4LL1B

The structure of the trx and txnip complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein/protein binding
molecule keywords Thioredoxin-interacting protein
publication title The structural basis for the negative regulation of thioredoxin by thioredoxin-interacting protein
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 105
sequence length 105
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ll1B00
2M80A 2QSIA 4AJ6A 5KN3A 1O85A 3IR4A 5E4WA 1XWBA 3CSJA 22GSA 5F07A 4MABA 4DSQA 1OVNA 2H73A 2K9FA 5JWRB 2C3NA 2PMTA 1K0BA 5CRGA 4GLTA 5DJMA 3G7JA 4YQVA 19GSA 3TRXA 3MNGA 3GKMA 1GSYA 1VF1A 1MD4A 2K6VA 3Q19A 4O5RA 3F3QA 4IJ3A 4J57E 2V6OA 1FB0A 3GTUB 1JZRA 1GLQA 2YNXA 2OACA 2GQKA 2YWMA 2O8VB 5ELAA 3I69A 4GXZA 3W6GA 4I97A 2K8SA 1QGVA 1THOA 3F3RA 1IYIA 1FW1A 1PX6A 1FB6A 1I5GA 2WJUA 2VOCA 3FR3A 2KP2A 2NTOA 5IO2A 4QQ7A 1EV4A 3CRTA 2XPEA 2JADA 4PUAA 3LQ7A 1Z3EA 5DCHA 3LYPA 3IK9A 1FHEA 1BG5A 2FA8A 3LXTA 5ECLB 2J23A 1GTIA 2HSHA 5ENUA 2X64A 2IIYA 3IHQA 1E6BA 2C80A 4YQUA 5ECNB 1A23A 4TW5A 17GSA 1NM3A 5IMFA 5CREA 2PU9C 3RBTA 3CRUA 3IDVA 1SL0B 3D5JA 1R4WA 2YN1A 4NHZA 1HD2A 4HDEA 2FWFA 7GSSA 2YCDA 3HD5A 2HZEA 1ERTA 3MWHA 6GSYA 2FCHA 2ZCTA 1ST9A 3M0FA 2VL3A 2GGTA 4L0UA 4G9HA 2L5LA 2YWIA 4NWYA 4Z7XA 4KSOA 4I8BA 4ZB8A 1GH2A 3GSSA 3H4KA 12GSA 5HQPA 5C04A 20GSA 3WGEA 2WS2A 2C1YA 4EDYA 3I9V2 3M9KA 3PINA 2DJ2A 1AAZA 1LBKA 1XW5A 3DEXA 3CXGA 2AAWA 4TKYA 2IMFA 2XC2A 4N11A 2IMKA 3TOTA 3QMXA 1R5AA 3US3A 1M9AA 5GAPD 3J7Yb 2C0EA 3F4TA 2IFQA 3L4NA 1W4VA 1R26A 2D2ZA 4E8EA 2E2GA 4X1UA 4EE0A 1AQWA 4NPBA 3GX0A 1H75A 1NHOA 4F03A 2PUKC 2C3TA 3TJFA 3C7MA 2XHFA 3ZMLA 3DIEA 1PX7A 3O6TA 5DVBA 2XPDA 2OE1A 3M8NA 1YDKA 4MF7A 2HNLA 4KB3A 3DD3A 2VL2A 4IQ1A 4ACSA 5J41A 1ZYEA 3FKFA 2BMXA 3C1SA 3HXSA 18GSA 1THXA 4HOJA 3RHBA 3DGQA 2DJ3A 3DMLA 4OO5A 1V98A 3IA1A 1YJ6A 1KBNA 5IMAA 3VWVA 4ZXGA 4EVMA 4DVCA 4MA9A 3VWXA 1VF2A 1GSEA 5D9TA 2JACA 4POLA 4HI7A 4WBRD 2ZUPA 2AUVA 3TKSA 2FHEA 5AN1A 2REMA 3A2VA 1K0AA 2PWJA 3LSZA 2WGRA 4HQSA 4N0ZA 1V9WA 3VPTA 2VUPA 5DAKB 3HZ4A 4AJ8A 2C0DA 4F82A 4YH2A 5J3RA 2KLXA 2YWNA 1MTCA 2JU5A 5B8AA 3GL3A 4G2EA 3W8JA 3P7XA 4KCAA 4KH7A 3L9SA 2JZRA 5DJLA 4IELA 5E59A 2GZZA 6GSVA 3PH9A 2JL4A 2CV4A 3U6VA 4QL7A 5KN1A 1GSQA 2VCXA 2DJJA 4FO5A 2X8HA 4LL1B 2LJRA 2H1DA 4BVYA 1J0FA 3VURA 2VCVA 4ML6A 4NAXA 2GLRA 3DKSA 4PQHA 4WXTA 3KD0A 3E0UA 3HCZA 1A0FA 1USBA 1X5CA 2P5RA 1IYHA 2EIOA 3LORA 4DEJA 3TJKA 1B8XA 3ERGA 1ZL9A 1PSQA 2F9SA 4K2DA 2B5YA 1WMJA 1XWKA 3LEFA 3VWUA 2CZ3A 3D21A 3ZFBA 3KH9A 4KE3A 3TB2A 2CAIA 3GRXA 3UBLA 4OO4A 1K3OA 5IM9A 3HY2A 4K6XA 2PVQA 1EP8A 4JZQA 2CAQA 3ME7A 3WGXA 5D9VA 1PL1A 2V2GA 4BWSA 1AQVA 1EOHA 5G1LA 1AXDA 1DSBA 2YZHA 1QUWA 5ECOB 3WT1A 3GN3A 4OWYA 1HNAA 2YPMA 5J9BA 2LTKA 1PMTA 1T3BA 3UOMA 2PN8A 3A2XA 2V6KA 5IOXA 3UVTA 4L8EA 3I43A 3DVWA 1F2EA 3F63A 3KCMA 1ERWA 3KZQA 2VCTA 1O81A 2VD0A 3BOAA 2C0GA 2M72A 4KUNA 1JZDA 4K7OA 1TKDB 4NXIA 4QL9A 4IS0A 1ZCPA 2MMAA 5CRDA 3ED3A 1M2BA 5D96A 2FWGA 3ERWA 6GSTA 5FHIA 4KW6A 1EWXA 2LQOA 5D93A 4X43A 4KCEA 2CX4A 4FYUA 4DSSA 2DIYA 3G7IA 1NW2A 2GQMA 1F9MA 2AJQB 3P90A 1SKSB 6GSUA 4NV5A 1XOAA 3KP8A 2CT6A 3IK7A 3KJYA 5A4UA 2FNOA 4IQAA 1YEXA 3Q74A 3FW2A 1K0NA 2F8AA 2GQLA 1OC9A 2J9HA 3TJJA 5HR1A 4BPYA 1R7HA 5AIVA 4TRXA 4O7HA 1RK4A 3G7YA 4MJAA 2B7JA 5AGYA 2KP1A 3RAZA 1X9WB 1U88A 5JCUA 5ECMB 2O85A 1UA5A 5F0GA 1XW6A 1EGRA 4O92A 3HZ8A 2GSRA 2RM6A 1GUKA 5J4UA 2WDUA 5ECQB 3ZIJA 2H0HA 2LJAA 3EU4A 3QFBC 5J5NA 1A8YA 2H70A 3FZAA 1TRUA 1ZYQB 1O8XA 3P8WA 3G9BA 5IOWA 3HJOA 1Z7RA 5A4VA 3IRAA 3LWAA 4EKZA 2DLXA 4POKA 1OE7A 2L4QA 2RM5A 2F8FA 5D9XA 4LL4B 2B3SA 5IPHA 2QGVA 1SJIA 1SJZA 1MDJA 1BEDA 4TR0A 5AISA 4D73A 3QPMA 3GFKA 3ZREA 2VCZA 2TRCP 5DDLA 1SD9A 1BYEA 4OCFA 2WCIA 4JBBA 1QMVA 1XOBA 4HJ2A 5ID2A 4MPGA 4ZL8A 2WB9A 4ZB6A 2DC5A 2DJ0A 1WPIA 2LQQA 2H1GA 4OFNA 2HZEB 2LRCA 4MH3A 3GHAA 4AJ7A 1Y6EA 5DCGA 1PD21 4KX4A 2DMMA 3OR5A 2K8VA 2DJKA 2A4VA 2B6MA 2L4CA 1G0TA 4V2LA 5L71A 2PVOC 1NHYA 1FVKA 2LJKA 2R2JA 2IL3A 5JCGA 5D9WA 4F0BA 3VI7A 3WGDA 1YQ1A 4J56E 3DYRA 4HEA2 3KTBA 1ML6A 2WZ9A 3O3TA 1LJRA 3CMIA 3CTFA 1X5EA 2EIRA 1TI3A 1SKRB 5ECHB 2H66A 5ECKB 1EGOA 3F0IA 1ERUA 4F2IA 2GT5A 3L9UA 3LGCA 2VLUA 2FD3A 2LS5A 5G1KA 2JZSA 3UVHA 1O6JA 4I2UA 1QXHA 1WRYA 6GSXA 4JEDA 2JSZA 2IFQB 4ECBA 2V1MA 5F05A 5IIZA 5COHA 5G2ZA 3EYTA 3TOUA 2O7KA 4TR1A 2G0FA 3N5OA 1TU7A 3ISOA 5ECSA 2H72A 2H6ZA 5CAXA 1I9DA 2FGXA 1JFUA 1R5PA 1AUCA 2LRTA 5IMDA 3TKSE 3GIXA 3U5RE 5CO3A 2ON5A 3FYGA 5G5FA 4OFMA 3EE2A 4GSNA 5B8BA 3EMPA 5ECPB 4ZL9A 1M99A 5EL8A 2HRFA 1WJKA 1VF3A 5JWQB 2KUCA 1XWCA 1XPVA 3BCIA 3J7Yk 1Z6MA 4PURA 2DMLA 2FA4A 1TDIA 4IP1A 3UBKA 1ZZYA 2VLVA 1JZOA 1Q4JA 1GULA 3KH7A 2B5XA 3VLNA 4RUVA 1GP1A 3APSA 4G19A 1PQNA 2PBJA 1EP7A 1S3DA 1K0CA 1Y25A 3TJBA 4TR3A 1SK1A 4BA7A 2QKEA 2P0GA 3IPZA 3H8QA 3D4MA 4KDUA 2VL9A 2OBKA 3ZL5A 1M0UA 1B48A 2VCQA 1BX9A 2GTUA 3DVXA 2XBQA 1QFNA 3M3MA 4K0GA 1VRSD 3GUSA 4ISDA 1TOFA 4K8MA 5HR0A 2LRNA 1K3YA 4ECCA 1K0MA 2ON7A 2YWOA 1EEJA 1O8WA 3GV1A 5IMZA 3ME8A 3IAM2 1YKAA 4K7NA 2MBSA 1UVZA 4MZBA 4FIWA 4GTUA 5G5EA 3E3EA 1B9XC 4HU7A 4TR4A 5B6MA 1J08A 1JHBA 2EC4A 1TK0B 3IV4A 4TVEA 4PNGA 4JR6A 5LNKe 2DIZA 4J2FA 1A0RP 4K0NA 3FK8A 5G31A 4ULXA 4EC0A 2I3YA 2TIRA 5D8IA 3C8EA 5JCWA 4WR5A 4KNDA 4ZL7A 3L78A 4ZBAA 5H5RA 3VI5A 2FWHA 3UARA 2DSAA 4I2TA 3QR6A 4RI6A 3IC4A 1Z9HA 2VD1A 2YV9A 8GSSA 4AGSA 2H0IA 16GSA 3LJRA 3AY8A 2AB6A 5DALB 3EINA 2MBTA 4PUFC 2N5BA 1T8EB 1PN9A 3GYKA 1K3LA 2H76A 4DSRA 1B9YC 2LV3A 3PR8A 1V57A 1KTEA 3FZ9A 1GL8A 1ILOA 4IVFA 4K9ZA 3F4RA 4EUYA 3GNJA 1ERVA 1AW9A 2YOIA 1ZOFA 4O32A 1EEMA 3E9JB 3HVSA 5KN0A 2MYGA 1GLPA 2OADA 4MF6A 2KOKA 1UC7A 3QAGA 2MMNA 4MF5A 2E2MA 4IKHA 3IOSA 4RQRA 5HFGA 4DSSB 14GSA 2FY6A 4K7IA 2HLSA 2NDOA 5DALA 2H01A 2O89A 4Q5QA 4EF0A 3QAVA 2VAFA 1MDIA 