4X4JA 3PR8A 1PX7A 1JHBA 2EIOA 2R0CA 2VLVA 4MZBA 4EKZA 3PPUA 2HE3A 3R3EA 4WBJA 1TRVA 4WF5A 3AY8A 1YF0A 2GZPA 2WB9A 2P0GA 4ULXA 5KOXA 4TXOB 2RIIA 1T00A 5F0GA 2EIQA 3GL5A 1GUHA 5H5SA 4POLA 4WKWA 1WIKA 2L4CA 4YQMA 2C0DA 2P5RA 1ZYEA 5D8IA 4FIWA 1JLVA 3QR6A 3HA9A 4TR1B 2AJQB 5EVOA 1X9MB 3ZMKA 2QSIA 2C3NA 3US3A 5D9XA 1ILOA 3TJGA 5EPFA 2HLSA 2CZ2A 2PGTA 1BQ7A 2GZYA 3VWXA 2DSAA 8GSSA 13GSA 4BWSA 2R5GA 1AAZA 1G7OA 3Q74A 4N30A 3E9JB 3LG6A 4G2EA 3UAPA 4LMVA 4DSSB 2YWIA 2H1BA 4MDCA 3FRCA 4MA9A 2DJ2A 1T1VA 3EINA 2QGVA 4MZWA 1VRSD 2QC7A 4XHMA 2VCVA 4G19A 1ZYQB 4ZBAA 4XCSA 3KMNA 1GLPA 3VLNA 3WGEA 4WXTA 2C4JA 2H0IA 1PQNA 4NMUA 1J08A 1BYEA 1U3AA 1A2JA 3E3EA 4EIPA 4XIHA 1V9WA 3KM6A 5G1KA 4F9ZA 1KEBA 2CQ9A 3ZFBA 3H1NA 4I2TA 1K3YA 3I6AA 2OACA 2REMA 1ZCPA 1F3BA 1GUMA 4IKHA 2ES7A 1GTUA 2YJHA 3F3QA 4KSMA 1JZWA 2H19A 3CQFA 1V98A 3F6DA 1HYUA 3IK7A 1WPIA 1M3IA 5DAKB 2VM2A 2GQMA 3IV4A 2LUSA 3BJ5A 3FY7A 1EWXA 1OKTA 3CBUA 1HQOA 4CHSA 1S3RA 3L9UA 2C8UA 3PINA 4GWRA 4JRRA 1NHOA 3IC8A 2GGTA 1O85A 4JEDA 5HFGA 1PGTA 2DKHA 2YNXA 4HU7A 3UOMA 5IMZA 4TW5A 1Z7RA 3F8UA 1U6TA 1EOHA 3ISOA 2H71A 3RPNA 2VCTA 1SKSB 4BVXA 2MBTA 5IPHA 5G31A 1EV4A 2LJRA 11GSA 4DSQA 4EXJA 3H79A 4MZCA 2BTOT 3VPQA 5D73A 4V2MA 3HD5A 4N0ZA 5FT3A 2GSTA 1TK5B 1YKCA 2D2ZA 4KW6A 4L5OA 4EUYA 3FZ5A 1FVJA 3KXOA 3I69A 1BX9A 2X4AA 4LL1B 2GZZA 4ECBA 3TB2A 5B8BA 5HR3A 3TKQA 2FCHA 4OFNA 1TRSA 2AYTA 2B1KA 5BRTA 5EL8A 2R0GA 5LD0A 1N2AA 4HZ2A 1PFOA 2N5AA 4ML6A 1B4QA 1MDJA 10GSA 5DJLA 3D4TA 4ECIA 1WP0A 4GRFA 1NM3A 4ZB9A 1PKZA 3CRUA 5DVBA 2FLSA 1WJKA 4AJ7A 2V41A 2N5BA 1WRYA 4USSA 2MMNA 3EYTA 3GX0A 2ON7A 3DD3A 3M8NA 4PNGA 5E59A 3VK9A 1UC7A 2X99A 3MNGA 5IMVA 2DJ0A 5CRWA 1R5PA 1X0RA 3M1GA 5G30A 5B7CA 2VIMA 2PU9C 3MYDA 3VFIA 3F6FA 4QQ7A 4Q5RA 2OA7A 3TCOA 3HYPA 4IELA 2PN8A 2CAIA 1JZRA 4MNNA 2LTKA 5J41A 4TR1A 4GCIA 1E2YA 4EC0A 2H72A 5HR0A 3LXTA 2O85A 1UVZA 1G6YA 3GH6A 1Y6EA 3KH7A 3VWVA 5IIZA 5DQSA 4BWQA 1M99A 2IIYA 3FR3A
chains in the Genus database with same CATH topology
4TVEA 4DSSA 2R0PA 1ACVA 3CRTA 22GSA 5KOWA 4N11A 2YZHA 3BCKA 5JCWA 2O7KA 3FYGA 1I9DA 3ZRDA 1SENA 3D5JA 4ZIJA 1F37A 3ME7A 1OAZA 4AJ6A 5H5QA 3HHVA 1USBA 2H6YA 4EL1A 2KOKA 1SL2B 4KSOA 3DWVA 4GSNA 1Z3EA 2XPEA 1HNBA 4IHUA 2OE1A 3IPZA 3EMPA 1T4YA 2PERA 4Q5FA 6GSTA 3C73A 5ECRB 3TKSA 6GSYA 3IAM2 4TOPA 1F3AA 1T4ZA 2VL9A 3NZNA 2JADA 1ST9A 1GLQA 3QAWA 1GULA 4HQZA 1OE7A 4WEYA 3H93A 5KN1A 4ZL9A 1TU7A 4GLTA 1OC9A 1SU9A 2FNOA 4EDYA 1E6BA 5ELGA 3TUEA 2N5FA 4POBA 2YJ7A 3W8JA 5DAKA 2PPTA 3M0FA 1UN2A 3W8SA 1XVWA 3JCML 4NWYA 1XVQA 2WZ9A 1SYXA 1O81A 1PA3A 4GQFA 4HU9A 4HZ4A 2CA8A 3ZZXA 1U3IA 1O8XA 1BEDA 4XS4B 5A4VA 4FQUA 3L0HA 4TRXA 3TGZA 1K3OA 3LYKA 1QUWA 1K0MA 2A2SA 3DVWA 4PQIA 2L5OA 1SK0A 2LSTA 3ZFLA 4KX4A 2H74A 1EEJA 4MJAA 4GSTA 3O6TA 3G7YA 2E7PA 4MF6A 3N5OA 2H30A 4Z2RA 1URMA 1A24A 1BG5A 4KGIA 1UA5A 3IDVA 1B9YC 3K8NA 4WR4A 2V32A 4OO5A 5AISA 1A23A 4N0VA 4ICYA 4F82A 3ZYWA 5BMUA 2C0EA 3HY2A 2LKUA 1PRXA 1XWBA 3LEFA 1BJXA 4G0KA 1Q98A 4Q5QA 1NHYA 1U87A 1WMJA 2TRCP 2MMOA 1GNWA 3FZ9A 2BJXA 4POMA 4IN0A 2LJAA 1PKWA 3GN3A 2F8AA 4X43A 3E0UA 5EY6A 3IHGA 1YDKA 1SL1B 4EF0A 5DCGA 1B48A 2VCZA 2HT9A 4PGTA 1M9BA 2X64A 3QAGA 1YKAA 5GAND 3N9JA 5G5EA 1JFUA 4RI7A 3A3TA 2ON5A 3OR5A 1GWCA 3TJJA 5CYYA 4X1UA 3ZIVA 1PN9A 2IFQB 2L59A 2HSMA 5CREA 1EGOA 3MWHA 4L8EA 5J5NA 2YPMA 1PSQA 2IL3A 2VO4A 3FHKA 4E8EA 4MPGA 4K7OA 2AHEA 2H6ZA 5ELAA 3GKMA 2B6MA 2FHEA 1V58A 1PD21 3MAKA 3VWWA 3GUSA 1M0UA 1XWAA 5HQPA 1XBSA 1FB6A 2CX4A 2KUCA 3GH9A 3FW2A 1QFNA 2R6KA 19GSA 1W4VA 3DXBA 4BL7A 4O5RA 2UZ8A 3WT1A 1MDIA 3CSHA 4IP1A 3FEUA 3GTUB 4ZBDA 1YF1A 5ECPB 1S3AA 1LJRA 1FB0A 1SD8A 3EWLA 1S3DA 3MIXA 3EU4A 5DJMA 3ZVJD 2GDRA 1XWCA 3LYPA 2K8VA 3CTFA 2ZUPA 4RQXA 1K0NA 4HS1A 3D22A 5CO3A 2WFCA 4MJBA 2NVLA 2PBJA 3P90A 1LU4A 1ZYNA 2HFDA 1OKDA 5A4WA 1AQXA 1XXUA 4J57E 2FWHA 5D9VA 1V2AA 3A5IA 1X9SB 2H0HA 2FY6A 3L9SA 1GTAA 1H75A 3L4NA 1A2LA 2R37A 2OJLA 1TRWA 4YH2A 5D9WA 2DLXA 1SKWB 4EDZA 1A0RP 3ZREA 3LJRA 2TIRA 3CXGA 4F0CA 3DMLA 3P8WA 1FOHA 5ECNB 4V1Ag 3GX8A 3RHCA 4IQAA 5ID2A 3NIVA 4OCEA 4NXIA 3HZ8A 2CVDA 3APSA 5GSTA 2FWFA 2ZNMA 3LW9A 3MSZA 4GTUA 4KNDA 1IYIA 3TRQA 4YQVA 4D73B 2JSZA 2VD1A 4V1Ap 5ECKB 2VM1A 3FMWA 2H66A 4G10A 3GV1A 2IWTA 3IOSA 3TKSC 2P5QA 1G0TA 3UVHA 3RBTA 2GTUA 4G0IA 1HNCA 4I6XA 2PWJA 4JE1A 1FG4A 4ZILA 4H86A 4YKGA 17GSA 2VL2A 2FWEA 2YWMA 1GSQA 5FWGA 4Z7XA 4YQUA 2GSRA 4OWYA 3KH9A 4DVCA 1JZDA 4POKA 2LEGA 4O92A 4RUVA 3C1SA 3KTBA 4LLRA 4LMWA 2X8HA 5HR1A 3HKRA 2DJJA 3KJYA 3GA4A 2FD3A 2LV3A 4ZXGA 5G5FA 4NV2A 1K0BA 1GTIA 5GZZB 4HOJA 3F9UA 4ZB6A 2DMMA 2RM6A 1AIUA 2JZTA 1V57A 4TR0A 2CVKA 4HJ2A 2FUG2 4GSSA 4MF7A 4ZB8A 3ED3A 2OBIA 4L0UA 1TKDB 3QPMA 2KHPA 4NHWA 1O73A 5H5RA 1Z5YE 2C0FA 3L78A 4K2XA 4GF0A 1GP1A 2VL3A 3LGCA 2LRTA 2I1UA 1EZKA 4I5QA 1LBKA 2L57A 5ECMB 1KTEA 4HUAA 2MBSA 4N10A 2IFQA 4JU5A 3IC4A 5D96A 5ECIB 3WYWA 2F9SA 3TDGA 4ILFA 2LNSA 3FR9A 2HYXA 4QL7A 3A2XA 5HFKA 5KEJA 1DSBA 2H76A 4MABA 3RHBA 2JSYA 4HDEA 3LORA 2HZEA 2DIYA 1TJDA 3IAS2 3GFKA 4AJ8A 1KBNA 4PURA 3S9FA 2JU5A 3TKPA 5B6NA 5B8AA 1TRUA 1YJ6A 3TKSE 2B5XA 1AC1A 2ZCTA 1PX6A 4TXOA 2F51A 1XCCA 2GT5A 2CZ3A 3J7Yk 3QFAC 1Z6NA 4ECCA 1YZXA 4PQHA 2DKIA 4K9ZA 2PVOC 3Q18A 4NAXA 5IMAA 4JR4A 1JZOA 2CV4A 2IMEA 5CRGA 3APOA 2DJ3A 2X49A 4Z2UA 3HJPA 3ZITA 3NOFA 3ERFA 4MJCA 4Z2TA 3TJKA 3GNJA 4EE0A 4RQRA 1KNGA 1TK8B 4V2NA 1OVNA 1GNEA 2LRNA 3DYRA 4F0BA 3CSJA 2VLTA 4K6XA 3UMAA 4OFMA 3EE2A 4NPBA 3QOUA 5LCZA 2YZUA 3FKFA 2AB6A 2HZFA 2PUKC 4F2IA 3ME8A 4PUAA 5CAXA 1EV9A 2QA2A 1AW9A 3C8EA 3EPTA 5IMFA 3GMFA 3IBHA 5JCGA 2WGRA 2OKAA 3M9KA 2BMXA 2WCIA 2NPBA 3R2QA 1THOA 4MF5A 3ERGA 4K0NA 2MZCA 2HSYA 2WRTA 3WD6A 4FYUA 2L6CA 1QQ2A 2QKEA 3ZLPA 2C3TA 3C1RA 4D73A 4LA1A 5JWQB 5A4UA 2JZRA 4OFTA 3TOUA 1GSSA 2I4AA 2MMAA 3HJMA 2K18A 5CNWA 2IN3A 3GIXA 2B1LA 4AGSA 1YEPA 3WT2A 2HRKA 1VF3A 1QK8A 2L6DA 1FO5A 1M7TA 1XPVA 2PVQA 5COHA 3HVSA 2NBSA 2XBIA 5AN1A 2M80A 3FK8A 5JCUA 1GH2A 3M9JA 3A5WA 1TW9A 1M9AA 3EVIA 2O89A 2L4QA 2KLXA 14GSA 1I5GA 2G2QA 3UVTA 4ZL7A 4EO3A 2H75A 3WGDA 1AQVA 1GSDA 2DIZA 1T3BA 2GQLA 1EP7A 2MMZA 1OC3A 1QXHA 4CW9A 2DBCA 1MDKA 2P31A 2IPAA 2VCXA 1MEKA 3EMXA 3P7XA 4ACSA 1RK4A 5CP1A 1F6MC 4AF2A 5ECLB 3RDWA 2KP2A 1MTCA 2IMKA 4XRAA 4TKYA 2LRCA 4NHZA 4IP6A 1ZL9A 4K5SA 2IMFA 3UBKA 1SD9A 1H4OA 1QMVA 3LXZA 5IMDA 1SL0B 3GKKA 4EIQA 2R4VA 5IPGA 4X0XA 1BAYA 2VL2C 2A2PA 2A2RA 4I8BA 1EP8A 5F07A 3APQA 2EC4A 4Q5NA 1AQWA 1M2BA 4JZQA 4IBPA 4J56E 2JZSA 1O8WA 2NTOA 1WWJA 5HFIA 1TTZA 5J9BA 1MD4A 1T7PB 4CDOA 2GT6A 2GQKA 1GSEA 2XBQA 1EGRA 2LQOA 4PX1A 3G7IA 4KDUA 3DKSA 3HCZA 4KUNA 2M46A 4K5RA 1ON4A 1XFLA 2H01A 1SKRB 3FR6A 4KCEA 4FYBA 1TI3A 2AAWA 2FGXA 4O32A 3QAVA 4ML1A 1MD3A 4O7HA 3IXRA 3IR4A 4KB3A 4OD7A 1TXXA 2H0GA 4MPFA 3IRAA 3QD9A 4GQCA 5AGYA 3H8QA 3QDNA 4KCAA 4PXOA 1Z7PA 5F8BA 5IOXA 9GSSA 1B4PA 1GTBA 3P2AA 3ERWA 4PUFC 1B9XC 1TI1A 1VF1A 3MDKA 2VUPA 2K9FA 4KF9A 2F8FA 3G7JA 4FH8A 2MYGA 1JLWA 2VAFA 5KN2A 1A8YA 18GSA 1YQ1A 3FZAA 4YAVA 1J9BA 3LSZA 1GL8A 2H1DA 3L9VA 3WGXA 4K2DA 5C00A 1ERTA 4HI7A 3KTLA 3GHAA 4HJMA 1SYRA 4KE3A 1K3LA 1F2EA 3QMXA 1NSWA 