1QUWA

Solution structure of the thioredoxin from bacillus acidocaldarius
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
105
structure length
105
Chain Sequence
ATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title NMR solution structure of a novel thioredoxin from Bacillus acidocaldarius possible determinants of protein stability.
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
total genus 20
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1999-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1quwA00
5ECHB 3UMAA 3ME7A 4L8EA 6GSUA 2BMXA 1PN9A 2FHEA 2YN1A 4ZBDA 4L5LA 3UOMA 4G9HA 2K9FA 5G1KA 1LU4A 2AB6A 4HJMA 4F03A 1WWJA 1B4PA 1K0NA 3ME8A 1GUHA 3CRTA 2AYTA 4V2NA 1TU7A 4AJ7A 4WXTA 1A2LA 2ON5A 3DMLA 3AY8A 4MZCA 2K8VA 2GQMA 6GSYA 1G7EA 2FWGA 3CXGA 2H74A 3ZMKA 2DBCA 2PVQA 3HD5A 1U88A 3GRXA 1RK4A 3TKQA 5D96A 3HJPA 1FOVA 2KHPA 1ZL9A 4Q5RA 5ECNB 1GTUA 5AN1A 5FWGA 3KP9A 3GL5A 4YAPA 3FZ9A 1UVZA 5G2ZA 5AIXA 5A4VA 3F6FA 2WS2A 2VAFA 1PA3A 3IDVA 2M72A 1SJIA 2AAWA 5EVOA 3F4RA 4AF2A 4TN8A 4MZBA 2EIQA 3KH9A 1PX6A 1M9AA 2LJRA 1Z6NA 2IWTA 2KLXA 5FHIA 5KEJA 5IMDA 5GAPD 3VI7A 1UA5A 4X0XA 1XWBA 1XWAA 5JCWA 3D4MA 4EC0A 4EL1A 2DJ1A 4FIWA 5JWOB 4KNDA 2JACA 4PUFC 1KBNA 2E0QA 1MD4A 5J4UA 2L59A 4O7HA 3UVTA 4HQZA 4IW9A 1KTEA 4KDUA 3G7IA 1OE7A 3D6IA 3P90A 1TOFA 4ZBAA 1J0FA 3E0UA 4TR3A 2BTOT 4XCSA 3WT2A 1V98A 2GZYA 4WR5A 5CRGA 2CVBA 3HJMA 1XW5A 2VM2A 3UARA 2CAQA 2PPTA 3EU3A 2YCDA 3LYPA 2GLRA 1EOHA 2L4CA 1MD3A 3UL3A 2I81A 3C7MA 5G5FA 3APSA 2FLSA 5DJMA 5EL8A 4BVYA 5ECSA 2LV3A 4D73B 1XWCA 3W6GA 3KZQA 2GS3A 2JZRA 3N5OA 1RW1A 1QXHA 3Q6OA 4X1UA 2IN3A 1X9WB 1OC8A 2O7KA 5KN1A 1X5CA 2C0DA 1M0UA 4KSOA 4NV5A 1LJRA 1YEPA 3A3TA 4PNGA 3GX0A 4LA1A 5KN3A 5ECOB 3IAS2 1WOUA 4J56E 3KTBA 2JSZA 4JR6A 5AGYA 5F05A 3GTUA 2HXKA 1GL8A 1TI1A 1GH2A 2YV7A 1TXXA 2RLIA 1AQXA 1I9DA 1TRUA 3MAKA 4F0CA 2OKAA 1A24A 3EMXA 3LXTA 1FB0A 2OBIA 2HT9A 3QD9A 3V1WA 2KP2A 4WBJA 2MMZA 1B48A 4GXZA 2TRXA 3KH7A 2N5FA 3M1GA 5D93A 3BBYA 1QUWA 4GTUA 3MSZA 3TKPA 3APQA 5LCZA 5J3RA 3GV1A 3BCKA 3GKKA 4N0VA 1NM3A 1TRVA 2FUG2 1QFNA 3RDWA 5B7CA 1XFLA 3C1SA 1FAAA 1XBSA 4WBRD 2ZNMA 2G2QA 2B5EA 3RHBA 2L57A 3TJGA 2A2RA 1FVKA 3ERWA 1DE1A 1XPVA 4I97A 4MPFA 4WR4A 2R2JA 3FR9A 17GSA 3SBCA 3D22A 2EC4A 2QGVA 1AQVA 2J23A 3ZVJA 2V41A 3HDCA 5D9TA 2H0IA 4MF5A 5G5EA 3I43A 5ECIB 3TB2A 4PUAA 2VLVA 3GURA 2VCQA 4XHMA 3EMPA 5IOXA 3RPPA 5CAXA 3F3RA 4ZL9A 4HS1A 3VFIA 2IMEA 4F9ZA 2P5RA 3W8SA 2AJQB 3EURA 2FY6A 2VLTA 2X8GA 1GUMA 4K2DA 2R6KA 3ZVJD 1AAZA 3EINA 1URMA 4IQ1A 4OCFA 2L6CA 3C73A 3GUSA 3EC3A 2B7JA 1EGOA 4ACSA 5HR0A 3NZNA 3F0IA 4I5QA 4NHZA 2GTUA 2A2SA 4GRFA 2MBTA 3TRQA 3VURA 2ZCTA 1GTBA 3BD2A 2H6XA 2QKEA 1BJXA 1G0TA 4MJCA 1EWXA 1GLPA 1O6JA 1SK1A 3ZRDA 1R5PA 2LEGA 5JCUA 2I1UA 3DRNA 4XS1A 2C4JA 4L0UA 1G7OA 4HZ2A 4ECJA 1PD21 5H5RA 2WDUA 2F8AA 4GQCA 1JZRA 3FEUA 1FVJA 1Z5YE 2CQ9A 3VPQA 1K0OA 4OFNA 2VCVA 1ZOFA 2O8VB 12GSA 4K9ZA 2DJ0A 4PXOA 1B9YC 2E7PA 2WJUA 4KX4A 4G10A 3UEMA 1YDKA 3TKSC 3GYKA 5GSSA 4MMMA 4PGTA 5F0GA 1KNGA 1BG5A 3WGXA 5DCGA 2BJXA 3N9JA 2NBSA 4FYCA 3LWAA 3FY7A 3O6TA 2VLUA 1X9SB 2YANA 1Z7PA 2C0GA 3J7Yk 3ZFBA 1ML6A 2IMDA 3UAPA 5G31A 3FHKA 2DSAA 3FRCA 3QOUA 5HFIA 4BL7A 3O3TA 1K0BA 1HNAA 2AHEA 2R37A 5B6NA 1GULA 1G6YA 3GH9A 1YJ6A 1TU8A 3L78A 2X8CA 1BYEA 3LXZA 4QL7A 4Q5NA 3ED3A 4K0NA 5DAKB 2RM6A 1QQ2A 3IBHA 5ECKB 3G7YA 4LLRA 4G2EA 1SD8A 2OE1A 5DALB 3WGDA 3FYGA 2DIZA 4ZB9A 2HZEB 1GSEA 2DIYA 1F3AA 4HUAA 1T7PB 4HOJA 1PMTA 5J9CA 2AUVA 2JZTA 3IPZA 2HSHA 3TDGA 1IYIA 2B1KA 1XZOA 1TRWA 2TRCP 3IA1A 4D73A 1O81A 1JZWA 2HRNA 3O76A 4MF7A 2GSTA 3KTLA 2H0GA 1X9MB 2IJYA 4JZQA 5ECMB 2CT6A 4ZL7A 2E2MA 2VD1A 2FWHA 5CP1A 4WF5A 3JCML 2DLXA 1ON4A 3BJ5A 3VLNA 4MJBA 2C3TA 3GKXA 5D8IA 1U3IA 5HR2A 4V2LA 2YWNA 5A5KA 1NSWA 5DBQA 2IIYA 3L9UA 2DC5A 1OAZA 1SJ6A 4AGSA 1T4YA 1OVNA 1ZMAA 3W8JA 11GSA 2L4QA 4XS6A 2GQKA 4ML6A 1GSQA 2E2GA 3HVVA 1H75A 4TRXA 3KCMA 4RQXA 1JZDA 2B5XA 4YAVA 2X99A 1S3DA 1ERVA 3UVHA 4MH3A 3CTGA 2JADA 4HJ2A 16GSA 2MZCA 2QSIA 5IOWA 4IP6A 1R5AA 1ZZYA 4JU5A 10GSA 2DMLA 3U5RE 3HJOA 1SKSB 4IKHA 2L5LA 3F4SA 3GMFA 4GF0A 5JWQB 1PQNA 5CRDA 4ZIJA 2CVDA 1DUGA 2IFQA 2YV9A 1EOGA 4EO3A 2LTKA 2CZ2A 4RQRA 4TR4A 1PL2A 4HU7A 4P3YB 3GSSA 4K6XA 3FW2A 1YKAA 3MWHA 2FD3A 5LNKe 4MZWA 2GT6A 1EEJA 2VL9A 4PURA 2VD0A 2X8HA 3RHCA 1Y25A 4EF0A 1Y6EA 4XRAA 2GT5A 3ZFLA 1T8EB 1DSBA 1SYXA 1T4ZA 4O92A 14GSA 5LD0A 3H79A 3IXRA 4QQ7A 1GSFA 5HFKA 3QR6A 1S3AA 2PGTA 2J9HA 2VL2C 4EUYA 1F3BA 1AXDA 1SYRA 1THOA 4F0BA 4K7NA 4V1Ap 1E6BA 3RBTA 3C71A 4NPBA 1UC7A 1N2AA 1Q98A 2H01A 3FZ4A 3ZL5A 4IHUA 1OC9B 3TOTA 5EY6A 2XBIA 5J41A 3D4TA 2VM1A 1K0AA 2PERA 1WIKA 5ELGA 6GSTA 1TDIA 9GSSA 1XW9A 3TKSA 1X0RA 3IV4A 4OCEA 1PKWA 1WPIA 5B8BA 1GRXA 3PINA 2LQQA 1MDJA 4ECCA 6GSXA 3QPMA 3U6VA 4TVEA 1Q4JA 5F8BA 4X43A 3EWLA 5F07A 4KB3A 1TRSA 4TOPA 1PGTA 4KE3A 1UN2A 2LQOA 4HI7A 2N5BA 3QFAC 1GLQA 2H1BA 3D21A 1XVQA 2YJ7A 5ENUA 3L0HA 2V1MA 5E4WA 4WEYA 3CSHA 3VWUA 2HZFA 2XPEA 2PMTA 3QDNA 2FA4A 2B7KA 1GSUA 4FO5A 2GQLA 4TR1B 5ABRA 4Q5FA 1EGRA 1H4OA 1JHBA 2G0FA 2H75A 3TRPA 4GSTA 2MBSA 5DCHA 3TJBA 4XTSA 5JWRB 1JFUA 1V2AA 3E9JB 3D0ZA 1F37A 2B1LA 4FYBA 5H5SA 3G7JA 4MJAA 1OYJA 20GSA 4K7IA 5HQPA 3Q74A 1R4WA 3GKNA 3TJFA 3GA4A 3HHVA 2VCZA 5DAKA 3M9JA 4ILFA 5IQYA 4OD7A 4MLYA 4JEDA 5DALA 2LKUA 4KDYA 2AV4A 1TKDB 2VCXA 2WZ9A 3HZ4A 4KDXA 1G6WA 3LEFA 4TXVA 3SWLA 3IOSA 4XIHA 2OE3A 3F3QA 2EIOA 3PGTA 2FWEA 2WFCA 2MMNA 3CMIA 2H71A 3J7Yb 2H1GA 2R3XA 3L9VA 3C1RA 4MA9A 3KD0A 5COHA 4MF6A 4NMUA 4F82A 3NIVA 2HRFA 5J5NA 3QMXA 4EXJA 1NHYA 1YZXA 2B3SA 2YP6A 3DGQA 4I2TA 2H72A 3BOAA 4BWQA 2JZSA 3KJYA 5IMVA 4CW9A 3CBUA 5CREA 5F06A 2YWMA 3GNJA 2H1AA 5G1LA 3L9SA 4L0WA 2CA8A 5H5QA 3LYKA 2NTOA 4QL9A 1V40A 3KGKA 2L6DA 1ABAA 2RM5A 2C80A 1V9WA 1WE0A 5A4UA 2YJHA 1GTAA 1O7UA 4EDYA 4OFMA 2TIRA 3TJKA 1VF3A 1BX9A 3TUEA 3VI5A 2F9SA 2IMIA 1K3LA 5G30A 1EZKA 6GSWA 2VL2A 3UIWA 3GSTA 3WGEA 3FZAA 4ZB6A 5ID2B 2IPAA 1W4VA 4ECBA 18GSA 2V2GA 2N5AA 4EKZA 2O85A 1K3YA 1VGLA 4MPGA 2C3NA 1XWKA 2M80A 4Q5QA 3HKRA 4GSSA 3D5JA 3Q18A 1GSSA 2KP1A 5C04A 4MH2A 1I5GA 3FR3A 3IR4A 2V6KA 3CYNA 2H6ZA 3I9V2 3WD6A 4HQSA 5D73A 1AC1A 3H8QA 2LNTA 3TGZA 2VCTA 1M2AA 1K0MA 2P0GA 2PN8A 1MEKA 2IMKA 3LQ7A 1ILOA 3QAWA 3K8NA 2WGRA 5DVBA 3CTFA 1T3BA 1OE8A 2WB9A 2R4VA 2K6VA 4MDCA 2P31A 4NXIA 2H66A 3GTUB 2GZPA 1R26A 4MP4A 4K7OA 3KMNA 3APOA 2NDOA 2OADA 4KA0A 2GZZA 1XVWA 5GAND 1GWCA 4I8BA 5AIVA 4HEA2 4JR4A 4EE0A 2DJ2A 1ERTA 3TKSE 4POBA 4DEJA 5IM9A 1E2YA 5DQSA 3A2XA 4HU9A 2OACA 2XPDA 2NVLA 1W89A 3RPNA 1PRXA 2B5YA 2VOCA 3KEBA 3ZITA 2KOKA 2H76A 1B4QA 5ECQB 1HNBA 3WYWA 1OKDA 3LSZA 4KCEA 3GHAA 3DXBA 2MMAA 4BVXA 3DEXA 2RIIA 3LJRA 1YF0A 1NW2A 3NOFA 2PUKC 1J08A 5DJLA 3DKSA 4FH8A 1VRSD 3TCOA 1XOAA 2H19A 3IK9A 2FWFA 3GH6A 2CV4A 3F8UA 4TR1A 4POMA 4N10A 4J57E 2JL4A 3ZYWA 3FR6A 4TKYA 1XW6A 3A2WA 4PQHA 3A2VA 1SKWB 1WRYA 2Z9SA 3H4KA 1BQ7A 4DSSB 2OA7A 1AIUA 2A4VA 2QC7A 3KXOA 4IP1A 5CO3A 1V58A 3IAM2 1Z3EA 4K8MA 2HLSA 3I6AA 2RUEA 1JLWA 1M7TA 4RI7A 2LRCA 3DWVA 1A0RP 2LRTA 2H8LA 5HFGA 2GDRA 1BEDA 1DE2A 2F3MA 3P7XA 1Z6MA 1WJKA 1JZOA 2O89A 2D2ZA 2YZHA 1SL2B 2ES7A 2GSQA 3MDKA 3F9UA 3M0FA 4N30A 1FW1A 3CRUA 5C00A 1VF4A 1R7HA 1HD2A 1A2JA 4CHSA 1X5EA 1TJDA 5A4WA 1SJZA 5KN0A 3EYTA 5ELAA 1ZYQB 4YH2A 2PWJA 1O73A 1M9BA 3G9BA 6GSVA 2DJ3A 4GQFA 1HNCA 2H30A 4PQ1A 3HXSA 3GFKA 4OO5A 2OBKA 3P2AA 1EP7A 4KAEA 2XBQA 4O32A 2KUCA 5IMZA 2VCWA 1LBKA 4DSQA 1QGVA 3VPTA 1SENA 3UJ1A 5D9XA 3S9FA 4K0GA 2I9HA 4NAXA 3US3A 1FG4A 1B9XC 4XS4B 2CVKA 4XRDA 3HZ8A 3IE3A 1ACVA 2YOIA 4MABA 1SD9A 1WP0A 2V6OA 1U3AA 5D9VA 2EIRA 3ERGA 2H1DA 2XC2A 1AW9A 1GUKA 2IMFA 4LL1B 2OE0A 3UBKA 1GSDA 3ZREA 5JCGA 1HYUA 5J9BA 5KN2A 1SKRB 1K0CA 2R5GA 2CX4A 4YQUA 2FCHA 5IO2A 1F9MA 4F2IA 1F2EA 6GSSA 4JBBA 2CX3A 2MMOA 1ZGNA 1PSQA 4TXOB 1O8XA 1XWGA 4GSNA 2L5OA 1M2BA 4OWYA 5ID2A 3A5WA 4NWYA 4PQIA 5CRWA 3R2QA 5HR1A 4ZB8A 3LORA 1YY7A 2LS5A 1K0DA 3ERFA 2HSYA 2FNOA 3QCPA 4O5RA 1CQGA 3BCIA 4KSMA 3ZIVA 1USBA 2LJAA 3QAVA 5IPGA 2C0FA 2F51A 4G19A 3VK9A 4I6XA 2GSRA 5B6MA 2VIMA 4KH7A 4GWRA 5EPFA 5E59A 1IYHA 3HCZA 2CZ3A 1XIYA 1JLVA 3DIEA 1QK8A 5FT3A 4E8HA 1TK0B 4IQAA 1ST9A 3M8NA 1TK8B 1ZYEA 4KGIA 1PKZA 4H86A 2H6YA 3FZ5A 1YQ1A 2YZUA 3RAZA 1Z7RA 3HA9A 8GSSA 2YWIA 1VF1A 2LRNA 3GL3A 2REMA 1GP1A 1THXA 3ZIJA 3KMOA 3DVXA 4ML1A 19GSA 2LSTA 4TR0A 2ALBA 1U87A 4HDEA 2HZEA 1O85A 1U6TA 2XHFA 1YF1A 3Q19A 2HE3A 5AISA 5IMFA 1B8XA 2LNSA 5ECLB 2JU5A 1Z9HA 1AUCA 3HVSA 1A8LA 1PL1A 5IMCA 1A23A 1FHEA 2H73A 2I4AA 4MK3A 2IFQB 3H93A 4ZXGA 1GNWA 1O8WA 2HYXA 1EP8A 2PBJA 3IC4A 3GIXA 2LUSA 2DJJA 1FB6A 4IBPA 3EE2A 1J9BA 1FO5A 5IIZA 4MJEA 1GTIA 1K3OA 4ULXA 2FA8A 4POKA 1A0FA 2JSYA 1C72A 2V32A 4IGJA 1QMVA 3EVIA 2P5QA 1SU9A 4N11A 5CRHA 3UBLA 2VUPA 1AQWA 3QAGA 4CDOA 3TKRA 4DSSA 1M2DA 2ON7A 1EV4A 4NV2A 3LGCA 4KW6A 1EV9A 3LG6A 2VO4A 2YWOA 3VWXA 1XOBA 4BA7A 1ZCPA 4IVFA 3H1NA 1TW9A 3QFBC 4LL4B 1ERWA 1MDIA 4J2FA 3DYRA 3IK7A 1MDKA 1SK0A 3ZMLA 3M9KA 1GNEA 4IELA 13GSA 22GSA 3VWVA 3EU4A 5ECRB 4FYUA 3FKFA 1V57A 3HVXA 1TK5B 4AJ8A 4K1FA 1HQOA 5IO0A 4WKWA 1CQHA 2X64A 3KP8A 3TRXA 4L5OA 1PX7A 1NHOA 4KUNA 3HY2A 1OC3A 2C0EA 2H70A 2WULA 4Z7XA 3KM6A 4JRRA 1SK2A 1TP9A 2YNXA 4GCIA 3TOUA 1N8JA 4IJ3A 3F63A 4ZBBA 3PH9A 1SL1B 4V2MA 4WETA 1X5DA 4V1Ag 3L4NA 4KCAA 5DDLA 5GSTA 3ISOA 3F4TA 1TTZA 1EEMA 1T00A 4E8EA 2NPBA 2C1YA 4ZILA 1BAYA 1SL0B 2MYGA 4RI6A 4DSRA 2K8SA 1OKTA 5INYA 4ISDA 4BPYA 5CYYA 4ECIA 5HR3A 4XS4A 5IMAA 4JE1A 5L71A 3IRAA 5D9WA 2IL3A 4PNFA 3MNGA 4YQVA 3GX8A 2DMMA 3F6DA 1OC9A 2H0HA 3P8WA 3CSIA 4ID0A 2C8UA 4EDZA 4EVMA 2F8FA 3ZLPA 2YPMA 1YKCA 4TW5A 2VL3A 2B6MA 1TI3A 3IHQA 4OO4A 3PR8A 1KEBA 1T1VA 2M46A 1S3CA 4TXOA 3C8EA 4PX1A 4LMVA 5ECPB 4YQMA 3GKMA 3TJJA 1A8YA 2WCIA 1DBYA 1F6MC 2GGTA 3GN3A 2FGXA 4LMWA 3M3MA 3VWWA 4HZ4A 4AJ6A 3ZZXA 2K18A 3LFLA 2HI7A 1XXUA 1MTCA 1YEXA 7GSSA 2C3QA 2WRTA 3WT1A 3CSJA 2HFDA 2OJLA 1WMJA 2O87A 1A2MA 4N0ZA 2CAIA 4DVCA 2RUFA 4RUVA 2GSSA 4GLTA 4WF4A 5GZZB 3ZTLA 2I3YA 4POLA 3E3EA 2PU9C 2PVOC 3I69A 3FK8A 4MCUA 4OFTA 5DQYA 4NHWA 3DVWA 2LJKA 4IJIA 1RQMA 5IPHA 1M99A 2DJKA 2GVPA 5B8AA 1VF2A 3OR5A 3HYPA 4IN0A 4IS0A 3KIJA 1ERUA 5CNWA 2HNLA 4BWSA 1XCCA 4ZL8A 3DD3A 4OMVA 2ZUPA 4I2UA 1GSYA