1GSDA 1JZWA 3GMFA 4IGJA 3ERFA 1AIUA 3DWVA 3HVXA 2GZYA 4I5QA 3LYKA 1OC9B 4XS6A 1QK8A 2L6DA 4F0CA 4Q5RA 1GWCA 3S9FA 2YZUA 4P3YB 1H4OA 3GSTA 4WR4A 4ECIA 1OC8A 3VK9A 1XWGA 1VF4A 3MDKA 1X5DA 1BAYA 1M9BA 1SK0A 1XXUA 3CTGA 1XZOA 2X99A 1BJXA 4OCEA 1ZGNA 2GS3A 3KMOA 2DBCA 1WOUA 3RDWA 4V2MA 13GSA 3KIJA 3TDGA 4ZB9A 2IPAA 1SYXA 4EO3A 1YEPA 1ACVA 2FWEA 1SJ6A 2YANA 3NZNA 2OJLA 5CRWA 3QCPA 3F8UA 3QOUA 1M2DA 2DJ1A 2VIMA 2HFDA 2AYTA 5HFIA 1O73A 1F3AA 4GWRA 3LFLA 4HU9A 2CQ9A 4XS1A 3SWLA 2H6XA 4IHUA 2HYXA 2HT9A 3RPNA 4I6XA 4EXJA 1YF0A 2H71A 3EC3A 4D73B 4XTSA 4BWQA 4N30A 2IN3A 2NPBA 4JR4A 2MMOA 1T1VA 2ALBA 2LEGA 2HE3A 3KP9A 4IP6A 3UEMA 3K8NA 1EZKA 1GUMA 1Z6NA 1DE2A 2FLSA 5ID2B 3QAWA 4WKWA 1TXXA 1A8LA 3BD2A 1V2AA 1T4YA 3GKNA 1MEKA 1PRXA 3TCOA 5ABRA 1OAZA 1OKDA 1FVJA 5H5SA 2V41A 4HJMA 1Q98A 3DRNA 2IMIA 2X8GA 4LLRA 1B4QA 5EY6A 2AHEA 1PL2A 1SD8A 1XWAA 5J9CA 1T7PB 4KA0A 3TKQA 1X9MB 2GSSA 3IE3A 6GSWA 1MD3A 2GDRA 4CW9A 4MPFA 1HNBA 3FZ5A 1XW9A 4ID0A 4XS4A 3O76A 3RPPA 3FR6A 4TXOA 1WE0A 1F6MC 5A4WA 1HNCA 2P5QA 1EV9A 1T00A 1FO5A 3L0HA 6GSSA 1AC1A 1ZMAA 3FHKA 1N8JA 3TUEA 4ZBBA 4YAPA 3GH9A 3NIVA 3Q6OA 5AIXA 4JU5A 4HUAA 4NMUA 1K0DA 2HI7A 2LSTA 4XCSA 5HFKA 4POBA 1OKTA 1FOVA 4BL7A 1TK8B 2RUFA 4V2NA 1N2AA 4HZ4A 5CNWA 4TR1B 2GSQA 3HHVA 4TN8A 3HA9A 2CVKA 5ELGA 1EOGA 3KTLA 4XIHA 2OE0A 3EU3A 3A3TA 3JCML 2LKUA 1G7OA 4PNFA 2L57A 5C00A 2IMDA 3GTUA 2H74A 2R37A 4XRDA 2IMEA 1Z5YE 3HVVA 5INYA 4EL1A 4ILFA 1G6YA 1U87A 2ES7A 3EWLA 5G30A 4XHMA 2L5OA 1B4PA 4TOPA 1A2MA 1XCCA 3KGKA 1YKCA 3QFAC 2IJYA 3CBUA 4NV2A 4PQIA 3RHCA 3FEUA 2VLTA 3EURA 1PKWA 5DQYA 1J9BA 2WFCA 3A5WA 4F9ZA 4PXOA 4WF5A 1JLWA 1TU8A 3GKKA 4X0XA 3TRPA 2VCWA 4ZBDA 1O7UA 2H1AA 1GUHA 4MP4A 3UIWA 4PX1A 4PGTA 3VWWA 3A2WA 3WYWA 4IN0A 3CSIA 4FH8A 1TJDA 3TJGA 1CQHA 3H93A 1GNEA 4L5OA 1W89A 4XRAA 1VGLA 4LA1A 3F4SA 1S3AA 1U3AA 2E7PA 1A2LA 3F9UA 2C0FA 2LUSA 1SK2A 3MAKA 2C8UA 4MK3A 3FZ4A 1GSSA 4HS1A 2I9HA 1G6WA 2KHPA 1PA3A 3ZMKA 1A2JA 2MZCA 3ZIVA 1X9SB 3APQA 4Q5FA 4V1Ap 5DBQA 4WETA 2HSYA 2Z9SA 3UAPA 1V58A 5GSSA 2N5AA 2CVBA 3GH6A 2GT6A 2JSYA 4ML1A 2H19A 2JZTA 3N9JA 2H8LA 2N5FA 4AF2A 1TTZA 1OYJA 2R5GA 1G7EA 3PGTA 4LMVA 1PGTA 4PQ1A 1SU9A 2E0QA 1F3BA 3LXZA 1GSFA 2WRTA 4V1Ag 3CYNA 3D0ZA 11GSA 1M7TA 2PPTA 4MJBA 1JLVA 4FYCA 3V1WA 3ZZXA 4WEYA 3ZFLA 2B5EA 2BJXA 2L6CA 5A5KA 3W8SA 1XVWA 4YAVA 4MLYA 3KEBA 2NVLA 2PERA 3BCKA 1UN2A 2B7KA 4RI7A 3TKRA 1FG4A 3TKPA 3H1NA 1HQOA 1F37A 4YQMA 3D4TA 10GSA 4JE1A 3UMAA 5ECRB 1YY7A 2OA7A 2R4VA 2O87A 1HYUA 3P2AA 5EPFA 3H79A 2F51A 1GSUA 3GKXA 1Z7PA 1GTBA 4E8HA 3L9VA 3C1RA 3C73A 3GURA 4BVXA 1XIYA 4MMMA 2MMZA 1OE8A 2VO4A 5EVOA 2HXKA 2VM2A 4ZILA 1GTUA 5IMCA 4ZIJA 3ZLPA 5KN2A 1U3IA 2F3MA 1V40A 3EMXA 2G2QA 2QC7A 5GSTA 2B1LA 4HZ2A 2GSTA 4KDYA 3R2QA 5H5QA 2C3QA 2NBSA 3ZVJA 4N10A 3ZRDA 2RLIA 5CRHA 1BQ7A 3MSZA 5DAKA 2C4JA 3BBYA 2I81A 4H86A 4MCUA 1OC3A 1GNWA 1TI1A 2HRNA 3WD6A 2EIQA 2OBIA 2K18A 2AV4A 1LU4A 3GX8A 5KEJA 3KXOA 3F6DA 3FY7A 2TRXA 3QD9A 3IAS2 1YF1A 2GZPA 2RUEA 4L5LA 2WULA 4GCIA 2M46A 1SYRA 1T4ZA 2A2SA 5F8BA 1TK5B 1WIKA 1DE1A 3FRCA 1PKZA 3SBCA 1ABAA 4KSMA 2BTOT 2CVDA 4IJIA 1URMA 4IBPA 5IQYA 2VL2C 1XFLA 3UJ1A 3D22A 1S3CA 1GRXA 1SL2B 2VM1A 1TW9A 1NSWA 2H0GA 4MZWA 2P31A 4GQFA 3VPQA 2HZFA 5D73A 5DQSA 2CA8A 4KDXA 3EVIA 1E2YA 1YZXA 5F06A 5LCZA 2X8CA 4Q5NA 4MZCA 2YJHA 2V32A 5HR2A 4MDCA 3QDNA 1TRWA 2XBIA 3ZITA 3IXRA 3D6IA 4GF0A 1WP0A 4OD7A 5JWOB 3GA4A 2H75A 4OMVA 3ZTLA 2YJ7A 1U6TA 2YP6A 4NHWA 5B6NA 1K0OA 1AQXA 2IWTA 3DXBA 5IPGA 1DUGA 3LG6A 3TKSC 5GZZB 1MDKA 3UL3A 5ECIB 5B7CA 9GSSA 4GSTA 4CHSA 3APOA 4KAEA 1C72A 1QQ2A 1KEBA 1TRSA 1FAAA 3WT2A 4MJEA 4N0VA 4FYBA 2H1BA 4TXVA 3M1GA 3HYPA 2CZ2A 2PGTA 3TGZA 2R6KA 3F6FA 1TRVA 5FT3A 3C71A 4OFTA 2L59A 4WF4A 3KMNA 1WWJA 4G10A 4POMA 1XBSA 3TRQA 5HR3A 3FR9A 3M9JA 3HJMA 4EDZA 2B1KA 3VFIA 2LNSA 2GVPA 1RW1A 2FUG2 2RIIA 3HJPA 1M2AA 1A24A 1X0RA 3I6AA 3Q18A 3CSHA 4ECJA 5LD0A 1CQGA 4CDOA 2I1UA 3KM6A 2I4AA 4K1FA 3HKRA 1RQMA 2R3XA 5CYYA 3BJ5A 1GTAA 5CP1A 4LMWA 2A2RA 4RQXA 1SKWB 5GAND 2H30A 2LNTA 3ZVJD 2YV7A 4XS4B 4MJCA 4KGIA 4TXOB 4IW9A 4HQZA 5IMVA 2ZNMA 1SENA 3GL5A 4L0WA 1DBYA 3NOFA 5IO0A 1SL1B 4JRRA 3HDCA 4GSSA 5FWGA 4GQCA 4MH2A 1TP9A 2H6YA 2OKAA 1XVQA 1ON4A 4GRFA 2OE3A 1KNGA 3ZYWA 3IBHA 2CX3A 4WBJA
chains in the Genus database with same CATH superfamily
2M80A 2QSIA 4AJ6A 5KN3A 1O85A 3IR4A 3A5IA 5E4WA 1XWBA 4EIQA 3CSJA 22GSA 5F07A 4MABA 4DSQA 1OVNA 2X49A 2H73A 4BL7B 2K9FA 5JWRB 2C3NA 2PMTA 1K0BA 5CRGA 4GLTA 5DJMA 3G7JA 4YQVA 19GSA 3TRXA 3MNGA 3GKMA 1GSYA 1VF1A 1MD4A 2K6VA 3Q19A 4O5RA 3F3QA 4IJ3A 4J57E 2V6OA 1FB0A 3GTUB 1JZRA 1GLQA 2YNXA 2OACA 2GQKA 2YWMA 2O8VB 5ELAA 3I69A 4GXZA 3W6GA 4I97A 2K8SA 1QGVA 1THOA 3F3RA 1IYIA 1FW1A 1PN0A 3MYDA 1PX6A 1FB6A 1I5GA 1M3JA 2WJUA 2VOCA 3FR3A 2KP2A 2NTOA 5IO2A 4QQ7A 1EV4A 3CRTA 2XPEA 2JADA 4PUAA 3LQ7A 1Z3EA 5DCHA 3LYPA 3IK9A 1FHEA 1BG5A 2FA8A 3LXTA 5ECLB 2J23A 1GTIA 2HSHA 5ENUA 2X64A 2IIYA 3IHQA 1E6BA 2C80A 4YQUA 5ECNB 1A23A 4TW5A 17GSA 1NM3A 5IMFA 5CREA 2PU9C 3RBTA 3CRUA 3IDVA 1SL0B 3D5JA 1R4WA 2YN1A 4NHZA 1HD2A 4HDEA 2FWFA 7GSSA 2YCDA 3HD5A 2HZEA 1ERTA 3MWHA 6GSYA 2FCHA 4PTSA 2ZCTA 1ST9A 3M0FA 2VL3A 2GGTA 4L0UA 4G9HA 2L5LA 2YWIA 4NWYA 4Z7XA 4KSOA 4I8BA 4ZB8A 1GH2A 3GSSA 3H4KA 12GSA 5HQPA 5C04A 20GSA 3WGEA 2WS2A 2C1YA 4EDYA 3I9V2 3M9KA 3PINA 2DJ2A 1AAZA 1LBKA 1XW5A 3DEXA 3CXGA 2AAWA 4TKYA 2IMFA 2XC2A 4N11A 2IMKA 3TOTA 3QMXA 1R5AA 3US3A 1M9AA 5GAPD 3J7Yb 2C0EA 3F4TA 2IFQA 3L4NA 1W4VA 1R26A 2D2ZA 4E8EA 2E2GA 4X1UA 4EE0A 1AQWA 4NPBA 3GX0A 1H75A 1NHOA 4F03A 2PUKC 2C3TA 3TJFA 3C7MA 2XHFA 3ZMLA 3DIEA 1PX7A 3O6TA 5DVBA 2XPDA 2OE1A 3M8NA 1YDKA 4MF7A 2HNLA 4KB3A 3DD3A 2VL2A 4IQ1A 4ACSA 5J41A 1ZYEA 3FKFA 2BMXA 3C1SA 3HXSA 18GSA 1THXA 4HOJA 3RHBA 3DGQA 2DJ3A 3DMLA 4OO5A 1V98A 3IA1A 1YJ6A 