1PN0A 3SWLA 1T8EB 1GRXA 3LFLA 4G0LA 2YCDA 3HDCA 3F4SA 3IE3A 2B5EA 4G9HA 4KDYA 1TU8A 5DQYA 4PTSA 4CY6A 1RQMA 5F06A 4XTSA 1X5CA 2H8LA 5FHIA 3U5RE 3HXSA 1K0AA 5DALB 2VLUA 3UL3A 1FHEA 4FO5A 1WOUA 3KD0A 2OE0A 4CY8A 1XIYA 2B7KA 2FA8A 5DCHA 5ECQB 1A8LA 3A2WA 2DJ1A 4MJEA 12GSA 3ZIJA 5JWOB 2F3MA 2VOCA 3QFBC 1ERWA 2DMLA 2NDOA 1R5AA 3ZL5A 3GSTA 3O76A 2J23A 4MK3A 4K7IA 4GXZA 2GS3A 1ERUA 4DSRA 2M72A 2VD0A 2EIRA 5ECSA 5E4WA 2LJKA 6GSVA 1ZZYA 6GSXA 3TOTA 2FWGA 2WDUA 4XS4A 5HR2A 3TJFA 4YKFA 2AV4A 3KCMA 4ZL8A 1VF4A 1NW2A 2AUVA 1X9WB 1ZGNA 2Z9SA 2O87A 1OC9B 3DIEA 3H4KA 2C1YA 3HJOA 3F4RA 4KA0A 3CYNA 3BOAA 3KZQA 3M3MA 4IS0A 3VWUA 2YANA 2G0FA 1A0FA 5J4UA 1ZOFA 1PMTA 2VCQA 4ID0A 5AIVA 1YEXA 1XWGA 3KP9A 5KN3A 3RAZA 2LNTA 2V6KA 2YP6A 4ZBBA 1M2DA 4HEA2 1WE0A 3BBYA 3GYKA 2I9HA 3V1WA 2FA4A 1VGLA 4FYCA 3TKRA 2C0GA 7GSSA 4XRDA 4BVYB 1FVKA 2IMDA 2DC5A 5IO0A 3A2VA 4P3YB 2LS5A 5L71A 5A5KA 2A4HA 5D9TA 4I97A 2K6VA 3IHQA 1B8XA 1X5EA 5CRHA 1OC8A 4JR6A 1TDIA 3LQ7A 3UJ1A 2WULA 3HZ4A 4WR5A 2KP1A 1GUKA 5B6MA 1TK0B 4YAPA 2J9HA 2H70A 1Z9HA 3D21A 5GAPD 1PL2A 3PGTA 2VCWA 4MLYA 1X5DA 1K0CA 3KP8A 1ABAA 3CTGA 5ABRA 3HVVA 1YY7A 4IVFA 3LWAA 2I81A 5D93A 3F4TA 6GSWA 1K0DA 4MMMA 2H73A 3PH9A 2IJYA 2WS2A 1O6JA 4TR3A 3GTUA 2CVBA 2B3SA 4O5UA 1XWKA 1IYHA 3VURA 4L5LA 2JACA 2V1MA 1FW1A 3I43A 3VI5A 2GSSA 2R2JA 2V2GA 1EEMA 2I3YA 3D6IA 3BCIA 2ALBA 3O3TA 4MH3A 2CX3A 2H6XA 3UIWA 3CSIA 5IM9A 4WETA 4V2LA 5G1LA 1G7EA 1SJZA 4OO4A 6GSSA 3F63A 4PNFA 1OYJA 5DBQA 4WBRD 2GVPA 2RM5A 2YV7A 3FZ4A 2R3XA 1EOGA 4IW9A 1R4WA 2RUFA 3TRPA 4J2FA 4BL7B 1U88A 2HRAA 2E2MA 4QL9A 1G6WA 3J7Yb 3GSSA 3ZVJA 4ECJA 2HRFA 4I2UA 1ZMAA 4RI6A 5G2ZA 1K0OA 1XOBA 2HXKA 5CRDA 2YOIA 1GSYA 1QGVA 5JWRB 6GSUA 1FOVA 3KGKA 2HRNA 1GSFA 4ISDA 2QA1A 2CAQA 4KDXA 2PMTA 5ENUA 3HVXA 4TR4A 3TJBA 3KEBA 5J9CA 5IMCA 1ERVA 1OE8A 2XHFA 1SK2A 5DALA 3C7MA 3CMIA 3TRXA 1TOFA 2YWOA 4K1FA 1DUGA 2E0QA 4MCUA 4TN8A 1DE1A 2K8SA 1A2MA 3GKNA 5F05A 1AUCA 1Q4JA 4IQ1A 2C80A 1TP9A 4L0WA 3D0ZA 3BD2A 1M2AA 1ZYPA 5AIXA 4JBBA 4KH7A 3ZTLA 1V40A 3UBLA 4BPYA 1R26A 2O8VB 3UARA 1XW5A 3DVXA 2WJUA 4KAEA 4K8MA 1VF2A 3Q6OA 4OCFA 3GL3A 5ECOB 2H1GA 4E8HA 3VI7A 1HNAA 2LQQA 1PL1A 2YV9A 3D4MA 4NV5A 5ID2B 4BA7A 1N8JA 4MH2A 5INYA 5J3RA 1HD2A 2H1AA 1RW1A 5ECHB 4F03A 4DEJA 2IMIA 1DBYA 3GURA 5KN0A 1AXDA 1W89A 4O5QA 4OMVA 3ZMLA 2C3QA 4IGJA 2OE3A 4HQSA 1SK1A 1ML6A 1SJIA 2L5LA 2HNLA 4K7NA 1C72A 3KMOA 4BVYA 2GSQA 2HI7A 1S3CA 4IJ3A 5LNKe 2GLRA 1Y25A 20GSA 2HSHA 1THXA 3EURA 2YWNA 4WF4A 1R7HA 4EVMA 3DGQA 3G9BA 4LL4B 2OADA 1GSUA 1SJ6A 3SBCA 2RLIA 3DRNA 3VPTA 2XPDA 2OBKA 4XS6A 16GSA 4PQ1A 4BVXB 4MP4A 1F9MA 1XOAA 5IO2A 2YN1A 3EC3A 3IK9A 3F3RA 2TRXA 3C71A 1CQGA 3RPPA 5IOWA 2CT6A 4IJIA 3W6GA 3DEXA 5DDLA 4K0GA 2E2GA 2A4VA 3IA1A 2B7JA 5C04A 1XZOA 5GSSA 5IQYA 1O7UA 4XS1A 2V6OA 1J0FA 3EU3A 3KIJA 2X8CA 2B5YA 1XW9A 3GKXA 3I9V2 2DJKA 2JL4A 4A5PA 2X8GA 1CQHA 1DE2A 1XW6A 2XC2A 4TXVA 3UEMA 3U6VA 1Z6MA 2RUEA 3GRXA 3QCPA 3F0IA 2HZEB 3Q19A 1FAAA 4X4JA 3PR8A 1PX7A 1JHBA 2EIOA 2R0CA 2VLVA 4MZBA 4EKZA 3PPUA 2HE3A 3R3EA 4WBJA 1TRVA 4WF5A 3AY8A 1YF0A 2GZPA 2WB9A 2P0GA 4ULXA 5KOXA 4TXOB 2RIIA 1T00A 5F0GA 2EIQA 3GL5A 1GUHA 5H5SA 4POLA 4WKWA 1WIKA 2L4CA 4YQMA 2C0DA 2P5RA 1ZYEA 5D8IA 4FIWA 1JLVA 3QR6A 3HA9A 4TR1B 2AJQB 5EVOA 1X9MB 3ZMKA 2QSIA 2C3NA 3US3A 5D9XA 1ILOA 3TJGA 5EPFA 2HLSA 2CZ2A 2PGTA 1BQ7A 2GZYA 3VWXA 2DSAA 8GSSA 13GSA 4BWSA 2R5GA 1AAZA 1G7OA 3Q74A 4N30A 3E9JB 3LG6A 4G2EA 3UAPA 4LMVA 4DSSB 2YWIA 2H1BA 4MDCA 3FRCA 4MA9A 2DJ2A 1T1VA 3EINA 2QGVA 4MZWA 1VRSD 2QC7A 4XHMA 2VCVA 4G19A 1ZYQB 4ZBAA 4XCSA 3KMNA 1GLPA 3VLNA 3WGEA 4WXTA 2C4JA 2H0IA 1PQNA 4NMUA 1J08A 1BYEA 1U3AA 1A2JA 3E3EA 4EIPA 4XIHA 1V9WA 3KM6A 5G1KA 4F9ZA 1KEBA 2CQ9A 3ZFBA 3H1NA 4I2TA 1K3YA 3I6AA 2OACA 2REMA 1ZCPA 1F3BA 1GUMA 4IKHA 2ES7A 1GTUA 2YJHA 3F3QA 4KSMA 1JZWA 2H19A 1V98A 3F6DA 1HYUA 3IK7A 1WPIA 5DAKB 2VM2A 2GQMA 3IV4A 2LUSA 3BJ5A 3FY7A 1EWXA 1OKTA 3CBUA 1HQOA 4CHSA 3L9UA 2C8UA 3PINA 4GWRA 4JRRA 1NHOA 3IC8A 2GGTA 1O85A 4JEDA 5HFGA 1PGTA 2DKHA 2YNXA 4HU7A 3UOMA 5IMZA 4TW5A 1Z7RA 3F8UA 1U6TA 1EOHA 3ISOA 2H71A 3RPNA 2VCTA 1SKSB 4BVXA 2MBTA 5IPHA 5G31A 1EV4A 2LJRA 11GSA 4DSQA 4EXJA 3H79A 4MZCA 2BTOT 3VPQA 5D73A 4V2MA 3HD5A 4N0ZA 5FT3A 2GSTA 1TK5B 1YKCA 2D2ZA 4KW6A 4L5OA 4EUYA 3FZ5A 1FVJA 3KXOA 3I69A 1BX9A 2X4AA 4LL1B 2GZZA 4ECBA 3TB2A 5B8BA 5HR3A 3TKQA 2FCHA 4OFNA 1TRSA 2AYTA 2B1KA 5BRTA 5EL8A 2R0GA 5LD0A 1N2AA 4HZ2A 2N5AA 4ML6A 1B4QA 1MDJA 10GSA 5DJLA 3D4TA 4ECIA 1WP0A 4GRFA 1NM3A 4ZB9A 1PKZA 3CRUA 5DVBA 2FLSA 1WJKA 4AJ7A 2V41A 2N5BA 1WRYA 4USSA 2MMNA 3EYTA 3GX0A 2ON7A 3DD3A 3M8NA 4PNGA 5E59A 3VK9A 1UC7A 2X99A 3MNGA 5IMVA 2DJ0A 5CRWA 1R5PA 1X0RA 3M1GA 5G30A 5B7CA 2VIMA 2PU9C 3MYDA 3VFIA 3F6FA 4QQ7A 4Q5RA 2OA7A 3TCOA 3HYPA 4IELA 2PN8A 2CAIA 1JZRA 4MNNA 2LTKA 5J41A 4TR1A 4GCIA 1E2YA 4EC0A 2H72A 5HR0A 3LXTA 2O85A 1UVZA 1G6YA 3GH6A 1Y6EA 3KH7A 3VWVA 5IIZA 5DQSA 4BWQA 1M99A 2IIYA 3FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVE A;  4DSS A;  1ACV A;  3CRT A;  22GS A;  4N11 A;  2YZH A;  3BCK A;  5JCW A;  2O7K A;  3FYG A;  1I9D A;  3ZRD A;  1SEN A;  3D5J A;  4ZIJ A;  1F37 A;  3ME7 A;  1OAZ A;  4AJ6 A;  5H5Q A;  3HHV A;  1USB A;  2H6Y A;  4EL1 A;  2KOK A;  1SL2 B;  4KSO A;  3DWV A;  4GSN A;  1Z3E A;  2XPE A;  1HNB A;  4IHU A;  2OE1 A;  3IPZ A;  3EMP A;  1T4Y A;  2PER A;  4Q5F A;  6GST A;  3C73 A;  5ECR B;  3TKS A;  6GSY A;  3IAM 2;  4TOP A;  1F3A A;  1T4Z A;  2VL9 A;  3NZN A;  2JAD A;  1ST9 A;  1GLQ A;  3QAW A;  1GUL A;  4HQZ A;  1OE7 A;  4WEY A;  3H93 A;  5KN1 A;  4ZL9 A;  1TU7 A;  4GLT A;  1OC9 A;  1SU9 A;  2FNO A;  4EDY A;  1E6B A;  5ELG A;  3TUE A;  2N5F A;  4POB A;  2YJ7 A;  3W8J A;  5DAK A;  2PPT A;  3M0F A;  1UN2 A;  3W8S A;  1XVW A;  3JCM L;  4NWY A;  1XVQ A;  2WZ9 A;  1SYX A;  1O81 A;  1PA3 A;  4GQF A;  4HU9 A;  4HZ4 A;  2CA8 A;  3ZZX A;  1U3I A;  1O8X A;  1BED A;  4XS4 B;  5A4V A;  3L0H A;  4TRX A;  3TGZ A;  1K3O A;  3LYK A;  1QUW A;  1K0M A;  2A2S A;  3DVW A;  4PQI A;  2L5O A;  1SK0 A;  2LST A;  3ZFL A;  4KX4 A;  2H74 A;  1EEJ A;  4MJA A;  4GST A;  3O6T A;  3G7Y A;  2E7P A;  4MF6 A;  3N5O A;  2H30 A;  1URM A;  1A24 A;  1BG5 A;  4KGI A;  1UA5 A;  3IDV A;  1B9Y C;  3K8N A;  4WR4 A;  2V32 A;  4OO5 A;  5AIS A;  1A23 A;  4N0V A;  4F82 A;  3ZYW A;  2C0E A;  3HY2 A;  2LKU A;  1PRX A;  1XWB A;  3LEF A;  1BJX A;  1Q98 A;  4Q5Q A;  1NHY A;  1U87 A;  1WMJ A;  2TRC P;  2MMO A;  1GNW A;  3FZ9 A;  2BJX A;  4POM A;  4IN0 A;  2LJA A;  1PKW A;  3GN3 A;  2F8A A;  4X43 A;  3E0U A;  5EY6 A;  1YDK A;  1SL1 B;  4EF0 A;  5DCG A;  1B48 A;  2VCZ A;  2HT9 A;  4PGT A;  1M9B A;  2X64 A;  3QAG A;  1YKA A;  5GAN D;  3N9J A;  5G5E A;  1JFU A;  4RI7 A;  3A3T A;  2ON5 A;  3OR5 A;  1GWC A;  3TJJ A;  5CYY A;  4X1U A;  3ZIV A;  1PN9 A;  2IFQ B;  2L59 A;  5CRE A;  1EGO A;  3MWH A;  4L8E A;  5J5N A;  2YPM A;  1PSQ A;  2IL3 A;  2VO4 A;  3FHK A;  4E8E A;  4MPG A;  4K7O A;  2AHE A;  2H6Z A;  5ELA A;  3GKM A;  2B6M A;  2FHE A;  1V58 A;  1PD2 1;  3MAK A;  3VWW A;  3GUS A;  1M0U A;  1XWA A;  5HQP A;  1XBS