chains in the Genus database with same CATH superfamily
5ECHB 3UMAA 3ME7A 4L8EA 6GSUA 2BMXA 1PN9A 2FHEA 2YN1A 4ZBDA 4L5LA 3UOMA 4G9HA 2K9FA 5G1KA 1LU4A 2AB6A 1S3RA 4HJMA 4F03A 1WWJA 1B4PA 1K0NA 3ME8A 1GUHA 3CRTA 2AYTA 4V2NA 1TU7A 4AJ7A 4WXTA 1A2LA 2ON5A 3DMLA 3AY8A 4MZCA 2K8VA 2GQMA 6GSYA 1G7EA 2FWGA 3CXGA 2H74A 3ZMKA 2DBCA 2PVQA 3HD5A 1U88A 3GRXA 1RK4A 2A4HA 3TKQA 5D96A 3HJPA 1FOVA 2KHPA 1ZL9A 4Q5RA 5ECNB 1GTUA 1PN0A 5AN1A 5FWGA 3KP9A 3GL5A 4YAPA 3FZ9A 1UVZA 5G2ZA 5AIXA 5A4VA 3F6FA 2WS2A 2VAFA 1PA3A 3IDVA 2M72A 1SJIA 2AAWA 5EVOA 3F4RA 4AF2A 4TN8A 4MZBA 2EIQA 3KH9A 1PX6A 1M9AA 2LJRA 1Z6NA 2IWTA 2KLXA 5FHIA 5KEJA 5IMDA 5GAPD 3VI7A 1UA5A 4X0XA 1XWBA 1XWAA 5JCWA 3D4MA 4EC0A 4EL1A 2DJ1A 4FIWA 5JWOB 4KNDA 2X49A 2JACA 4PUFC 1KBNA 2E0QA 1MD4A 5J4UA 4BL7B 2L59A 4O7HA 3UVTA 3IC8A 4HQZA 4IW9A 1KTEA 4KDUA 3G7IA 1OE7A 3D6IA 3P90A 1TOFA 4ZBAA 1J0FA 3E0UA 4TR3A 2BTOT 4ICYA 4XCSA 3WT2A 3MIXA 1V98A 2GZYA 4WR5A 5CRGA 3CQFA 2CVBA 3HJMA 1XW5A 2VM2A 3UARA 3A5IA 2CAQA 2PPTA 3EU3A 2YCDA 3LYPA 2GLRA 1EOHA 2L4CA 1MD3A 3UL3A 2I81A 3C7MA 5G5FA 3APSA 2FLSA 5DJMA 5EL8A 4BVYA 5ECSA 2LV3A 4D73B 1XWCA 3W6GA 3KZQA 2GS3A 2JZRA 3N5OA 1RW1A 1QXHA 3Q6OA 4X1UA 2IN3A 1X9WB 1OC8A 2O7KA 5KN1A 1X5CA 2C0DA 1M0UA 4KSOA 4NV5A 1LJRA 1YEPA 3A3TA 4PNGA 3GX0A 4LA1A 5KN3A 5ECOB 3IAS2 1WOUA 4J56E 3KTBA 2JSZA 4JR6A 5AGYA 5F05A 3GTUA 2HXKA 1GL8A 1TI1A 1GH2A 2YV7A 1TXXA 2RLIA 1AQXA 1I9DA 1TRUA 4G0LA 3MAKA 4F0CA 2OKAA 1A24A 3EMXA 3LXTA 1FB0A 2OBIA 2HT9A 3QD9A 3V1WA 2KP2A 4WBJA 2MMZA 1B48A 4GXZA 2TRXA 3KH7A 2N5FA 3M1GA 5D93A 3BBYA 1QUWA 4GTUA 3MSZA 3TKPA 3APQA 5LCZA 5J3RA 3GV1A 3BCKA 3GKKA 4N0VA 1NM3A 1TRVA 2FUG2 1QFNA 3RDWA 5B7CA 1XFLA 3C1SA 1FAAA 1XBSA 4WBRD 2ZNMA 2G2QA 2B5EA 3RHBA 2L57A 3TJGA 2A2PA 2A2RA 1FVKA 3ERWA 4EIQA 1DE1A 1XPVA 4I97A 4MPFA 4WR4A 4CY6A 2R2JA 3FR9A 17GSA 3SBCA 3D22A 2EC4A 2QGVA 1AQVA 2J23A 3EPTA 2V41A 3ZVJA 3HDCA 5D9TA 2H0IA 4MF5A 5G5EA 3I43A 5ECIB 3TB2A 4PUAA 2VLVA 3GURA 2VCQA 4XHMA 3EMPA 5IOXA 3RPPA 5CAXA 3F3RA 4ZL9A 4HS1A 3VFIA 2IMEA 4F9ZA 2P5RA 3W8SA 2AJQB 3EURA 2FY6A 2VLTA 2X8GA 1GUMA 4K2DA 4EIPA 2R6KA 3ZVJD 1AAZA 3EINA 1URMA 4IQ1A 1ZYNA 4OCFA 2L6CA 3C73A 3GUSA 4K5SA 3EC3A 2B7JA 1EGOA 4ACSA 5HR0A 3NZNA 3F0IA 4I5QA 4NHZA 2GTUA 2A2SA 4GRFA 2MBTA 3TRQA 3VURA 2ZCTA 1GTBA 3BD2A 2H6XA 2QKEA 1BJXA 1G0TA 4MJCA 1EWXA 1GLPA 1O6JA 1SK1A 3ZRDA 1R5PA 2LEGA 5JCUA 2I1UA 3DRNA 4BIKA 4XS1A 2C4JA 4L0UA 1G7OA 4HZ2A 4ECJA 1PD21 5H5RA 2WDUA 2F8AA 4GQCA 3LW9A 1JZRA 3FEUA 1FVJA 1Z5YE 2CQ9A 2DKIA 3VPQA 1K0OA 4OFNA 2VCVA 1ZOFA 2O8VB 12GSA 4K9ZA 2DJ0A 2QA1A 4PXOA 1B9YC 2E7PA 2WJUA 4KX4A 4G10A 3UEMA 1YDKA 3TKSC 3GYKA 5GSSA 4MMMA 4PGTA 5F0GA 1KNGA 1BG5A 3WGXA 5DCGA 2BJXA 3N9JA 2NBSA 4FYCA 3LWAA 3FY7A 3O6TA 2VLUA 1X9SB 2YANA 1Z7PA 5BRTA 2C0GA 3J7Yk 1XG8A 3ZFBA 1ML6A 2IMDA 3UAPA 5G31A 3FHKA 2DSAA 3FRCA 3QOUA 5HFIA 4BL7A 3O3TA 1K0BA 4HSCX 1HNAA 2AHEA 2R37A 5B6NA 1GULA 1G6YA 3GH9A 1YJ6A 1TU8A 3L78A 2X8CA 1BYEA 3LXZA 4QL7A 4Q5NA 3ED3A 4K0NA 5DAKB 2RM6A 1QQ2A 3IBHA 5ECKB 3G7YA 4LLRA 4G2EA 1SD8A 2OE1A 5DALB 3WGDA 3FYGA 2DIZA 4ZB9A 2HZEB 1GSEA 2DIYA 1F3AA 4HUAA 1T7PB 4HOJA 1PMTA 5J9CA 2AUVA 2JZTA 3IPZA 2HSHA 3TDGA 1IYIA 2B1KA 1XZOA 1TRWA 2TRCP 3FMWA 3IA1A 4D73A 1O81A 1JZWA 2HRNA 3O76A 4MF7A 2GSTA 3KTLA 4Z2RA 2H0GA 2R0PA 1X9MB 2IJYA 4JZQA 5ECMB 2CT6A 4ZL7A 2E2MA 2VD1A 2FWHA 5CP1A 4WF5A 3JCML 2DLXA 1ON4A 3BJ5A 3VLNA 4MJBA 2C3TA 3GKXA 5D8IA 1U3IA 5HR2A 4V2LA 2YWNA 5A5KA 1NSWA 5DBQA 2IIYA 3L9UA 2DC5A 1OAZA 1SJ6A 4AGSA 1T4YA 1OVNA 1ZMAA 3W8JA 11GSA 2L4QA 4XS6A 2GQKA 4ML6A 1GSQA 2E2GA 3HVVA 1H75A 4TRXA 3KCMA 4RQXA 1JZDA 2B5XA 4YAVA 2X99A 1S3DA 1ERVA 3UVHA 4MH3A 3CTGA 2JADA 4HJ2A 16GSA 2MZCA 2QSIA 5IOWA 4IP6A 1R5AA 1ZZYA 4JU5A 10GSA 2DMLA 3U5RE 3HJOA 1SKSB 4IKHA 2L5LA 3F4SA 3GMFA 4GF0A 5JWQB 1PQNA 5CRDA 4ZIJA 2CVDA 1DUGA 2IFQA 2YV9A 1EOGA 4EO3A 2LTKA 2CZ2A 4RQRA 1M3JA 4TR4A 1PL2A 4HU7A 4P3YB 3GSSA 4K6XA 3FW2A 1YKAA 3MWHA 2FD3A 5LNKe 4G0KA 4MZWA 2GT6A 1EEJA 2VL9A 4PURA 2VD0A 2X8HA 3RHCA 1Y25A 4EF0A 2UZ8A 1Y6EA 4XRAA 2GT5A 3ZFLA 1T8EB 1DSBA 1SYXA 1T4ZA 4O92A 14GSA 5LD0A 3H79A 3IXRA 4QQ7A 1GSFA 2R0GA 5HFKA 3QR6A 1S3AA 2PGTA 2J9HA 2VL2C 4EUYA 1F3BA 1AXDA 1SYRA 1THOA 4PTSA 4F0BA 4K7NA 4V1Ap 1E6BA 3RBTA 3C71A 4NPBA 1UC7A 1N2AA 1Q98A 2H01A 3FZ4A 3ZL5A 4IHUA 1OC9B 3TOTA 5EY6A 2XBIA 5J41A 4YKFA 3D4TA 2VM1A 1K0AA 2PERA 1WIKA 5ELGA 6GSTA 1TDIA 9GSSA 1XW9A 3TKSA 1X0RA 3IV4A 4OCEA 1PKWA 1WPIA 5B8BA 1GRXA 3PINA 2LQQA 1MDJA 4ECCA 4X4JA 6GSXA 3QPMA 3U6VA 4TVEA 1Q4JA 5F8BA 4X43A 3EWLA 5F07A 4KB3A 1TRSA 4TOPA 1PGTA 4KE3A 1UN2A 2LQOA 4HI7A 2N5BA 3QFAC 1GLQA 4MNNA 2H1BA 3D21A 4BVXB 1XVQA 2YJ7A 5ENUA 3L0HA 2V1MA 5E4WA 4WEYA 3CSHA 3VWUA 2HZFA 2XPEA 2PMTA 3QDNA 2FA4A 2B7KA 1GSUA 4FO5A 2GQLA 4TR1B 5ABRA 4Q5FA 1EGRA 1H4OA 1JHBA 2G0FA 2H75A 3TRPA 4GSTA 2MBSA 5DCHA 3TJBA 4XTSA 5JWRB 1JFUA 3MYDA 1V2AA 3E9JB 3D0ZA 1F37A 2B1LA 4FYBA 5H5SA 3G7JA 4MJAA 1OYJA 20GSA 3R3EA 4K7IA 5HQPA 3Q74A 1R4WA 3GKNA 3TJFA 3GA4A 3HHVA 2VCZA 5DAKA 3M9JA 4ILFA 5IQYA 4OD7A 4MLYA 4JEDA 5DALA 2LKUA 4KDYA 2AV4A 1TKDB 2VCXA 2WZ9A 3HZ4A 4KDXA 1G6WA 3LEFA 4TXVA 3SWLA 3IOSA 4XIHA 2OE3A 3F3QA 2EIOA 3PGTA 1M3IA 2FWEA 2WFCA 2MMNA 3CMIA 2H71A 3J7Yb 2H1GA 2R3XA 3L9VA 3C1RA 4MA9A 3KD0A 5COHA 4MF6A 4NMUA 4F82A 3NIVA 2HRFA 4FQUA 5J5NA 3QMXA 4EXJA 1NHYA 1YZXA 2B3SA 2YP6A 3DGQA 4I2TA 2H72A 2DKHA 3BOAA 4Z2UA 4BWQA 2JZSA 3KJYA 5IMVA 4CW9A 3CBUA 4K2XA 5CREA 5F06A 2YWMA 3GNJA 2H1AA 5G1LA 3L9SA 4L0WA 2CA8A 5H5QA 3LYKA 2NTOA 4QL9A 1V40A 3KGKA 2L6DA 1ABAA 2RM5A 2C80A 1V9WA 1WE0A 4O5UA 5A4UA 2YJHA 1GTAA 1O7UA 4EDYA 4OFMA 2TIRA 3TJKA 1VF3A 1BX9A 3TUEA 3VI5A 2F9SA 2IMIA 1K3LA 5G30A 1EZKA 6GSWA 2VL2A 3UIWA 3GSTA 3WGEA 3FZAA 4ZB6A 5ID2B 2IPAA 1W4VA 4ECBA 18GSA 2V2GA 2N5AA 2X4AA 4EKZA 2O85A 1K3YA 1VGLA 4MPGA 2C3NA 1XWKA 2M80A 4Q5QA 3HKRA 4GSSA 3D5JA 3Q18A 1GSSA 2KP1A 5C04A 4MH2A 1I5GA 3FR3A 3IR4A 2V6KA 3CYNA 2H6ZA 3I9V2 3WD6A 4HQSA 5D73A 1AC1A 4BVYB 3H8QA 2LNTA 3TGZA 2VCTA 1M2AA 4Z2TA 1K0MA 2HRAA 2P0GA 2PN8A 1MEKA 2IMKA 3LQ7A 1ILOA 3QAWA 3K8NA 2WGRA 5DVBA 3CTFA 1T3BA 1OE8A 2WB9A 2R4VA 2K6VA 4MDCA 2P31A 4NXIA 2H66A 3GTUB 2GZPA 1R26A 4MP4A 4K7OA 3KMNA 3APOA 2NDOA 2OADA 4KA0A 2GZZA 1XVWA 5GAND 1GWCA 4G0IA 4I8BA 5AIVA 4HEA2 4JR4A 4EE0A 2DJ2A 1ERTA 1FOHA 3TKSE 4POBA 4DEJA 5IM9A 1E2YA 5DQSA 3A2XA 4HU9A 2OACA 2XPDA 2NVLA 1W89A 3RPNA 1PRXA 2B5YA 2VOCA 3KEBA 3ZITA 2KOKA 2H76A 1B4QA 5ECQB 1HNBA 3WYWA 1OKDA 3LSZA 4KCEA 3GHAA 3DXBA 2MMAA 4BVXA 3DEXA 2RIIA 3LJRA 1YF0A 1NW2A 3NOFA 2PUKC 1J08A 5DJLA 3DKSA 4FH8A 1VRSD 3TCOA 1XOAA 2H19A 3IK9A 2FWFA 3GH6A 2CV4A 3F8UA 4TR1A 4POMA 4N10A 4J57E 2JL4A 3ZYWA 3FR6A 4TKYA 1XW6A 3A2WA 4PQHA 3A2VA 1SKWB 1WRYA 2Z9SA 3H4KA 1BQ7A 4DSSB 2OA7A 1AIUA 2A4VA 2QC7A 3KXOA 4IP1A 5CO3A 1V58A 4KF9A 3IAM2 1Z3EA 4K8MA 2HLSA 3I6AA 2RUEA 1JLWA 1M7TA 4RI7A 2LRCA 3DWVA 1A0RP 2LRTA 2H8LA 5HFGA 2GDRA 1BEDA 1DE2A 2F3MA 3P7XA 1Z6MA 1WJKA 1JZOA 2O89A 2D2ZA 2YZHA 1SL2B 2ES7A 2GSQA 3MDKA 3F9UA 4O5QA 3M0FA 4N30A 1FW1A 5KOWA 3CRUA 5C00A 1VF4A 1R7HA 1HD2A 1A2JA 4CHSA 1X5EA 1TJDA 5A4WA 1SJZA 5KN0A 3EYTA 5ELAA 1ZYQB 4YH2A 2PWJA 1O73A 1M9BA 3G9BA 6GSVA 2DJ3A 4GQFA 1HNCA 2H30A 4PQ1A 3HXSA 3GFKA 4OO5A 2OBKA 3P2AA 1EP7A 4KAEA 2XBQA 4O32A 2KUCA 5IMZA 2VCWA 1ZYPA 1LBKA 4DSQA 1QGVA 3VPTA 1SENA 3UJ1A 5D9XA 3S9FA 4K0GA 2I9HA 4NAXA 3US3A 1FG4A 1B9XC 4XS4B 2CVKA 4XRDA 3HZ8A 3IE3A 1ACVA 2YOIA 4MABA 1SD9A 1WP0A 2V6OA 1U3AA 5D9VA 2EIRA 3ERGA 2H1DA 2XC2A 1AW9A 1GUKA 2IMFA 4LL1B 2OE0A 3UBKA 1GSDA 3ZREA 4A5PA 5JCGA 1HYUA 5J9BA 5KN2A 1SKRB 1K0CA 2R5GA 2CX4A 4YQUA 2FCHA 5IO2A 1F9MA 4F2IA 1F2EA 6GSSA 4JBBA 2CX3A 2MMOA 1ZGNA 1PSQA 4TXOB 1O8XA 1XWGA 4GSNA 2L5OA 1M2BA 4OWYA 5ID2A 3A5WA 4NWYA 4PQIA 5CRWA 3R2QA 5HR1A 3PPUA 4ZB8A 3LORA 1YY7A 2LS5A 1K0DA 3ERFA 2HSYA 2FNOA 3QCPA 4O5RA 1CQGA 3BCIA 2R0CA 4KSMA 3ZIVA 1USBA 2LJAA 3QAVA 5IPGA 2C0FA 2F51A 4G19A 3VK9A 4I6XA 2GSRA 5B6MA 2VIMA 4KH7A 4GWRA 5EPFA 5E59A 1IYHA 3HCZA 2CZ3A 1XIYA 1JLVA 3DIEA 1QK8A 5FT3A 4E8HA 1TK0B 4IQAA 1ST9A 3M8NA 1TK8B 1ZYEA 4KGIA 1PKZA 4H86A 2H6YA 3FZ5A 1YQ1A 2YZUA 3RAZA 1Z7RA 3HA9A 8GSSA 2YWIA 5KOXA 1VF1A 2LRNA 3GL3A 2REMA 1GP1A 1THXA 3ZIJA 3KMOA 3DVXA 4ML1A 19GSA 2LSTA 4TR0A 2ALBA 1U87A 4HDEA 2HZEA 1O85A 1U6TA 2XHFA 1YF1A 3Q19A 2HE3A 5AISA 5IMFA 1B8XA 2LNSA 5ECLB 2JU5A 1Z9HA 3IHGA 1AUCA 3HVSA 1A8LA 1PL1A 1PFOA 5IMCA 1A23A 1FHEA 2H73A 2I4AA 4MK3A 2IFQB 3H93A 4ZXGA 1GNWA 1O8WA 2HYXA 1EP8A 2PBJA 3IC4A 3GIXA 2LUSA 2DJJA 1FB6A 4IBPA 3EE2A 1J9BA 1FO5A 5IIZA 4MJEA 1GTIA 1K3OA 4ULXA 2FA8A 4POKA 1A0FA 2JSYA 1C72A 2V32A 4IGJA 1QMVA 3EVIA 4USSA 2P5QA 