1KBNA 4BVXB 5IMAA 3VWVA 4ZXGA 4EVMA 4DVCA 4MA9A 3VWXA 1VF2A 1GSEA 5D9TA 2JACA 4POLA 4HI7A 4WBRD 2ZUPA 2AUVA 3TKSA 2FHEA 5AN1A 2REMA 3A2VA 1K0AA 2PWJA 3LSZA 2WGRA 4HQSA 4N0ZA 1V9WA 3VPTA 2VUPA 5DAKB 3HZ4A 4AJ8A 2C0DA 4F82A 4Z2RA 4YH2A 5J3RA 2KLXA 2YWNA 1MTCA 2JU5A 5B8AA 3GL3A 4G2EA 3W8JA 3P7XA 4KCAA 4KH7A 3L9SA 2JZRA 5DJLA 4IELA 5E59A 2GZZA 6GSVA 3PH9A 2JL4A 2CV4A 3U6VA 4QL7A 5KN1A 1GSQA 2VCXA 2DJJA 4FO5A 2X8HA 4LL1B 2LJRA 2H1DA 4BVYA 1J0FA 3VURA 2VCVA 4ML6A 4NAXA 2GLRA 3DKSA 4PQHA 4WXTA 3KD0A 3E0UA 3HCZA 1A0FA 1USBA 1X5CA 2P5RA 1IYHA 2EIOA 3LORA 4DEJA 3TJKA 1B8XA 3ERGA 1ZL9A 1PSQA 2F9SA 4K2DA 2B5YA 1WMJA 1XWKA 3LEFA 3VWUA 2CZ3A 3D21A 3ZFBA 2QA1A 3KH9A 4KE3A 3TB2A 2CAIA 3GRXA 3UBLA 4OO4A 1K3OA 5IM9A 3HY2A 4K6XA 2PVQA 1EP8A 4JZQA 5KOXA 2CAQA 3ME7A 3WGXA 5D9VA 1PL1A 2V2GA 4BWSA 2UZ8A 1AQVA 1EOHA 5G1LA 1AXDA 1DSBA 2YZHA 1QUWA 5ECOB 3WT1A 3GN3A 4OWYA 1HNAA 2YPMA 5J9BA 2LTKA 3R3EA 1PMTA 1T3BA 3UOMA 2PN8A 3A2XA 2V6KA 1PFOA 5IOXA 3UVTA 4L8EA 3I43A 3DVWA 1F2EA 3F63A 3KCMA 1ERWA 3KZQA 2VCTA 1O81A 2VD0A 3BOAA 2C0GA 2M72A 4KUNA 1JZDA 4K7OA 1TKDB 4NXIA 4QL9A 4IS0A 1ZCPA 2MMAA 5CRDA 3ED3A 1M2BA 5D96A 2FWGA 3ERWA 6GSTA 5FHIA 4KW6A 1EWXA 2LQOA 4X43A 5D93A 4KCEA 2CX4A 4FYUA 4DSSA 2DIYA 3G7IA 1NW2A 2GQMA 1F9MA 2AJQB 3P90A 1SKSB 6GSUA 4NV5A 1XOAA 3KP8A 2CT6A 3IK7A 3KJYA 5A4UA 2FNOA 4IQAA 1YEXA 3Q74A 3FW2A 1K0NA 2F8AA 2GQLA 1OC9A 2J9HA 3TJJA 1ZYNA 5HR1A 4BPYA 1R7HA 5AIVA 4TRXA 4O7HA 1RK4A 3G7YA 4MJAA 2B7JA 5AGYA 2KP1A 3RAZA 1X9WB 1U88A 5JCUA 5ECMB 2O85A 1UA5A 5F0GA 1XW6A 1EGRA 4O92A 3HZ8A 2GSRA 2RM6A 1GUKA 5J4UA 2WDUA 5ECQB 3ZIJA 2H0HA 2LJAA 3EU4A 3QFBC 5J5NA 1A8YA 2H70A 3FZAA 1TRUA 1ZYQB 1O8XA 3P8WA 3G9BA 5IOWA 3HJOA 1Z7RA 5A4VA 3IRAA 3LWAA 4ICYA 4EKZA 2DLXA 4POKA 1OE7A 3IC8A 2L4QA 2RM5A 2F8FA 5D9XA 4LL4B 2B3SA 5IPHA 2QGVA 1SJIA 1SJZA 1MDJA 1BEDA 4TR0A 5AISA 4D73A 4MNNA 3QPMA 4CY8A 3GFKA 3ZREA 2VCZA 2TRCP 5DDLA 1SD9A 1BYEA 4OCFA 1M3IA 2WCIA 4JBBA 1QMVA 1XOBA 4HJ2A 5ID2A 4MPGA 4ZL8A 4BIKA 2WB9A 4ZB6A 2DC5A 2DJ0A 1WPIA 2LQQA 2H1GA 4OFNA 2HZEB 2LRCA 4MH3A 3GHAA 4AJ7A 1Y6EA 5DCGA 1PD21 4KX4A 2DMMA 3OR5A 2K8VA 2DJKA 2A4VA 2B6MA 2L4CA 1G0TA 4V2LA 5L71A 2PVOC 1NHYA 1FVKA 2LJKA 2R2JA 2IL3A 5JCGA 5D9WA 4F0BA 3VI7A 3WGDA 1YQ1A 4J56E 3DYRA 4HEA2 3KTBA 1ML6A 2WZ9A 4K2XA 3O3TA 1LJRA 3CMIA 3CTFA 1X5EA 2EIRA 1TI3A 1SKRB 5ECHB 2H66A 5ECKB 1EGOA 3F0IA 1ERUA 4F2IA 2GT5A 3L9UA 3LGCA 2VLUA 2FD3A 2LS5A 5G1KA 2JZSA 3UVHA 1O6JA 4I2UA 1QXHA 1WRYA 6GSXA 4JEDA 2JSZA 5BMUA 2IFQB 4ECBA 2V1MA 5F05A 5IIZA 4A5PA 5COHA 5G2ZA 3EYTA 3TOUA 2O7KA 4TR1A 4Z2UA 2HRAA 2G0FA 3MIXA 3N5OA 1TU7A 3ISOA 5ECSA 2H72A 2H6ZA 5CAXA 1I9DA 2FGXA 1JFUA 1R5PA 1AUCA 2LRTA 5IMDA 3TKSE 3GIXA 3U5RE 5CO3A 2ON5A 3FYGA 5G5FA 4OFMA 3EE2A 4GSNA 5B8BA 3EMPA 5ECPB 4ZL9A 1M99A 5EL8A 2HRFA 1WJKA 1VF3A 5JWQB 3EPTA 2KUCA 1XWCA 1XPVA 3BCIA 3J7Yk 1Z6MA 4PURA 2DMLA 2FA4A 1TDIA 4IP1A 3UBKA 1ZZYA 2VLVA 1JZOA 1Q4JA 4G0IA 1GULA 1FOHA 3KH7A 2B5XA 3VLNA 4RUVA 1GP1A 3APSA 4Z2TA 4G19A 1PQNA 2PBJA 1EP7A 1S3DA 4K5RA 2DKHA 1K0CA 1Y25A 3TJBA 4TR3A 1SK1A 4BA7A 2QKEA 2P0GA 3IPZA 3H8QA 3D4MA 4KDUA 2VL9A 2OBKA 3ZL5A 1M0UA 1B48A 2VCQA 1BX9A 2GTUA 3DVXA 2XBQA 1QFNA 3M3MA 4K0GA 4BVYB 1VRSD 3GUSA 4ISDA 1TOFA 4K8MA 5HR0A 2LRNA 1K3YA 4ECCA 1K0MA 2ON7A 2YWOA 1EEJA 1O8WA 3GV1A 5IMZA 3ME8A 3IAM2 1YKAA 4K7NA 2MBSA 1UVZA 4MZBA 4FIWA 4GTUA 5G5EA 3E3EA 1B9XC 2HRKA 4HU7A 4TR4A 4K5SA 5B6MA 1J08A 1JHBA 2EC4A 1TK0B 3IV4A 4TVEA 4PNGA 4JR6A 5LNKe 2DIZA 4J2FA 1A0RP 4K0NA 3FK8A 3FMWA 5G31A 5BRTA 4ULXA 4EC0A 2I3YA 2TIRA 5D8IA 3C8EA 5JCWA 4WR5A 4KNDA 4ZL7A 3L78A 4ZBAA 5H5RA 4X4JA 3VI5A 2FWHA 3UARA 2DSAA 4I2TA 3QR6A 4RI6A 3IC4A 1Z9HA 2VD1A 2YV9A 8GSSA 4AGSA 2H0IA 16GSA 3LJRA 3AY8A 4O5QA 2AB6A 5DALB 3PPUA 3EINA 4CY6A 2MBTA 4PUFC 2N5BA 1T8EB 1PN9A 3GYKA 1K3LA 2H76A 4DSRA 1B9YC 2LV3A 3PR8A 1V57A 1KTEA 3FZ9A 1GL8A 1ILOA 4IVFA 4K9ZA 3F4RA 4EUYA 3GNJA 1ERVA 1AW9A 2YOIA 1ZOFA 4O32A 1EEMA 3E9JB 3HVSA 5KN0A 2MYGA 1GLPA 2OADA 4MF6A 4EIPA 2KOKA 1UC7A 3QAGA 2MMNA 4MF5A 2E2MA 4IKHA 3IOSA 4RQRA 5HFGA 4DSSB 14GSA 2FY6A 4K7IA 2HLSA 2NDOA 5DALA 2H01A 2O89A 4Q5QA 4FQUA 4G0LA 4EF0A 3QAVA 4YKGA 2VAFA 1MDIA 1GSDA 1JZWA 3GMFA 3IHGA 4IGJA 3ERFA 1AIUA 3DWVA 3HVXA 2GZYA 4I5QA 3LYKA 1OC9B 4XS6A 1QK8A 2L6DA 4YKFA 4F0CA 4Q5RA 1GWCA 3S9FA 2YZUA 4P3YB 1H4OA 3GSTA 4WR4A 4ECIA 1OC8A 3VK9A 1XWGA 1VF4A 3MDKA 1X5DA 1BAYA 1M9BA 1SK0A 1XXUA 2R0PA 3CTGA 1XZOA 2X99A 1BJXA 4OCEA 1ZGNA 2GS3A 3KMOA 2DBCA 1WOUA 3RDWA 4V2MA 13GSA 3KIJA 3TDGA 4ZB9A 2IPAA 1SYXA 4EO3A 1YEPA 1ACVA 2FWEA 1SJ6A 2YANA 3NZNA 2OJLA 5CRWA 3QCPA 3F8UA 3QOUA 1M2DA 2DJ1A 2VIMA 2HFDA 2AYTA 5HFIA 1O73A 1F3AA 4GWRA 2X4AA 3LFLA 4HU9A 2CQ9A 4XS1A 3SWLA 2H6XA 4IHUA 2HYXA 2HT9A 3RPNA 4I6XA 4EXJA 1YF0A 2H71A 3EC3A 4D73B 4XTSA 4BWQA 4N30A 2IN3A 2NPBA 4JR4A 2MMOA 1T1VA 2ALBA 2LEGA 2HE3A 3KP9A 4IP6A 3UEMA 3K8NA 1EZKA 1GUMA 1Z6NA 1DE2A 2FLSA 5ID2B 3QAWA 4WKWA 1TXXA 1A8LA 3BD2A 1V2AA 1T4YA 3GKNA 1MEKA 1PRXA 3TCOA 5ABRA 1OAZA 1OKDA 1FVJA 5H5SA 2V41A 4HJMA 1Q98A 3DRNA 2IMIA 2X8GA 4LLRA 1B4QA 4HSCX 5EY6A 2AHEA 1PL2A 1SD8A 1XWAA 5J9CA 1T7PB 4KA0A 3TKQA 1X9MB 2GSSA 3IE3A 6GSWA 1MD3A 2GDRA 4CW9A 4MPFA 1HNBA 3FZ5A 1XW9A 4ID0A 4XS4A 3O76A 3RPPA 3FR6A 4TXOA 1WE0A 1F6MC 5A4WA 1HNCA 2P5QA 1EV9A 1T00A 1FO5A 3L0HA 6GSSA 1AC1A 1ZMAA 3FHKA 1N8JA 3TUEA 4ZBBA 1XG8A 3GH9A 4YAPA 3NIVA 3Q6OA 5AIXA 4JU5A 4HUAA 4NMUA 1K0DA 2HI7A 2LSTA 4XCSA 5HFKA 4POBA 1OKTA 1FOVA 4BL7A 1TK8B 2RUFA 4V2NA 1N2AA 4O5UA 3HVNA 4HZ4A 5CNWA 4TR1B 2GSQA 3HHVA 4TN8A 3HA9A 2CVKA 5ELGA 1EOGA 3KTLA 4XIHA 2OE0A 3EU3A 3A3TA 3JCML 2LKUA 1G7OA 4PNFA 2L57A 5C00A 2IMDA 3GTUA 2H74A 2R37A 4XRDA 2IMEA 1Z5YE 3HVVA 2HSMA 5INYA 4EL1A 4ILFA 1G6YA 1U87A 2ES7A 3EWLA 5G30A 4XHMA 2L5OA 1B4PA 4TOPA 1A2MA 1XCCA 3KGKA 1YKCA 3QFAC 2IJYA 