A;  1FB6 A;  2CX4 A;  2KUC A;  3GH9 A;  3FW2 A;  1QFN A;  2R6K A;  19GS A;  1W4V A;  3DXB A;  4BL7 A;  4O5R A;  3WT1 A;  1MDI A;  3CSH A;  4IP1 A;  3FEU A;  3GTU B;  4ZBD A;  1YF1 A;  5ECP B;  1S3A A;  1LJR A;  1FB0 A;  1SD8 A;  3EWL A;  1S3D A;  3EU4 A;  5DJM A;  3ZVJ D;  2GDR A;  1XWC A;  3LYP A;  2K8V A;  3CTF A;  2ZUP A;  4RQX A;  1K0N A;  4HS1 A;  3D22 A;  5CO3 A;  2WFC A;  4MJB A;  2NVL A;  2PBJ A;  3P90 A;  1LU4 A;  2HFD A;  1OKD A;  5A4W A;  1AQX A;  1XXU A;  4J57 E;  2FWH A;  5D9V A;  1V2A A;  1X9S B;  2H0H A;  2FY6 A;  3L9S A;  1GTA A;  1H75 A;  3L4N A;  1A2L A;  2R37 A;  2OJL A;  1TRW A;  4YH2 A;  5D9W A;  2DLX A;  1SKW B;  4EDZ A;  1A0R P;  3ZRE A;  3LJR A;  2TIR A;  3CXG A;  4F0C A;  3DML A;  3P8W A;  5ECN B;  4V1A g;  3GX8 A;  3RHC A;  4IQA A;  5ID2 A;  3NIV A;  4OCE A;  4NXI A;  3HZ8 A;  2CVD A;  3APS A;  5GST A;  2FWF A;  2ZNM A;  3MSZ A;  4GTU A;  4KND A;  1IYI A;  3TRQ A;  4YQV A;  4D73 B;  2JSZ A;  2VD1 A;  4V1A p;  5ECK B;  2VM1 A;  2H66 A;  4G10 A;  3GV1 A;  2IWT A;  3IOS A;  3TKS C;  2P5Q A;  1G0T A;  3UVH A;  3RBT A;  2GTU A;  1HNC A;  4I6X A;  2PWJ A;  4JE1 A;  1FG4 A;  4ZIL A;  4H86 A;  17GS A;  2VL2 A;  2FWE A;  2YWM A;  1GSQ A;  5FWG A;  4Z7X A;  4YQU A;  2GSR A;  4OWY A;  3KH9 A;  4DVC A;  1JZD A;  4POK A;  2LEG A;  4O92 A;  4RUV A;  3C1S A;  3KTB A;  4LLR A;  4LMW A;  2X8H A;  5HR1 A;  3HKR A;  2DJJ A;  3KJY A;  3GA4 A;  2FD3 A;  2LV3 A;  4ZXG A;  5G5F A;  4NV2 A;  1K0B A;  1GTI A;  5GZZ B;  4HOJ A;  3F9U A;  4ZB6 A;  2DMM A;  2RM6 A;  1AIU A;  2JZT A;  1V57 A;  4TR0 A;  2CVK A;  4HJ2 A;  2FUG 2;  4GSS A;  4MF7 A;  4ZB8 A;  3ED3 A;  2OBI A;  4L0U A;  1TKD B;  3QPM A;  2KHP A;  4NHW A;  1O73 A;  5H5R A;  1Z5Y E;  2C0F A;  3L78 A;  4GF0 A;  1GP1 A;  2VL3 A;  3LGC A;  2LRT A;  2I1U A;  1EZK A;  4I5Q A;  1LBK A;  2L57 A;  5ECM B;  1KTE A;  4HUA A;  2MBS A;  4N10 A;  2IFQ A;  4JU5 A;  3IC4 A;  5D96 A;  3WYW A;  2F9S A;  3TDG A;  4ILF A;  2LNS A;  3FR9 A;  2HYX A;  4QL7 A;  3A2X A;  5HFK A;  5KEJ A;  1DSB A;  2H76 A;  4MAB A;  3RHB A;  2JSY A;  4HDE A;  3LOR A;  2HZE A;  2DIY A;  1TJD A;  3IAS 2;  3GFK A;  4AJ8 A;  1KBN A;  4PUR A;  3S9F A;  2JU5 A;  3TKP A;  5B6N A;  5B8A A;  1TRU A;  1YJ6 A;  3TKS E;  2B5X A;  1AC1 A;  2ZCT A;  1PX6 A;  4TXO A;  2F51 A;  1XCC A;  2GT5 A;  2CZ3 A;  3J7Y k;  3QFA C;  1Z6N A;  4ECC A;  1YZX A;  4PQH A;  4K9Z A;  2PVO C;  3Q18 A;  4NAX A;  5IMA A;  4JR4 A;  1JZO A;  2CV4 A;  2IME A;  5CRG A;  3APO A;  2DJ3 A;  3HJP A;  3ZIT A;  3NOF A;  3ERF A;  4MJC A;  3TJK A;  3GNJ A;  4EE0 A;  4RQR A;  1KNG A;  1TK8 B;  4V2N A;  1OVN A;  1GNE A;  2LRN A;  3DYR A;  4F0B A;  3CSJ A;  2VLT A;  4K6X A;  3UMA A;  4OFM A;  3EE2 A;  4NPB A;  3QOU A;  5LCZ A;  2YZU A;  3FKF A;  2AB6 A;  2HZF A;  2PUK C;  4F2I A;  3ME8 A;  4PUA A;  5CAX A;  1EV9 A;  1AW9 A;  3C8E A;  5IMF A;  3GMF A;  3IBH A;  5JCG A;  2WGR A;  2OKA A;  3M9K A;  2BMX A;  2WCI A;  2NPB A;  3R2Q A;  1THO A;  4MF5 A;  3ERG A;  4K0N A;  2MZC A;  2HSY A;  2WRT A;  3WD6 A;  4FYU A;  2L6C A;  1QQ2 A;  2QKE A;  3ZLP A;  2C3T A;  3C1R A;  4D73 A;  4LA1 A;  5JWQ B;  5A4U A;  2JZR A;  4OFT A;  3TOU A;  1GSS A;  2I4A A;  2MMA A;  3HJM A;  2K18 A;  5CNW A;  2IN3 A;  3GIX A;  2B1L A;  4AGS A;  1YEP A;  3WT2 A;  1VF3 A;  1QK8 A;  2L6D A;  1FO5 A;  1M7T A;  1XPV A;  2PVQ A;  5COH A;  3HVS A;  2NBS A;  2XBI A;  5AN1 A;  2M80 A;  3FK8 A;  5JCU A;  1GH2 A;  3M9J A;  3A5W A;  1TW9 A;  1M9A A;  3EVI A;  2O89 A;  2L4Q A;  2KLX A;  14GS A;  1I5G A;  2G2Q A;  3UVT A;  4ZL7 A;  4EO3 A;  2H75 A;  3WGD A;  1AQV A;  1GSD A;  2DIZ A;  1T3B A;  2GQL A;  1EP7 A;  2MMZ A;  1OC3 A;  1QXH A;  4CW9 A;  2DBC A;  1MDK A;  2P31 A;  2IPA A;  2VCX A;  1MEK A;  3EMX A;  3P7X A;  4ACS A;  1RK4 A;  5CP1 A;  1F6M C;  4AF2 A;  5ECL B;  3RDW A;  2KP2 A;  1MTC A;  2IMK A;  4XRA A;  4TKY A;  2LRC A;  4NHZ A;  4IP6 A;  1ZL9 A;  2IMF A;  3UBK A;  1SD9 A;  1H4O A;  1QMV A;  3LXZ A;  5IMD A;  1SL0 B;  3GKK A;  2R4V A;  5IPG A;  4X0X A;  1BAY A;  2VL2 C;  2A2R A;  4I8B A;  1EP8 A;  5F07 A;  3APQ A;  2EC4 A;  4Q5N A;  1AQW A;  1M2B A;  4JZQ A;  4IBP A;  4J56 E;  2JZS A;  1O8W A;  2NTO A;  1WWJ A;  5HFI A;  1TTZ A;  5J9B A;  1MD4 A;  1T7P B;  4CDO A;  2GT6 A;  2GQK A;  1GSE A;  2XBQ A;  1EGR A;  2LQO A;  4PX1 A;  3G7I A;  4KDU A;  3DKS A;  3HCZ A;  4KUN A;  2M46 A;  1ON4 A;  1XFL A;  2H01 A;  1SKR B;  3FR6 A;  4KCE A;  4FYB A;  1TI3 A;  2AAW A;  2FGX A;  4O32 A;  3QAV A;  4ML1 A;  1MD3 A;  4O7H A;  3IXR A;  3IR4 A;  4KB3 A;  4OD7 A;  1TXX A;  2H0G A;  4MPF A;  3IRA A;  3QD9 A;  4GQC A;  5AGY A;  3H8Q A;  3QDN A;  4KCA A;  4PXO A;  1Z7P A;  5F8B A;  5IOX A;  9GSS A;  1B4P A;  1GTB A;  3P2A A;  3ERW A;  4PUF C;  1B9X C;  1TI1 A;  1VF1 A;  3MDK A;  2VUP A;  2K9F A;  2F8F A;  3G7J A;  4FH8 A;  2MYG A;  1JLW A;  2VAF A;  5KN2 A;  1A8Y A;  18GS A;  1YQ1 A;  3FZA A;  4YAV A;  1J9B A;  3LSZ A;  1GL8 A;  2H1D A;  3L9V A;  3WGX A;  4K2D A;  5C00 A;  1ERT A;  4HI7 A;  3KTL A;  3GHA A;  4HJM A;  1SYR A;  4KE3 A;  1K3L A;  1F2E A;  3QMX A;  1NSW A;  3SWL A;  1T8E B;  1GRX A;  3LFL A;  2YCD A;  3HDC A;  3F4S A;  3IE3 A;  2B5E A;  4G9H A;  4KDY A;  1TU8 A;  5DQY A;  1RQM A;  5F06 A;  4XTS A;  1X5C A;  2H8L A;  5FHI A;  3U5R E;  3HXS A;  1K0A A;  5DAL B;  2VLU A;  3UL3 A;  1FHE A;  4FO5 A;  1WOU A;  3KD0 A;  2OE0 A;  1XIY A;  2B7K A;  2FA8 A;  5DCH A;  5ECQ B;  1A8L A;  3A2W A;  2DJ1 A;  4MJE A;  12GS A;  3ZIJ A;  5JWO B;  2F3M A;  2VOC A;  3QFB C;  1ERW A;  2DML A;  2NDO A;  1R5A A;  3ZL5 A;  3GST A;  3O76 A;  2J23 A;  4MK3 A;  4K7I A;  4GXZ A;  2GS3 A;  1ERU A;  4DSR A;  2M72 A;  2VD0 A;  2EIR A;  5ECS A;  5E4W A;  2LJK A;  6GSV A;  1ZZY A;  6GSX A;  3TOT A;  2FWG A;  2WDU A;  4XS4 A;  5HR2 A;  3TJF A;  2AV4 A;  3KCM A;  4ZL8 A;  1VF4 A;  1NW2 A;  2AUV A;  1X9W B;  1ZGN A;  2Z9S A;  2O87 A;  1OC9 B;  3DIE A;  3H4K A;  2C1Y A;  3HJO A;  3F4R A;  4KA0 A;  3CYN A;  3BOA A;  3KZQ A;  3M3M A;  4IS0 A;  3VWU A;  2YAN A;  2G0F A;  1A0F A;  5J4U A;  1ZOF A;  1PMT A;  2VCQ A;  4ID0 A;  5AIV A;  1YEX A;  1XWG A;  3KP9 A;  5KN3 A;  3RAZ A;  2LNT A;  2V6K A;  2YP6 A;  4ZBB A;  1M2D A;  4HEA 2;  1WE0 A;  3BBY A;  3GYK A;  2I9H A;  3V1W A;  2FA4 A;  1VGL A;  4FYC A;  3TKR A;  2C0G A;  7GSS A;  4XRD A;  1FVK A;  2IMD A;  2DC5 A;  5IO0 A;  3A2V A;  4P3Y B;  2LS5 A;  5L71 A;  5A5K A;  5D9T A;  4I97 A;  2K6V A;  3IHQ A;  1B8X A;  1X5E A;  5CRH A;  1OC8 A;  4JR6 A;  1TDI A;  3LQ7 A;  3UJ1 A;  2WUL A;  3HZ4 A;  4WR5 A;  2KP1 A;  1GUK A;  5B6M A;  1TK0 B;  4YAP A;  2J9H A;  2H70 A;  1Z9H A;  3D21 A;  5GAP D;  1PL2 A;  3PGT A;  2VCW A;  4MLY A;  1X5D A;  1K0C A;  3KP8 A;  1ABA A;  3CTG A;  5ABR A;  3HVV A;  1YY7 A;  4IVF A;  3LWA A;  2I81 A;  5D93 A;  3F4T A;  6GSW A;  1K0D A;  4MMM A;  2H73 A;  3PH9 A;  2IJY A;  2WS2 A;  1O6J A;  4TR3 A;  3GTU A;  2CVB A;  2B3S A;  1XWK A;  1IYH A;  3VUR A;  4L5L A;  2JAC A;  2V1M A;  1FW1 A;  3I43 A;  3VI5 