1SU9A 4N11A 5CRHA 3UBLA 2VUPA 4K5RA 1AQWA 3QAGA 4CDOA 3TKRA 4DSSA 1M2DA 2ON7A 1EV4A 4NV2A 3LGCA 4KW6A 1EV9A 3LG6A 2VO4A 2YWOA 3VWXA 1XOBA 4BA7A 1ZCPA 4IVFA 3H1NA 1TW9A 3QFBC 4LL4B 1ERWA 1MDIA 4J2FA 3DYRA 3IK7A 1MDKA 1SK0A 3ZMLA 3M9KA 1GNEA 4IELA 13GSA 22GSA 3VWVA 3EU4A 5ECRB 4FYUA 3FKFA 1V57A 3HVXA 1TK5B 4AJ8A 4K1FA 1HQOA 5BMUA 5IO0A 2HRKA 4WKWA 1CQHA 2X64A 3KP8A 3TRXA 4L5OA 1PX7A 1NHOA 4KUNA 3HY2A 1OC3A 2C0EA 2H70A 2WULA 4Z7XA 3KM6A 4JRRA 1SK2A 1TP9A 2YNXA 4GCIA 3TOUA 1N8JA 4IJ3A 3F63A 4ZBBA 3PH9A 2HSMA 1SL1B 4V2MA 4WETA 1X5DA 4V1Ag 3L4NA 4KCAA 5DDLA 5GSTA 3ISOA 3F4TA 1TTZA 1EEMA 1T00A 4E8EA 2NPBA 2C1YA 4ZILA 1BAYA 1SL0B 2MYGA 4CY8A 4RI6A 4DSRA 2K8SA 1OKTA 5INYA 4ISDA 4BPYA 5CYYA 4ECIA 5HR3A 4XS4A 5IMAA 4JE1A 5L71A 3IRAA 5D9WA 2IL3A 4PNFA 3MNGA 4YQVA 3GX8A 2DMMA 3F6DA 1OC9A 2H0HA 3P8WA 3CSIA 4ID0A 2C8UA 4EDZA 4EVMA 2F8FA 2QA2A 3ZLPA 2YPMA 1YKCA 4TW5A 2VL3A 2B6MA 1TI3A 3IHQA 4OO4A 3PR8A 1KEBA 1T1VA 2M46A 1S3CA 4TXOA 3C8EA 4PX1A 4LMVA 5ECPB 4YQMA 3GKMA 3TJJA 1A8YA 2WCIA 1DBYA 1F6MC 2GGTA 3GN3A 2FGXA 4LMWA 3M3MA 3VWWA 4HZ4A 4AJ6A 3ZZXA 2K18A 3LFLA 2HI7A 1XXUA 1MTCA 1YEXA 7GSSA 2C3QA 2WRTA 3HVNA 3WT1A 3CSJA 2HFDA 2OJLA 1WMJA 2O87A 1A2MA 4N0ZA 2CAIA 4DVCA 2RUFA 4RUVA 2GSSA 4GLTA 4WF4A 5GZZB 3ZTLA 2I3YA 4POLA 3E3EA 2PU9C 2PVOC 3I69A 3FK8A 4MCUA 4OFTA 5DQYA 4NHWA 3DVWA 2LJKA 4IJIA 1RQMA 5IPHA 1M99A 2DJKA 2GVPA 5B8AA 1VF2A 3OR5A 4YKGA 3HYPA 4IN0A 4IS0A 3KIJA 1ERUA 5CNWA 2HNLA 4BWSA 1XCCA 4ZL8A 3DD3A 4OMVA 2ZUPA 4I2UA 1GSYA
chains in the Genus database with same CATH topology
5ECHB 3UMAA 3ME7A 4L8EA 6GSUA 2BMXA 1PN9A 2FHEA 2YN1A 4ZBDA 4L5LA 3UOMA 4G9HA 2K9FA 5G1KA 1LU4A 2AB6A 4HJMA 4F03A 1WWJA 1B4PA 1K0NA 3ME8A 1GUHA 3CRTA 2AYTA 4V2NA 1TU7A 4AJ7A 4WXTA 1A2LA 2ON5A 3DMLA 3AY8A 4MZCA 2K8VA 2GQMA 6GSYA 1G7EA 2FWGA 3CXGA 2H74A 3ZMKA 2DBCA 2PVQA 3HD5A 1U88A 3GRXA 1RK4A 2A4HA 3TKQA 5D96A 3HJPA 1FOVA 2KHPA 1ZL9A 4Q5RA 5ECNB 1GTUA 1PN0A 5AN1A 5FWGA 3KP9A 3GL5A 4YAPA 3FZ9A 1UVZA 5G2ZA 5AIXA 5A4VA 3F6FA 2WS2A 2VAFA 1PA3A 3IDVA 2M72A 1SJIA 2AAWA 5EVOA 3F4RA 4AF2A 4TN8A 4MZBA 2EIQA 3KH9A 1PX6A 1M9AA 2LJRA 1Z6NA 2IWTA 2KLXA 5FHIA 5KEJA 5IMDA 5GAPD 3VI7A 1UA5A 4X0XA 1XWBA 1XWAA 5JCWA 3D4MA 4EC0A 4EL1A 2DJ1A 4FIWA 5JWOB 4KNDA 2X49A 2JACA 4PUFC 1KBNA 2E0QA 1MD4A 5J4UA 4BL7B 2L59A 4O7HA 3UVTA 3IC8A 4HQZA 4IW9A 1KTEA 4KDUA 3G7IA 1OE7A 3D6IA 3P90A 1TOFA 4ZBAA 1J0FA 3E0UA 4TR3A 2BTOT 4ICYA 4XCSA 3WT2A 3MIXA 1V98A 2GZYA 4WR5A 5CRGA 2CVBA 3HJMA 1XW5A 2VM2A 3UARA 3A5IA 2CAQA 2PPTA 3EU3A 2YCDA 3LYPA 2GLRA 1EOHA 2L4CA 1MD3A 3UL3A 2I81A 3C7MA 5G5FA 3APSA 2FLSA 5DJMA 5EL8A 4BVYA 5ECSA 2LV3A 4D73B 1XWCA 3W6GA 3KZQA 2GS3A 2JZRA 3N5OA 1RW1A 1QXHA 3Q6OA 4X1UA 2IN3A 1X9WB 1OC8A 2O7KA 5KN1A 1X5CA 2C0DA 1M0UA 4KSOA 4NV5A 1LJRA 1YEPA 3A3TA 4PNGA 3GX0A 4LA1A 5KN3A 5ECOB 3IAS2 1WOUA 4J56E 3KTBA 2JSZA 4JR6A 5AGYA 5F05A 3GTUA 2HXKA 1GL8A 1TI1A 1GH2A 2YV7A 1TXXA 2RLIA 1AQXA 1I9DA 1TRUA 4G0LA 3MAKA 4F0CA 2OKAA 1A24A 3EMXA 3LXTA 1FB0A 2OBIA 2HT9A 3QD9A 3V1WA 2KP2A 4WBJA 2MMZA 1B48A 4GXZA 2TRXA 3KH7A 2N5FA 3M1GA 5D93A 3BBYA 1QUWA 4GTUA 3MSZA 3TKPA 3APQA 5LCZA 5J3RA 3GV1A 3BCKA 3GKKA 4N0VA 1NM3A 1TRVA 2FUG2 1QFNA 3RDWA 5B7CA 1XFLA 3C1SA 1FAAA 1XBSA 4WBRD 2ZNMA 2G2QA 2B5EA 3RHBA 2L57A 3TJGA 2A2PA 2A2RA 1FVKA 3ERWA 4EIQA 1DE1A 1XPVA 4I97A 4MPFA 4WR4A 4CY6A 2R2JA 3FR9A 17GSA 3SBCA 3D22A 2EC4A 2QGVA 1AQVA 2J23A 3EPTA 2V41A 3ZVJA 3HDCA 5D9TA 2H0IA 4MF5A 5G5EA 3I43A 5ECIB 3TB2A 4PUAA 2VLVA 3GURA 2VCQA 4XHMA 3EMPA 5IOXA 3RPPA 5CAXA 3F3RA 4ZL9A 4HS1A 3VFIA 2IMEA 4F9ZA 2P5RA 3W8SA 2AJQB 3EURA 2FY6A 2VLTA 2X8GA 1GUMA 4K2DA 4EIPA 2R6KA 3ZVJD 1AAZA 3EINA 1URMA 4IQ1A 1ZYNA 4OCFA 2L6CA 3C73A 3GUSA 4K5SA 3EC3A 2B7JA 1EGOA 4ACSA 5HR0A 3NZNA 3F0IA 4I5QA 4NHZA 2GTUA 2A2SA 4GRFA 2MBTA 3TRQA 3VURA 2ZCTA 1GTBA 3BD2A 2H6XA 2QKEA 1BJXA 1G0TA 4MJCA 1EWXA 1GLPA 1O6JA 1SK1A 3ZRDA 1R5PA 2LEGA 5JCUA 2I1UA 3DRNA 4XS1A 2C4JA 4L0UA 1G7OA 4HZ2A 4ECJA 1PD21 5H5RA 2WDUA 2F8AA 4GQCA 3LW9A 1JZRA 3FEUA 1FVJA 1Z5YE 2CQ9A 2DKIA 3VPQA 1K0OA 4OFNA 2VCVA 1ZOFA 2O8VB 12GSA 4K9ZA 2DJ0A 2QA1A 4PXOA 1B9YC 2E7PA 2WJUA 4KX4A 4G10A 3UEMA 1YDKA 3TKSC 3GYKA 5GSSA 4MMMA 4PGTA 5F0GA 1KNGA 1BG5A 3WGXA 5DCGA 2BJXA 3N9JA 2NBSA 4FYCA 3LWAA 3FY7A 3O6TA 2VLUA 1X9SB 2YANA 1Z7PA 5BRTA 2C0GA 3J7Yk 3ZFBA 1ML6A 2IMDA 3UAPA 5G31A 3FHKA 2DSAA 3FRCA 3QOUA 5HFIA 4BL7A 3O3TA 1K0BA 1HNAA 2AHEA 2R37A 5B6NA 1GULA 1G6YA 3GH9A 1YJ6A 1TU8A 3L78A 2X8CA 1BYEA 3LXZA 4QL7A 4Q5NA 3ED3A 4K0NA 5DAKB 2RM6A 1QQ2A 3IBHA 5ECKB 3G7YA 4LLRA 4G2EA 1SD8A 2OE1A 5DALB 3WGDA 3FYGA 2DIZA 4ZB9A 2HZEB 1GSEA 2DIYA 1F3AA 4HUAA 1T7PB 4HOJA 1PMTA 5J9CA 2AUVA 2JZTA 3IPZA 2HSHA 3TDGA 1IYIA 2B1KA 1XZOA 1TRWA 2TRCP 3FMWA 3IA1A 4D73A 1O81A 1JZWA 2HRNA 3O76A 4MF7A 2GSTA 3KTLA 4Z2RA 2H0GA 2R0PA 1X9MB 2IJYA 4JZQA 5ECMB 2CT6A 4ZL7A 2E2MA 2VD1A 2FWHA 5CP1A 4WF5A 3JCML 2DLXA 1ON4A 3BJ5A 3VLNA 4MJBA 2C3TA 3GKXA 5D8IA 1U3IA 5HR2A 4V2LA 2YWNA 5A5KA 1NSWA 5DBQA 2IIYA 3L9UA 2DC5A 1OAZA 1SJ6A 4AGSA 1T4YA 1OVNA 1ZMAA 3W8JA 11GSA 2L4QA 4XS6A 2GQKA 4ML6A 1GSQA 2E2GA 3HVVA 1H75A 4TRXA 3KCMA 4RQXA 1JZDA 2B5XA 4YAVA 2X99A 1S3DA 1ERVA 3UVHA 4MH3A 3CTGA 2JADA 4HJ2A 16GSA 2MZCA 2QSIA 5IOWA 4IP6A 1R5AA 1ZZYA 4JU5A 10GSA 2DMLA 3U5RE 3HJOA 1SKSB 4IKHA 2L5LA 3F4SA 3GMFA 4GF0A 5JWQB 1PQNA 5CRDA 4ZIJA 2CVDA 1DUGA 2IFQA 2YV9A 1EOGA 4EO3A 2LTKA 2CZ2A 4RQRA 4TR4A 1PL2A 4HU7A 4P3YB 3GSSA 4K6XA 3FW2A 1YKAA 3MWHA 2FD3A 5LNKe 4G0KA 4MZWA 2GT6A 1EEJA 2VL9A 4PURA 2VD0A 2X8HA 3RHCA 1Y25A 4EF0A 2UZ8A 1Y6EA 4XRAA 2GT5A 3ZFLA 1T8EB 1DSBA 1SYXA 1T4ZA 4O92A 14GSA 5LD0A 3H79A 3IXRA 4QQ7A 1GSFA 2R0GA 5HFKA 3QR6A 1S3AA 2PGTA 2J9HA 2VL2C 4EUYA 1F3BA 1AXDA 1SYRA 1THOA 4PTSA 4F0BA 4K7NA 4V1Ap 1E6BA 3RBTA 3C71A 4NPBA 1UC7A 1N2AA 1Q98A 2H01A 3FZ4A 3ZL5A 4IHUA 1OC9B 3TOTA 5EY6A 2XBIA 5J41A 4YKFA 3D4TA 2VM1A 1K0AA 2PERA 1WIKA 5ELGA 6GSTA 1TDIA 9GSSA 1XW9A 3TKSA 1X0RA 3IV4A 4OCEA 1PKWA 1WPIA 5B8BA 1GRXA 3PINA 2LQQA 1MDJA 4ECCA 4X4JA 6GSXA 3QPMA 3U6VA 4TVEA 1Q4JA 5F8BA 4X43A 3EWLA 5F07A 4KB3A 1TRSA 4TOPA 1PGTA 4KE3A 1UN2A 2LQOA 4HI7A 2N5BA 3QFAC 1GLQA 4MNNA 2H1BA 3D21A 4BVXB 1XVQA 2YJ7A 5ENUA 3L0HA 2V1MA 5E4WA 4WEYA 3CSHA 3VWUA 2HZFA 2XPEA 2PMTA 3QDNA 2FA4A 2B7KA 1GSUA 4FO5A 2GQLA 4TR1B 5ABRA 4Q5FA 1EGRA 1H4OA 1JHBA 2G0FA 2H75A 3TRPA 4GSTA 2MBSA 5DCHA 3TJBA 4XTSA 5JWRB 1JFUA 3MYDA 1V2AA 3E9JB 3D0ZA 1F37A 2B1LA 4FYBA 5H5SA 3G7JA 4MJAA 1OYJA 20GSA 3R3EA 4K7IA 5HQPA 3Q74A 1R4WA 3GKNA 3TJFA 3GA4A 3HHVA 2VCZA 5DAKA 3M9JA 4ILFA 5IQYA 4OD7A 4MLYA 4JEDA 5DALA 2LKUA 4KDYA 2AV4A 1TKDB 2VCXA 2WZ9A 3HZ4A 4KDXA 1G6WA 3LEFA 4TXVA 3SWLA 3IOSA 4XIHA 2OE3A 3F3QA 2EIOA 3PGTA 2FWEA 2WFCA 2MMNA 3CMIA 2H71A 3J7Yb 2H1GA 2R3XA 3L9VA 3C1RA 4MA9A 3KD0A 5COHA 4MF6A 4NMUA 4F82A 3NIVA 2HRFA 4FQUA 5J5NA 3QMXA 4EXJA 1NHYA 1YZXA 2B3SA 2YP6A 3DGQA 4I2TA 2H72A 2DKHA 3BOAA 4Z2UA 4BWQA 2JZSA 3KJYA 5IMVA 4CW9A 3CBUA 4K2XA 5CREA 5F06A 2YWMA 3GNJA 2H1AA 5G1LA 3L9SA 4L0WA 2CA8A 5H5QA 3LYKA 2NTOA 4QL9A 1V40A 3KGKA 2L6DA 1ABAA 2RM5A 2C80A 1V9WA 1WE0A 4O5UA 5A4UA 2YJHA 1GTAA 1O7UA 4EDYA 4OFMA 2TIRA 3TJKA 1VF3A 1BX9A 3TUEA 3VI5A 2F9SA 2IMIA 1K3LA 5G30A 1EZKA 6GSWA 2VL2A 3UIWA 3GSTA 3WGEA 3FZAA 4ZB6A 5ID2B 2IPAA 1W4VA 4ECBA 18GSA 2V2GA 2N5AA 2X4AA 4EKZA 2O85A 1K3YA 1VGLA 4MPGA 2C3NA 1XWKA 2M80A 4Q5QA 3HKRA 4GSSA 3D5JA 3Q18A 1GSSA 2KP1A 5C04A 4MH2A 1I5GA 3FR3A 3IR4A 2V6KA 3CYNA 2H6ZA 3I9V2 3WD6A 4HQSA 5D73A 1AC1A 4BVYB 3H8QA 2LNTA 3TGZA 2VCTA 1M2AA 4Z2TA 1K0MA 2HRAA 2P0GA 2PN8A 1MEKA 2IMKA 3LQ7A 1ILOA 3QAWA 3K8NA 2WGRA 5DVBA 3CTFA 1T3BA 1OE8A 2WB9A 2R4VA 2K6VA 4MDCA 2P31A 4NXIA 2H66A 3GTUB 2GZPA 1R26A 4MP4A 4K7OA 3KMNA 3APOA 2NDOA 2OADA 4KA0A 2GZZA 1XVWA 5GAND 1GWCA 4G0IA 4I8BA 5AIVA 4HEA2 4JR4A 4EE0A 2DJ2A 1ERTA 1FOHA 3TKSE 4POBA 4DEJA 5IM9A 1E2YA 5DQSA 3A2XA 4HU9A 2OACA 2XPDA 2NVLA 1W89A 3RPNA 1PRXA 2B5YA 2VOCA 3KEBA 3ZITA 2KOKA 2H76A 1B4QA 5ECQB 1HNBA 3WYWA 1OKDA 3LSZA 4KCEA 3GHAA 3DXBA 2MMAA 4BVXA 3DEXA 2RIIA 3LJRA 1YF0A 1NW2A 3NOFA 2PUKC 1J08A 5DJLA 3DKSA 4FH8A 1VRSD 3TCOA 1XOAA 2H19A 3IK9A 2FWFA 3GH6A 2CV4A 3F8UA 4TR1A 4POMA 4N10A 4J57E 2JL4A 3ZYWA 3FR6A 4TKYA 1XW6A 3A2WA 4PQHA 3A2VA 1SKWB 1WRYA 2Z9SA 3H4KA 1BQ7A 4DSSB 2OA7A 1AIUA 2A4VA 2QC7A 3KXOA 4IP1A 5CO3A 1V58A 4KF9A 3IAM2 1Z3EA 4K8MA 2HLSA 3I6AA 2RUEA 1JLWA 1M7TA 4RI7A 2LRCA 3DWVA 1A0RP 2LRTA 2H8LA 5HFGA 2GDRA 1BEDA 1DE2A 2F3MA 3P7XA 1Z6MA 1WJKA 1JZOA 2O89A 2D2ZA 2YZHA 1SL2B 2ES7A 2GSQA 3MDKA 3F9UA 4O5QA 3M0FA 4N30A 1FW1A 5KOWA 3CRUA 5C00A 1VF4A 1R7HA 1HD2A 1A2JA 4CHSA 1X5EA 1TJDA 5A4WA 1SJZA 5KN0A 3EYTA 5ELAA 1ZYQB 4YH2A 2PWJA 1O73A 1M9BA 3G9BA 6GSVA 2DJ3A 4GQFA 1HNCA 2H30A 4PQ1A 3HXSA 3GFKA 4OO5A 2OBKA 3P2AA 1EP7A 4KAEA 2XBQA 4O32A 2KUCA 5IMZA 2VCWA 1ZYPA 1LBKA 4DSQA 1QGVA 3VPTA 1SENA 3UJ1A 5D9XA 3S9FA 4K0GA 2I9HA 4NAXA 3US3A 1FG4A 1B9XC 4XS4B 2CVKA 4XRDA 3HZ8A 3IE3A 1ACVA 2YOIA 4MABA 1SD9A 1WP0A 2V6OA 1U3AA 5D9VA 2EIRA 3ERGA 2H1DA 2XC2A 1AW9A 1GUKA 2IMFA 4LL1B 2OE0A 3UBKA 1GSDA 3ZREA 4A5PA 5JCGA 1HYUA 5J9BA 5KN2A 1SKRB 1K0CA 2R5GA 2CX4A 4YQUA 2FCHA 5IO2A 1F9MA 4F2IA 1F2EA 6GSSA 4JBBA 2CX3A 2MMOA 1ZGNA 1PSQA 4TXOB 1O8XA 1XWGA 4GSNA 2L5OA 1M2BA 4OWYA 5ID2A 3A5WA 4NWYA 4PQIA 5CRWA 3R2QA 5HR1A 3PPUA 4ZB8A 3LORA 1YY7A 2LS5A 1K0DA 3ERFA 2HSYA 2FNOA 3QCPA 4O5RA 1CQGA 3BCIA 2R0CA 4KSMA 3ZIVA 1USBA 2LJAA 3QAVA 5IPGA 2C0FA 2F51A 4G19A 3VK9A 4I6XA 2GSRA 5B6MA 2VIMA 