3CBUA 4NV2A 4PQIA 3RHCA 3FEUA 2VLTA 3EURA 1PKWA 5DQYA 1J9BA 2WFCA 3A5WA 4F9ZA 4PXOA 4WF5A 1JLWA 1TU8A 3GKKA 4X0XA 3TRPA 2VCWA 4ZBDA 1O7UA 2H1AA 1GUHA 4MP4A 3UIWA 4PX1A 4PGTA 3VWWA 3A2WA 3WYWA 4IN0A 3CSIA 4FH8A 1TJDA 3TJGA 1CQHA 3H93A 1GNEA 4L5OA 1W89A 4XRAA 1VGLA 4LA1A 3F4SA 1S3AA 1U3AA 2E7PA 1A2LA 3F9UA 2C0FA 2LUSA 1SK2A 3MAKA 2C8UA 4MK3A 3FZ4A 1GSSA 4HS1A 2I9HA 1G6WA 2KHPA 1PA3A 2R0GA 3ZMKA 1A2JA 2MZCA 3ZIVA 1X9SB 3APQA 4Q5FA 1S3RA 4V1Ap 5DBQA 4WETA 2HSYA 2Z9SA 3UAPA 1V58A 5GSSA 2N5AA 2CVBA 3GH6A 2GT6A 2JSYA 4ML1A 2H19A 2JZTA 3N9JA 2H8LA 2N5FA 4AF2A 1TTZA 1OYJA 2R5GA 1G7EA 3PGTA 4LMVA 1PGTA 4PQ1A 1SU9A 2E0QA 1F3BA 3LXZA 1GSFA 2WRTA 4V1Ag 3CYNA 3D0ZA 11GSA 2R0CA 1M7TA 2PPTA 4MJBA 1JLVA 4FYCA 3V1WA 3ZZXA 4WEYA 3ZFLA 2B5EA 2BJXA 2L6CA 5A5KA 3W8SA 1XVWA 4YAVA 4MLYA 3KEBA 2NVLA 2PERA 3BCKA 1UN2A 2B7KA 4RI7A 3TKRA 1FG4A 3TKPA 3H1NA 1HQOA 1F37A 4YQMA 3D4TA 10GSA 4JE1A 3UMAA 5ECRB 1YY7A 2OA7A 2R4VA 2O87A 1HYUA 3P2AA 5EPFA 3H79A 2F51A 1GSUA 3GKXA 1Z7PA 1GTBA 4E8HA 3L9VA 3C1RA 3C73A 3GURA 4BVXA 1XIYA 4MMMA 2MMZA 1OE8A 2VO4A 5EVOA 2HXKA 2VM2A 4ZILA 1GTUA 5IMCA 4ZIJA 3ZLPA 5KN2A 1U3IA 2F3MA 1V40A 3EMXA 2G2QA 2QC7A 5GSTA 2B1LA 4HZ2A 2GSTA 4KDYA 3R2QA 5H5QA 2C3QA 2NBSA 3ZVJA 4N10A 3ZRDA 2RLIA 5CRHA 1BQ7A 3MSZA 5DAKA 2C4JA 3BBYA 2I81A 4H86A 4MCUA 1OC3A 2QA2A 1GNWA 1TI1A 2HRNA 3WD6A 2EIQA 2OBIA 2K18A 2AV4A 1LU4A 3GX8A 5KEJA 3KXOA 3F6DA 3FY7A 2TRXA 3QD9A 3IAS2 1YF1A 2GZPA 2RUEA 4L5LA 2WULA 4GCIA 2M46A 1SYRA 1T4ZA 2A2SA 5F8BA 1TK5B 1WIKA 1DE1A 3FRCA 1PKZA 3SBCA 1ABAA 4KSMA 2BTOT 2CVDA 4IJIA 1URMA 4IBPA 5IQYA 2VL2C 1XFLA 3UJ1A 3D22A 1S3CA 1GRXA 1SL2B 2VM1A 1TW9A 1NSWA 2H0GA 4MZWA 2P31A 4GQFA 3VPQA 2HZFA 5D73A 5DQSA 2CA8A 4KDXA 3EVIA 1E2YA 1YZXA 5F06A 5LCZA 2X8CA 4Q5NA 4MZCA 3LW9A 2YJHA 1ZYPA 2V32A 5HR2A 4MDCA 3QDNA 1TRWA 2XBIA 3ZITA 3IXRA 3D6IA 4GF0A 1WP0A 4OD7A 5JWOB 3GA4A 2H75A 4OMVA 3ZTLA 2YJ7A 1U6TA 2YP6A 4NHWA 5B6NA 1K0OA 1AQXA 2IWTA 3DXBA 5IPGA 1DUGA 3LG6A 3TKSC 5GZZB 1MDKA 3UL3A 5ECIB 3CQFA 5B7CA 9GSSA 4GSTA 4CHSA 3APOA 4KAEA 1C72A 1QQ2A 1KEBA 1TRSA 1FAAA 3WT2A 4MJEA 4N0VA 4FYBA 2H1BA 4TXVA 3M1GA 3HYPA 2CZ2A 2PGTA 3TGZA 2R6KA 3F6FA 1TRVA 5FT3A 3C71A 4OFTA 2L59A 4WF4A 3KMNA 1WWJA 4G10A 4POMA 1XBSA 3TRQA 5HR3A 3FR9A 3M9JA 3HJMA 4EDZA 2DKIA 2B1KA 2A2PA 3VFIA 2LNSA 2GVPA 1RW1A 2FUG2 2RIIA 3HJPA 1M2AA 1A24A 1X0RA 3I6AA 3Q18A 3CSHA 4ECJA 4KF9A 5LD0A 1CQGA 4CDOA 5KOWA 2I1UA 2A4HA 3KM6A 2I4AA 4K1FA 3HKRA 1RQMA 2R3XA 5CYYA 3BJ5A 1GTAA 5CP1A 4LMWA 2A2RA 4RQXA 1SKWB 5GAND 2H30A 2LNTA 4USSA 4G0KA 3ZVJD 2YV7A 4XS4B 4MJCA 4KGIA 4TXOB 4IW9A 4HQZA 5IMVA 2ZNMA 1SENA 3GL5A 4L0WA 1DBYA 3NOFA 5IO0A 1SL1B 4JRRA 3HDCA 4GSSA 5FWGA 4GQCA 4MH2A 1TP9A 2H6YA 2OKAA 1XVQA 1ON4A 4GRFA 2OE3A 1KNGA 3ZYWA 3IBHA 2CX3A 4WBJA
chains in the Genus database with same CATH topology
2M80A 2QSIA 4AJ6A 5KN3A 1O85A 3IR4A 3A5IA 5E4WA 1XWBA 4EIQA 3CSJA 22GSA 5F07A 4MABA 4DSQA 1OVNA 2X49A 2H73A 4BL7B 2K9FA 5JWRB 2C3NA 2PMTA 1K0BA 5CRGA 4GLTA 5DJMA 3G7JA 4YQVA 19GSA 3TRXA 3MNGA 3GKMA 1GSYA 1VF1A 1MD4A 2K6VA 3Q19A 4O5RA 3F3QA 4IJ3A 4J57E 2V6OA 1FB0A 3GTUB 1JZRA 1GLQA 2YNXA 2OACA 2GQKA 2YWMA 2O8VB 5ELAA 3I69A 4GXZA 3W6GA 4I97A 2K8SA 1QGVA 1THOA 3F3RA 1IYIA 1FW1A 1PN0A 3MYDA 1PX6A 1FB6A 1I5GA 2WJUA 2VOCA 3FR3A 2KP2A 2NTOA 5IO2A 4QQ7A 1EV4A 3CRTA 2XPEA 2JADA 4PUAA 3LQ7A 1Z3EA 5DCHA 3LYPA 3IK9A 1FHEA 1BG5A 2FA8A 3LXTA 5ECLB 2J23A 1GTIA 2HSHA 5ENUA 2X64A 2IIYA 3IHQA 1E6BA 2C80A 4YQUA 5ECNB 1A23A 4TW5A 17GSA 1NM3A 5IMFA 5CREA 2PU9C 3RBTA 3CRUA 3IDVA 1SL0B 3D5JA 1R4WA 2YN1A 4NHZA 1HD2A 4HDEA 2FWFA 7GSSA 2YCDA 3HD5A 2HZEA 1ERTA 3MWHA 6GSYA 2FCHA 4PTSA 2ZCTA 1ST9A 3M0FA 2VL3A 2GGTA 4L0UA 4G9HA 2L5LA 2YWIA 4NWYA 4Z7XA 4KSOA 4I8BA 4ZB8A 1GH2A 3GSSA 3H4KA 12GSA 5HQPA 5C04A 20GSA 3WGEA 2WS2A 2C1YA 4EDYA 3I9V2 3M9KA 3PINA 2DJ2A 1AAZA 1LBKA 1XW5A 3DEXA 3CXGA 2AAWA 4TKYA 2IMFA 2XC2A 4N11A 2IMKA 3TOTA 3QMXA 1R5AA 3US3A 1M9AA 5GAPD 3J7Yb 2C0EA 3F4TA 2IFQA 3L4NA 1W4VA 1R26A 2D2ZA 4E8EA 2E2GA 4X1UA 4EE0A 1AQWA 4NPBA 3GX0A 1H75A 1NHOA 4F03A 2PUKC 2C3TA 3TJFA 3C7MA 2XHFA 3ZMLA 3DIEA 1PX7A 3O6TA 5DVBA 2XPDA 2OE1A 3M8NA 1YDKA 4MF7A 2HNLA 4KB3A 3DD3A 2VL2A 4IQ1A 4ACSA 5J41A 1ZYEA 3FKFA 2BMXA 3C1SA 3HXSA 18GSA 1THXA 4HOJA 3RHBA 3DGQA 2DJ3A 3DMLA 4OO5A 1V98A 3IA1A 1YJ6A 1KBNA 4BVXB 5IMAA 3VWVA 4ZXGA 4EVMA 4DVCA 4MA9A 3VWXA 1VF2A 1GSEA 5D9TA 2JACA 4POLA 4HI7A 4WBRD 2ZUPA 2AUVA 3TKSA 2FHEA 5AN1A 2REMA 3A2VA 1K0AA 2PWJA 3LSZA 2WGRA 4HQSA 4N0ZA 1V9WA 3VPTA 2VUPA 5DAKB 3HZ4A 4AJ8A 2C0DA 4F82A 4Z2RA 4YH2A 5J3RA 2KLXA 2YWNA 1MTCA 2JU5A 5B8AA 3GL3A 4G2EA 3W8JA 3P7XA 4KCAA 4KH7A 3L9SA 2JZRA 5DJLA 4IELA 5E59A 2GZZA 6GSVA 3PH9A 2JL4A 2CV4A 3U6VA 4QL7A 5KN1A 1GSQA 2VCXA 2DJJA 4FO5A 2X8HA 4LL1B 2LJRA 2H1DA 4BVYA 1J0FA 3VURA 2VCVA 4ML6A 4NAXA 2GLRA 3DKSA 4PQHA 4WXTA 3KD0A 3E0UA 3HCZA 1A0FA 1USBA 1X5CA 2P5RA 1IYHA 2EIOA 3LORA 4DEJA 3TJKA 1B8XA 3ERGA 1ZL9A 1PSQA 2F9SA 4K2DA 2B5YA 1WMJA 1XWKA 3LEFA 3VWUA 2CZ3A 3D21A 3ZFBA 2QA1A 3KH9A 4KE3A 3TB2A 2CAIA 3GRXA 3UBLA 4OO4A 1K3OA 5IM9A 3HY2A 4K6XA 2PVQA 1EP8A 4JZQA 5KOXA 2CAQA 3ME7A 3WGXA 5D9VA 1PL1A 2V2GA 4BWSA 2UZ8A 1AQVA 1EOHA 5G1LA 1AXDA 1DSBA 2YZHA 1QUWA 5ECOB 3WT1A 3GN3A 4OWYA 1HNAA 2YPMA 5J9BA 2LTKA 3R3EA 1PMTA 1T3BA 3UOMA 2PN8A 3A2XA 2V6KA 5IOXA 3UVTA 4L8EA 3I43A 3DVWA 1F2EA 3F63A 3KCMA 1ERWA 3KZQA 2VCTA 1O81A 2VD0A 3BOAA 2C0GA 2M72A 4KUNA 1JZDA 4K7OA 1TKDB 4NXIA 4QL9A 4IS0A 1ZCPA 2MMAA 5CRDA 3ED3A 1M2BA 5D96A 2FWGA 3ERWA 6GSTA 5FHIA 4KW6A 1EWXA 2LQOA 4X43A 5D93A 4KCEA 2CX4A 4FYUA 4DSSA 2DIYA 3G7IA 1NW2A 2GQMA 1F9MA 2AJQB 3P90A 1SKSB 6GSUA 4NV5A 1XOAA 3KP8A 2CT6A 3IK7A 3KJYA 5A4UA 2FNOA 4IQAA 1YEXA 3Q74A 3FW2A 1K0NA 2F8AA 2GQLA 1OC9A 2J9HA 3TJJA 1ZYNA 5HR1A 4BPYA 1R7HA 5AIVA 4TRXA 4O7HA 1RK4A 3G7YA 4MJAA 