A;  2GSS A;  2R2J A;  2V2G A;  1EEM A;  2I3Y A;  3D6I A;  3BCI A;  2ALB A;  3O3T A;  4MH3 A;  2CX3 A;  2H6X A;  3UIW A;  3CSI A;  5IM9 A;  4WET A;  4V2L A;  5G1L A;  1G7E A;  1SJZ A;  4OO4 A;  6GSS A;  3F63 A;  4PNF A;  1OYJ A;  5DBQ A;  4WBR D;  2GVP A;  2RM5 A;  2YV7 A;  3FZ4 A;  2R3X A;  1EOG A;  4IW9 A;  1R4W A;  2RUF A;  3TRP A;  4J2F A;  1U88 A;  2E2M A;  4QL9 A;  1G6W A;  3J7Y b;  3GSS A;  3ZVJ A;  4ECJ A;  2HRF A;  4I2U A;  1ZMA A;  4RI6 A;  5G2Z A;  1K0O A;  1XOB A;  2HXK A;  5CRD A;  2YOI A;  1GSY A;  1QGV A;  5JWR B;  6GSU A;  1FOV A;  3KGK A;  2HRN A;  1GSF A;  4ISD A;  2CAQ A;  4KDX A;  2PMT A;  5ENU A;  3HVX A;  4TR4 A;  3TJB A;  3KEB A;  5J9C A;  5IMC A;  1ERV A;  1OE8 A;  2XHF A;  1SK2 A;  5DAL A;  3C7M A;  3CMI A;  3TRX A;  1TOF A;  2YWO A;  4K1F A;  1DUG A;  2E0Q A;  4MCU A;  4TN8 A;  1DE1 A;  2K8S A;  1A2M A;  3GKN A;  5F05 A;  1AUC A;  1Q4J A;  4IQ1 A;  2C80 A;  1TP9 A;  4L0W A;  3D0Z A;  3BD2 A;  1M2A A;  5AIX A;  4JBB A;  4KH7 A;  3ZTL A;  1V40 A;  3UBL A;  4BPY A;  1R26 A;  2O8V B;  3UAR A;  1XW5 A;  3DVX A;  2WJU A;  4KAE A;  4K8M A;  1VF2 A;  3Q6O A;  4OCF A;  3GL3 A;  5ECO B;  2H1G A;  4E8H A;  3VI7 A;  1HNA A;  2LQQ A;  1PL1 A;  2YV9 A;  3D4M A;  4NV5 A;  5ID2 B;  4BA7 A;  1N8J A;  4MH2 A;  5INY A;  5J3R A;  1HD2 A;  2H1A A;  1RW1 A;  5ECH B;  4F03 A;  4DEJ A;  2IMI A;  1DBY A;  3GUR A;  5KN0 A;  1AXD A;  1W89 A;  4OMV A;  3ZML A;  2C3Q A;  4IGJ A;  2OE3 A;  4HQS A;  1SK1 A;  1ML6 A;  1SJI A;  2L5L A;  2HNL A;  4K7N A;  1C72 A;  3KMO A;  4BVY A;  2GSQ A;  2HI7 A;  1S3C A;  4IJ3 A;  5LNK e;  2GLR A;  1Y25 A;  20GS A;  2HSH A;  1THX A;  3EUR A;  2YWN A;  4WF4 A;  1R7H A;  4EVM A;  3DGQ A;  3G9B A;  4LL4 B;  2OAD A;  1GSU A;  1SJ6 A;  3SBC A;  2RLI A;  3DRN A;  3VPT A;  2XPD A;  2OBK A;  4XS6 A;  16GS A;  4PQ1 A;  4MP4 A;  1F9M A;  1XOA A;  5IO2 A;  2YN1 A;  3EC3 A;  3IK9 A;  3F3R A;  2TRX A;  3C71 A;  1CQG A;  3RPP A;  5IOW A;  2CT6 A;  4IJI A;  3W6G A;  3DEX A;  5DDL A;  4K0G A;  2E2G A;  2A4V A;  3IA1 A;  2B7J A;  5C04 A;  1XZO A;  5GSS A;  5IQY A;  1O7U A;  4XS1 A;  2V6O A;  1J0F A;  3EU3 A;  3KIJ A;  2X8C A;  2B5Y A;  1XW9 A;  3GKX A;  3I9V 2;  2DJK A;  2JL4 A;  2X8G A;  1CQH A;  1DE2 A;  1XW6 A;  2XC2 A;  4TXV A;  3UEM A;  3U6V A;  1Z6M A;  2RUE A;  3GRX A;  3QCP A;  3F0I A;  2HZE B;  3Q19 A;  1FAA A;  3PR8 A;  1PX7 A;  1JHB A;  2EIO A;  2VLV A;  4MZB A;  4EKZ A;  2HE3 A;  4WBJ A;  1TRV A;  4WF5 A;  3AY8 A;  1YF0 A;  2GZP A;  2WB9 A;  2P0G A;  4ULX A;  4TXO B;  2RII A;  1T00 A;  5F0G A;  2EIQ A;  3GL5 A;  1GUH A;  5H5S A;  4POL A;  4WKW A;  1WIK A;  2L4C A;  4YQM A;  2C0D A;  2P5R A;  1ZYE A;  5D8I A;  4FIW A;  1JLV A;  3QR6 A;  3HA9 A;  4TR1 B;  2AJQ B;  5EVO A;  1X9M B;  3ZMK A;  2QSI A;  2C3N A;  3US3 A;  5D9X A;  1ILO A;  3TJG A;  5EPF A;  2HLS A;  2CZ2 A;  2PGT A;  1BQ7 A;  2GZY A;  3VWX A;  2DSA A;  8GSS A;  13GS A;  4BWS A;  2R5G A;  1AAZ A;  1G7O A;  3Q74 A;  4N30 A;  3E9J B;  3LG6 A;  4G2E A;  3UAP A;  4LMV A;  4DSS B;  2YWI A;  2H1B A;  4MDC A;  3FRC A;  4MA9 A;  2DJ2 A;  1T1V A;  3EIN A;  2QGV A;  4MZW A;  1VRS D;  2QC7 A;  4XHM A;  2VCV A;  4G19 A;  1ZYQ B;  4ZBA A;  4XCS A;  3KMN A;  1GLP A;  3VLN A;  3WGE A;  4WXT A;  2C4J A;  2H0I A;  1PQN A;  4NMU A;  1J08 A;  1BYE A;  1U3A A;  1A2J A;  3E3E A;  4XIH A;  1V9W A;  3KM6 A;  5G1K A;  4F9Z A;  1KEB A;  2CQ9 A;  3ZFB A;  3H1N A;  4I2T A;  1K3Y A;  3I6A A;  2OAC A;  2REM A;  1ZCP A;  1F3B A;  1GUM A;  4IKH A;  2ES7 A;  1GTU A;  2YJH A;  3F3Q A;  4KSM A;  1JZW A;  2H19 A;  1V98 A;  3F6D A;  1HYU A;  3IK7 A;  1WPI A;  5DAK B;  2VM2 A;  2GQM A;  3IV4 A;  2LUS A;  3BJ5 A;  3FY7 A;  1EWX A;  1OKT A;  3CBU A;  1HQO A;  4CHS A;  3L9U A;  2C8U A;  3PIN A;  4GWR A;  4JRR A;  1NHO A;  2GGT A;  1O85 A;  4JED A;  5HFG A;  1PGT A;  2YNX A;  4HU7 A;  3UOM A;  5IMZ A;  4TW5 A;  1Z7R A;  3F8U A;  1U6T A;  1EOH A;  3ISO A;  2H71 A;  3RPN A;  2VCT A;  1SKS B;  4BVX A;  2MBT A;  5IPH A;  5G31 A;  1EV4 A;  2LJR A;  11GS A;  4DSQ A;  4EXJ A;  3H79 A;  4MZC A;  2BTO T;  3VPQ A;  5D73 A;  4V2M A;  3HD5 A;  4N0Z A;  5FT3 A;  2GST A;  1TK5 B;  1YKC A;  2D2Z A;  4KW6 A;  4L5O A;  2IIY A;  4EUY A;  3FZ5 A;  1FVJ A;  3KXO A;  3I69 A;  1BX9 A;  4LL1 B;  2GZZ A;  4ECB A;  3TB2 A;  5B8B A;  5HR3 A;  3TKQ A;  2FCH A;  4OFN A;  1TRS A;  2AYT A;  2B1K A;  5EL8 A;  5LD0 A;  1N2A A;  4HZ2 A;  2N5A A;  4ML6 A;  1B4Q A;  1MDJ A;  10GS A;  5DJL A;  3D4T A;  4ECI A;  1WP0 A;  4GRF A;  1NM3 A;  4ZB9 A;  1PKZ A;  3CRU A;  5DVB A;  2FLS A;  1WJK A;  4AJ7 A;  2V41 A;  2N5B A;  1WRY A;  2MMN A;  3EYT A;  3GX0 A;  2ON7 A;  3DD3 A;  3M8N A;  4PNG A;  5E59 A;  3VK9 A;  1UC7 A;  2X99 A;  3MNG A;  5IMV A;  2DJ0 A;  5CRW A;  1R5P A;  1X0R A;  3M1G A;  5G30 A;  5B7C A;  2VIM A;  2PU9 C;  3VFI A;  3F6F A;  4QQ7 A;  4Q5R A;  2OA7 A;  3TCO A;  3HYP A;  4IEL A;  2PN8 A;  2CAI A;  1JZR A;  2LTK A;  5J41 A;  4TR1 A;  4GCI A;  1E2Y A;  4EC0 A;  2H72 A;  5HR0 A;  3LXT A;  2O85 A;  1UVZ A;  1G6Y A;  3GH6 A;  1Y6E A;  3KH7 A;  3VWV A;  5IIZ A;  5DQS A;  4BWQ A;  1M99 A;  5ECI B;  3FR3 A; 
#chains in the Genus database with same CATH topology
 4TVE A;  4DSS A;  2R0P A;  1ACV A;  3CRT A;  22GS A;  5KOW A;  4N11 A;  2YZH A;  3BCK A;  5JCW A;  2O7K A;  3FYG A;  1I9D A;  3ZRD A;  1SEN A;  3D5J A;  4ZIJ A;  1F37 A;  3ME7 A;  1OAZ A;  4AJ6 A;  5H5Q A;  3HHV A;  1USB A;  2H6Y A;  4EL1 A;  2KOK A;  1SL2 B;  4KSO A;  3DWV A;  4GSN A;  1Z3E A;  2XPE A;  1HNB A;  4IHU A;  2OE1 A;  3IPZ A;  3EMP A;  1T4Y A;  2PER A;  4Q5F A;  6GST A;  3C73 A;  5ECR B;  3TKS A;  6GSY A;  3IAM 2;  4TOP A;  1F3A A;  1T4Z A;  2VL9 A;  3NZN A;  2JAD A;  1ST9 A;  1GLQ A;  3QAW A;  1GUL A;  4HQZ A;  1OE7 A;  4WEY A;  3H93 A;  5KN1 A;  4ZL9 A;  1TU7 A;  4GLT A;  1OC9 A;  1SU9 A;  2FNO A;  4EDY A;  1E6B A;  5ELG A;  3TUE A;  2N5F A;  4POB A;  2YJ7 A;  3W8J A;  5DAK A;  2PPT A;  1M3J A;  3M0F A;  1UN2 A;  3W8S A;  1XVW A;  3JCM L;  4NWY A;  1XVQ A;  2WZ9 A;  1SYX A;  1O81 A;  1PA3 A;  4GQF A;  4HU9 A;  4HZ4 A;  2CA8 A;  3ZZX A;  1U3I A;  1O8X A;  1BED A;  4XS4 B;  5A4V A;  4FQU A;  3L0H A;  4TRX A;  3TGZ A;  1K3O A;  3LYK A;  1QUW A;  1K0M A;  2A2S A;  3DVW A;  4PQI A;  2L5O A;  1SK0 A;  2LST A;  3ZFL A;  4KX4 A;  2H74 A;  1EEJ A;  4MJA A;  4GST A;  3O6T A;  3G7Y A;  2E7P A;  4MF6 A;  3N5O A;  2H30 A;  4Z2R A;  1URM A;  1A24 A;  1BG5 A;  4KGI A;  1UA5 A;  3IDV A;  1B9Y C;  3K8N A;  4WR4 A;  2V32 A;  4OO5 A;  5AIS A;  1A23 A;  4N0V A;  4ICY A;  4F82 A;  3ZYW A;  5BMU A;  2C0E A;  3HY2 A;  2LKU A;  1PRX A;  1XWB A;  3LEF A;  1BJX A;  4G0K A;  1Q98 A;  4Q5Q A;  1NHY A;  1U87 A;  1WMJ A;  2TRC P;  2MMO A;  1GNW A;  3FZ9 A;  2BJX A;  4POM A;  4IN0 A;  2LJA A;  1PKW A;  3GN3 A;  2F8A A;  4X43 A;  3E0U A;  5EY6 A;  3IHG A;  1YDK A;  1SL1 B;  4EF0 A;  5DCG A;  1B48 A;  2VCZ A;  2HT9 A;  4PGT A;  1M9B A;  2X64 A;  3QAG A;  1YKA A;  5GAN D;  3N9J A;  5G5E A;  1JFU A;  4RI7 