4KH7A 4GWRA 5EPFA 5E59A 1IYHA 3HCZA 2CZ3A 1XIYA 1JLVA 3DIEA 1QK8A 5FT3A 4E8HA 1TK0B 4IQAA 1ST9A 3M8NA 1TK8B 1ZYEA 4KGIA 1PKZA 4H86A 2H6YA 3FZ5A 1YQ1A 2YZUA 3RAZA 1Z7RA 3HA9A 8GSSA 2YWIA 5KOXA 1VF1A 2LRNA 3GL3A 2REMA 1GP1A 1THXA 3ZIJA 3KMOA 3DVXA 4ML1A 19GSA 2LSTA 4TR0A 2ALBA 1U87A 4HDEA 2HZEA 1O85A 1U6TA 2XHFA 1YF1A 3Q19A 2HE3A 5AISA 5IMFA 1B8XA 2LNSA 5ECLB 2JU5A 1Z9HA 3IHGA 1AUCA 3HVSA 1A8LA 1PL1A 5IMCA 1A23A 1FHEA 2H73A 2I4AA 4MK3A 2IFQB 3H93A 4ZXGA 1GNWA 1O8WA 2HYXA 1EP8A 2PBJA 3IC4A 3GIXA 2LUSA 2DJJA 1FB6A 4IBPA 3EE2A 1J9BA 1FO5A 5IIZA 4MJEA 1GTIA 1K3OA 4ULXA 2FA8A 4POKA 1A0FA 2JSYA 1C72A 2V32A 4IGJA 1QMVA 3EVIA 4USSA 2P5QA 1SU9A 4N11A 5CRHA 3UBLA 2VUPA 4K5RA 1AQWA 3QAGA 4CDOA 3TKRA 4DSSA 1M2DA 2ON7A 1EV4A 4NV2A 3LGCA 4KW6A 1EV9A 3LG6A 2VO4A 2YWOA 3VWXA 1XOBA 4BA7A 1ZCPA 4IVFA 3H1NA 1TW9A 3QFBC 4LL4B 1ERWA 1MDIA 4J2FA 3DYRA 3IK7A 1MDKA 1SK0A 3ZMLA 3M9KA 1GNEA 4IELA 13GSA 22GSA 3VWVA 3EU4A 5ECRB 4FYUA 3FKFA 1V57A 3HVXA 1TK5B 4AJ8A 4K1FA 1HQOA 5BMUA 5IO0A 2HRKA 4WKWA 1CQHA 2X64A 3KP8A 3TRXA 4L5OA 1PX7A 1NHOA 4KUNA 3HY2A 1OC3A 2C0EA 2H70A 2WULA 4Z7XA 3KM6A 4JRRA 1SK2A 1TP9A 2YNXA 4GCIA 3TOUA 1N8JA 4IJ3A 3F63A 4ZBBA 3PH9A 2HSMA 1SL1B 4V2MA 4WETA 1X5DA 4V1Ag 3L4NA 4KCAA 5DDLA 5GSTA 3ISOA 3F4TA 1TTZA 1EEMA 1T00A 4E8EA 2NPBA 2C1YA 4ZILA 1BAYA 1SL0B 2MYGA 4CY8A 4RI6A 4DSRA 2K8SA 1OKTA 5INYA 4ISDA 4BPYA 5CYYA 4ECIA 5HR3A 4XS4A 5IMAA 4JE1A 5L71A 3IRAA 5D9WA 2IL3A 4PNFA 3MNGA 4YQVA 3GX8A 2DMMA 3F6DA 1OC9A 2H0HA 3P8WA 3CSIA 4ID0A 2C8UA 4EDZA 4EVMA 2F8FA 2QA2A 3ZLPA 2YPMA 1YKCA 4TW5A 2VL3A 2B6MA 1TI3A 3IHQA 4OO4A 3PR8A 1KEBA 1T1VA 2M46A 1S3CA 4TXOA 3C8EA 4PX1A 4LMVA 5ECPB 4YQMA 3GKMA 3TJJA 1A8YA 2WCIA 1DBYA 1F6MC 2GGTA 3GN3A 2FGXA 4LMWA 3M3MA 3VWWA 4HZ4A 4AJ6A 3ZZXA 2K18A 3LFLA 2HI7A 1XXUA 1MTCA 1YEXA 7GSSA 2C3QA 2WRTA 3WT1A 3CSJA 2HFDA 2OJLA 1WMJA 2O87A 1A2MA 4N0ZA 2CAIA 4DVCA 2RUFA 4RUVA 2GSSA 4GLTA 4WF4A 5GZZB 3ZTLA 2I3YA 4POLA 3E3EA 2PU9C 2PVOC 3I69A 3FK8A 4MCUA 4OFTA 5DQYA 4NHWA 3DVWA 2LJKA 4IJIA 1RQMA 5IPHA 1M99A 2DJKA 2GVPA 5B8AA 1VF2A 3OR5A 4YKGA 3HYPA 4IN0A 4IS0A 3KIJA 1ERUA 5CNWA 2HNLA 4BWSA 1XCCA 4ZL8A 3DD3A 4OMVA 2ZUPA 4I2UA 1GSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECH B;  3UMA A;  3ME7 A;  4L8E A;  6GSU A;  2BMX A;  1PN9 A;  2FHE A;  2YN1 A;  4ZBD A;  4L5L A;  3UOM A;  4G9H A;  2K9F A;  5G1K A;  1LU4 A;  2AB6 A;  4HJM A;  4F03 A;  1WWJ A;  1B4P A;  1K0N A;  3ME8 A;  1GUH A;  3CRT A;  2AYT A;  4V2N A;  1TU7 A;  4AJ7 A;  4WXT A;  1A2L A;  2ON5 A;  3DML A;  3AY8 A;  4MZC A;  2K8V A;  2GQM A;  6GSY A;  1G7E A;  2FWG A;  3CXG A;  2H74 A;  3ZMK A;  2DBC A;  2PVQ A;  3HD5 A;  1U88 A;  3GRX A;  1RK4 A;  3TKQ A;  5D96 A;  3HJP A;  1FOV A;  2KHP A;  1ZL9 A;  4Q5R A;  5ECN B;  1GTU A;  5AN1 A;  5FWG A;  3KP9 A;  3GL5 A;  4YAP A;  3FZ9 A;  1UVZ A;  5G2Z A;  5AIX A;  5A4V A;  3F6F A;  2WS2 A;  2VAF A;  1PA3 A;  3IDV A;  2M72 A;  1SJI A;  2AAW A;  5EVO A;  3F4R A;  4AF2 A;  4TN8 A;  4MZB A;  2EIQ A;  3KH9 A;  1PX6 A;  1M9A A;  2LJR A;  1Z6N A;  2IWT A;  2KLX A;  5FHI A;  5KEJ A;  5IMD A;  5GAP D;  3VI7 A;  1UA5 A;  4X0X A;  1XWB A;  1XWA A;  5JCW A;  3D4M A;  4EC0 A;  4EL1 A;  2DJ1 A;  4FIW A;  5JWO B;  4KND A;  2JAC A;  4PUF C;  1KBN A;  2E0Q A;  1MD4 A;  5J4U A;  2L59 A;  4O7H A;  3UVT A;  4HQZ A;  4IW9 A;  1KTE A;  4KDU A;  3G7I A;  1OE7 A;  3D6I A;  3P90 A;  1TOF A;  4ZBA A;  1J0F A;  3E0U A;  4TR3 A;  2BTO T;  4XCS A;  3WT2 A;  1V98 A;  2GZY A;  4WR5 A;  5CRG A;  2CVB A;  3HJM A;  1XW5 A;  2VM2 A;  3UAR A;  2CAQ A;  2PPT A;  3EU3 A;  2YCD A;  3LYP A;  2GLR A;  1EOH A;  2L4C A;  1MD3 A;  3UL3 A;  2I81 A;  3C7M A;  5G5F A;  3APS A;  2FLS A;  5DJM A;  5EL8 A;  4BVY A;  5ECS A;  2LV3 A;  4D73 B;  1XWC A;  3W6G A;  3KZQ A;  2GS3 A;  2JZR A;  3N5O A;  1RW1 A;  1QXH A;  3Q6O A;  4X1U A;  2IN3 A;  1X9W B;  1OC8 A;  2O7K A;  5KN1 A;  1X5C A;  2C0D A;  1M0U A;  4KSO A;  4NV5 A;  1LJR A;  1YEP A;  3A3T A;  4PNG A;  3GX0 A;  4LA1 A;  5KN3 A;  5ECO B;  3IAS 2;  1WOU A;  4J56 E;  3KTB A;  2JSZ A;  4JR6 A;  5AGY A;  5F05 A;  3GTU A;  2HXK A;  1GL8 A;  1TI1 A;  1GH2 A;  2YV7 A;  1TXX A;  2RLI A;  1AQX A;  1I9D A;  1TRU A;  3MAK A;  4F0C A;  2OKA A;  1A24 A;  3EMX A;  3LXT A;  1FB0 A;  2OBI A;  2HT9 A;  3QD9 A;  3V1W A;  2KP2 A;  4WBJ A;  2MMZ A;  1B48 A;  4GXZ A;  2TRX A;  3KH7 A;  2N5F A;  3M1G A;  5D93 A;  3BBY A;  1QUW A;  4GTU A;  3MSZ A;  3TKP A;  3APQ A;  5LCZ A;  5J3R A;  3GV1 A;  3BCK A;  3GKK A;  4N0V A;  1NM3 A;  1TRV A;  2FUG 2;  1QFN A;  3RDW A;  5B7C A;  1XFL A;  3C1S A;  1FAA A;  1XBS A;  4WBR D;  2ZNM A;  2G2Q A;  2B5E A;  3RHB A;  2L57 A;  3TJG A;  2A2R A;  1FVK A;  3ERW A;  1DE1 A;  1XPV A;  4I97 A;  4MPF A;  4WR4 A;  2R2J A;  3FR9 A;  17GS A;  3SBC A;  3D22 A;  2EC4 A;  2QGV A;  1AQV A;  2J23 A;  3ZVJ A;  2V41 A;  3HDC A;  5D9T A;  2H0I A;  4MF5 A;  5G5E A;  3I43 A;  5ECI B;  3TB2 A;  4PUA A;  2VLV A;  3GUR A;  2VCQ A;  4XHM A;  3EMP A;  5IOX A;  3RPP A;  5CAX A;  3F3R A;  4ZL9 A;  4HS1 A;  3VFI A;  2IME A;  4F9Z A;  2P5R A;  3W8S A;  2AJQ B;  3EUR A;  2FY6 A;  2VLT A;  2X8G A;  1GUM A;  4K2D A;  2R6K A;  3ZVJ D;  1AAZ A;  3EIN A;  1URM A;  4IQ1 A;  4OCF A;  2L6C A;  3C73 A;  3GUS A;  3EC3 A;  2B7J A;  1EGO A;  4ACS A;  5HR0 A;  3NZN A;  3F0I A;  4I5Q A;  4NHZ A;  2GTU A;  2A2S A;  4GRF A;  2MBT A;  3TRQ A;  3VUR A;  2ZCT A;  1GTB A;  3BD2 A;  2H6X A;  2QKE A;  1BJX A;  1G0T A;  4MJC A;  1EWX A;  1GLP A;  1O6J A;  1SK1 A;  3ZRD A;  1R5P A;  2LEG A;  5JCU A;  2I1U A;  3DRN A;  4XS1 A;  2C4J A;  4L0U A;  1G7O A;  4HZ2 A;  4ECJ A;  1PD2 1;  5H5R A;  2WDU A;  2F8A A;  4GQC A;  1JZR A;  3FEU A;  1FVJ A;  1Z5Y E;  2CQ9 A;  3VPQ A;  1K0O A;  4OFN A;  2VCV A;  1ZOF A;  2O8V B;  12GS A;  4K9Z A;  2DJ0 A;  4PXO A;  1B9Y C;  2E7P A;  2WJU A;  4KX4 A;  4G10 A;  3UEM A;  1YDK A;  3TKS C;  3GYK A;  5GSS A;  4MMM A;  4PGT A;  5F0G A;  1KNG A;  1BG5 A;  3WGX A;  5DCG A;  2BJX A;  3N9J A;  2NBS A;  4FYC A;  3LWA A;  3FY7 A;  3O6T A;  2VLU A;  1X9S B;  2YAN A;  1Z7P A;  2C0G A;  3J7Y k;  3ZFB A;  1ML6 A;  2IMD A;  3UAP A;  5G31 A;  3FHK A;  2DSA A;  3FRC A;  3QOU A;  5HFI A;  4BL7 A;  3O3T A;  1K0B A;  1HNA A;  2AHE A;  2R37 A;  5B6N A;  1GUL A;  1G6Y A;  3GH9 A;  1YJ6 A;  1TU8 A;  3L78 A;  2X8C A;  1BYE A;  3LXZ A;  4QL7 A;  4Q5N A;  3ED3 A;  4K0N A;  5DAK B;  2RM6 A;  1QQ2 A;  3IBH A;  5ECK B;  3G7Y A;  4LLR A;  4G2E A;  1SD8 A;  2OE1 A;  5DAL B;  3WGD A;  3FYG A;  2DIZ A;  4ZB9 A;  2HZE B;  1GSE A;  2DIY A;  1F3A A;  4HUA A;  1T7P B;  4HOJ A;  1PMT A;  5J9C A;  2AUV A;  2JZT A;  3IPZ A;  2HSH A;  3TDG A;  1IYI A;  2B1K A;  1XZO A;  1TRW A;  2TRC P;  3IA1 A;  4D73 A;  1O81 A;  1JZW A;  2HRN A;  3O76 A;  4MF7 A;  2GST A;  3KTL A;  2H0G A;  1X9M B;  2IJY A;  4JZQ A;  5ECM B;  2CT6 A;  4ZL7 A;  2E2M A;  2VD1 A;  2FWH A;  5CP1 A;  4WF5 A;  3JCM L;  2DLX A;  1ON4 A;  3BJ5 A;  3VLN A;  4MJB A;  2C3T A;  3GKX A;  5D8I A;  1U3I A;  5HR2 A;  4V2L A;  2YWN A;  5A5K A;  1NSW A;  5DBQ A;  2IIY A;  3L9U A;  2DC5 A;  1OAZ A;  1SJ6 A;  4AGS A;  1T4Y A;  1OVN A;  1ZMA A;  3W8J A;  11GS A;  2L4Q A;  4XS6 A;  2GQK A;  4ML6 A;  1GSQ A;  2E2G A;  3HVV A;  1H75 A;  4TRX A;  3KCM A;  4RQX A;  1JZD A;  2B5X A;  4YAV A;  2X99 A;  1S3D A;  1ERV A;  3UVH A;  4MH3 A;  3CTG A;  2JAD A;  4HJ2 A;  16GS A;  2MZC A;  2QSI A;  5IOW A;  4IP6 A;  1R5A A;  1ZZY A;  4JU5 A;  10GS A;  2DML A;  3U5R E;  3HJO A;  1SKS B;  4IKH A;  2L5L A;  3F4S A;  3GMF A;  4GF0 A;  5JWQ B;  1PQN A;  5CRD A;  4ZIJ A;  2CVD A;  1DUG A;  2IFQ A;  2YV9 A;  1EOG A;  4EO3 A;  2LTK A;  2CZ2 A;  4RQR A;  4TR4 A;  1PL2 A;  4HU7 A;  4P3Y B;  3GSS A;  4K6X A;  3FW2 A;  1YKA A;  3MWH A;  2FD3 A;  5LNK e;  4MZW A;  2GT6 A;  1EEJ A;  2VL9 A;  4PUR A;  2VD0 A;  2X8H A;  3RHC A;  1Y25 A;  4EF0 A;  1Y6E A;  4XRA A;  2GT5 A;  3ZFL A;  1T8E B;  1DSB A;  1SYX A;  1T4Z A;  4O92 A;  14GS A;  5LD0 A;  3H79 A;  3IXR A;  4QQ7 A;  1GSF A;  5HFK A;  3QR6 A;  1S3A A;  2PGT A;  2J9H A;  2VL2 C;  4EUY A;  1F3B A;  1AXD A;  1SYR A;  1THO A;  4F0B A;  4K7N A;  4V1A p;  1E6B A;  3RBT A;  3C71 A;  4NPB A;  1UC7 A;  1N2A A;  1Q98 A;  2H01 A;  3FZ4 A;  3ZL5 A;  4IHU A;  1OC9 B;  3TOT A;  5EY6 A;  2XBI A;  5J41 A;  3D4T A;  2VM1 A;  1K0A A;  2PER A;  1WIK A;  5ELG A;  6GST A;  1TDI A;  9GSS A;  1XW9 A;  3TKS A;  1X0R A;  3IV4 A;  4OCE A;  1PKW A;  1WPI A;  5B8B A;  1GRX A;  3PIN A;  2LQQ A;  1MDJ A;  4ECC A;  6GSX A;  3QPM A;  3U6V A;  4TVE A;  1Q4J A;  5F8B A;  4X43 A;  3EWL A;  5F07 A;  4KB3 A;  1TRS A;  4TOP A;  1PGT A;  4KE3 A;  1UN2 A;  2LQO A;  4HI7 A;  2N5B A;  3QFA C;  1GLQ A;  2H1B A;  3D21 A;  1XVQ A;  2YJ7 A;  5ENU A;  3L0H A;  2V1M A;  5E4W A;  4WEY A;  3CSH A;  3VWU A;  2HZF A;  2XPE A;  2PMT A;  3QDN A;  2FA4 A;  2B7K A;  1GSU A;  4FO5 A;  2GQL A;  4TR1 B;  5ABR A;  4Q5F A;  1EGR A;  1H4O A;  1JHB A;  2G0F A;  2H75 A;  3TRP A;  4GST A;  2MBS A;  5DCH A;  3TJB A;  4XTS A;  5JWR B;  1JFU A;  1V2A A;  3E9J B;  3D0Z A;  1F37 A;  2B1L A;  4FYB A;  5H5S A;  3G7J A;  4MJA A;  1OYJ A;  20GS A;  4K7I A;  5HQP A;  3Q74 A;  1R4W A;  3GKN A;  3TJF A;  3GA4 A;  3HHV A;  2VCZ A;  5DAK A;  3M9J A;  4ILF A;  5IQY A;  4OD7 A;  4MLY A;  4JED A;  5DAL A;  2LKU A;  