2B7JA 5AGYA 2KP1A 3RAZA 1X9WB 1U88A 5JCUA 5ECMB 2O85A 1UA5A 5F0GA 1XW6A 1EGRA 4O92A 3HZ8A 2GSRA 2RM6A 1GUKA 5J4UA 2WDUA 5ECQB 3ZIJA 2H0HA 2LJAA 3EU4A 3QFBC 5J5NA 1A8YA 2H70A 3FZAA 1TRUA 1ZYQB 1O8XA 3P8WA 3G9BA 5IOWA 3HJOA 1Z7RA 5A4VA 3IRAA 3LWAA 4ICYA 4EKZA 2DLXA 4POKA 1OE7A 3IC8A 2L4QA 2RM5A 2F8FA 5D9XA 4LL4B 2B3SA 5IPHA 2QGVA 1SJIA 1SJZA 1MDJA 1BEDA 4TR0A 5AISA 4D73A 4MNNA 3QPMA 4CY8A 3GFKA 3ZREA 2VCZA 2TRCP 5DDLA 1SD9A 1BYEA 4OCFA 2WCIA 4JBBA 1QMVA 1XOBA 4HJ2A 5ID2A 4MPGA 4ZL8A 2WB9A 4ZB6A 2DC5A 2DJ0A 1WPIA 2LQQA 2H1GA 4OFNA 2HZEB 2LRCA 4MH3A 3GHAA 4AJ7A 1Y6EA 5DCGA 1PD21 4KX4A 2DMMA 3OR5A 2K8VA 2DJKA 2A4VA 2B6MA 2L4CA 1G0TA 4V2LA 5L71A 2PVOC 1NHYA 1FVKA 2LJKA 2R2JA 2IL3A 5JCGA 5D9WA 4F0BA 3VI7A 3WGDA 1YQ1A 4J56E 3DYRA 4HEA2 3KTBA 1ML6A 2WZ9A 4K2XA 3O3TA 1LJRA 3CMIA 3CTFA 1X5EA 2EIRA 1TI3A 1SKRB 5ECHB 2H66A 5ECKB 1EGOA 3F0IA 1ERUA 4F2IA 2GT5A 3L9UA 3LGCA 2VLUA 2FD3A 2LS5A 5G1KA 2JZSA 3UVHA 1O6JA 4I2UA 1QXHA 1WRYA 6GSXA 4JEDA 2JSZA 5BMUA 2IFQB 4ECBA 2V1MA 5F05A 5IIZA 4A5PA 5COHA 5G2ZA 3EYTA 3TOUA 2O7KA 4TR1A 4Z2UA 2HRAA 2G0FA 3MIXA 3N5OA 1TU7A 3ISOA 5ECSA 2H72A 2H6ZA 5CAXA 1I9DA 2FGXA 1JFUA 1R5PA 1AUCA 2LRTA 5IMDA 3TKSE 3GIXA 3U5RE 5CO3A 2ON5A 3FYGA 5G5FA 4OFMA 3EE2A 4GSNA 5B8BA 3EMPA 5ECPB 4ZL9A 1M99A 5EL8A 2HRFA 1WJKA 1VF3A 5JWQB 3EPTA 2KUCA 1XWCA 1XPVA 3BCIA 3J7Yk 1Z6MA 4PURA 2DMLA 2FA4A 1TDIA 4IP1A 3UBKA 1ZZYA 2VLVA 1JZOA 1Q4JA 4G0IA 1GULA 1FOHA 3KH7A 2B5XA 3VLNA 4RUVA 1GP1A 3APSA 4Z2TA 4G19A 1PQNA 2PBJA 1EP7A 1S3DA 4K5RA 2DKHA 1K0CA 1Y25A 3TJBA 4TR3A 1SK1A 4BA7A 2QKEA 2P0GA 3IPZA 3H8QA 3D4MA 4KDUA 2VL9A 2OBKA 3ZL5A 1M0UA 1B48A 2VCQA 1BX9A 2GTUA 3DVXA 2XBQA 1QFNA 3M3MA 4K0GA 4BVYB 1VRSD 3GUSA 4ISDA 1TOFA 4K8MA 5HR0A 2LRNA 1K3YA 4ECCA 1K0MA 2ON7A 2YWOA 1EEJA 1O8WA 3GV1A 5IMZA 3ME8A 3IAM2 1YKAA 4K7NA 2MBSA 1UVZA 4MZBA 4FIWA 4GTUA 5G5EA 3E3EA 1B9XC 2HRKA 4HU7A 4TR4A 4K5SA 5B6MA 1J08A 1JHBA 2EC4A 1TK0B 3IV4A 4TVEA 4PNGA 4JR6A 5LNKe 2DIZA 4J2FA 1A0RP 4K0NA 3FK8A 3FMWA 5G31A 5BRTA 4ULXA 4EC0A 2I3YA 2TIRA 5D8IA 3C8EA 5JCWA 4WR5A 4KNDA 4ZL7A 3L78A 4ZBAA 5H5RA 4X4JA 3VI5A 2FWHA 3UARA 2DSAA 4I2TA 3QR6A 4RI6A 3IC4A 1Z9HA 2VD1A 2YV9A 8GSSA 4AGSA 2H0IA 16GSA 3LJRA 3AY8A 4O5QA 2AB6A 5DALB 3PPUA 3EINA 4CY6A 2MBTA 4PUFC 2N5BA 1T8EB 1PN9A 3GYKA 1K3LA 2H76A 4DSRA 1B9YC 2LV3A 3PR8A 1V57A 1KTEA 3FZ9A 1GL8A 1ILOA 4IVFA 4K9ZA 3F4RA 4EUYA 3GNJA 1ERVA 1AW9A 2YOIA 1ZOFA 4O32A 1EEMA 3E9JB 3HVSA 5KN0A 2MYGA 1GLPA 2OADA 4MF6A 4EIPA 2KOKA 1UC7A 3QAGA 2MMNA 4MF5A 2E2MA 4IKHA 3IOSA 4RQRA 5HFGA 4DSSB 14GSA 2FY6A 4K7IA 2HLSA 2NDOA 5DALA 2H01A 2O89A 4Q5QA 4FQUA 4G0LA 4EF0A 3QAVA 4YKGA 2VAFA 1MDIA 1GSDA 1JZWA 3GMFA 3IHGA 4IGJA 3ERFA 1AIUA 3DWVA 3HVXA 2GZYA 4I5QA 3LYKA 1OC9B 4XS6A 1QK8A 2L6DA 4YKFA 4F0CA 4Q5RA 1GWCA 3S9FA 2YZUA 4P3YB 1H4OA 3GSTA 4WR4A 4ECIA 1OC8A 3VK9A 1XWGA 1VF4A 3MDKA 1X5DA 1BAYA 1M9BA 1SK0A 1XXUA 2R0PA 3CTGA 1XZOA 2X99A 1BJXA 4OCEA 1ZGNA 2GS3A 3KMOA 2DBCA 1WOUA 3RDWA 4V2MA 13GSA 3KIJA 3TDGA 4ZB9A 2IPAA 1SYXA 4EO3A 1YEPA 1ACVA 2FWEA 1SJ6A 2YANA 3NZNA 2OJLA 5CRWA 3QCPA 3F8UA 3QOUA 1M2DA 2DJ1A 2VIMA 2HFDA 2AYTA 5HFIA 1O73A 1F3AA 4GWRA 2X4AA 3LFLA 4HU9A 2CQ9A 4XS1A 3SWLA 2H6XA 4IHUA 2HYXA 2HT9A 3RPNA 4I6XA 4EXJA 1YF0A 2H71A 3EC3A 4D73B 4XTSA 4BWQA 4N30A 2IN3A 2NPBA 4JR4A 2MMOA 1T1VA 2ALBA 2LEGA 2HE3A 3KP9A 4IP6A 3UEMA 3K8NA 1EZKA 1GUMA 1Z6NA 1DE2A 2FLSA 5ID2B 3QAWA 4WKWA 1TXXA 1A8LA 3BD2A 1V2AA 1T4YA 3GKNA 1MEKA 1PRXA 3TCOA 5ABRA 1OAZA 1OKDA 1FVJA 5H5SA 2V41A 4HJMA 1Q98A 3DRNA 2IMIA 2X8GA 4LLRA 1B4QA 5EY6A 2AHEA 1PL2A 1SD8A 1XWAA 5J9CA 1T7PB 4KA0A 3TKQA 1X9MB 2GSSA 3IE3A 6GSWA 1MD3A 2GDRA 4CW9A 4MPFA 1HNBA 3FZ5A 1XW9A 4ID0A 4XS4A 3O76A 3RPPA 3FR6A 4TXOA 1WE0A 1F6MC 5A4WA 1HNCA 2P5QA 1EV9A 1T00A 1FO5A 3L0HA 6GSSA 1AC1A 1ZMAA 3FHKA 1N8JA 3TUEA 4ZBBA 4YAPA 3GH9A 3NIVA 3Q6OA 5AIXA 4JU5A 4HUAA 4NMUA 1K0DA 2HI7A 2LSTA 4XCSA 5HFKA 4POBA 1OKTA 1FOVA 4BL7A 1TK8B 2RUFA 4V2NA 1N2AA 4O5UA 4HZ4A 5CNWA 4TR1B 2GSQA 3HHVA 4TN8A 3HA9A 2CVKA 5ELGA 1EOGA 3KTLA 4XIHA 2OE0A 3EU3A 3A3TA 3JCML 2LKUA 1G7OA 4PNFA 2L57A 5C00A 2IMDA 3GTUA 2H74A 2R37A 4XRDA 2IMEA 1Z5YE 3HVVA 2HSMA 5INYA 4EL1A 4ILFA 1G6YA 1U87A 2ES7A 3EWLA 5G30A 4XHMA 2L5OA 1B4PA 4TOPA 1A2MA 1XCCA 3KGKA 1YKCA 3QFAC 2IJYA 3CBUA 4NV2A 4PQIA 3RHCA 3FEUA 2VLTA 3EURA 1PKWA 5DQYA 1J9BA 2WFCA 3A5WA 4F9ZA 4PXOA 4WF5A 1JLWA 1TU8A 3GKKA 4X0XA 3TRPA 2VCWA 4ZBDA 1O7UA 2H1AA 1GUHA 4MP4A 3UIWA 4PX1A 4PGTA 3VWWA 3A2WA 3WYWA 4IN0A 3CSIA 4FH8A 1TJDA 3TJGA 1CQHA 3H93A 1GNEA 4L5OA 1W89A 4XRAA 1VGLA 4LA1A 3F4SA 1S3AA 1U3AA 2E7PA 1A2LA 3F9UA 2C0FA 2LUSA 1SK2A 3MAKA 2C8UA 4MK3A 3FZ4A 1GSSA 4HS1A 2I9HA 1G6WA 2KHPA 1PA3A 2R0GA 3ZMKA 1A2JA 2MZCA 3ZIVA 1X9SB 3APQA 4Q5FA 4V1Ap 5DBQA 4WETA 2HSYA 2Z9SA 3UAPA 1V58A 5GSSA 2N5AA 2CVBA 3GH6A 2GT6A 2JSYA 4ML1A 2H19A 2JZTA 3N9JA 2H8LA 2N5FA 4AF2A 1TTZA 1OYJA 2R5GA 1G7EA 3PGTA 4LMVA 1PGTA 4PQ1A 1SU9A 2E0QA 1F3BA 3LXZA 1GSFA 2WRTA 4V1Ag 3CYNA 3D0ZA 11GSA 2R0CA 1M7TA 2PPTA 4MJBA 1JLVA 4FYCA 3V1WA 3ZZXA 4WEYA 3ZFLA 2B5EA 2BJXA 2L6CA 5A5KA 3W8SA 1XVWA 4YAVA 4MLYA 3KEBA 2NVLA 2PERA 3BCKA 1UN2A 2B7KA 4RI7A 3TKRA 1FG4A 3TKPA 3H1NA 1HQOA 1F37A 4YQMA 3D4TA 10GSA 4JE1A 3UMAA 5ECRB 1YY7A 2OA7A 2R4VA 2O87A 1HYUA 3P2AA 5EPFA 3H79A 2F51A 1GSUA 3GKXA 1Z7PA 1GTBA 4E8HA 3L9VA 3C1RA 3C73A 3GURA 4BVXA 1XIYA 4MMMA 2MMZA 1OE8A 2VO4A 5EVOA 2HXKA 2VM2A 4ZILA 1GTUA 5IMCA 4ZIJA 3ZLPA 5KN2A 1U3IA 2F3MA 1V40A 3EMXA 2G2QA 2QC7A 5GSTA 2B1LA 4HZ2A 2GSTA 4KDYA 3R2QA 5H5QA 2C3QA 2NBSA 3ZVJA 4N10A 3ZRDA 2RLIA 5CRHA 1BQ7A 3MSZA 5DAKA 2C4JA 3BBYA 2I81A 4H86A 4MCUA 1OC3A 2QA2A 1GNWA 1TI1A 2HRNA 3WD6A 2EIQA 2OBIA 2K18A 2AV4A 1LU4A 3GX8A 5KEJA 3KXOA 3F6DA 3FY7A 2TRXA 3QD9A 3IAS2 1YF1A 2GZPA 2RUEA 4L5LA 2WULA 4GCIA 2M46A 1SYRA 1T4ZA 2A2SA 5F8BA 1TK5B 