A;  3A3T A;  2ON5 A;  3OR5 A;  1GWC A;  3TJJ A;  5CYY A;  4X1U A;  3ZIV A;  1PN9 A;  2IFQ B;  2L59 A;  2HSM A;  5CRE A;  1EGO A;  3MWH A;  4L8E A;  5J5N A;  2YPM A;  1PSQ A;  2IL3 A;  2VO4 A;  3FHK A;  4E8E A;  4MPG A;  4K7O A;  2AHE A;  2H6Z A;  5ELA A;  3GKM A;  2B6M A;  2FHE A;  1V58 A;  1PD2 1;  3MAK A;  3VWW A;  3GUS A;  1M0U A;  1XWA A;  5HQP A;  1XBS A;  1FB6 A;  2CX4 A;  2KUC A;  3GH9 A;  3FW2 A;  1QFN A;  2R6K A;  19GS A;  1W4V A;  3DXB A;  4BL7 A;  4O5R A;  2UZ8 A;  3WT1 A;  1MDI A;  3CSH A;  4IP1 A;  3FEU A;  3GTU B;  4ZBD A;  1YF1 A;  5ECP B;  1S3A A;  1LJR A;  1FB0 A;  1SD8 A;  3EWL A;  1S3D A;  3MIX A;  3EU4 A;  5DJM A;  3ZVJ D;  2GDR A;  1XWC A;  3LYP A;  2K8V A;  3CTF A;  2ZUP A;  4RQX A;  1K0N A;  4HS1 A;  3D22 A;  5CO3 A;  2WFC A;  4MJB A;  2NVL A;  2PBJ A;  3P90 A;  1LU4 A;  1ZYN A;  2HFD A;  1OKD A;  5A4W A;  1AQX A;  1XXU A;  4J57 E;  2FWH A;  5D9V A;  1V2A A;  3A5I A;  1X9S B;  2H0H A;  2FY6 A;  3L9S A;  1GTA A;  1H75 A;  3L4N A;  1A2L A;  2R37 A;  2OJL A;  1TRW A;  4YH2 A;  5D9W A;  2DLX A;  1SKW B;  4EDZ A;  1A0R P;  3ZRE A;  3LJR A;  2TIR A;  3CXG A;  4F0C A;  3DML A;  3P8W A;  1FOH A;  5ECN B;  4V1A g;  3GX8 A;  3RHC A;  4IQA A;  5ID2 A;  3NIV A;  4OCE A;  4NXI A;  3HZ8 A;  2CVD A;  3APS A;  5GST A;  2FWF A;  2ZNM A;  3LW9 A;  3MSZ A;  4GTU A;  4KND A;  1IYI A;  3TRQ A;  4YQV A;  4D73 B;  2JSZ A;  2VD1 A;  4V1A p;  5ECK B;  2VM1 A;  3FMW A;  2H66 A;  4HSC X;  4G10 A;  3GV1 A;  2IWT A;  3IOS A;  3TKS C;  2P5Q A;  1G0T A;  3UVH A;  3RBT A;  2GTU A;  4G0I A;  1HNC A;  4I6X A;  2PWJ A;  4JE1 A;  1FG4 A;  4ZIL A;  4H86 A;  4YKG A;  17GS A;  2VL2 A;  2FWE A;  2YWM A;  1GSQ A;  5FWG A;  4Z7X A;  4YQU A;  2GSR A;  4OWY A;  3KH9 A;  4DVC A;  1JZD A;  4POK A;  2LEG A;  4O92 A;  4RUV A;  3C1S A;  3KTB A;  4LLR A;  4LMW A;  2X8H A;  5HR1 A;  3HKR A;  2DJJ A;  3KJY A;  3GA4 A;  2FD3 A;  2LV3 A;  4ZXG A;  5G5F A;  4NV2 A;  1K0B A;  1GTI A;  5GZZ B;  4HOJ A;  3F9U A;  4ZB6 A;  2DMM A;  2RM6 A;  1AIU A;  2JZT A;  1V57 A;  4TR0 A;  2CVK A;  4HJ2 A;  2FUG 2;  4GSS A;  4MF7 A;  4ZB8 A;  3ED3 A;  2OBI A;  4L0U A;  1TKD B;  3QPM A;  2KHP A;  4NHW A;  1O73 A;  5H5R A;  1Z5Y E;  2C0F A;  3L78 A;  4K2X A;  4GF0 A;  1GP1 A;  2VL3 A;  3LGC A;  2LRT A;  2I1U A;  1EZK A;  4I5Q A;  1LBK A;  2L57 A;  5ECM B;  1KTE A;  4HUA A;  2MBS A;  4N10 A;  2IFQ A;  4JU5 A;  3IC4 A;  5D96 A;  5ECI B;  3WYW A;  2F9S A;  3TDG A;  4ILF A;  2LNS A;  3FR9 A;  2HYX A;  4QL7 A;  3A2X A;  5HFK A;  5KEJ A;  1DSB A;  2H76 A;  4MAB A;  3RHB A;  2JSY A;  4HDE A;  3LOR A;  2HZE A;  2DIY A;  1TJD A;  3IAS 2;  3GFK A;  4AJ8 A;  1KBN A;  4PUR A;  3S9F A;  2JU5 A;  3TKP A;  5B6N A;  5B8A A;  1TRU A;  1YJ6 A;  3TKS E;  2B5X A;  1AC1 A;  2ZCT A;  1PX6 A;  4TXO A;  2F51 A;  1XCC A;  2GT5 A;  2CZ3 A;  3J7Y k;  3QFA C;  1Z6N A;  4ECC A;  1YZX A;  4PQH A;  2DKI A;  4K9Z A;  2PVO C;  3Q18 A;  4NAX A;  5IMA A;  4JR4 A;  1JZO A;  2CV4 A;  2IME A;  5CRG A;  3APO A;  2DJ3 A;  2X49 A;  4Z2U A;  3HJP A;  3ZIT A;  3NOF A;  3ERF A;  4MJC A;  4Z2T A;  3TJK A;  3GNJ A;  4EE0 A;  4RQR A;  1KNG A;  1TK8 B;  4V2N A;  1OVN A;  1GNE A;  2LRN A;  3DYR A;  4F0B A;  3CSJ A;  2VLT A;  4K6X A;  3UMA A;  4OFM A;  3EE2 A;  4NPB A;  3QOU A;  5LCZ A;  2YZU A;  3FKF A;  2AB6 A;  2HZF A;  2PUK C;  4F2I A;  3ME8 A;  4PUA A;  5CAX A;  1EV9 A;  2QA2 A;  1AW9 A;  3C8E A;  3EPT A;  5IMF A;  3GMF A;  3IBH A;  5JCG A;  2WGR A;  2OKA A;  3M9K A;  2BMX A;  2WCI A;  2NPB A;  3R2Q A;  1THO A;  4MF5 A;  3ERG A;  4K0N A;  2MZC A;  2HSY A;  2WRT A;  3WD6 A;  4FYU A;  2L6C A;  1QQ2 A;  2QKE A;  3ZLP A;  2C3T A;  3C1R A;  4D73 A;  4LA1 A;  5JWQ B;  5A4U A;  2JZR A;  4OFT A;  3TOU A;  1GSS A;  2I4A A;  2MMA A;  3HJM A;  2K18 A;  5CNW A;  2IN3 A;  3GIX A;  2B1L A;  4AGS A;  1YEP A;  3WT2 A;  2HRK A;  1VF3 A;  1QK8 A;  2L6D A;  1FO5 A;  1M7T A;  1XPV A;  2PVQ A;  5COH A;  3HVS A;  2NBS A;  2XBI A;  5AN1 A;  2M80 A;  3FK8 A;  5JCU A;  1GH2 A;  3M9J A;  3A5W A;  1TW9 A;  1M9A A;  3EVI A;  2O89 A;  2L4Q A;  2KLX A;  14GS A;  1I5G A;  2G2Q A;  3UVT A;  4ZL7 A;  4EO3 A;  2H75 A;  3WGD A;  1AQV A;  1GSD A;  2DIZ A;  1T3B A;  2GQL A;  1EP7 A;  2MMZ A;  1OC3 A;  1QXH A;  4CW9 A;  2DBC A;  1MDK A;  2P31 A;  2IPA A;  2VCX A;  1MEK A;  3EMX A;  3P7X A;  4ACS A;  1RK4 A;  5CP1 A;  1F6M C;  4AF2 A;  5ECL B;  3RDW A;  2KP2 A;  1MTC A;  2IMK A;  4XRA A;  4TKY A;  2LRC A;  4NHZ A;  4IP6 A;  1ZL9 A;  4K5S A;  2IMF A;  3UBK A;  1SD9 A;  1H4O A;  1QMV A;  3LXZ A;  5IMD A;  3HVN A;  1SL0 B;  3GKK A;  4EIQ A;  2R4V A;  5IPG A;  4X0X A;  1BAY A;  2VL2 C;  2A2P A;  2A2R A;  4I8B A;  1EP8 A;  5F07 A;  3APQ A;  2EC4 A;  4Q5N A;  1AQW A;  1M2B A;  4JZQ A;  4IBP A;  4J56 E;  2JZS A;  1O8W A;  2NTO A;  1WWJ A;  5HFI A;  1TTZ A;  5J9B A;  1MD4 A;  1T7P B;  4CDO A;  2GT6 A;  2GQK A;  1GSE A;  2XBQ A;  1EGR A;  2LQO A;  4PX1 A;  3G7I A;  4KDU A;  3DKS A;  3HCZ A;  4KUN A;  2M46 A;  4K5R A;  1ON4 A;  1XFL A;  2H01 A;  1SKR B;  3FR6 A;  4KCE A;  4FYB A;  1TI3 A;  2AAW A;  2FGX A;  4O32 A;  3QAV A;  4ML1 A;  1MD3 A;  4O7H A;  3IXR A;  3IR4 A;  4KB3 A;  4OD7 A;  1TXX A;  2H0G A;  4MPF A;  3IRA A;  3QD9 A;  4GQC A;  5AGY A;  3H8Q A;  3QDN A;  4KCA A;  4PXO A;  1Z7P A;  5F8B A;  5IOX A;  9GSS A;  1B4P A;  1GTB A;  3P2A A;  3ERW A;  4PUF C;  1B9X C;  1TI1 A;  1VF1 A;  3MDK A;  2VUP A;  2K9F A;  4KF9 A;  2F8F A;  3G7J A;  4FH8 A;  2MYG A;  1JLW A;  2VAF A;  5KN2 A;  1A8Y A;  18GS A;  1YQ1 A;  3FZA A;  4YAV A;  1J9B A;  3LSZ A;  1GL8 A;  2H1D A;  3L9V A;  3WGX A;  4K2D A;  5C00 A;  1ERT A;  4HI7 A;  3KTL A;  3GHA A;  4HJM A;  1SYR A;  4KE3 A;  1K3L A;  1F2E A;  3QMX A;  1NSW A;  1PN0 A;  3SWL A;  1T8E B;  1GRX A;  3LFL A;  4G0L A;  2YCD A;  3HDC A;  3F4S A;  3IE3 A;  2B5E A;  4G9H A;  4KDY A;  1TU8 A;  5DQY A;  4PTS A;  4CY6 A;  1RQM A;  5F06 A;  4XTS A;  1X5C A;  2H8L A;  5FHI A;  3U5R E;  3HXS A;  1K0A A;  5DAL B;  2VLU A;  3UL3 A;  1FHE A;  4FO5 A;  1WOU A;  3KD0 A;  2OE0 A;  4CY8 A;  1XIY A;  2B7K A;  2FA8 A;  5DCH A;  5ECQ B;  1A8L A;  3A2W A;  2DJ1 A;  4MJE A;  12GS A;  3ZIJ A;  5JWO B;  2F3M A;  2VOC A;  3QFB C;  1ERW A;  2DML A;  2NDO A;  1R5A A;  3ZL5 A;  3GST A;  3O76 A;  2J23 A;  4MK3 A;  4K7I A;  4GXZ A;  2GS3 A;  1ERU A;  4DSR A;  2M72 A;  2VD0 A;  2EIR A;  5ECS A;  5E4W A;  2LJK A;  6GSV A;  1ZZY A;  6GSX A;  3TOT A;  2FWG A;  2WDU A;  4XS4 A;  5HR2 A;  3TJF A;  4YKF A;  2AV4 A;  3KCM A;  4ZL8 A;  1VF4 A;  1NW2 A;  2AUV A;  4BIK A;  1X9W B;  1ZGN A;  2Z9S A;  2O87 A;  1OC9 B;  3DIE A;  3H4K A;  2C1Y A;  3HJO A;  3F4R A;  4KA0 A;  3CYN A;  3BOA A;  3KZQ A;  3M3M A;  4IS0 A;  3VWU A;  2YAN A;  2G0F A;  1A0F A;  5J4U A;  1ZOF A;  1PMT A;  2VCQ A;  4ID0 A;  5AIV A;  1YEX A;  1XWG A;  3KP9 A;  5KN3 A;  3RAZ A;  2LNT A;  2V6K A;  2YP6 A;  4ZBB A;  1M2D A;  4HEA 2;  1WE0 A;  3BBY A;  3GYK A;  2I9H A;  3V1W A;  2FA4 A;  1VGL A;  4FYC A;  3TKR A;  2C0G A;  7GSS A;  4XRD