4KDY A;  2AV4 A;  1TKD B;  2VCX A;  2WZ9 A;  3HZ4 A;  4KDX A;  1G6W A;  3LEF A;  4TXV A;  3SWL A;  3IOS A;  4XIH A;  2OE3 A;  3F3Q A;  2EIO A;  3PGT A;  2FWE A;  2WFC A;  2MMN A;  3CMI A;  2H71 A;  3J7Y b;  2H1G A;  2R3X A;  3L9V A;  3C1R A;  4MA9 A;  3KD0 A;  5COH A;  4MF6 A;  4NMU A;  4F82 A;  3NIV A;  2HRF A;  5J5N A;  3QMX A;  4EXJ A;  1NHY A;  1YZX A;  2B3S A;  2YP6 A;  3DGQ A;  4I2T A;  2H72 A;  3BOA A;  4BWQ A;  2JZS A;  3KJY A;  5IMV A;  4CW9 A;  3CBU A;  5CRE A;  5F06 A;  2YWM A;  3GNJ A;  2H1A A;  5G1L A;  3L9S A;  4L0W A;  2CA8 A;  5H5Q A;  3LYK A;  2NTO A;  4QL9 A;  1V40 A;  3KGK A;  2L6D A;  1ABA A;  2RM5 A;  2C80 A;  1V9W A;  1WE0 A;  5A4U A;  2YJH A;  1GTA A;  1O7U A;  4EDY A;  4OFM A;  2TIR A;  3TJK A;  1VF3 A;  1BX9 A;  3TUE A;  3VI5 A;  2F9S A;  2IMI A;  1K3L A;  5G30 A;  1EZK A;  6GSW A;  2VL2 A;  3UIW A;  3GST A;  3WGE A;  3FZA A;  4ZB6 A;  5ID2 B;  2IPA A;  1W4V A;  4ECB A;  18GS A;  2V2G A;  2N5A A;  4EKZ A;  2O85 A;  1K3Y A;  1VGL A;  4MPG A;  2C3N A;  1XWK A;  2M80 A;  4Q5Q A;  3HKR A;  4GSS A;  3D5J A;  3Q18 A;  1GSS A;  2KP1 A;  5C04 A;  4MH2 A;  1I5G A;  3FR3 A;  3IR4 A;  2V6K A;  3CYN A;  2H6Z A;  3I9V 2;  3WD6 A;  4HQS A;  5D73 A;  1AC1 A;  3H8Q A;  2LNT A;  3TGZ A;  2VCT A;  1M2A A;  1K0M A;  2P0G A;  2PN8 A;  1MEK A;  2IMK A;  3LQ7 A;  1ILO A;  3QAW A;  3K8N A;  2WGR A;  5DVB A;  3CTF A;  1T3B A;  1OE8 A;  2WB9 A;  2R4V A;  2K6V A;  4MDC A;  2P31 A;  4NXI A;  2H66 A;  3GTU B;  2GZP A;  1R26 A;  4MP4 A;  4K7O A;  3KMN A;  3APO A;  2NDO A;  2OAD A;  4KA0 A;  2GZZ A;  1XVW A;  5GAN D;  1GWC A;  4I8B A;  5AIV A;  4HEA 2;  4JR4 A;  4EE0 A;  2DJ2 A;  1ERT A;  3TKS E;  4POB A;  4DEJ A;  5IM9 A;  1E2Y A;  5DQS A;  3A2X A;  4HU9 A;  2OAC A;  2XPD A;  2NVL A;  1W89 A;  3RPN A;  1PRX A;  2B5Y A;  2VOC A;  3KEB A;  3ZIT A;  2KOK A;  2H76 A;  1B4Q A;  5ECQ B;  1HNB A;  3WYW A;  1OKD A;  3LSZ A;  4KCE A;  3GHA A;  3DXB A;  2MMA A;  4BVX A;  3DEX A;  2RII A;  3LJR A;  1YF0 A;  1NW2 A;  3NOF A;  2PUK C;  1J08 A;  5DJL A;  3DKS A;  4FH8 A;  1VRS D;  3TCO A;  1XOA A;  2H19 A;  3IK9 A;  2FWF A;  3GH6 A;  2CV4 A;  3F8U A;  4TR1 A;  4POM A;  4N10 A;  4J57 E;  2JL4 A;  3ZYW A;  3FR6 A;  4TKY A;  1XW6 A;  3A2W A;  4PQH A;  3A2V A;  1SKW B;  1WRY A;  2Z9S A;  3H4K A;  1BQ7 A;  4DSS B;  2OA7 A;  1AIU A;  2A4V A;  2QC7 A;  3KXO A;  4IP1 A;  5CO3 A;  1V58 A;  3IAM 2;  1Z3E A;  4K8M A;  2HLS A;  3I6A A;  2RUE A;  1JLW A;  1M7T A;  4RI7 A;  2LRC A;  3DWV A;  1A0R P;  2LRT A;  2H8L A;  5HFG A;  2GDR A;  1BED A;  1DE2 A;  2F3M A;  3P7X A;  1Z6M A;  1WJK A;  1JZO A;  2O89 A;  2D2Z A;  2YZH A;  1SL2 B;  2ES7 A;  2GSQ A;  3MDK A;  3F9U A;  3M0F A;  4N30 A;  1FW1 A;  3CRU A;  5C00 A;  1VF4 A;  1R7H A;  1HD2 A;  1A2J A;  4CHS A;  1X5E A;  1TJD A;  5A4W A;  1SJZ A;  5KN0 A;  3EYT A;  5ELA A;  1ZYQ B;  4YH2 A;  2PWJ A;  1O73 A;  1M9B A;  3G9B A;  6GSV A;  2DJ3 A;  4GQF A;  1HNC A;  2H30 A;  4PQ1 A;  3HXS A;  3GFK A;  4OO5 A;  2OBK A;  3P2A A;  1EP7 A;  4KAE A;  2XBQ A;  4O32 A;  2KUC A;  5IMZ A;  2VCW A;  1LBK A;  4DSQ A;  1QGV A;  3VPT A;  1SEN A;  3UJ1 A;  5D9X A;  3S9F A;  4K0G A;  2I9H A;  4NAX A;  3US3 A;  1FG4 A;  1B9X C;  4XS4 B;  2CVK A;  4XRD A;  3HZ8 A;  3IE3 A;  1ACV A;  2YOI A;  4MAB A;  1SD9 A;  1WP0 A;  2V6O A;  1U3A A;  5D9V A;  2EIR A;  3ERG A;  2H1D A;  2XC2 A;  1AW9 A;  1GUK A;  2IMF A;  4LL1 B;  2OE0 A;  3UBK A;  1GSD A;  3ZRE A;  5JCG A;  1HYU A;  5J9B A;  5KN2 A;  1SKR B;  1K0C A;  2R5G A;  2CX4 A;  4YQU A;  2FCH A;  5IO2 A;  1F9M A;  4F2I A;  1F2E A;  6GSS A;  4JBB A;  2CX3 A;  2MMO A;  1ZGN A;  1PSQ A;  4TXO B;  1O8X A;  1XWG A;  4GSN A;  2L5O A;  1M2B A;  4OWY A;  5ID2 A;  3A5W A;  4NWY A;  4PQI A;  5CRW A;  3R2Q A;  5HR1 A;  4ZB8 A;  3LOR A;  1YY7 A;  2LS5 A;  1K0D A;  3ERF A;  2HSY A;  2FNO A;  3QCP A;  4O5R A;  1CQG A;  3BCI A;  4KSM A;  3ZIV A;  1USB A;  2LJA A;  3QAV A;  5IPG A;  2C0F A;  2F51 A;  4G19 A;  3VK9 A;  4I6X A;  2GSR A;  5B6M A;  2VIM A;  4KH7 A;  4GWR A;  5EPF A;  5E59 A;  1IYH A;  3HCZ A;  2CZ3 A;  1XIY A;  1JLV A;  3DIE A;  1QK8 A;  5FT3 A;  4E8H A;  1TK0 B;  4IQA A;  1ST9 A;  3M8N A;  1TK8 B;  1ZYE A;  4KGI A;  1PKZ A;  4H86 A;  2H6Y A;  3FZ5 A;  1YQ1 A;  2YZU A;  3RAZ A;  1Z7R A;  3HA9 A;  8GSS A;  2YWI A;  1VF1 A;  2LRN A;  3GL3 A;  2REM A;  1GP1 A;  1THX A;  3ZIJ A;  3KMO A;  3DVX A;  4ML1 A;  19GS A;  2LST A;  4TR0 A;  2ALB A;  1U87 A;  4HDE A;  2HZE A;  1O85 A;  1U6T A;  2XHF A;  1YF1 A;  3Q19 A;  2HE3 A;  5AIS A;  5IMF A;  1B8X A;  2LNS A;  5ECL B;  2JU5 A;  1Z9H A;  1AUC A;  3HVS A;  1A8L A;  1PL1 A;  5IMC A;  1A23 A;  1FHE A;  2H73 A;  2I4A A;  4MK3 A;  2IFQ B;  3H93 A;  4ZXG A;  1GNW A;  1O8W A;  2HYX A;  1EP8 A;  2PBJ A;  3IC4 A;  3GIX A;  2LUS A;  2DJJ A;  1FB6 A;  4IBP A;  3EE2 A;  1J9B A;  1FO5 A;  5IIZ A;  4MJE A;  1GTI A;  1K3O A;  4ULX A;  2FA8 A;  4POK A;  1A0F A;  2JSY A;  1C72 A;  2V32 A;  4IGJ A;  1QMV A;  3EVI A;  2P5Q A;  1SU9 A;  4N11 A;  5CRH A;  3UBL A;  2VUP A;  1AQW A;  3QAG A;  4CDO A;  3TKR A;  4DSS A;  1M2D A;  2ON7 A;  1EV4 A;  4NV2 A;  3LGC A;  4KW6 A;  1EV9 A;  3LG6 A;  2VO4 A;  2YWO A;  3VWX A;  1XOB A;  4BA7 A;  1ZCP A;  4IVF A;  3H1N A;  1TW9 A;  3QFB C;  4LL4 B;  1ERW A;  1MDI A;  4J2F A;  3DYR A;  3IK7 A;  1MDK A;  1SK0 A;  3ZML A;  3M9K A;  1GNE A;  4IEL A;  13GS A;  22GS A;  3VWV A;  3EU4 A;  5ECR B;  4FYU A;  3FKF A;  1V57 A;  3HVX A;  1TK5 B;  4AJ8 A;  4K1F A;  1HQO A;  5IO0 A;  4WKW A;  1CQH A;  2X64 A;  3KP8 A;  3TRX A;  4L5O A;  1PX7 A;  1NHO A;  4KUN A;  3HY2 A;  1OC3 A;  2C0E A;  2H70 A;  2WUL A;  4Z7X A;  3KM6 A;  4JRR A;  1SK2 A;  1TP9 A;  2YNX A;  4GCI A;  3TOU A;  1N8J A;  4IJ3 A;  3F63 A;  4ZBB A;  3PH9 A;  1SL1 B;  4V2M A;  4WET A;  1X5D A;  4V1A g;  3L4N A;  4KCA A;  5DDL A;  5GST A;  3ISO A;  3F4T A;  1TTZ A;  1EEM A;  1T00 A;  4E8E A;  2NPB A;  2C1Y A;  4ZIL A;  1BAY A;  1SL0 B;  2MYG A;  4RI6 A;  4DSR A;  2K8S A;  1OKT A;  5INY A;  4ISD A;  4BPY A;  5CYY A;  4ECI A;  5HR3 A;  4XS4 A;  5IMA A;  4JE1 A;  5L71 A;  3IRA A;  5D9W A;  2IL3 A;  4PNF A;  3MNG A;  4YQV A;  3GX8 A;  2DMM A;  3F6D A;  1OC9 A;  2H0H A;  3P8W A;  3CSI A;  4ID0 A;  2C8U A;  4EDZ A;  4EVM A;  2F8F A;  3ZLP A;  2YPM A;  1YKC A;  4TW5 A;  2VL3 A;  2B6M A;  1TI3 A;  3IHQ A;  4OO4 A;  3PR8 A;  1KEB A;  1T1V A;  2M46 A;  1S3C A;  4TXO A;  3C8E A;  4PX1 A;  4LMV A;  5ECP B;  4YQM A;  3GKM A;  3TJJ A;  1A8Y A;  2WCI A;  1DBY A;  1F6M C;  2GGT A;  3GN3 A;  2FGX A;  4LMW A;  3M3M A;  3VWW A;  4HZ4 A;  4AJ6 A;  3ZZX A;  2K18 A;  3LFL A;  2HI7 A;  1XXU A;  1MTC A;  1YEX A;  7GSS A;  2C3Q A;  2WRT A;  3WT1 A;  3CSJ A;  2HFD A;  2OJL A;  1WMJ A;  2O87 A;  1A2M A;  4N0Z A;  2CAI A;  4DVC A;  2RUF A;  4RUV A;  2GSS A;  4GLT A;  4WF4 A;  5GZZ B;  3ZTL A;  2I3Y A;  4POL A;  3E3E A;  2PU9 C;  2PVO C;  3I69 A;  3FK8 A;  4MCU A;  4OFT A;  5DQY A;  4NHW A;  3DVW A;  2LJK A;  4IJI A;  1RQM A;  5IPH A;  1M99 A;  2DJK A;  2GVP A;  5B8A A;  1VF2 A;  3OR5 A;  3HYP A;  4IN0 A;  4IS0 A;  3KIJ A;  1ERU A;  5CNW A;  2HNL A;  4BWS A;  1XCC A;  4ZL8 A;  3DD3 A;  4OMV A;  2ZUP A;  4I2U A;  1GSY A; 
#chains in the Genus database with same CATH topology
 5ECH B;  3UMA A;  3ME7 A;  4L8E A;  6GSU A;  2BMX A;  1PN9 A;  2FHE A;  2YN1 A;  4ZBD A;  4L5L A;  3UOM A;  4G9H A;  2K9F A;  5G1K A;  1LU4 A;  2AB6 A;  1S3R A;  4HJM A;  4F03 A;  1WWJ A;  1B4P A;  1K0N A;  3ME8 A;  1GUH A;  3CRT A;  2AYT A;  4V2N A;  1TU7 A;  4AJ7 A;  4WXT A;  1A2L A;  2ON5 A;  3DML A;  3AY8 A;  4MZC A;  2K8V A;  2GQM A;  6GSY A;  1G7E A;  2FWG A;  3CXG A;  2H74 A;  3ZMK A;  2DBC A;  2PVQ A;  3HD5 A;  1U88 A;  3GRX A;  1RK4 A;  2A4H A;  3TKQ A;  5D96 A;  3HJP A;  1FOV A;  2KHP A;  1ZL9 A;  4Q5R A;  5ECN B;  1GTU A;  1PN0 A;  5AN1 A;  5FWG A;  3KP9 A;  3GL5 A;  4YAP A;  3FZ9 A;  1UVZ A;  5G2Z A;  5AIX A;  5A4V A;  3F6F A;  2WS2 A;  2VAF A;  1PA3 A;  3IDV A;  2M72 A;  1SJI A;  2AAW A;  5EVO A;  3F4R A;  4AF2 A;  4TN8 A;  4MZB A;  2EIQ A;  3KH9 A;  1PX6 A;  1M9A A;  2LJR A;  1Z6N A;  2IWT A;  2KLX A;  5FHI A;  5KEJ A;  5IMD A;  5GAP D;  3VI7 A;  1UA5 A;  4X0X A;  1XWB A;  1XWA A;  5JCW A;  3D4M A;  4EC0 A;  4EL1 A;  2DJ1 A;  4FIW A;  5JWO B;  4KND A;  2X49 A;  2JAC A;  4PUF C;  1KBN A;  2E0Q A;  1MD4 A;  5J4U A;  4BL7 B;  2L59 A;  4O7H A;  3UVT A;  3IC8 A;  4HQZ A;  4IW9 A;  1KTE A;  4KDU A;  3G7I A;  1OE7 A;  3D6I A;  3P90 A;  1TOF A;  4ZBA A;  1J0F A;  3E0U A;  4TR3 A;  2BTO T;  4ICY A;  4XCS A;  3WT2 A;  3MIX A;  1V98 A;  2GZY A;  4WR5 A;  5CRG A;  3CQF A;  2CVB A;  3HJM A;  1XW5 A;  2VM2 A;  3UAR A;  3A5I A;  2CAQ A;  2PPT A;  3EU3 A;  2YCD A;  3LYP A;  2GLR A;  1EOH A;  2L4C A;  1MD3 A;  3UL3 A;  2I81 A;  3C7M A;  5G5F A;  3APS A;  2FLS A;  5DJM A;  5EL8 A;  4BVY A;  5ECS A;  2LV3 A;  4D73 B;  1XWC A;  3W6G A;  3KZQ A;  2GS3 A;  2JZR A;  3N5O A;  1RW1 A;  1QXH A;  3Q6O A;  4X1U A;  2IN3 A;  1X9W B;  1OC8 A;  2O7K A;  5KN1 A;  1X5C A;  2C0D A;  1M0U A;  4KSO A;  4NV5 A;  1LJR A;  1YEP A;  3A3T A;  4PNG A;  3GX0 A;  4LA1 A;  5KN3 A;  5ECO B;  3IAS 2;  1WOU A;  4J56 E;  3KTB A;  2JSZ A;  4JR6 A;  5AGY A;  5F05 A;  3GTU A;  2HXK A;  1GL8 A;  1TI1 A;  1GH2 A;  2YV7 A;  1TXX