1WIKA 1DE1A 3FRCA 1PKZA 3SBCA 1ABAA 4KSMA 2BTOT 2CVDA 4IJIA 1URMA 4IBPA 5IQYA 2VL2C 1XFLA 3UJ1A 3D22A 1S3CA 1GRXA 1SL2B 2VM1A 1TW9A 1NSWA 2H0GA 4MZWA 2P31A 4GQFA 3VPQA 2HZFA 5D73A 5DQSA 2CA8A 4KDXA 3EVIA 1E2YA 1YZXA 5F06A 5LCZA 2X8CA 4Q5NA 4MZCA 3LW9A 2YJHA 1ZYPA 2V32A 5HR2A 4MDCA 3QDNA 1TRWA 2XBIA 3ZITA 3IXRA 3D6IA 4GF0A 1WP0A 4OD7A 5JWOB 3GA4A 2H75A 4OMVA 3ZTLA 2YJ7A 1U6TA 2YP6A 4NHWA 5B6NA 1K0OA 1AQXA 2IWTA 3DXBA 5IPGA 1DUGA 3LG6A 3TKSC 5GZZB 1MDKA 3UL3A 5ECIB 5B7CA 9GSSA 4GSTA 4CHSA 3APOA 4KAEA 1C72A 1QQ2A 1KEBA 1TRSA 1FAAA 3WT2A 4MJEA 4N0VA 4FYBA 2H1BA 4TXVA 3M1GA 3HYPA 2CZ2A 2PGTA 3TGZA 2R6KA 3F6FA 1TRVA 5FT3A 3C71A 4OFTA 2L59A 4WF4A 3KMNA 1WWJA 4G10A 4POMA 1XBSA 3TRQA 5HR3A 3FR9A 3M9JA 3HJMA 4EDZA 2DKIA 2B1KA 2A2PA 3VFIA 2LNSA 2GVPA 1RW1A 2FUG2 2RIIA 3HJPA 1M2AA 1A24A 1X0RA 3I6AA 3Q18A 3CSHA 4ECJA 4KF9A 5LD0A 1CQGA 4CDOA 5KOWA 2I1UA 2A4HA 3KM6A 2I4AA 4K1FA 3HKRA 1RQMA 2R3XA 5CYYA 3BJ5A 1GTAA 5CP1A 4LMWA 2A2RA 4RQXA 1SKWB 5GAND 2H30A 2LNTA 4USSA 4G0KA 3ZVJD 2YV7A 4XS4B 4MJCA 4KGIA 4TXOB 4IW9A 4HQZA 5IMVA 2ZNMA 1SENA 3GL5A 4L0WA 1DBYA 3NOFA 5IO0A 1SL1B 4JRRA 3HDCA 4GSSA 5FWGA 4GQCA 4MH2A 1TP9A 2H6YA 2OKAA 1XVQA 1ON4A 4GRFA 2OE3A 1KNGA 3ZYWA 3IBHA 2CX3A 4WBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M80 A;  2QSI A;  4AJ6 A;  5KN3 A;  1O85 A;  3IR4 A;  5E4W A;  1XWB A;  3CSJ A;  22GS A;  5F07 A;  4MAB A;  4DSQ A;  1OVN A;  2H73 A;  2K9F A;  5JWR B;  2C3N A;  2PMT A;  1K0B A;  5CRG A;  4GLT A;  5DJM A;  3G7J A;  4YQV A;  19GS A;  3TRX A;  3MNG A;  3GKM A;  1GSY A;  1VF1 A;  1MD4 A;  2K6V A;  3Q19 A;  4O5R A;  3F3Q A;  4IJ3 A;  4J57 E;  2V6O A;  1FB0 A;  3GTU B;  1JZR A;  1GLQ A;  2YNX A;  2OAC A;  2GQK A;  2YWM A;  2O8V B;  5ELA A;  3I69 A;  4GXZ A;  3W6G A;  4I97 A;  2K8S A;  1QGV A;  1THO A;  3F3R A;  1IYI A;  1FW1 A;  1PX6 A;  1FB6 A;  1I5G A;  2WJU A;  2VOC A;  3FR3 A;  2KP2 A;  2NTO A;  5IO2 A;  4QQ7 A;  1EV4 A;  3CRT A;  2XPE A;  2JAD A;  4PUA A;  3LQ7 A;  1Z3E A;  5DCH A;  3LYP A;  3IK9 A;  1FHE A;  1BG5 A;  2FA8 A;  3LXT A;  5ECL B;  2J23 A;  1GTI A;  2HSH A;  5ENU A;  2X64 A;  2IIY A;  3IHQ A;  1E6B A;  2C80 A;  4YQU A;  5ECN B;  1A23 A;  4TW5 A;  17GS A;  1NM3 A;  5IMF A;  5CRE A;  2PU9 C;  3RBT A;  3CRU A;  3IDV A;  1SL0 B;  3D5J A;  1R4W A;  2YN1 A;  4NHZ A;  1HD2 A;  4HDE A;  2FWF A;  7GSS A;  2YCD A;  3HD5 A;  2HZE A;  1ERT A;  3MWH A;  6GSY A;  2FCH A;  2ZCT A;  1ST9 A;  3M0F A;  2VL3 A;  2GGT A;  4L0U A;  4G9H A;  2L5L A;  2YWI A;  4NWY A;  4Z7X A;  4KSO A;  4I8B A;  4ZB8 A;  1GH2 A;  3GSS A;  3H4K A;  12GS A;  5HQP A;  5C04 A;  20GS A;  3WGE A;  2WS2 A;  2C1Y A;  4EDY A;  3I9V 2;  3M9K A;  3PIN A;  2DJ2 A;  1AAZ A;  1LBK A;  1XW5 A;  3DEX A;  3CXG A;  2AAW A;  4TKY A;  2IMF A;  2XC2 A;  4N11 A;  2IMK A;  3TOT A;  3QMX A;  1R5A A;  3US3 A;  1M9A A;  5GAP D;  3J7Y b;  2C0E A;  3F4T A;  2IFQ A;  3L4N A;  1W4V A;  1R26 A;  2D2Z A;  4E8E A;  2E2G A;  4X1U A;  4EE0 A;  1AQW A;  4NPB A;  3GX0 A;  1H75 A;  1NHO A;  4F03 A;  2PUK C;  2C3T A;  3TJF A;  3C7M A;  2XHF A;  3ZML A;  3DIE A;  1PX7 A;  3O6T A;  5DVB A;  2XPD A;  2OE1 A;  3M8N A;  1YDK A;  4MF7 A;  2HNL A;  4KB3 A;  3DD3 A;  2VL2 A;  4IQ1 A;  4ACS A;  5J41 A;  1ZYE A;  3FKF A;  2BMX A;  3C1S A;  3HXS A;  18GS A;  1THX A;  4HOJ A;  3RHB A;  3DGQ A;  2DJ3 A;  3DML A;  4OO5 A;  1V98 A;  3IA1 A;  1YJ6 A;  1KBN A;  5IMA A;  3VWV A;  4ZXG A;  4EVM A;  4DVC A;  4MA9 A;  3VWX A;  1VF2 A;  1GSE A;  5D9T A;  2JAC A;  4POL A;  4HI7 A;  4WBR D;  2ZUP A;  2AUV A;  3TKS A;  2FHE A;  5AN1 A;  2REM A;  3A2V A;  1K0A A;  2PWJ A;  3LSZ A;  2WGR A;  4HQS A;  4N0Z A;  1V9W A;  3VPT A;  2VUP A;  5DAK B;  3HZ4 A;  4AJ8 A;  2C0D A;  4F82 A;  4YH2 A;  5J3R A;  2KLX A;  2YWN A;  1MTC A;  2JU5 A;  5B8A A;  3GL3 A;  4G2E A;  3W8J A;  3P7X A;  4KCA A;  4KH7 A;  3L9S A;  2JZR A;  5DJL A;  4IEL A;  5E59 A;  2GZZ A;  6GSV A;  3PH9 A;  2JL4 A;  2CV4 A;  3U6V A;  4QL7 A;  5KN1 A;  1GSQ A;  2VCX A;  2DJJ A;  4FO5 A;  2X8H A;  4LL1 B;  2LJR A;  2H1D A;  4BVY A;  1J0F A;  3VUR A;  2VCV A;  4ML6 A;  4NAX A;  2GLR A;  3DKS A;  4PQH A;  4WXT A;  3KD0 A;  3E0U A;  3HCZ A;  1A0F A;  1USB A;  1X5C A;  2P5R A;  1IYH A;  2EIO A;  3LOR A;  4DEJ A;  3TJK A;  1B8X A;  3ERG A;  1ZL9 A;  1PSQ A;  2F9S A;  4K2D A;  2B5Y A;  1WMJ A;  1XWK A;  3LEF A;  3VWU A;  2CZ3 A;  3D21 A;  3ZFB A;  3KH9 A;  4KE3 A;  3TB2 A;  2CAI A;  3GRX A;  3UBL A;  4OO4 A;  1K3O A;  5IM9 A;  3HY2 A;  4K6X A;  2PVQ A;  1EP8 A;  4JZQ A;  2CAQ A;  3ME7 A;  3WGX A;  5D9V A;  1PL1 A;  2V2G A;  4BWS A;  1AQV A;  1EOH A;  5G1L A;  1AXD A;  1DSB A;  2YZH A;  1QUW A;  5ECO B;  3WT1 A;  3GN3 A;  4OWY A;  1HNA A;  2YPM A;  5J9B A;  2LTK A;  1PMT A;  1T3B A;  3UOM A;  2PN8 A;  3A2X A;  2V6K A;  5IOX A;  3UVT A;  4L8E A;  3I43 A;  3DVW A;  1F2E A;  3F63 A;  3KCM A;  1ERW A;  3KZQ A;  2VCT A;  1O81 A;  2VD0 A;  3BOA A;  2C0G A;  2M72 A;  4KUN A;  1JZD A;  4K7O A;  1TKD B;  4NXI A;  4QL9 A;  4IS0 A;  1ZCP A;  2MMA A;  5CRD A;  3ED3 A;  1M2B A;  5D96 A;  2FWG A;  3ERW A;  6GST A;  5FHI A;  4KW6 A;  1EWX A;  2LQO A;  5D93 A;  4X43 A;  4KCE A;  2CX4 A;  4FYU A;  4DSS A;  2DIY A;  3G7I A;  1NW2 A;  2GQM A;  1F9M A;  2AJQ B;  3P90 A;  1SKS B;  6GSU A;  4NV5 A;  1XOA A;  3KP8 A;  2CT6 A;  3IK7 A;  3KJY A;  5A4U A;  2FNO A;  4IQA A;  1YEX A;  3Q74 A;  3FW2 A;  1K0N A;  2F8A A;  2GQL A;  1OC9 A;  2J9H A;  3TJJ A;  5HR1 A;  4BPY A;  1R7H A;  5AIV A;  4TRX A;  4O7H A;  1RK4 A;  3G7Y A;  4MJA A;  2B7J A;  5AGY A;  2KP1 A;  3RAZ A;  1X9W B;  1U88 A;  5JCU A;  5ECM B;  2O85 A;  1UA5 A;  5F0G A;  1XW6 A;  1EGR A;  4O92 A;  3HZ8 A;  2GSR A;  2RM6 A;  1GUK A;  5J4U A;  2WDU A;  5ECQ B;  