A;  4BVY B;  1FVK A;  2IMD A;  2DC5 A;  5IO0 A;  3A2V A;  4P3Y B;  2LS5 A;  5L71 A;  5A5K A;  2A4H A;  5D9T A;  4I97 A;  2K6V A;  3IHQ A;  1B8X A;  1X5E A;  5CRH A;  1OC8 A;  4JR6 A;  1TDI A;  3LQ7 A;  3UJ1 A;  2WUL A;  3HZ4 A;  4WR5 A;  2KP1 A;  1GUK A;  5B6M A;  1TK0 B;  4YAP A;  2J9H A;  2H70 A;  1Z9H A;  3D21 A;  5GAP D;  1PL2 A;  3PGT A;  2VCW A;  4MLY A;  1X5D A;  1K0C A;  3KP8 A;  1ABA A;  3CTG A;  5ABR A;  3HVV A;  1YY7 A;  4IVF A;  3LWA A;  2I81 A;  5D93 A;  3F4T A;  6GSW A;  1K0D A;  4MMM A;  2H73 A;  3PH9 A;  2IJY A;  2WS2 A;  1O6J A;  4TR3 A;  3GTU A;  2CVB A;  2B3S A;  4O5U A;  1XWK A;  1IYH A;  3VUR A;  4L5L A;  2JAC A;  2V1M A;  1FW1 A;  3I43 A;  3VI5 A;  2GSS A;  2R2J A;  2V2G A;  1EEM A;  2I3Y A;  3D6I A;  3BCI A;  2ALB A;  3O3T A;  4MH3 A;  2CX3 A;  2H6X A;  3UIW A;  3CSI A;  5IM9 A;  4WET A;  4V2L A;  5G1L A;  1G7E A;  1SJZ A;  4OO4 A;  6GSS A;  3F63 A;  4PNF A;  1OYJ A;  5DBQ A;  4WBR D;  2GVP A;  2RM5 A;  2YV7 A;  3FZ4 A;  2R3X A;  1EOG A;  4IW9 A;  1R4W A;  2RUF A;  3TRP A;  4J2F A;  4BL7 B;  1U88 A;  2HRA A;  2E2M A;  4QL9 A;  1G6W A;  3J7Y b;  3GSS A;  3ZVJ A;  4ECJ A;  2HRF A;  4I2U A;  1ZMA A;  4RI6 A;  5G2Z A;  1K0O A;  1XOB A;  2HXK A;  5CRD A;  2YOI A;  1GSY A;  1QGV A;  5JWR B;  6GSU A;  1FOV A;  3KGK A;  2HRN A;  1GSF A;  4ISD A;  2QA1 A;  2CAQ A;  4KDX A;  2PMT A;  5ENU A;  3HVX A;  4TR4 A;  3TJB A;  3KEB A;  5J9C A;  5IMC A;  1ERV A;  1OE8 A;  2XHF A;  1SK2 A;  5DAL A;  3C7M A;  3CMI A;  3TRX A;  1TOF A;  2YWO A;  4K1F A;  1DUG A;  2E0Q A;  4MCU A;  4TN8 A;  1DE1 A;  2K8S A;  1A2M A;  3GKN A;  5F05 A;  1AUC A;  1Q4J A;  4IQ1 A;  2C80 A;  1TP9 A;  4L0W A;  3D0Z A;  3BD2 A;  1M2A A;  1ZYP A;  5AIX A;  4JBB A;  4KH7 A;  3ZTL A;  1V40 A;  3UBL A;  4BPY A;  1R26 A;  2O8V B;  3UAR A;  1XW5 A;  3DVX A;  2WJU A;  4KAE A;  4K8M A;  1VF2 A;  3Q6O A;  4OCF A;  3GL3 A;  5ECO B;  2H1G A;  4E8H A;  3VI7 A;  1HNA A;  2LQQ A;  1PL1 A;  2YV9 A;  3D4M A;  4NV5 A;  5ID2 B;  4BA7 A;  1N8J A;  4MH2 A;  5INY A;  5J3R A;  1HD2 A;  2H1A A;  1RW1 A;  5ECH B;  4F03 A;  4DEJ A;  2IMI A;  1DBY A;  3GUR A;  5KN0 A;  1AXD A;  1W89 A;  4O5Q A;  4OMV A;  3ZML A;  2C3Q A;  4IGJ A;  2OE3 A;  4HQS A;  1SK1 A;  1ML6 A;  1SJI A;  2L5L A;  2HNL A;  4K7N A;  1C72 A;  3KMO A;  4BVY A;  2GSQ A;  2HI7 A;  1S3C A;  4IJ3 A;  5LNK e;  2GLR A;  1Y25 A;  20GS A;  2HSH A;  1THX A;  3EUR A;  2YWN A;  4WF4 A;  1R7H A;  4EVM A;  3DGQ A;  3G9B A;  4LL4 B;  2OAD A;  1GSU A;  1SJ6 A;  3SBC A;  2RLI A;  3DRN A;  3VPT A;  2XPD A;  2OBK A;  4XS6 A;  16GS A;  4PQ1 A;  4BVX B;  4MP4 A;  1F9M A;  1XOA A;  5IO2 A;  2YN1 A;  3EC3 A;  3IK9 A;  3F3R A;  2TRX A;  3C71 A;  1CQG A;  3RPP A;  5IOW A;  1XG8 A;  2CT6 A;  4IJI A;  3W6G A;  3DEX A;  5DDL A;  4K0G A;  2E2G A;  2A4V A;  3IA1 A;  2B7J A;  5C04 A;  1XZO A;  5GSS A;  5IQY A;  1O7U A;  4XS1 A;  2V6O A;  1J0F A;  3EU3 A;  3KIJ A;  2X8C A;  2B5Y A;  1XW9 A;  3GKX A;  3I9V 2;  2DJK A;  2JL4 A;  4A5P A;  2X8G A;  1CQH A;  1DE2 A;  1XW6 A;  2XC2 A;  4TXV A;  3UEM A;  3U6V A;  1Z6M A;  2RUE A;  3GRX A;  3QCP A;  3F0I A;  2HZE B;  3Q19 A;  1FAA A;  4X4J A;  3PR8 A;  1PX7 A;  1JHB A;  2EIO A;  2R0C A;  2VLV A;  4MZB A;  4EKZ A;  3PPU A;  2HE3 A;  3R3E A;  4WBJ A;  1TRV A;  4WF5 A;  3AY8 A;  1YF0 A;  2GZP A;  2WB9 A;  2P0G A;  4ULX A;  5KOX A;  4TXO B;  2RII A;  1T00 A;  5F0G A;  2EIQ A;  3GL5 A;  1GUH A;  5H5S A;  4POL A;  4WKW A;  1WIK A;  2L4C A;  4YQM A;  2C0D A;  2P5R A;  1ZYE A;  5D8I A;  4FIW A;  1JLV A;  3QR6 A;  3HA9 A;  4TR1 B;  2AJQ B;  5EVO A;  1X9M B;  3ZMK A;  2QSI A;  2C3N A;  3US3 A;  5D9X A;  1ILO A;  3TJG A;  5EPF A;  2HLS A;  2CZ2 A;  2PGT A;  1BQ7 A;  2GZY A;  3VWX A;  2DSA A;  8GSS A;  13GS A;  4BWS A;  2R5G A;  1AAZ A;  1G7O A;  3Q74 A;  4N30 A;  3E9J B;  3LG6 A;  4G2E A;  3UAP A;  4LMV A;  4DSS B;  2YWI A;  2H1B A;  4MDC A;  3FRC A;  4MA9 A;  2DJ2 A;  1T1V A;  3EIN A;  2QGV A;  4MZW A;  1VRS D;  2QC7 A;  4XHM A;  2VCV A;  4G19 A;  1ZYQ B;  4ZBA A;  4XCS A;  3KMN A;  1GLP A;  3VLN A;  3WGE A;  4WXT A;  2C4J A;  2H0I A;  1PQN A;  4NMU A;  1J08 A;  1BYE A;  1U3A A;  1A2J A;  3E3E A;  4EIP A;  4XIH A;  1V9W A;  3KM6 A;  5G1K A;  4F9Z A;  1KEB A;  2CQ9 A;  3ZFB A;  3H1N A;  4I2T A;  1K3Y A;  3I6A A;  2OAC A;  2REM A;  1ZCP A;  1F3B A;  1GUM A;  4IKH A;  2ES7 A;  1GTU A;  2YJH A;  3F3Q A;  4KSM A;  1JZW A;  2H19 A;  3CQF A;  1V98 A;  3F6D A;  1HYU A;  3IK7 A;  1WPI A;  1M3I A;  5DAK B;  2VM2 A;  2GQM A;  3IV4 A;  2LUS A;  3BJ5 A;  3FY7 A;  1EWX A;  1OKT A;  3CBU A;  1HQO A;  4CHS A;  1S3R A;  3L9U A;  2C8U A;  3PIN A;  4GWR A;  4JRR A;  1NHO A;  3IC8 A;  2GGT A;  1O85 A;  4JED A;  5HFG A;  1PGT A;  2DKH A;  2YNX A;  4HU7 A;  3UOM A;  5IMZ A;  4TW5 A;  1Z7R A;  3F8U A;  1U6T A;  1EOH A;  3ISO A;  2H71 A;  3RPN A;  2VCT A;  1SKS B;  4BVX A;  2MBT A;  5IPH A;  5G31 A;  1EV4 A;  2LJR A;  11GS A;  4DSQ A;  4EXJ A;  3H79 A;  4MZC A;  2BTO T;  3VPQ A;  5D73 A;  4V2M A;  3HD5 A;  4N0Z A;  5FT3 A;  2GST A;  1TK5 B;  1YKC A;  2D2Z A;  4KW6 A;  4L5O A;  4EUY A;  3FZ5 A;  1FVJ A;  3KXO A;  3I69 A;  1BX9 A;  2X4A A;  4LL1 B;  2GZZ A;  4ECB A;  3TB2 A;  5B8B A;  5HR3 A;  3TKQ A;  2FCH A;  4OFN A;  1TRS A;  2AYT A;  2B1K A;  5BRT A;  5EL8 A;  2R0G A;  5LD0 A;  1N2A A;  4HZ2 A;  1PFO A;  2N5A A;  4ML6 A;  1B4Q A;  1MDJ A;  10GS A;  5DJL A;  3D4T A;  4ECI A;  1WP0 A;  4GRF A;  1NM3 A;  4ZB9 A;  1PKZ A;  3CRU A;  5DVB A;  2FLS A;  1WJK A;  4AJ7 A;  2V41 A;  2N5B A;  1WRY A;  4USS A;  2MMN A;  3EYT A;  3GX0 A;  2ON7 A;  3DD3 A;  3M8N A;  4PNG A;  5E59 A;  3VK9 A;  1UC7 A;  2X99 A;  3MNG A;  5IMV A;  2DJ0 A;  5CRW A;  1R5P A;  1X0R A;  3M1G A;  5G30 A;  5B7C A;  2VIM A;  2PU9 C;  3MYD A;  3VFI A;  3F6F A;  4QQ7 A;  4Q5R A;  2OA7 A;  3TCO A;  3HYP A;  4IEL A;  2PN8 A;  2CAI A;  1JZR A;  4MNN A;  2LTK A;  5J41 A;  4TR1 A;  4GCI A;  1E2Y A;  4EC0 A;  2H72 A;  5HR0 A;  3LXT A;  2O85 A;  1UVZ A;  1G6Y A;  3GH6 A;  1Y6E A;  3KH7 A;  3VWV A;  5IIZ A;  5DQS A;  4BWQ A;  1M99 A;  2IIY A;  3FR3 A; 
#chains in the Genus database with same CATH homology