A;  2RLI A;  1AQX A;  1I9D A;  1TRU A;  4G0L A;  3MAK A;  4F0C A;  2OKA A;  1A24 A;  3EMX A;  3LXT A;  1FB0 A;  2OBI A;  2HT9 A;  3QD9 A;  3V1W A;  2KP2 A;  4WBJ A;  2MMZ A;  1B48 A;  4GXZ A;  2TRX A;  3KH7 A;  2N5F A;  3M1G A;  5D93 A;  3BBY A;  1QUW A;  4GTU A;  3MSZ A;  3TKP A;  3APQ A;  5LCZ A;  5J3R A;  3GV1 A;  3BCK A;  3GKK A;  4N0V A;  1NM3 A;  1TRV A;  2FUG 2;  1QFN A;  3RDW A;  5B7C A;  1XFL A;  3C1S A;  1FAA A;  1XBS A;  4WBR D;  2ZNM A;  2G2Q A;  2B5E A;  3RHB A;  2L57 A;  3TJG A;  2A2P A;  2A2R A;  1FVK A;  3ERW A;  4EIQ A;  1DE1 A;  1XPV A;  4I97 A;  4MPF A;  4WR4 A;  4CY6 A;  2R2J A;  3FR9 A;  17GS A;  3SBC A;  3D22 A;  2EC4 A;  2QGV A;  1AQV A;  2J23 A;  3EPT A;  2V41 A;  3ZVJ A;  3HDC A;  5D9T A;  2H0I A;  4MF5 A;  5G5E A;  3I43 A;  5ECI B;  3TB2 A;  4PUA A;  2VLV A;  3GUR A;  2VCQ A;  4XHM A;  3EMP A;  5IOX A;  3RPP A;  5CAX A;  3F3R A;  4ZL9 A;  4HS1 A;  3VFI A;  2IME A;  4F9Z A;  2P5R A;  3W8S A;  2AJQ B;  3EUR A;  2FY6 A;  2VLT A;  2X8G A;  1GUM A;  4K2D A;  4EIP A;  2R6K A;  3ZVJ D;  1AAZ A;  3EIN A;  1URM A;  4IQ1 A;  1ZYN A;  4OCF A;  2L6C A;  3C73 A;  3GUS A;  4K5S A;  3EC3 A;  2B7J A;  1EGO A;  4ACS A;  5HR0 A;  3NZN A;  3F0I A;  4I5Q A;  4NHZ A;  2GTU A;  2A2S A;  4GRF A;  2MBT A;  3TRQ A;  3VUR A;  2ZCT A;  1GTB A;  3BD2 A;  2H6X A;  2QKE A;  1BJX A;  1G0T A;  4MJC A;  1EWX A;  1GLP A;  1O6J A;  1SK1 A;  3ZRD A;  1R5P A;  2LEG A;  5JCU A;  2I1U A;  3DRN A;  4BIK A;  4XS1 A;  2C4J A;  4L0U A;  1G7O A;  4HZ2 A;  4ECJ A;  1PD2 1;  5H5R A;  2WDU A;  2F8A A;  4GQC A;  3LW9 A;  1JZR A;  3FEU A;  1FVJ A;  1Z5Y E;  2CQ9 A;  2DKI A;  3VPQ A;  1K0O A;  4OFN A;  2VCV A;  1ZOF A;  2O8V B;  12GS A;  4K9Z A;  2DJ0 A;  2QA1 A;  4PXO A;  1B9Y C;  2E7P A;  2WJU A;  4KX4 A;  4G10 A;  3UEM A;  1YDK A;  3TKS C;  3GYK A;  5GSS A;  4MMM A;  4PGT A;  5F0G A;  1KNG A;  1BG5 A;  3WGX A;  5DCG A;  2BJX A;  3N9J A;  2NBS A;  4FYC A;  3LWA A;  3FY7 A;  3O6T A;  2VLU A;  1X9S B;  2YAN A;  1Z7P A;  5BRT A;  2C0G A;  3J7Y k;  1XG8 A;  3ZFB A;  1ML6 A;  2IMD A;  3UAP A;  5G31 A;  3FHK A;  2DSA A;  3FRC A;  3QOU A;  5HFI A;  4BL7 A;  3O3T A;  1K0B A;  4HSC X;  1HNA A;  2AHE A;  2R37 A;  5B6N A;  1GUL A;  1G6Y A;  3GH9 A;  1YJ6 A;  1TU8 A;  3L78 A;  2X8C A;  1BYE A;  3LXZ A;  4QL7 A;  4Q5N A;  3ED3 A;  4K0N A;  5DAK B;  2RM6 A;  1QQ2 A;  3IBH A;  5ECK B;  3G7Y A;  4LLR A;  4G2E A;  1SD8 A;  2OE1 A;  5DAL B;  3WGD A;  3FYG A;  2DIZ A;  4ZB9 A;  2HZE B;  1GSE A;  2DIY A;  1F3A A;  4HUA A;  1T7P B;  4HOJ A;  1PMT A;  5J9C A;  2AUV A;  2JZT A;  3IPZ A;  2HSH A;  3TDG A;  1IYI A;  2B1K A;  1XZO A;  1TRW A;  2TRC P;  3FMW A;  3IA1 A;  4D73 A;  1O81 A;  1JZW A;  2HRN A;  3O76 A;  4MF7 A;  2GST A;  3KTL A;  4Z2R A;  2H0G A;  2R0P A;  1X9M B;  2IJY A;  4JZQ A;  5ECM B;  2CT6 A;  4ZL7 A;  2E2M A;  2VD1 A;  2FWH A;  5CP1 A;  4WF5 A;  3JCM L;  2DLX A;  1ON4 A;  3BJ5 A;  3VLN A;  4MJB A;  2C3T A;  3GKX A;  5D8I A;  1U3I A;  5HR2 A;  4V2L A;  2YWN A;  5A5K A;  1NSW A;  5DBQ A;  2IIY A;  3L9U A;  2DC5 A;  1OAZ A;  1SJ6 A;  4AGS A;  1T4Y A;  1OVN A;  1ZMA A;  3W8J A;  11GS A;  2L4Q A;  4XS6 A;  2GQK A;  4ML6 A;  1GSQ A;  2E2G A;  3HVV A;  1H75 A;  4TRX A;  3KCM A;  4RQX A;  1JZD A;  2B5X A;  4YAV A;  2X99 A;  1S3D A;  1ERV A;  3UVH A;  4MH3 A;  3CTG A;  2JAD A;  4HJ2 A;  16GS A;  2MZC A;  2QSI A;  5IOW A;  4IP6 A;  1R5A A;  1ZZY A;  4JU5 A;  10GS A;  2DML A;  3U5R E;  3HJO A;  1SKS B;  4IKH A;  2L5L A;  3F4S A;  3GMF A;  4GF0 A;  5JWQ B;  1PQN A;  5CRD A;  4ZIJ A;  2CVD A;  1DUG A;  2IFQ A;  2YV9 A;  1EOG A;  4EO3 A;  2LTK A;  2CZ2 A;  4RQR A;  1M3J A;  4TR4 A;  1PL2 A;  4HU7 A;  4P3Y B;  3GSS A;  4K6X A;  3FW2 A;  1YKA A;  3MWH A;  2FD3 A;  5LNK e;  4G0K A;  4MZW A;  2GT6 A;  1EEJ A;  2VL9 A;  4PUR A;  2VD0 A;  2X8H A;  3RHC A;  1Y25 A;  4EF0 A;  2UZ8 A;  1Y6E A;  4XRA A;  2GT5 A;  3ZFL A;  1T8E B;  1DSB A;  1SYX A;  1T4Z A;  4O92 A;  14GS A;  5LD0 A;  3H79 A;  3IXR A;  4QQ7 A;  1GSF A;  2R0G A;  5HFK A;  3QR6 A;  1S3A A;  2PGT A;  2J9H A;  2VL2 C;  4EUY A;  1F3B A;  1AXD A;  1SYR A;  1THO A;  4PTS A;  4F0B A;  4K7N A;  4V1A p;  1E6B A;  3RBT A;  3C71 A;  4NPB A;  1UC7 A;  1N2A A;  1Q98 A;  2H01 A;  3FZ4 A;  3ZL5 A;  4IHU A;  1OC9 B;  3TOT A;  5EY6 A;  2XBI A;  5J41 A;  4YKF A;  3D4T A;  2VM1 A;  1K0A A;  2PER A;  1WIK A;  5ELG A;  6GST A;  1TDI A;  9GSS A;  1XW9 A;  3TKS A;  1X0R A;  3IV4 A;  4OCE A;  1PKW A;  1WPI A;  5B8B A;  1GRX A;  3PIN A;  2LQQ A;  1MDJ A;  4ECC A;  4X4J A;  6GSX A;  3QPM A;  3U6V A;  4TVE A;  1Q4J A;  5F8B A;  4X43 A;  3EWL A;  5F07 A;  4KB3 A;  1TRS A;  4TOP A;  1PGT A;  4KE3 A;  1UN2 A;  2LQO A;  4HI7 A;  2N5B A;  3QFA C;  1GLQ A;  4MNN A;  2H1B A;  3D21 A;  4BVX B;  1XVQ A;  2YJ7 A;  5ENU A;  3L0H A;  2V1M A;  5E4W A;  4WEY A;  3CSH A;  3VWU A;  2HZF A;  2XPE A;  2PMT A;  3QDN A;  2FA4 A;  2B7K A;  1GSU A;  4FO5 A;  2GQL A;  4TR1 B;  5ABR A;  4Q5F A;  1EGR A;  1H4O A;  1JHB A;  2G0F A;  2H75 A;  3TRP A;  4GST A;  2MBS A;  5DCH A;  3TJB A;  4XTS A;  5JWR B;  1JFU A;  3MYD A;  1V2A A;  3E9J B;  3D0Z A;  1F37 A;  2B1L A;  4FYB A;  5H5S A;  3G7J A;  4MJA A;  1OYJ A;  20GS A;  3R3E A;  4K7I A;  5HQP A;  3Q74 A;  1R4W A;  3GKN A;  3TJF A;  3GA4 A;  3HHV A;  2VCZ A;  5DAK A;  3M9J A;  4ILF A;  5IQY A;  4OD7 A;  4MLY A;  4JED A;  5DAL A;  2LKU A;  4KDY A;  2AV4 A;  1TKD B;  2VCX A;  2WZ9 A;  3HZ4 A;  4KDX A;  1G6W A;  3LEF A;  4TXV A;  3SWL A;  3IOS A;  4XIH A;  2OE3 A;  3F3Q A;  2EIO A;  3PGT A;  1M3I A;  2FWE A;  2WFC A;  2MMN A;  3CMI A;  2H71 A;  3J7Y b;  2H1G A;  2R3X A;  3L9V A;  3C1R A;  4MA9 A;  3KD0 A;  5COH A;  4MF6 A;  4NMU A;  4F82 A;  3NIV A;  2HRF A;  4FQU A;  5J5N A;  3QMX A;  4EXJ A;  1NHY A;  1YZX A;  2B3S A;  2YP6 A;  3DGQ A;  4I2T A;  2H72 A;  2DKH A;  3BOA A;  4Z2U A;  4BWQ A;  2JZS A;  3KJY A;  5IMV A;  4CW9 A;  3CBU A;  4K2X A;  5CRE A;  5F06 A;  2YWM A;  3GNJ A;  2H1A A;  5G1L A;  3L9S A;  4L0W A;  2CA8 A;  5H5Q A;  3LYK A;  2NTO A;  4QL9 A;  1V40 A;  3KGK A;  2L6D A;  1ABA A;  2RM5 A;  2C80 A;  1V9W A;  1WE0 A;  4O5U A;  5A4U A;  2YJH A;  1GTA A;  1O7U A;  4EDY A;  4OFM A;  2TIR A;  3TJK A;  1VF3 A;  1BX9 A;  3TUE A;  3VI5 A;  2F9S A;  2IMI A;  1K3L A;  5G30 A;  1EZK A;  6GSW A;  2VL2 A;  3UIW A;  3GST A;  3WGE A;  3FZA A;  4ZB6 A;  5ID2 B;  2IPA A;  1W4V A;  4ECB A;  18GS A;  2V2G A;  2N5A A;  2X4A A;  4EKZ A;  2O85 A;  1K3Y A;  1VGL A;  4MPG A;  2C3N A;  1XWK A;  2M80 A;  4Q5Q A;  3HKR A;  4GSS A;  3D5J A;  3Q18 A;  1GSS A;  2KP1 A;  5C04 A;  4MH2 A;  1I5G A;  3FR3 A;  3IR4 A;  2V6K A;  3CYN A;  2H6Z A;  3I9V 2;  3WD6 A;  4HQS A;  5D73 A;  1AC1 A;  4BVY B;  3H8Q A;  2LNT A;  3TGZ A;  2VCT A;  1M2A A;  4Z2T A;  1K0M A;  2HRA A;  2P0G A;  2PN8 A;  1MEK A;  2IMK A;  3LQ7 A;  1ILO A;  3QAW A;  3K8N A;  2WGR A;  5DVB A;  3CTF A;  1T3B A;  1OE8 A;  2WB9 A;  2R4V A;  2K6V A;  4MDC A;  2P31 A;  4NXI A;  2H66 A;  3GTU B;  2GZP A;  1R26 A;  4MP4 A;  4K7O A;  3KMN A;  3APO A;  2NDO A;  2OAD A;  4KA0 A;  2GZZ A;  1XVW A;  5GAN D;  1GWC A;  4G0I A;  4I8B A;  5AIV A;  4HEA 2;  4JR4 A;  4EE0 A;  2DJ2 A;  1ERT A;  1FOH A;  3TKS E;  4POB A;  4DEJ A;  5IM9 A;  1E2Y A;  5DQS A;  3A2X A;  4HU9 A;  2OAC A;  2XPD A;  2NVL A;  1W89 A;  3RPN A;  1PRX A;  2B5Y A;  2VOC A;  3KEB A;  3ZIT A;  2KOK A;  2H76 A;  1B4Q A;  5ECQ B;  1HNB A;  3WYW A;  1OKD A;  3LSZ A;  4KCE A;  3GHA A;  3DXB A;  2MMA A;  4BVX A;  3DEX A;  2RII A;  3LJR A;  1YF0 A;  1NW2 A;  3NOF A;  2PUK C;  1J08 A;  5DJL A;  3DKS A;  4FH8 A;  1VRS D;  3TCO A;  1XOA A;  2H19 A;  3IK9 A;  2FWF A;  3GH6 A;  2CV4 A;  3F8U A;  4TR1 A;  4POM A;  4N10 A;  4J57 E;  2JL4 A;  3ZYW A;  3FR6 A;  4TKY A;  1XW6 A;  3A2W A;  4PQH A;  3A2V A;  1SKW B;  1WRY A;  2Z9S A;  3H4K A;  1BQ7 A;  4DSS B;  2OA7 A;  1AIU A;  2A4V A;  2QC7 A;  3KXO A;  4IP1 A;  5CO3 A;  1V58 A;  4KF9 A;  3IAM 2;  1Z3E A;  4K8M A;  2HLS A;  3I6A A;  2RUE A;  1JLW A;  1M7T A;  4RI7 A;  2LRC A;  3DWV A;  1A0R P;  2LRT A;  2H8L A;  5HFG A;  2GDR A;  1BED A;  1DE2 A;  2F3M A;  3P7X A;  1Z6M A;  1WJK A;  1JZO A;  2O89 A;  2D2Z A;  2YZH A;  1SL2 B;  2ES7 A;  2GSQ A;  3MDK A;  3F9U A;  4O5Q A;  3M0F A;  4N30 A;  1FW1 A;  5KOW A;  3CRU A;  5C00 A;  1VF4 A;  1R7H A;  1HD2 A;  1A2J A;  4CHS A;  1X5E A;  1TJD A;  5A4W A;  1SJZ A;  5KN0 A;  3EYT A;  5ELA A;  1ZYQ B;  4YH2 A;  2PWJ A;  1O73 A;  1M9B A;  3G9B A;  6GSV A;  2DJ3 A;  4GQF A;  1HNC A;  2H30 A;  4PQ1 A;  3HXS A;  3GFK A;  4OO5 A;  2OBK A;  3P2A A;  1EP7 A;  4KAE A;  2XBQ A;  4O32 A;  2KUC A;  5IMZ A;  2VCW A;  1ZYP A;  1LBK A;  4DSQ A;  1QGV A;  3VPT A;  1SEN A;  3UJ1 A;  5D9X A;  3S9F A;  4K0G A;  2I9H A;  4NAX A;  3US3 A;  1FG4 A;  1B9X C;  4XS4 B;  2CVK A;  4XRD A;  3HZ8 A;  3IE3 A;  1ACV A;  2YOI A;  4MAB A;  1SD9 A;  1WP0 A;  2V6O A;  1U3A A;  5D9V A;  2EIR A;  3ERG A;  2H1D A;  2XC2 A;  1AW9 A;  1GUK A;  2IMF A;  4LL1 B;  2OE0 A;  3UBK A;  1GSD A;  3ZRE A;  4A5P A;  5JCG A;  1HYU A;  5J9B A;  5KN2 A;  1SKR B;  1K0C A;  2R5G A;  2CX4 A;  4YQU A;  2FCH A;  5IO2 A;  1F9M A;  4F2I A;  1F2E A;  6GSS A;  4JBB A;  2CX3 A;  2MMO A;  1ZGN A;  1PSQ A;  4TXO B;  1O8X A;  1XWG A;  4GSN A;  2L5O A;  1M2B A;  4OWY