3ZIJ A;  2H0H A;  2LJA A;  3EU4 A;  3QFB C;  5J5N A;  1A8Y A;  2H70 A;  3FZA A;  1TRU A;  1ZYQ B;  1O8X A;  3P8W A;  3G9B A;  5IOW A;  3HJO A;  1Z7R A;  5A4V A;  3IRA A;  3LWA A;  4EKZ A;  2DLX A;  4POK A;  1OE7 A;  2L4Q A;  2RM5 A;  2F8F A;  5D9X A;  4LL4 B;  2B3S A;  5IPH A;  2QGV A;  1SJI A;  1SJZ A;  1MDJ A;  1BED A;  4TR0 A;  5AIS A;  4D73 A;  3QPM A;  3GFK A;  3ZRE A;  2VCZ A;  2TRC P;  5DDL A;  1SD9 A;  1BYE A;  4OCF A;  2WCI A;  4JBB A;  1QMV A;  1XOB A;  4HJ2 A;  5ID2 A;  4MPG A;  4ZL8 A;  2WB9 A;  4ZB6 A;  2DC5 A;  2DJ0 A;  1WPI A;  2LQQ A;  2H1G A;  4OFN A;  2HZE B;  2LRC A;  4MH3 A;  3GHA A;  4AJ7 A;  1Y6E A;  5DCG A;  1PD2 1;  4KX4 A;  2DMM A;  3OR5 A;  2K8V A;  2DJK A;  2A4V A;  2B6M A;  2L4C A;  1G0T A;  4V2L A;  5L71 A;  2PVO C;  1NHY A;  1FVK A;  2LJK A;  2R2J A;  2IL3 A;  5JCG A;  5D9W A;  4F0B A;  3VI7 A;  3WGD A;  1YQ1 A;  4J56 E;  3DYR A;  4HEA 2;  3KTB A;  1ML6 A;  2WZ9 A;  3O3T A;  1LJR A;  3CMI A;  3CTF A;  1X5E A;  2EIR A;  1TI3 A;  1SKR B;  5ECH B;  2H66 A;  5ECK B;  1EGO A;  3F0I A;  1ERU A;  4F2I A;  2GT5 A;  3L9U A;  3LGC A;  2VLU A;  2FD3 A;  2LS5 A;  5G1K A;  2JZS A;  3UVH A;  1O6J A;  4I2U A;  1QXH A;  1WRY A;  6GSX A;  4JED A;  2JSZ A;  2IFQ B;  4ECB A;  2V1M A;  5F05 A;  5IIZ A;  5COH A;  5G2Z A;  3EYT A;  3TOU A;  2O7K A;  4TR1 A;  2G0F A;  3N5O A;  1TU7 A;  3ISO A;  5ECS A;  2H72 A;  2H6Z A;  5CAX A;  1I9D A;  2FGX A;  1JFU A;  1R5P A;  1AUC A;  2LRT A;  5IMD A;  3TKS E;  3GIX A;  3U5R E;  5CO3 A;  2ON5 A;  3FYG A;  5G5F A;  4OFM A;  3EE2 A;  4GSN A;  5B8B A;  3EMP A;  5ECP B;  4ZL9 A;  1M99 A;  5EL8 A;  2HRF A;  1WJK A;  1VF3 A;  5JWQ B;  2KUC A;  1XWC A;  1XPV A;  3BCI A;  3J7Y k;  1Z6M A;  4PUR A;  2DML A;  2FA4 A;  1TDI A;  4IP1 A;  3UBK A;  1ZZY A;  2VLV A;  1JZO A;  1Q4J A;  1GUL A;  3KH7 A;  2B5X A;  3VLN A;  4RUV A;  1GP1 A;  3APS A;  4G19 A;  1PQN A;  2PBJ A;  1EP7 A;  1S3D A;  1K0C A;  1Y25 A;  3TJB A;  4TR3 A;  1SK1 A;  4BA7 A;  2QKE A;  2P0G A;  3IPZ A;  3H8Q A;  3D4M A;  4KDU A;  2VL9 A;  2OBK A;  3ZL5 A;  1M0U A;  1B48 A;  2VCQ A;  1BX9 A;  2GTU A;  3DVX A;  2XBQ A;  1QFN A;  3M3M A;  4K0G A;  1VRS D;  3GUS A;  4ISD A;  1TOF A;  4K8M A;  5HR0 A;  2LRN A;  1K3Y A;  4ECC A;  1K0M A;  2ON7 A;  2YWO A;  1EEJ A;  1O8W A;  3GV1 A;  5IMZ A;  3ME8 A;  3IAM 2;  1YKA A;  4K7N A;  2MBS A;  1UVZ A;  4MZB A;  4FIW A;  4GTU A;  5G5E A;  3E3E A;  1B9X C;  4HU7 A;  4TR4 A;  5B6M A;  1J08 A;  1JHB A;  2EC4 A;  1TK0 B;  3IV4 A;  4TVE A;  4PNG A;  4JR6 A;  5LNK e;  2DIZ A;  4J2F A;  1A0R P;  4K0N A;  3FK8 A;  5G31 A;  4ULX A;  4EC0 A;  2I3Y A;  2TIR A;  5D8I A;  3C8E A;  5JCW A;  4WR5 A;  4KND A;  4ZL7 A;  3L78 A;  4ZBA A;  5H5R A;  3VI5 A;  2FWH A;  3UAR A;  2DSA A;  4I2T A;  3QR6 A;  4RI6 A;  3IC4 A;  1Z9H A;  2VD1 A;  2YV9 A;  8GSS A;  4AGS A;  2H0I A;  16GS A;  3LJR A;  3AY8 A;  2AB6 A;  5DAL B;  3EIN A;  2MBT A;  4PUF C;  2N5B A;  1T8E B;  1PN9 A;  3GYK A;  1K3L A;  2H76 A;  4DSR A;  1B9Y C;  2LV3 A;  3PR8 A;  1V57 A;  1KTE A;  3FZ9 A;  1GL8 A;  1ILO A;  4IVF A;  4K9Z A;  3F4R A;  4EUY A;  3GNJ A;  1ERV A;  1AW9 A;  2YOI A;  1ZOF A;  4O32 A;  1EEM A;  3E9J B;  3HVS A;  5KN0 A;  2MYG A;  1GLP A;  2OAD A;  4MF6 A;  2KOK A;  1UC7 A;  3QAG A;  2MMN A;  4MF5 A;  2E2M A;  4IKH A;  3IOS A;  4RQR A;  5HFG A;  4DSS B;  14GS A;  2FY6 A;  4K7I A;  2HLS A;  2NDO A;  5DAL A;  2H01 A;  2O89 A;  4Q5Q A;  4EF0 A;  3QAV A;  2VAF A;  1MDI A;  1GSD A;  1JZW A;  3GMF A;  4IGJ A;  3ERF A;  1AIU A;  3DWV A;  3HVX A;  2GZY A;  4I5Q A;  3LYK A;  1OC9 B;  4XS6 A;  1QK8 A;  2L6D A;  4F0C A;  4Q5R A;  1GWC A;  3S9F A;  2YZU A;  4P3Y B;  1H4O A;  3GST A;  4WR4 A;  4ECI A;  1OC8 A;  3VK9 A;  1XWG A;  1VF4 A;  3MDK A;  1X5D A;  1BAY A;  1M9B A;  1SK0 A;  1XXU A;  3CTG A;  1XZO A;  2X99 A;  1BJX A;  4OCE A;  1ZGN A;  2GS3 A;  3KMO A;  2DBC A;  1WOU A;  3RDW A;  4V2M A;  13GS A;  3KIJ A;  3TDG A;  4ZB9 A;  2IPA A;  1SYX A;  4EO3 A;  1YEP A;  1ACV A;  2FWE A;  1SJ6 A;  2YAN A;  3NZN A;  2OJL A;  5CRW A;  3QCP A;  3F8U A;  3QOU A;  1M2D A;  2DJ1 A;  2VIM A;  2HFD A;  2AYT A;  5HFI A;  1O73 A;  1F3A A;  4GWR A;  3LFL A;  4HU9 A;  2CQ9 A;  4XS1 A;  3SWL A;  2H6X A;  4IHU A;  2HYX A;  2HT9 A;  3RPN A;  4I6X A;  4EXJ A;  1YF0 A;  2H71 A;  3EC3 A;  4D73 B;  4XTS A;  4BWQ A;  4N30 A;  2IN3 A;  2NPB A;  4JR4 A;  2MMO A;  1T1V A;  2ALB A;  2LEG A;  2HE3 A;  3KP9 A;  4IP6 A;  3UEM A;  3K8N A;  1EZK A;  1GUM A;  1Z6N A;  1DE2 A;  2FLS A;  5ID2 B;  3QAW A;  4WKW A;  1TXX A;  1A8L A;  3BD2 A;  1V2A A;  1T4Y A;  3GKN A;  1MEK A;  1PRX A;  3TCO A;  5ABR A;  1OAZ A;  1OKD A;  1FVJ A;  5H5S A;  2V41 A;  4HJM A;  1Q98 A;  3DRN A;  2IMI A;  2X8G A;  4LLR A;  1B4Q A;  5EY6 A;  2AHE A;  1PL2 A;  1SD8 A;  1XWA A;  5J9C A;  1T7P B;  4KA0 A;  3TKQ A;  1X9M B;  2GSS A;  3IE3 A;  6GSW A;  1MD3 A;  2GDR A;  4CW9 A;  4MPF A;  1HNB A;  3FZ5 A;  1XW9 A;  4ID0 A;  4XS4 A;  3O76 A;  3RPP A;  3FR6 A;  4TXO A;  1WE0 A;  1F6M C;  5A4W A;  1HNC A;  2P5Q A;  1EV9 A;  1T00 A;  1FO5 A;  3L0H A;  6GSS A;  1AC1 A;  1ZMA A;  3FHK A;  1N8J A;  3TUE A;  4ZBB A;  4YAP A;  3GH9 A;  3NIV A;  3Q6O A;  5AIX A;  4JU5 A;  4HUA A;  4NMU A;  1K0D A;  2HI7 A;  2LST A;  4XCS A;  5HFK A;  4POB A;  1OKT A;  1FOV A;  4BL7 A;  1TK8 B;  2RUF A;  4V2N A;  1N2A A;  4HZ4 A;  5CNW A;  4TR1 B;  2GSQ A;  3HHV A;  4TN8 A;  3HA9 A;  2CVK A;  5ELG A;  1EOG A;  3KTL A;  4XIH A;  2OE0 A;  3EU3 A;  3A3T A;  3JCM L;  2LKU A;  1G7O A;  4PNF A;  2L57 A;  5C00 A;  2IMD A;  3GTU A;  2H74 A;  2R37 A;  4XRD A;  2IME A;  1Z5Y E;  3HVV A;  5INY A;  4EL1 A;  4ILF A;  1G6Y A;  1U87 A;  2ES7 A;  3EWL A;  5G30 A;  4XHM A;  2L5O A;  