 4TVE A;  4DSS A;  2R0P A;  1ACV A;  3CRT A;  22GS A;  5KOW A;  4N11 A;  2YZH A;  3BCK A;  5JCW A;  2O7K A;  3FYG A;  1I9D A;  3ZRD A;  1SEN A;  3D5J A;  4ZIJ A;  1F37 A;  3ME7 A;  1OAZ A;  4AJ6 A;  5H5Q A;  3HHV A;  1USB A;  2H6Y A;  4EL1 A;  2KOK A;  1SL2 B;  4KSO A;  3DWV A;  4GSN A;  1Z3E A;  2XPE A;  1HNB A;  4IHU A;  2OE1 A;  3IPZ A;  3EMP A;  1T4Y A;  2PER A;  4Q5F A;  6GST A;  3C73 A;  5ECR B;  3TKS A;  6GSY A;  3IAM 2;  4TOP A;  1F3A A;  1T4Z A;  2VL9 A;  3NZN A;  2JAD A;  1ST9 A;  1GLQ A;  3QAW A;  1GUL A;  4HQZ A;  1OE7 A;  4WEY A;  3H93 A;  5KN1 A;  4ZL9 A;  1TU7 A;  4GLT A;  1OC9 A;  1SU9 A;  2FNO A;  4EDY A;  1E6B A;  5ELG A;  3TUE A;  2N5F A;  4POB A;  2YJ7 A;  3W8J A;  5DAK A;  2PPT A;  3M0F A;  1UN2 A;  3W8S A;  1XVW A;  3JCM L;  4NWY A;  1XVQ A;  2WZ9 A;  1SYX A;  1O81 A;  1PA3 A;  4GQF A;  4HU9 A;  4HZ4 A;  2CA8 A;  3ZZX A;  1U3I A;  1O8X A;  1BED A;  4XS4 B;  5A4V A;  4FQU A;  3L0H A;  4TRX A;  3TGZ A;  1K3O A;  3LYK A;  1QUW A;  1K0M A;  2A2S A;  3DVW A;  4PQI A;  2L5O A;  1SK0 A;  2LST A;  3ZFL A;  4KX4 A;  2H74 A;  1EEJ A;  4MJA A;  4GST A;  3O6T A;  3G7Y A;  2E7P A;  4MF6 A;  3N5O A;  2H30 A;  4Z2R A;  1URM A;  1A24 A;  1BG5 A;  4KGI A;  1UA5 A;  3IDV A;  1B9Y C;  3K8N A;  4WR4 A;  2V32 A;  4OO5 A;  5AIS A;  1A23 A;  4N0V A;  4ICY A;  4F82 A;  3ZYW A;  5BMU A;  2C0E A;  3HY2 A;  2LKU A;  1PRX A;  1XWB A;  3LEF A;  1BJX A;  4G0K A;  1Q98 A;  4Q5Q A;  1NHY A;  1U87 A;  1WMJ A;  2TRC P;  2MMO A;  1GNW A;  3FZ9 A;  2BJX A;  4POM A;  4IN0 A;  2LJA A;  1PKW A;  3GN3 A;  2F8A A;  4X43 A;  3E0U A;  5EY6 A;  3IHG A;  1YDK A;  1SL1 B;  4EF0 A;  5DCG A;  1B48 A;  2VCZ A;  2HT9 A;  4PGT A;  1M9B A;  2X64 A;  3QAG A;  1YKA A;  5GAN D;  3N9J A;  5G5E A;  1JFU A;  4RI7 A;  3A3T A;  2ON5 A;  3OR5 A;  1GWC A;  3TJJ A;  5CYY A;  4X1U A;  3ZIV A;  1PN9 A;  2IFQ B;  2L59 A;  2HSM A;  5CRE A;  1EGO A;  3MWH A;  4L8E A;  5J5N A;  2YPM A;  1PSQ A;  2IL3 A;  2VO4 A;  3FHK A;  4E8E A;  4MPG A;  4K7O A;  2AHE A;  2H6Z A;  5ELA A;  3GKM A;  2B6M A;  2FHE A;  1V58 A;  1PD2 1;  3MAK A;  3VWW A;  3GUS A;  1M0U A;  1XWA A;  5HQP A;  1XBS A;  1FB6 A;  2CX4 A;  2KUC A;  3GH9 A;  3FW2 A;  1QFN A;  2R6K A;  19GS A;  1W4V A;  3DXB A;  4BL7 A;  4O5R A;  2UZ8 A;  3WT1 A;  1MDI A;  3CSH A;  4IP1 A;  3FEU A;  3GTU B;  4ZBD A;  1YF1 A;  5ECP B;  1S3A A;  1LJR A;  1FB0 A;  1SD8 A;  3EWL A;  1S3D A;  3MIX A;  3EU4 A;  5DJM A;  3ZVJ D;  2GDR A;  1XWC A;  3LYP A;  2K8V A;  3CTF A;  2ZUP A;  4RQX A;  1K0N A;  4HS1 A;  3D22 A;  5CO3 A;  2WFC A;  4MJB A;  2NVL A;  2PBJ A;  3P90 A;  1LU4 A;  1ZYN A;  2HFD A;  1OKD A;  5A4W A;  1AQX A;  1XXU A;  4J57 E;  2FWH A;  5D9V A;  1V2A A;  3A5I A;  1X9S B;  2H0H A;  2FY6 A;  3L9S A;  1GTA A;  1H75 A;  3L4N A;  1A2L A;  2R37 A;  2OJL A;  1TRW A;  4YH2 A;  5D9W A;  2DLX A;  1SKW B;  4EDZ A;  1A0R P;  3ZRE A;  3LJR A;  2TIR A;  3CXG A;  4F0C A;  3DML A;  3P8W A;  1FOH A;  5ECN B;  4V1A g;  3GX8 A;  3RHC A;  4IQA A;  5ID2 A;  3NIV A;  4OCE A;  4NXI A;  3HZ8 A;  2CVD A;  3APS A;  5GST A;  2FWF A;  2ZNM A;  3LW9 A;  3MSZ A;  4GTU A;  4KND A;  1IYI A;  3TRQ A;  4YQV A;  4D73 B;  2JSZ A;  2VD1 A;  4V1A p;  5ECK B;  2VM1 A;  3FMW A;  2H66 A;  4G10 A;  3GV1 A;  2IWT A;  3IOS A;  3TKS C;  2P5Q A;  1G0T A;  3UVH A;  3RBT A;  2GTU A;  4G0I A;  1HNC A;  4I6X A;  2PWJ A;  4JE1 A;  1FG4 A;  4ZIL A;  4H86 A;  4YKG A;  17GS A;  2VL2 A;  2FWE A;  2YWM A;  1GSQ A;  5FWG A;  4Z7X A;  4YQU A;  2GSR A;  4OWY A;  3KH9 A;  4DVC A;  1JZD A;  4POK A;  2LEG A;  4O92 A;  4RUV A;  3C1S A;  3KTB A;  4LLR A;  4LMW A;  2X8H A;  5HR1 A;  3HKR A;  2DJJ A;  3KJY A;  3GA4 A;  2FD3 A;  2LV3 A;  4ZXG A;  5G5F A;  4NV2 A;  1K0B A;  1GTI A;  5GZZ B;  4HOJ A;  3F9U A;  4ZB6 A;  2DMM A;  2RM6 A;  1AIU A;  2JZT A;  1V57 A;  4TR0 A;  2CVK A;  4HJ2 A;  2FUG 2;  4GSS A;  4MF7 A;  4ZB8 A;  3ED3 A;  2OBI A;  4L0U A;  1TKD B;  3QPM A;  2KHP A;  4NHW A;  1O73 A;  5H5R A;  1Z5Y E;  2C0F A;  3L78 A;  4K2X A;  4GF0 A;  1GP1 A;  2VL3 A;  3LGC A;  2LRT A;  2I1U A;  1EZK A;  4I5Q A;  1LBK A;  2L57 A;  5ECM B;  1KTE A;  4HUA A;  2MBS A;  4N10 A;  2IFQ A;  4JU5 A;  3IC4 A;  5D96 A;  5ECI B;  3WYW A;  2F9S A;  3TDG A;  4ILF A;  2LNS A;  3FR9 A;  2HYX A;  4QL7 A;  3A2X A;  5HFK A;  5KEJ A;  1DSB A;  2H76 A;  4MAB A;  3RHB A;  2JSY A;  4HDE A;  3LOR A;  2HZE A;  2DIY A;  1TJD A;  3IAS 2;  3GFK A;  4AJ8 A;  1KBN A;  4PUR A;  3S9F A;  2JU5 A;  3TKP A;  5B6N A;  5B8A A;  1TRU A;  1YJ6 A;  3TKS E;  2B5X A;  1AC1 A;  2ZCT A;  1PX6 A;  4TXO A;  2F51 A;  1XCC A;  2GT5 A;  2CZ3 A;  3J7Y k;  3QFA C;  1Z6N A;  4ECC A;  1YZX A;  4PQH A;  2DKI A;  4K9Z A;  2PVO C;  3Q18 A;  4NAX A;  5IMA A;  4JR4 A;  1JZO A;  2CV4 A;  2IME A;  5CRG A;  3APO A;  2DJ3 A;  2X49 A;  4Z2U A;  3HJP A;  3ZIT A;  3NOF A;  3ERF A;  4MJC A;  4Z2T A;  3TJK A;  3GNJ A;  4EE0 A;  4RQR A;  1KNG A;  1TK8 B;  4V2N A;  1OVN A;  1GNE A;  2LRN A;  3DYR A;  4F0B A;  3CSJ A;  2VLT A;  4K6X A;  3UMA A;  4OFM A;  3EE2 A;  4NPB A;  3QOU A;  5LCZ A;  2YZU A;  3FKF A;  2AB6 A;  2HZF A;  2PUK C;  4F2I A;  3ME8 A;  4PUA A;  5CAX A;  1EV9 A;  2QA2 A;  1AW9 A;  3C8E A;  3EPT A;  5IMF A;  3GMF A;  3IBH A;  5JCG A;  2WGR A;  2OKA A;  3M9K A;  2BMX A;  2WCI A;  2NPB A;  3R2Q A;  1THO A;  4MF5 A;  3ERG A;  4K0N A;  2MZC A;  2HSY A;  2WRT A;  3WD6 A;  4FYU A;  2L6C A;  1QQ2 A;  2QKE A;  3ZLP A;  2C3T A;  3C1R A;  4D73 A;  4LA1 A;  5JWQ B;  5A4U A;  2JZR A;  4OFT A;  3TOU A;  1GSS A;  2I4A A;  2MMA A;  3HJM A;  2K18 A;  5CNW A;  2IN3 A;  3GIX A;  2B1L A;  4AGS A;  1YEP A;  3WT2 A;  2HRK A;  1VF3 A;  1QK8 A;  2L6D A;  1FO5 A;  1M7T A;  1XPV A;  2PVQ A;  5COH A;  3HVS A;  2NBS A;  2XBI A;  5AN1 A;  2M80 A;  3FK8 A;  5JCU A;  1GH2 A;  3M9J A;  3A5W A;  1TW9 A;  1M9A A;  3EVI A;  2O89 A;  2L4Q A;  2KLX A;  14GS A;  1I5G A;  2G2Q A;  3UVT A;  4ZL7 A;  4EO3 A;  2H75 A;  3WGD A;  1AQV A;  1GSD A;  2DIZ A;  1T3B A;  2GQL A;  1EP7 A;  2MMZ A;  1OC3 A;  1QXH A;  4CW9 A;  2DBC A;  1MDK A;  2P31 A;  2IPA A;  2VCX A;  1MEK A;  3EMX A;  3P7X A;  4ACS A;  1RK4 A;  5CP1 A;  1F6M C;  4AF2 A;  5ECL B;  3RDW A;  2KP2 A;  1MTC A;  2IMK A;  4XRA A;  4TKY A;  2LRC A;  4NHZ A;  4IP6 A;  1ZL9 A;  4K5S A;  2IMF A;  3UBK A;  1SD9 A;  1H4O A;  1QMV A;  3LXZ A;  5IMD A;  1SL0 B;  3GKK A;  4EIQ A;  2R4V A;  5IPG A;  4X0X A;  1BAY A;  2VL2 C;  2A2P A;  2A2R A;  4I8B A;  1EP8 A;  5F07 A;  3APQ A;  2EC4 A;  4Q5N A;  1AQW A;  1M2B A;  4JZQ A;  4IBP A;  4J56 E;  2JZS A;  1O8W A;  2NTO A;  1WWJ A;  5HFI A;  1TTZ A;  5J9B A;  1MD4 A;  1T7P B;  4CDO A;  2GT6 A;  2GQK A;  1GSE A;  2XBQ A;  1EGR A;  2LQO A;  4PX1 A;  3G7I A;  4KDU A;  3DKS A;  3HCZ A;  4KUN A;  2M46 A;  4K5R A;  1ON4 A;  1XFL A;  2H01 A;  1SKR B;  3FR6 A;  4KCE A;  4FYB A;  1TI3 A;  2AAW A;  2FGX A;  4O32 A;  3QAV A;  4ML1 A;  1MD3 A;  4O7H A;  3IXR A;  3IR4 A;  4KB3 A;  4OD7 A;  1TXX A;  2H0G A;  4MPF A;  3IRA A;  3QD9 A;  4GQC A;  5AGY A;  3H8Q A;  3QDN A;  4KCA A;  4PXO A;  1Z7P A;  5F8B A;  5IOX A;  9GSS A;  1B4P A;  1GTB A;  3P2A A;  3ERW A;  4PUF C;  1B9X C;  1TI1 A;  1VF1 A;  3MDK A;  2VUP A;  2K9F A;  4KF9 A;  2F8F A;  3G7J A;  4FH8 A;  2MYG A;  1JLW A;  2VAF A;  5KN2 A;  1A8Y A;  18GS A;  1YQ1 A;  3FZA A;  4YAV A;  1J9B A;  3LSZ A;  1GL8 A;  2H1D A;  3L9V A;  3WGX A;  4K2D A;  5C00 A;  1ERT A;  4HI7 A;  3KTL A;  3GHA A;  4HJM A;  1SYR A;  4KE3 A;  1K3L A;  1F2E A;  3QMX A;  1NSW A;  1PN0 A;  3SWL A;  1T8E B;  1GRX A;  3LFL A;  4G0L A;  2YCD A;  3HDC A;  3F4S A;  3IE3 A;  2B5E A;  4G9H A;  4KDY A;  1TU8 A;  5DQY A;  4PTS A;  4CY6 A;  1RQM A;  5F06 A;  4XTS A;  1X5C A;  2H8L A;  5FHI A;  3U5R E;  3HXS A;  1K0A A;  5DAL B;  2VLU A;  3UL3 A;  1FHE A;  4FO5 A;  1WOU A;  3KD0 A;  2OE0 A;  4CY8 A;  1XIY A;  2B7K A;  2FA8 A;  5DCH