A;  5ID2 A;  3A5W A;  4NWY A;  4PQI A;  5CRW A;  3R2Q A;  5HR1 A;  3PPU A;  4ZB8 A;  3LOR A;  1YY7 A;  2LS5 A;  1K0D A;  3ERF A;  2HSY A;  2FNO A;  3QCP A;  4O5R A;  1CQG A;  3BCI A;  2R0C A;  4KSM A;  3ZIV A;  1USB A;  2LJA A;  3QAV A;  5IPG A;  2C0F A;  2F51 A;  4G19 A;  3VK9 A;  4I6X A;  2GSR A;  5B6M A;  2VIM A;  4KH7 A;  4GWR A;  5EPF A;  5E59 A;  1IYH A;  3HCZ A;  2CZ3 A;  1XIY A;  1JLV A;  3DIE A;  1QK8 A;  5FT3 A;  4E8H A;  1TK0 B;  4IQA A;  1ST9 A;  3M8N A;  1TK8 B;  1ZYE A;  4KGI A;  1PKZ A;  4H86 A;  2H6Y A;  3FZ5 A;  1YQ1 A;  2YZU A;  3RAZ A;  1Z7R A;  3HA9 A;  8GSS A;  2YWI A;  5KOX A;  1VF1 A;  2LRN A;  3GL3 A;  2REM A;  1GP1 A;  1THX A;  3ZIJ A;  3KMO A;  3DVX A;  4ML1 A;  19GS A;  2LST A;  4TR0 A;  2ALB A;  1U87 A;  4HDE A;  2HZE A;  1O85 A;  1U6T A;  2XHF A;  1YF1 A;  3Q19 A;  2HE3 A;  5AIS A;  5IMF A;  1B8X A;  2LNS A;  5ECL B;  2JU5 A;  1Z9H A;  3IHG A;  1AUC A;  3HVS A;  1A8L A;  1PL1 A;  1PFO A;  5IMC A;  1A23 A;  1FHE A;  2H73 A;  2I4A A;  4MK3 A;  2IFQ B;  3H93 A;  4ZXG A;  1GNW A;  1O8W A;  2HYX A;  1EP8 A;  2PBJ A;  3IC4 A;  3GIX A;  2LUS A;  2DJJ A;  1FB6 A;  4IBP A;  3EE2 A;  1J9B A;  1FO5 A;  5IIZ A;  4MJE A;  1GTI A;  1K3O A;  4ULX A;  2FA8 A;  4POK A;  1A0F A;  2JSY A;  1C72 A;  2V32 A;  4IGJ A;  1QMV A;  3EVI A;  4USS A;  2P5Q A;  1SU9 A;  4N11 A;  5CRH A;  3UBL A;  2VUP A;  4K5R A;  1AQW A;  3QAG A;  4CDO A;  3TKR A;  4DSS A;  1M2D A;  2ON7 A;  1EV4 A;  4NV2 A;  3LGC A;  4KW6 A;  1EV9 A;  3LG6 A;  2VO4 A;  2YWO A;  3VWX A;  1XOB A;  4BA7 A;  1ZCP A;  4IVF A;  3H1N A;  1TW9 A;  3QFB C;  4LL4 B;  1ERW A;  1MDI A;  4J2F A;  3DYR A;  3IK7 A;  1MDK A;  1SK0 A;  3ZML A;  3M9K A;  1GNE A;  4IEL A;  13GS A;  22GS A;  3VWV A;  3EU4 A;  5ECR B;  4FYU A;  3FKF A;  1V57 A;  3HVX A;  1TK5 B;  4AJ8 A;  4K1F A;  1HQO A;  5BMU A;  5IO0 A;  2HRK A;  4WKW A;  1CQH A;  2X64 A;  3KP8 A;  3TRX A;  4L5O A;  1PX7 A;  1NHO A;  4KUN A;  3HY2 A;  1OC3 A;  2C0E A;  2H70 A;  2WUL A;  4Z7X A;  3KM6 A;  4JRR A;  1SK2 A;  1TP9 A;  2YNX A;  4GCI A;  3TOU A;  1N8J A;  4IJ3 A;  3F63 A;  4ZBB A;  3PH9 A;  2HSM A;  1SL1 B;  4V2M A;  4WET A;  1X5D A;  4V1A g;  3L4N A;  4KCA A;  5DDL A;  5GST A;  3ISO A;  3F4T A;  1TTZ A;  1EEM A;  1T00 A;  4E8E A;  2NPB A;  2C1Y A;  4ZIL A;  1BAY A;  1SL0 B;  2MYG A;  4CY8 A;  4RI6 A;  4DSR A;  2K8S A;  1OKT A;  5INY A;  4ISD A;  4BPY A;  5CYY A;  4ECI A;  5HR3 A;  4XS4 A;  5IMA A;  4JE1 A;  5L71 A;  3IRA A;  5D9W A;  2IL3 A;  4PNF A;  3MNG A;  4YQV A;  3GX8 A;  2DMM A;  3F6D A;  1OC9 A;  2H0H A;  3P8W A;  3CSI A;  4ID0 A;  2C8U A;  4EDZ A;  4EVM A;  2F8F A;  2QA2 A;  3ZLP A;  2YPM A;  1YKC A;  4TW5 A;  2VL3 A;  2B6M A;  1TI3 A;  3IHQ A;  4OO4 A;  3PR8 A;  1KEB A;  1T1V A;  2M46 A;  1S3C A;  4TXO A;  3C8E A;  4PX1 A;  4LMV A;  5ECP B;  4YQM A;  3GKM A;  3TJJ A;  1A8Y A;  2WCI A;  1DBY A;  1F6M C;  2GGT A;  3GN3 A;  2FGX A;  4LMW A;  3M3M A;  3VWW A;  4HZ4 A;  4AJ6 A;  3ZZX A;  2K18 A;  3LFL A;  2HI7 A;  1XXU A;  1MTC A;  1YEX A;  7GSS A;  2C3Q A;  2WRT A;  3HVN A;  3WT1 A;  3CSJ A;  2HFD A;  2OJL A;  1WMJ A;  2O87 A;  1A2M A;  4N0Z A;  2CAI A;  4DVC A;  2RUF A;  4RUV A;  2GSS A;  4GLT A;  4WF4 A;  5GZZ B;  3ZTL A;  2I3Y A;  4POL A;  3E3E A;  2PU9 C;  2PVO C;  3I69 A;  3FK8 A;  4MCU A;  4OFT A;  5DQY A;  4NHW A;  3DVW A;  2LJK A;  4IJI A;  1RQM A;  5IPH A;  1M99 A;  2DJK A;  2GVP A;  5B8A A;  1VF2 A;  3OR5 A;  4YKG A;  3HYP A;  4IN0 A;  4IS0 A;  3KIJ A;  1ERU A;  5CNW A;  2HNL A;  4BWS A;  1XCC A;  4ZL8 A;  3DD3 A;  4OMV A;  2ZUP A;  4I2U A;  1GSY A; 
#chains in the Genus database with same CATH homology
 5ECH B;  3UMA A;  3ME7 A;  4L8E A;  6GSU A;  2BMX A;  1PN9 A;  2FHE A;  2YN1 A;  4ZBD A;  4L5L A;  3UOM A;  4G9H A;  2K9F A;  5G1K A;  1LU4 A;  2AB6 A;  4HJM A;  4F03 A;  1WWJ A;  1B4P A;  1K0N A;  3ME8 A;  1GUH A;  3CRT A;  2AYT A;  4V2N A;  1TU7 A;  4AJ7 A;  4WXT A;  1A2L A;  2ON5 A;  3DML A;  3AY8 A;  4MZC A;  2K8V A;  2GQM A;  6GSY A;  1G7E A;  2FWG A;  3CXG A;  2H74 A;  3ZMK A;  2DBC A;  2PVQ A;  3HD5 A;  1U88 A;  3GRX A;  1RK4 A;  2A4H A;  3TKQ A;  5D96 A;  3HJP A;  1FOV A;  2KHP A;  1ZL9 A;  4Q5R A;  5ECN B;  1GTU A;  1PN0 A;  5AN1 A;  5FWG A;  3KP9 A;  3GL5 A;  4YAP A;  3FZ9 A;  1UVZ A;  5G2Z A;  5AIX A;  5A4V A;  3F6F A;  2WS2 A;  2VAF A;  1PA3 A;  3IDV A;  2M72 A;  1SJI A;  2AAW A;  5EVO A;  3F4R A;  4AF2 A;  4TN8 A;  4MZB A;  2EIQ A;  3KH9 A;  1PX6 A;  1M9A A;  2LJR A;  1Z6N A;  2IWT A;  2KLX A;  5FHI A;  5KEJ A;  5IMD A;  5GAP D;  3VI7 A;  1UA5 A;  4X0X A;  1XWB A;  1XWA A;  5JCW A;  3D4M A;  4EC0 A;  4EL1 A;  2DJ1 A;  4FIW A;  5JWO B;  4KND A;  2X49 A;  2JAC A;  4PUF C;  1KBN A;  2E0Q A;  1MD4 A;  5J4U A;  4BL7 B;  2L59 A;  4O7H A;  3UVT A;  3IC8 A;  4HQZ A;  4IW9 A;  1KTE A;  4KDU A;  3G7I A;  1OE7 A;  3D6I A;  3P90 A;  1TOF A;  4ZBA A;  1J0F A;  3E0U A;  4TR3 A;  2BTO T;  4ICY A;  4XCS A;  3WT2 A;  3MIX A;  1V98 A;  2GZY A;  4WR5 A;  5CRG A;  2CVB A;  3HJM A;  1XW5 A;  2VM2 A;  3UAR A;  3A5I A;  2CAQ A;  2PPT A;  3EU3 A;  2YCD A;  3LYP A;  2GLR A;  1EOH A;  2L4C A;  1MD3 A;  3UL3 A;  2I81 A;  3C7M A;  5G5F A;  3APS A;  2FLS A;  5DJM A;  5EL8 A;  4BVY A;  5ECS A;  2LV3 A;  4D73 B;  1XWC A;  3W6G A;  3KZQ A;  2GS3 A;  2JZR A;  3N5O A;  1RW1 A;  1QXH A;  3Q6O A;  4X1U A;  2IN3 A;  1X9W B;  1OC8 A;  2O7K A;  5KN1 A;  1X5C A;  2C0D A;  1M0U A;  4KSO A;  4NV5 A;  1LJR A;  1YEP A;  3A3T A;  4PNG A;  3GX0 A;  4LA1 A;  5KN3 A;  5ECO B;  3IAS 2;  1WOU A;  4J56 E;  3KTB A;  2JSZ A;  4JR6 A;  5AGY A;  5F05 A;  3GTU A;  2HXK A;  1GL8 A;  1TI1 A;  1GH2 A;  2YV7 A;  1TXX A;  2RLI A;  1AQX A;  1I9D A;  1TRU A;  4G0L A;  3MAK A;  4F0C A;  2OKA A;  1A24 A;  3EMX A;  3LXT A;  1FB0 A;  2OBI A;  2HT9 A;  3QD9 A;  3V1W A;  2KP2 A;  4WBJ A;  2MMZ A;  1B48 A;  4GXZ A;  2TRX A;  3KH7 A;  2N5F A;  3M1G A;  5D93 A;  3BBY A;  1QUW A;  4GTU A;  3MSZ A;  3TKP A;  3APQ A;  5LCZ A;  5J3R A;  3GV1 A;  3BCK A;  3GKK A;  4N0V A;  1NM3 A;  1TRV A;  2FUG 2;  1QFN A;  3RDW A;  5B7C A;  1XFL A;  3C1S A;  1FAA A;  1XBS A;  4WBR D;  2ZNM A;  2G2Q A;  2B5E A;  3RHB A;  2L57 A;  3TJG A;  2A2P A;  2A2R A;  1FVK A;  3ERW A;  4EIQ A;  1DE1 A;  1XPV A;  4I97 A;  4MPF A;  4WR4 A;  4CY6 A;  2R2J A;  3FR9 A;  17GS A;  3SBC A;  3D22 A;  2EC4 A;  2QGV A;  1AQV A;  2J23 A;  3EPT A;  2V41 A;  3ZVJ A;  3HDC A;  5D9T A;  2H0I A;  4MF5 A;  5G5E A;  3I43 A;  5ECI B;  3TB2 A;  4PUA A;  2VLV A;  3GUR A;  2VCQ A;  4XHM A;  3EMP A;  5IOX A;  3RPP A;  5CAX A;  3F3R A;  4ZL9 A;  4HS1 A;  3VFI A;  2IME A;  4F9Z A;  2P5R A;  3W8S A;  2AJQ B;  3EUR A;  2FY6 A;  2VLT A;  2X8G A;  1GUM A;  4K2D A;  4EIP A;  2R6K A;  3ZVJ D;  1AAZ A;  3EIN A;  1URM A;  4IQ1 A;  1ZYN A;  4OCF A;  2L6C A;  3C73 A;  3GUS A;  4K5S A;  3EC3 A;  2B7J A;  1EGO A;  4ACS A;  5HR0 A;  3NZN A;  3F0I A;  4I5Q A;  4NHZ A;  2GTU A;  2A2S A;  4GRF A;  2MBT A;  3TRQ A;  3VUR A;  2ZCT A;  1GTB A;  3BD2 A;  2H6X A;  2QKE A;  1BJX A;  1G0T A;  4MJC A;  1EWX A;  1GLP A;  1O6J A;  1SK1 A;  3ZRD A;  1R5P A;  2LEG A;  5JCU A;  2I1U A;  3DRN A;  4XS1 A;  2C4J A;  4L0U A;  1G7O A;  4HZ2 A;  4ECJ A;  1PD2 1;  5H5R A;  2WDU A;  2F8A A;  4GQC A;  3LW9 A;  1JZR A;  3FEU A;  1FVJ A;  1Z5Y E;  2CQ9 A;  2DKI A;  3VPQ A;  1K0O A;  4OFN A;  2VCV A;  1ZOF A;  2O8V B;  12GS A;  4K9Z A;  2DJ0 A;  2QA1 A;  4PXO A;  1B9Y C;  2E7P A;  2WJU A;  4KX4 A;  4G10 A;  3UEM A;  1YDK A;  3TKS C;  3GYK A;  5GSS A;  4MMM A;  4PGT A;  5F0G A;  1KNG A;  1BG5 A;  3WGX A;  5DCG A;  2BJX A;  3N9J A;  2NBS A;  4FYC A;  3LWA A;  3FY7 A;  3O6T A;  2VLU A;  1X9S B;  2YAN A;  1Z7P A;  5BRT A;  2C0G A;  3J7Y k;  3ZFB A;  1ML6 A;  2IMD A;  3UAP A;  5G31 A;  3FHK A;  2DSA A;  3FRC A;  3QOU A;  5HFI A;  4BL7 A;  3O3T A;  1K0B A;  1HNA A;  2AHE A;  2R37 A;  5B6N A;  1GUL A;  1G6Y A;  3GH9 A;  1YJ6 A;  1TU8 A;  3L78 A;  2X8C A;  1BYE A;  3LXZ A;  4QL7 A;  4Q5N A;  3ED3 A;  4K0N A;  5DAK B;  2RM6 A;  1QQ2 A;  3IBH A;  5ECK B;  3G7Y A;  4LLR A;  4G2E A;  1SD8 A;  2OE1 A;  5DAL B;  3WGD A;  3FYG A;  2DIZ A;  4ZB9 A;  2HZE B;  1GSE A;  2DIY A;  1F3A A;  4HUA A;  1T7P B;  4HOJ A;  1PMT A;  5J9C A;  2AUV A;  2JZT A;  3IPZ A;  2HSH A;  3TDG A;  1IYI A;  2B1K A;  1XZO A;  1TRW A;  2TRC P;  3FMW A;  3IA1 A;  4D73 A;  1O81 A;  1JZW A;  2HRN A;  3O76 A;  4MF7 A;  2GST A;  3KTL A;  4Z2R A;  2H0G A;  2R0P A;  1X9M B;  2IJY A;  4JZQ A;  5ECM B;  2CT6 A;  4ZL7 A;  2E2M A;  2VD1 A;  2FWH A;  5CP1 A;  4WF5 A;  3JCM L;  2DLX A;  1ON4 A;  3BJ5 A;  3VLN A;  4MJB A;  2C3T A;  3GKX A;  5D8I A;  1U3I A;  5HR2 A;  4V2L A;  2YWN A;  5A5K A;  1NSW A;  5DBQ A;  2IIY A;  3L9U A;  2DC5 A;  1OAZ A;  1SJ6 A;  4AGS A;  1T4Y A;  1OVN A;  1ZMA A;  3W8J A;  11GS A;  2L4Q A;  4XS6 A;  2GQK A;  4ML6 A;  1GSQ A;  2E2G A;  3HVV A;  1H75 A;  4TRX A;  3KCM A;  4RQX A;  1JZD A;  2B5X A;  4YAV A;  2X99 A;  1S3D A;  1ERV A;  3UVH A;  4MH3 A;  3CTG A;  2JAD A;  4HJ2 A;  16GS A;  2MZC A;  2QSI A;  5IOW A;  4IP6 A;  1R5A A;  1ZZY A;  4JU5 A;  10GS A;  2DML A;  3U5R E;  3HJO A;  1SKS B;  4IKH A;  2L5L A;  3F4S A;  3GMF A;  4GF0 A;  5JWQ B;  1PQN A;  5CRD A;  4ZIJ A;  2CVD A;  1DUG A;  2IFQ A;  2YV9 A;  1EOG A;  4EO3 A;  