A;  5ECQ B;  1A8L A;  3A2W A;  2DJ1 A;  4MJE A;  12GS A;  3ZIJ A;  5JWO B;  2F3M A;  2VOC A;  3QFB C;  1ERW A;  2DML A;  2NDO A;  1R5A A;  3ZL5 A;  3GST A;  3O76 A;  2J23 A;  4MK3 A;  4K7I A;  4GXZ A;  2GS3 A;  1ERU A;  4DSR A;  2M72 A;  2VD0 A;  2EIR A;  5ECS A;  5E4W A;  2LJK A;  6GSV A;  1ZZY A;  6GSX A;  3TOT A;  2FWG A;  2WDU A;  4XS4 A;  5HR2 A;  3TJF A;  4YKF A;  2AV4 A;  3KCM A;  4ZL8 A;  1VF4 A;  1NW2 A;  2AUV A;  1X9W B;  1ZGN A;  2Z9S A;  2O87 A;  1OC9 B;  3DIE A;  3H4K A;  2C1Y A;  3HJO A;  3F4R A;  4KA0 A;  3CYN A;  3BOA A;  3KZQ A;  3M3M A;  4IS0 A;  3VWU A;  2YAN A;  2G0F A;  1A0F A;  5J4U A;  1ZOF A;  1PMT A;  2VCQ A;  4ID0 A;  5AIV A;  1YEX A;  1XWG A;  3KP9 A;  5KN3 A;  3RAZ A;  2LNT A;  2V6K A;  2YP6 A;  4ZBB A;  1M2D A;  4HEA 2;  1WE0 A;  3BBY A;  3GYK A;  2I9H A;  3V1W A;  2FA4 A;  1VGL A;  4FYC A;  3TKR A;  2C0G A;  7GSS A;  4XRD A;  4BVY B;  1FVK A;  2IMD A;  2DC5 A;  5IO0 A;  3A2V A;  4P3Y B;  2LS5 A;  5L71 A;  5A5K A;  2A4H A;  5D9T A;  4I97 A;  2K6V A;  3IHQ A;  1B8X A;  1X5E A;  5CRH A;  1OC8 A;  4JR6 A;  1TDI A;  3LQ7 A;  3UJ1 A;  2WUL A;  3HZ4 A;  4WR5 A;  2KP1 A;  1GUK A;  5B6M A;  1TK0 B;  4YAP A;  2J9H A;  2H70 A;  1Z9H A;  3D21 A;  5GAP D;  1PL2 A;  3PGT A;  2VCW A;  4MLY A;  1X5D A;  1K0C A;  3KP8 A;  1ABA A;  3CTG A;  5ABR A;  3HVV A;  1YY7 A;  4IVF A;  3LWA A;  2I81 A;  5D93 A;  3F4T A;  6GSW A;  1K0D A;  4MMM A;  2H73 A;  3PH9 A;  2IJY A;  2WS2 A;  1O6J A;  4TR3 A;  3GTU A;  2CVB A;  2B3S A;  4O5U A;  1XWK A;  1IYH A;  3VUR A;  4L5L A;  2JAC A;  2V1M A;  1FW1 A;  3I43 A;  3VI5 A;  2GSS A;  2R2J A;  2V2G A;  1EEM A;  2I3Y A;  3D6I A;  3BCI A;  2ALB A;  3O3T A;  4MH3 A;  2CX3 A;  2H6X A;  3UIW A;  3CSI A;  5IM9 A;  4WET A;  4V2L A;  5G1L A;  1G7E A;  1SJZ A;  4OO4 A;  6GSS A;  3F63 A;  4PNF A;  1OYJ A;  5DBQ A;  4WBR D;  2GVP A;  2RM5 A;  2YV7 A;  3FZ4 A;  2R3X A;  1EOG A;  4IW9 A;  1R4W A;  2RUF A;  3TRP A;  4J2F A;  4BL7 B;  1U88 A;  2HRA A;  2E2M A;  4QL9 A;  1G6W A;  3J7Y b;  3GSS A;  3ZVJ A;  4ECJ A;  2HRF A;  4I2U A;  1ZMA A;  4RI6 A;  5G2Z A;  1K0O A;  1XOB A;  2HXK A;  5CRD A;  2YOI A;  1GSY A;  1QGV A;  5JWR B;  6GSU A;  1FOV A;  3KGK A;  2HRN A;  1GSF A;  4ISD A;  2QA1 A;  2CAQ A;  4KDX A;  2PMT A;  5ENU A;  3HVX A;  4TR4 A;  3TJB A;  3KEB A;  5J9C A;  5IMC A;  1ERV A;  1OE8 A;  2XHF A;  1SK2 A;  5DAL A;  3C7M A;  3CMI A;  3TRX A;  1TOF A;  2YWO A;  4K1F A;  1DUG A;  2E0Q A;  4MCU A;  4TN8 A;  1DE1 A;  2K8S A;  1A2M A;  3GKN A;  5F05 A;  1AUC A;  1Q4J A;  4IQ1 A;  2C80 A;  1TP9 A;  4L0W A;  3D0Z A;  3BD2 A;  1M2A A;  1ZYP A;  5AIX A;  4JBB A;  4KH7 A;  3ZTL A;  1V40 A;  3UBL A;  4BPY A;  1R26 A;  2O8V B;  3UAR A;  1XW5 A;  3DVX A;  2WJU A;  4KAE A;  4K8M A;  1VF2 A;  3Q6O A;  4OCF A;  3GL3 A;  5ECO B;  2H1G A;  4E8H A;  3VI7 A;  1HNA A;  2LQQ A;  1PL1 A;  2YV9 A;  3D4M A;  4NV5 A;  5ID2 B;  4BA7 A;  1N8J A;  4MH2 A;  5INY A;  5J3R A;  1HD2 A;  2H1A A;  1RW1 A;  5ECH B;  4F03 A;  4DEJ A;  2IMI A;  1DBY A;  3GUR A;  5KN0 A;  1AXD A;  1W89 A;  4O5Q A;  4OMV A;  3ZML A;  2C3Q A;  4IGJ A;  2OE3 A;  4HQS A;  1SK1 A;  1ML6 A;  1SJI A;  2L5L A;  2HNL A;  4K7N A;  1C72 A;  3KMO A;  4BVY A;  2GSQ A;  2HI7 A;  1S3C A;  4IJ3 A;  5LNK e;  2GLR A;  1Y25 A;  20GS A;  2HSH A;  1THX A;  3EUR A;  2YWN A;  4WF4 A;  1R7H A;  4EVM A;  3DGQ A;  3G9B A;  4LL4 B;  2OAD A;  1GSU A;  1SJ6 A;  3SBC A;  2RLI A;  3DRN A;  3VPT A;  2XPD A;  2OBK A;  4XS6 A;  16GS A;  4PQ1 A;  4BVX B;  4MP4 A;  1F9M A;  1XOA A;  5IO2 A;  2YN1 A;  3EC3 A;  3IK9 A;  3F3R A;  2TRX A;  3C71 A;  1CQG A;  3RPP A;  5IOW A;  2CT6 A;  4IJI A;  3W6G A;  3DEX A;  5DDL A;  4K0G A;  2E2G A;  2A4V A;  3IA1 A;  2B7J A;  5C04 A;  1XZO A;  5GSS A;  5IQY A;  1O7U A;  4XS1 A;  2V6O A;  1J0F A;  3EU3 A;  3KIJ A;  2X8C A;  2B5Y A;  1XW9 A;  3GKX A;  3I9V 2;  2DJK A;  2JL4 A;  4A5P A;  2X8G A;  1CQH A;  1DE2 A;  1XW6 A;  2XC2 A;  4TXV A;  3UEM A;  3U6V A;  1Z6M A;  2RUE A;  3GRX A;  3QCP A;  3F0I A;  2HZE B;  3Q19 A;  1FAA A;  4X4J A;  3PR8 A;  1PX7 A;  1JHB A;  2EIO A;  2R0C A;  2VLV A;  4MZB A;  4EKZ A;  3PPU A;  2HE3 A;  3R3E A;  4WBJ A;  1TRV A;  4WF5 A;  3AY8 A;  1YF0 A;  2GZP A;  2WB9 A;  2P0G A;  4ULX A;  5KOX A;  4TXO B;  2RII A;  1T00 A;  5F0G A;  2EIQ A;  3GL5 A;  1GUH A;  5H5S A;  4POL A;  4WKW A;  1WIK A;  2L4C A;  4YQM A;  2C0D A;  2P5R A;  1ZYE A;  5D8I A;  4FIW A;  1JLV A;  3QR6 A;  3HA9 A;  4TR1 B;  2AJQ B;  5EVO A;  1X9M B;  3ZMK A;  2QSI A;  2C3N A;  3US3 A;  5D9X A;  1ILO A;  3TJG A;  5EPF A;  2HLS A;  2CZ2 A;  2PGT A;  1BQ7 A;  2GZY A;  3VWX A;  2DSA A;  8GSS A;  13GS A;  4BWS A;  2R5G A;  1AAZ A;  1G7O A;  3Q74 A;  4N30 A;  3E9J B;  3LG6 A;  4G2E A;  3UAP A;  4LMV A;  4DSS B;  2YWI A;  2H1B A;  4MDC A;  3FRC A;  4MA9 A;  2DJ2 A;  1T1V A;  3EIN A;  2QGV A;  4MZW A;  1VRS D;  2QC7 A;  4XHM A;  2VCV A;  4G19 A;  1ZYQ B;  4ZBA A;  4XCS A;  3KMN A;  1GLP A;  3VLN A;  3WGE A;  4WXT A;  2C4J A;  2H0I A;  1PQN A;  4NMU A;  1J08 A;  1BYE A;  1U3A A;  1A2J A;  3E3E A;  4EIP A;  4XIH A;  1V9W A;  3KM6 A;  5G1K A;  4F9Z A;  1KEB A;  2CQ9 A;  3ZFB A;  3H1N A;  4I2T A;  1K3Y A;  3I6A A;  2OAC A;  2REM A;  1ZCP A;  1F3B A;  1GUM A;  4IKH A;  2ES7 A;  1GTU A;  2YJH A;  3F3Q A;  4KSM A;  1JZW A;  2H19 A;  1V98 A;  3F6D A;  1HYU A;  3IK7 A;  1WPI A;  5DAK B;  2VM2 A;  2GQM A;  3IV4 A;  2LUS A;  3BJ5 A;  3FY7 A;  1EWX A;  1OKT A;  3CBU A;  1HQO A;  4CHS A;  3L9U A;  2C8U A;  3PIN A;  4GWR A;  4JRR A;  1NHO A;  3IC8 A;  2GGT A;  1O85 A;  4JED A;  5HFG A;  1PGT A;  2DKH A;  2YNX A;  4HU7 A;  3UOM A;  5IMZ A;  4TW5 A;  1Z7R A;  3F8U A;  1U6T A;  1EOH A;  3ISO A;  2H71 A;  3RPN A;  2VCT A;  1SKS B;  4BVX A;  2MBT A;  5IPH A;  5G31 A;  1EV4 A;  2LJR A;  11GS A;  4DSQ A;  4EXJ A;  3H79 A;  4MZC A;  2BTO T;  3VPQ A;  5D73 A;  4V2M A;  3HD5 A;  4N0Z A;  5FT3 A;  2GST A;  1TK5 B;  1YKC A;  2D2Z A;  4KW6 A;  4L5O A;  4EUY A;  3FZ5 A;  1FVJ A;  3KXO A;  3I69 A;  1BX9 A;  2X4A A;  4LL1 B;  2GZZ A;  4ECB A;  3TB2 A;  5B8B A;  5HR3 A;  3TKQ A;  2FCH A;  4OFN A;  1TRS A;  2AYT A;  2B1K A;  5BRT A;  5EL8 A;  2R0G A;  5LD0 A;  1N2A A;  4HZ2 A;  2N5A A;  4ML6 A;  1B4Q A;  1MDJ A;  10GS A;  5DJL A;  3D4T A;  4ECI A;  1WP0 A;  4GRF A;  1NM3 A;  4ZB9 A;  1PKZ A;  3CRU A;  5DVB A;  2FLS A;  1WJK A;  4AJ7 A;  2V41 A;  2N5B A;  1WRY A;  4USS A;  2MMN A;  3EYT A;  3GX0 A;  2ON7 A;  3DD3 A;  3M8N A;  4PNG A;  5E59 A;  3VK9 A;  1UC7 A;  2X99 A;  3MNG A;  5IMV A;  2DJ0 A;  5CRW A;  1R5P A;  1X0R A;  3M1G A;  5G30 A;  5B7C A;  2VIM A;  2PU9 C;  3MYD A;  3VFI A;  3F6F A;  4QQ7 A;  4Q5R A;  2OA7 A;  3TCO A;  3HYP A;  4IEL A;  2PN8 A;  2CAI A;  1JZR A;  4MNN A;  2LTK A;  5J41 A;  4TR1 A;  4GCI A;  1E2Y A;  4EC0 A;  2H72 A;  5HR0 A;  3LXT A;  2O85 A;  1UVZ A;  1G6Y A;  3GH6 A;  1Y6E A;  3KH7 A;  3VWV A;  5IIZ A;  5DQS A;  4BWQ A;  1M99 A;  2IIY A;  3FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...