2LTK A;  2CZ2 A;  4RQR A;  4TR4 A;  1PL2 A;  4HU7 A;  4P3Y B;  3GSS A;  4K6X A;  3FW2 A;  1YKA A;  3MWH A;  2FD3 A;  5LNK e;  4G0K A;  4MZW A;  2GT6 A;  1EEJ A;  2VL9 A;  4PUR A;  2VD0 A;  2X8H A;  3RHC A;  1Y25 A;  4EF0 A;  2UZ8 A;  1Y6E A;  4XRA A;  2GT5 A;  3ZFL A;  1T8E B;  1DSB A;  1SYX A;  1T4Z A;  4O92 A;  14GS A;  5LD0 A;  3H79 A;  3IXR A;  4QQ7 A;  1GSF A;  2R0G A;  5HFK A;  3QR6 A;  1S3A A;  2PGT A;  2J9H A;  2VL2 C;  4EUY A;  1F3B A;  1AXD A;  1SYR A;  1THO A;  4PTS A;  4F0B A;  4K7N A;  4V1A p;  1E6B A;  3RBT A;  3C71 A;  4NPB A;  1UC7 A;  1N2A A;  1Q98 A;  2H01 A;  3FZ4 A;  3ZL5 A;  4IHU A;  1OC9 B;  3TOT A;  5EY6 A;  2XBI A;  5J41 A;  4YKF A;  3D4T A;  2VM1 A;  1K0A A;  2PER A;  1WIK A;  5ELG A;  6GST A;  1TDI A;  9GSS A;  1XW9 A;  3TKS A;  1X0R A;  3IV4 A;  4OCE A;  1PKW A;  1WPI A;  5B8B A;  1GRX A;  3PIN A;  2LQQ A;  1MDJ A;  4ECC A;  4X4J A;  6GSX A;  3QPM A;  3U6V A;  4TVE A;  1Q4J A;  5F8B A;  4X43 A;  3EWL A;  5F07 A;  4KB3 A;  1TRS A;  4TOP A;  1PGT A;  4KE3 A;  1UN2 A;  2LQO A;  4HI7 A;  2N5B A;  3QFA C;  1GLQ A;  4MNN A;  2H1B A;  3D21 A;  4BVX B;  1XVQ A;  2YJ7 A;  5ENU A;  3L0H A;  2V1M A;  5E4W A;  4WEY A;  3CSH A;  3VWU A;  2HZF A;  2XPE A;  2PMT A;  3QDN A;  2FA4 A;  2B7K A;  1GSU A;  4FO5 A;  2GQL A;  4TR1 B;  5ABR A;  4Q5F A;  1EGR A;  1H4O A;  1JHB A;  2G0F A;  2H75 A;  3TRP A;  4GST A;  2MBS A;  5DCH A;  3TJB A;  4XTS A;  5JWR B;  1JFU A;  3MYD A;  1V2A A;  3E9J B;  3D0Z A;  1F37 A;  2B1L A;  4FYB A;  5H5S A;  3G7J A;  4MJA A;  1OYJ A;  20GS A;  3R3E A;  4K7I A;  5HQP A;  3Q74 A;  1R4W A;  3GKN A;  3TJF A;  3GA4 A;  3HHV A;  2VCZ A;  5DAK A;  3M9J A;  4ILF A;  5IQY A;  4OD7 A;  4MLY A;  4JED A;  5DAL A;  2LKU A;  4KDY A;  2AV4 A;  1TKD B;  2VCX A;  2WZ9 A;  3HZ4 A;  4KDX A;  1G6W A;  3LEF A;  4TXV A;  3SWL A;  3IOS A;  4XIH A;  2OE3 A;  3F3Q A;  2EIO A;  3PGT A;  2FWE A;  2WFC A;  2MMN A;  3CMI A;  2H71 A;  3J7Y b;  2H1G A;  2R3X A;  3L9V A;  3C1R A;  4MA9 A;  3KD0 A;  5COH A;  4MF6 A;  4NMU A;  4F82 A;  3NIV A;  2HRF A;  4FQU A;  5J5N A;  3QMX A;  4EXJ A;  1NHY A;  1YZX A;  2B3S A;  2YP6 A;  3DGQ A;  4I2T A;  2H72 A;  2DKH A;  3BOA A;  4Z2U A;  4BWQ A;  2JZS A;  3KJY A;  5IMV A;  4CW9 A;  3CBU A;  4K2X A;  5CRE A;  5F06 A;  2YWM A;  3GNJ A;  2H1A A;  5G1L A;  3L9S A;  4L0W A;  2CA8 A;  5H5Q A;  3LYK A;  2NTO A;  4QL9 A;  1V40 A;  3KGK A;  2L6D A;  1ABA A;  2RM5 A;  2C80 A;  1V9W A;  1WE0 A;  4O5U A;  5A4U A;  2YJH A;  1GTA A;  1O7U A;  4EDY A;  4OFM A;  2TIR A;  3TJK A;  1VF3 A;  1BX9 A;  3TUE A;  3VI5 A;  2F9S A;  2IMI A;  1K3L A;  5G30 A;  1EZK A;  6GSW A;  2VL2 A;  3UIW A;  3GST A;  3WGE A;  3FZA A;  4ZB6 A;  5ID2 B;  2IPA A;  1W4V A;  4ECB A;  18GS A;  2V2G A;  2N5A A;  2X4A A;  4EKZ A;  2O85 A;  1K3Y A;  1VGL A;  4MPG A;  2C3N A;  1XWK A;  2M80 A;  4Q5Q A;  3HKR A;  4GSS A;  3D5J A;  3Q18 A;  1GSS A;  2KP1 A;  5C04 A;  4MH2 A;  1I5G A;  3FR3 A;  3IR4 A;  2V6K A;  3CYN A;  2H6Z A;  3I9V 2;  3WD6 A;  4HQS A;  5D73 A;  1AC1 A;  4BVY B;  3H8Q A;  2LNT A;  3TGZ A;  2VCT A;  1M2A A;  4Z2T A;  1K0M A;  2HRA A;  2P0G A;  2PN8 A;  1MEK A;  2IMK A;  3LQ7 A;  1ILO A;  3QAW A;  3K8N A;  2WGR A;  5DVB A;  3CTF A;  1T3B A;  1OE8 A;  2WB9 A;  2R4V A;  2K6V A;  4MDC A;  2P31 A;  4NXI A;  2H66 A;  3GTU B;  2GZP A;  1R26 A;  4MP4 A;  4K7O A;  3KMN A;  3APO A;  2NDO A;  2OAD A;  4KA0 A;  2GZZ A;  1XVW A;  5GAN D;  1GWC A;  4G0I A;  4I8B A;  5AIV A;  4HEA 2;  4JR4 A;  4EE0 A;  2DJ2 A;  1ERT A;  1FOH A;  3TKS E;  4POB A;  4DEJ A;  5IM9 A;  1E2Y A;  5DQS A;  3A2X A;  4HU9 A;  2OAC A;  2XPD A;  2NVL A;  1W89 A;  3RPN A;  1PRX A;  2B5Y A;  2VOC A;  3KEB A;  3ZIT A;  2KOK A;  2H76 A;  1B4Q A;  5ECQ B;  1HNB A;  3WYW A;  1OKD A;  3LSZ A;  4KCE A;  3GHA A;  3DXB A;  2MMA A;  4BVX A;  3DEX A;  2RII A;  3LJR A;  1YF0 A;  1NW2 A;  3NOF A;  2PUK C;  1J08 A;  5DJL A;  3DKS A;  4FH8 A;  1VRS D;  3TCO A;  1XOA A;  2H19 A;  3IK9 A;  2FWF A;  3GH6 A;  2CV4 A;  3F8U A;  4TR1 A;  4POM A;  4N10 A;  4J57 E;  2JL4 A;  3ZYW A;  3FR6 A;  4TKY A;  1XW6 A;  3A2W A;  4PQH A;  3A2V A;  1SKW B;  1WRY A;  2Z9S A;  3H4K A;  1BQ7 A;  4DSS B;  2OA7 A;  1AIU A;  2A4V A;  2QC7 A;  3KXO A;  4IP1 A;  5CO3 A;  1V58 A;  4KF9 A;  3IAM 2;  1Z3E A;  4K8M A;  2HLS A;  3I6A A;  2RUE A;  1JLW A;  1M7T A;  4RI7 A;  2LRC A;  3DWV A;  1A0R P;  2LRT A;  2H8L A;  5HFG A;  2GDR A;  1BED A;  1DE2 A;  2F3M A;  3P7X A;  1Z6M A;  1WJK A;  1JZO A;  2O89 A;  2D2Z A;  2YZH A;  1SL2 B;  2ES7 A;  2GSQ A;  3MDK A;  3F9U A;  4O5Q A;  3M0F A;  4N30 A;  1FW1 A;  5KOW A;  3CRU A;  5C00 A;  1VF4 A;  1R7H A;  1HD2 A;  1A2J A;  4CHS A;  1X5E A;  1TJD A;  5A4W A;  1SJZ A;  5KN0 A;  3EYT A;  5ELA A;  1ZYQ B;  4YH2 A;  2PWJ A;  1O73 A;  1M9B A;  3G9B A;  6GSV A;  2DJ3 A;  4GQF A;  1HNC A;  2H30 A;  4PQ1 A;  3HXS A;  3GFK A;  4OO5 A;  2OBK A;  3P2A A;  1EP7 A;  4KAE A;  2XBQ A;  4O32 A;  2KUC A;  5IMZ A;  2VCW A;  1ZYP A;  1LBK A;  4DSQ A;  1QGV A;  3VPT A;  1SEN A;  3UJ1 A;  5D9X A;  3S9F A;  4K0G A;  2I9H A;  4NAX A;  3US3 A;  1FG4 A;  1B9X C;  4XS4 B;  2CVK A;  4XRD A;  3HZ8 A;  3IE3 A;  1ACV A;  2YOI A;  4MAB A;  1SD9 A;  1WP0 A;  2V6O A;  1U3A A;  5D9V A;  2EIR A;  3ERG A;  2H1D A;  2XC2 A;  1AW9 A;  1GUK A;  2IMF A;  4LL1 B;  2OE0 A;  3UBK A;  1GSD A;  3ZRE A;  4A5P A;  5JCG A;  1HYU A;  5J9B A;  5KN2 A;  1SKR B;  1K0C A;  2R5G A;  2CX4 A;  4YQU A;  2FCH A;  5IO2 A;  1F9M A;  4F2I A;  1F2E A;  6GSS A;  4JBB A;  2CX3 A;  2MMO A;  1ZGN A;  1PSQ A;  4TXO B;  1O8X A;  1XWG A;  4GSN A;  2L5O A;  1M2B A;  4OWY A;  5ID2 A;  3A5W A;  4NWY A;  4PQI A;  5CRW A;  3R2Q A;  5HR1 A;  3PPU A;  4ZB8 A;  3LOR A;  1YY7 A;  2LS5 A;  1K0D A;  3ERF A;  2HSY A;  2FNO A;  3QCP A;  4O5R A;  1CQG A;  3BCI A;  2R0C A;  4KSM A;  3ZIV A;  1USB A;  2LJA A;  3QAV A;  5IPG A;  2C0F A;  2F51 A;  4G19 A;  3VK9 A;  4I6X A;  2GSR A;  5B6M A;  2VIM A;  4KH7 A;  4GWR A;  5EPF A;  5E59 A;  1IYH A;  3HCZ A;  2CZ3 A;  1XIY A;  1JLV A;  3DIE A;  1QK8 A;  5FT3 A;  4E8H A;  1TK0 B;  4IQA A;  1ST9 A;  3M8N A;  1TK8 B;  1ZYE A;  4KGI A;  1PKZ A;  4H86 A;  2H6Y A;  3FZ5 A;  1YQ1 A;  2YZU A;  3RAZ A;  1Z7R A;  3HA9 A;  8GSS A;  2YWI A;  5KOX A;  1VF1 A;  2LRN A;  3GL3 A;  2REM A;  1GP1 A;  1THX A;  3ZIJ A;  3KMO A;  3DVX A;  4ML1 A;  19GS A;  2LST A;  4TR0 A;  2ALB A;  1U87 A;  4HDE A;  2HZE A;  1O85 A;  1U6T A;  2XHF A;  1YF1 A;  3Q19 A;  2HE3 A;  5AIS A;  5IMF A;  1B8X A;  2LNS A;  5ECL B;  2JU5 A;  1Z9H A;  3IHG A;  1AUC A;  3HVS A;  1A8L A;  1PL1 A;  5IMC A;  1A23 A;  1FHE A;  2H73 A;  2I4A A;  4MK3 A;  2IFQ B;  3H93 A;  4ZXG A;  1GNW A;  1O8W A;  2HYX A;  1EP8 A;  2PBJ A;  3IC4 A;  3GIX A;  2LUS A;  2DJJ A;  1FB6 A;  4IBP A;  3EE2 A;  1J9B A;  1FO5 A;  5IIZ A;  4MJE A;  1GTI A;  1K3O A;  4ULX A;  2FA8 A;  4POK A;  1A0F A;  2JSY A;  1C72 A;  2V32 A;  4IGJ A;  1QMV A;  3EVI A;  4USS A;  2P5Q A;  1SU9 A;  4N11 A;  5CRH A;  3UBL A;  2VUP A;  4K5R A;  1AQW A;  3QAG A;  4CDO A;  3TKR A;  4DSS A;  1M2D A;  2ON7 A;  1EV4 A;  4NV2 A;  3LGC A;  4KW6 A;  1EV9 A;  3LG6 A;  2VO4 A;  2YWO A;  3VWX A;  1XOB A;  4BA7 A;  1ZCP A;  4IVF A;  3H1N A;  1TW9 A;  3QFB C;  4LL4 B;  1ERW A;  1MDI A;  4J2F A;  3DYR A;  3IK7 A;  1MDK A;  1SK0 A;  3ZML A;  3M9K A;  1GNE A;  4IEL A;  13GS A;  22GS A;  3VWV A;  3EU4 A;  5ECR B;  4FYU A;  3FKF A;  1V57 A;  3HVX A;  1TK5 B;  4AJ8 A;  4K1F A;  1HQO A;  5BMU A;  5IO0 A;  2HRK A;  4WKW A;  1CQH A;  2X64 A;  3KP8 A;  3TRX A;  4L5O A;  1PX7 A;  1NHO A;  4KUN A;  3HY2 A;  1OC3 A;  2C0E A;  2H70 A;  2WUL A;  4Z7X A;  3KM6 A;  4JRR A;  1SK2 A;  1TP9 A;  2YNX A;  4GCI A;  3TOU A;  1N8J A;  4IJ3 A;  3F63 A;  4ZBB A;  3PH9 A;  2HSM A;  1SL1 B;  4V2M A;  4WET A;  1X5D A;  4V1A g;  3L4N A;  4KCA A;  5DDL A;  5GST A;  3ISO A;  3F4T A;  1TTZ A;  1EEM A;  1T00 A;  4E8E A;  2NPB A;  2C1Y A;  4ZIL A;  1BAY A;  1SL0 B;  2MYG A;  4CY8 A;  4RI6 A;  4DSR A;  2K8S A;  1OKT A;  5INY A;  4ISD A;  4BPY A;  5CYY A;  4ECI A;  5HR3 A;  4XS4 A;  5IMA A;  4JE1 A;  5L71 A;  3IRA A;  5D9W A;  2IL3 A;  4PNF A;  3MNG A;  4YQV A;  3GX8 A;  2DMM A;  3F6D A;  1OC9 A;  2H0H A;  3P8W A;  3CSI A;  4ID0 A;  2C8U A;  4EDZ A;  4EVM A;  2F8F A;  2QA2 A;  3ZLP A;  2YPM A;  1YKC A;  4TW5 A;  2VL3 A;  2B6M A;  1TI3 A;  3IHQ A;  4OO4 A;  3PR8 A;  1KEB A;  1T1V A;  2M46 A;  1S3C A;  4TXO A;  3C8E A;  4PX1 A;  4LMV A;  5ECP B;  4YQM A;  3GKM A;  3TJJ A;  1A8Y A;  2WCI A;  1DBY A;  1F6M C;  2GGT A;  3GN3 A;  2FGX A;  4LMW A;  3M3M A;  3VWW A;  4HZ4 A;  4AJ6 A;  3ZZX A;  2K18 A;  3LFL A;  2HI7 A;  1XXU A;  1MTC A;  1YEX A;  7GSS A;  2C3Q A;  2WRT A;  3WT1 A;  3CSJ A;  2HFD A;  2OJL A;  1WMJ A;  2O87 A;  1A2M A;  4N0Z A;  2CAI A;  4DVC A;  2RUF A;  4RUV A;  2GSS A;  4GLT A;  4WF4 A;  5GZZ B;  3ZTL A;  2I3Y A;  4POL A;  3E3E A;  2PU9 C;  2PVO C;  3I69 A;  3FK8 A;  4MCU A;  4OFT A;  5DQY A;  4NHW A;  3DVW A;  2LJK A;  4IJI A;  1RQM A;  5IPH A;  1M99 A;  2DJK A;  2GVP A;  5B8A A;  1VF2 A;  3OR5 A;  4YKG A;  3HYP A;  4IN0 A;  4IS0 A;  3KIJ A;  1ERU A;  5CNW A;  2HNL A;  4BWS A;  1XCC A;  4ZL8 A;  3DD3 A;  4OMV A;  2ZUP A;  4I2U A;  1GSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...