1B4P A;  4TOP A;  1A2M A;  1XCC A;  3KGK A;  1YKC A;  3QFA C;  2IJY A;  3CBU A;  4NV2 A;  4PQI A;  3RHC A;  3FEU A;  2VLT A;  3EUR A;  1PKW A;  5DQY A;  1J9B A;  2WFC A;  3A5W A;  4F9Z A;  4PXO A;  4WF5 A;  1JLW A;  1TU8 A;  3GKK A;  4X0X A;  3TRP A;  2VCW A;  4ZBD A;  1O7U A;  2H1A A;  1GUH A;  4MP4 A;  3UIW A;  4PX1 A;  4PGT A;  3VWW A;  3A2W A;  3WYW A;  4IN0 A;  3CSI A;  4FH8 A;  1TJD A;  3TJG A;  1CQH A;  3H93 A;  1GNE A;  4L5O A;  1W89 A;  4XRA A;  1VGL A;  4LA1 A;  3F4S A;  1S3A A;  1U3A A;  2E7P A;  1A2L A;  3F9U A;  2C0F A;  2LUS A;  1SK2 A;  3MAK A;  2C8U A;  4MK3 A;  3FZ4 A;  1GSS A;  4HS1 A;  2I9H A;  1G6W A;  2KHP A;  1PA3 A;  3ZMK A;  1A2J A;  2MZC A;  3ZIV A;  1X9S B;  3APQ A;  4Q5F A;  4V1A p;  5DBQ A;  4WET A;  2HSY A;  2Z9S A;  3UAP A;  1V58 A;  5GSS A;  2N5A A;  2CVB A;  3GH6 A;  2GT6 A;  2JSY A;  4ML1 A;  2H19 A;  2JZT A;  3N9J A;  2H8L A;  2N5F A;  4AF2 A;  1TTZ A;  1OYJ A;  2R5G A;  1G7E A;  3PGT A;  4LMV A;  1PGT A;  4PQ1 A;  1SU9 A;  2E0Q A;  1F3B A;  3LXZ A;  1GSF A;  2WRT A;  4V1A g;  3CYN A;  3D0Z A;  11GS A;  1M7T A;  2PPT A;  4MJB A;  1JLV A;  4FYC A;  3V1W A;  3ZZX A;  4WEY A;  3ZFL A;  2B5E A;  2BJX A;  2L6C A;  5A5K A;  3W8S A;  1XVW A;  4YAV A;  4MLY A;  3KEB A;  2NVL A;  2PER A;  3BCK A;  1UN2 A;  2B7K A;  4RI7 A;  3TKR A;  1FG4 A;  3TKP A;  3H1N A;  1HQO A;  1F37 A;  4YQM A;  3D4T A;  10GS A;  4JE1 A;  3UMA A;  5ECR B;  1YY7 A;  2OA7 A;  2R4V A;  2O87 A;  1HYU A;  3P2A A;  5EPF A;  3H79 A;  2F51 A;  1GSU A;  3GKX A;  1Z7P A;  1GTB A;  4E8H A;  3L9V A;  3C1R A;  3C73 A;  3GUR A;  4BVX A;  1XIY A;  4MMM A;  2MMZ A;  1OE8 A;  2VO4 A;  5EVO A;  2HXK A;  2VM2 A;  4ZIL A;  1GTU A;  5IMC A;  4ZIJ A;  3ZLP A;  5KN2 A;  1U3I A;  2F3M A;  1V40 A;  3EMX A;  2G2Q A;  2QC7 A;  5GST A;  2B1L A;  4HZ2 A;  2GST A;  4KDY A;  3R2Q A;  5H5Q A;  2C3Q A;  2NBS A;  3ZVJ A;  4N10 A;  3ZRD A;  2RLI A;  5CRH A;  1BQ7 A;  3MSZ A;  5DAK A;  2C4J A;  3BBY A;  2I81 A;  4H86 A;  4MCU A;  1OC3 A;  1GNW A;  1TI1 A;  2HRN A;  3WD6 A;  2EIQ A;  2OBI A;  2K18 A;  2AV4 A;  1LU4 A;  3GX8 A;  5KEJ A;  3KXO A;  3F6D A;  3FY7 A;  2TRX A;  3QD9 A;  3IAS 2;  1YF1 A;  2GZP A;  2RUE A;  4L5L A;  2WUL A;  4GCI A;  2M46 A;  1SYR A;  1T4Z A;  2A2S A;  5F8B A;  1TK5 B;  1WIK A;  1DE1 A;  3FRC A;  1PKZ A;  3SBC A;  1ABA A;  4KSM A;  2BTO T;  2CVD A;  4IJI A;  1URM A;  4IBP A;  5IQY A;  2VL2 C;  1XFL A;  3UJ1 A;  3D22 A;  1S3C A;  1GRX A;  1SL2 B;  2VM1 A;  1TW9 A;  1NSW A;  2H0G A;  4MZW A;  2P31 A;  4GQF A;  3VPQ A;  2HZF A;  5D73 A;  5DQS A;  2CA8 A;  4KDX A;  3EVI A;  1E2Y A;  1YZX A;  5F06 A;  5LCZ A;  2X8C A;  4Q5N A;  4MZC A;  2YJH A;  2V32 A;  5HR2 A;  4MDC A;  3QDN A;  1TRW A;  2XBI A;  3ZIT A;  3IXR A;  3D6I A;  4GF0 A;  1WP0 A;  4OD7 A;  5JWO B;  3GA4 A;  2H75 A;  4OMV A;  3ZTL A;  2YJ7 A;  1U6T A;  2YP6 A;  4NHW A;  5B6N A;  1K0O A;  1AQX A;  2IWT A;  3DXB A;  5IPG A;  1DUG A;  3LG6 A;  3TKS C;  5GZZ B;  1MDK A;  3UL3 A;  5ECI B;  5B7C A;  9GSS A;  4GST A;  4CHS A;  3APO A;  4KAE A;  1C72 A;  1QQ2 A;  1KEB A;  1TRS A;  1FAA A;  3WT2 A;  4MJE A;  4N0V A;  4FYB A;  2H1B A;  4TXV A;  3M1G A;  3HYP A;  2CZ2 A;  2PGT A;  3TGZ A;  2R6K A;  3F6F A;  1TRV A;  5FT3 A;  3C71 A;  4OFT A;  2L59 A;  4WF4 A;  3KMN A;  1WWJ A;  4G10 A;  4POM A;  1XBS A;  3TRQ A;  5HR3 A;  3FR9 A;  3M9J A;  3HJM A;  4EDZ A;  2B1K A;  3VFI A;  2LNS A;  2GVP A;  1RW1 A;  2FUG 2;  2RII A;  3HJP A;  1M2A A;  1A24 A;  1X0R A;  3I6A A;  3Q18 A;  3CSH A;  4ECJ A;  5LD0 A;  1CQG A;  4CDO A;  2I1U A;  3KM6 A;  2I4A A;  4K1F A;  3HKR A;  1RQM A;  2R3X A;  5CYY A;  3BJ5 A;  1GTA A;  5CP1 A;  4LMW A;  2A2R A;  4RQX A;  1SKW B;  5GAN D;  2H30 A;  2LNT A;  3ZVJ D;  2YV7 A;  4XS4 B;  4MJC A;  4KGI A;  4TXO B;  4IW9 A;  4HQZ A;  5IMV A;  2ZNM A;  1SEN A;  3GL5 A;  4L0W A;  1DBY A;  3NOF A;  5IO0 A;  1SL1 B;  4JRR A;  3HDC A;  4GSS A;  5FWG A;  4GQC A;  4MH2 A;  1TP9 A;  2H6Y A;  2OKA A;  1XVQ A;  1ON4 A;  4GRF A;  2OE3 A;  1KNG A;  3ZYW A;  3IBH A;  2CX3 A;  4WBJ A; 
#chains in the Genus database with same CATH topology
 2M80 A;  2QSI A;  4AJ6 A;  5KN3 A;  1O85 A;  3IR4 A;  3A5I A;  5E4W A;  1XWB A;  4EIQ A;  3CSJ A;  22GS A;  5F07 A;  4MAB A;  4DSQ A;  1OVN A;  2X49 A;  2H73 A;  4BL7 B;  2K9F A;  5JWR B;  2C3N A;  2PMT A;  1K0B A;  5CRG A;  4GLT A;  5DJM A;  3G7J A;  4YQV A;  19GS A;  3TRX A;  3MNG A;  3GKM A;  1GSY A;  1VF1 A;  1MD4 A;  2K6V A;  3Q19 A;  4O5R A;  3F3Q A;  4IJ3 A;  4J57 E;  2V6O A;  1FB0 A;  3GTU B;  1JZR A;  1GLQ A;  2YNX A;  2OAC A;  2GQK A;  2YWM A;  2O8V B;  5ELA A;  3I69 A;  4GXZ A;  3W6G A;  4I97 A;  2K8S A;  1QGV A;  1THO A;  3F3R A;  1IYI A;  1FW1 A;  1PN0 A;  3MYD A;  1PX6 A;  1FB6 A;  1I5G A;  1M3J A;  2WJU A;  2VOC A;  3FR3 A;  2KP2 A;  2NTO A;  5IO2 A;  4QQ7 A;  1EV4 A;  3CRT A;  2XPE A;  2JAD A;  4PUA A;  3LQ7 A;  1Z3E A;  5DCH A;  3LYP A;  3IK9 A;  1FHE A;  1BG5 A;  2FA8 A;  3LXT A;  5ECL B;  2J23 A;  1GTI A;  2HSH A;  5ENU A;  2X64 A;  2IIY A;  3IHQ A;  1E6B A;  2C80 A;  4YQU A;  5ECN B;  1A23 A;  4TW5 A;  17GS A;  1NM3 A;  5IMF A;  5CRE A;  2PU9 C;  3RBT A;  3CRU A;  3IDV A;  1SL0 B;  3D5J A;  1R4W A;  2YN1 A;  4NHZ A;  1HD2 A;  4HDE A;  2FWF A;  7GSS A;  2YCD A;  3HD5 A;  2HZE A;  1ERT A;  3MWH A;  6GSY A;  2FCH A;  4PTS A;  2ZCT A;  1ST9 A;  3M0F A;  2VL3 A;  2GGT A;  4L0U A;  4G9H A;  2L5L A;  2YWI A;  4NWY A;  4Z7X A;  4KSO A;  4I8B A;  4ZB8 A;  1GH2 A;  3GSS A;  3H4K A;  12GS A;  5HQP A;  5C04 A;  20GS A;  3WGE A;  2WS2 A;  2C1Y A;  4EDY A;  3I9V 2;  3M9K A;  3PIN A;  2DJ2 A;  1AAZ A;  1LBK A;  1XW5 A;  3DEX A;  3CXG A;  2AAW A;  4TKY A;  2IMF A;  2XC2 A;  4N11 A;  2IMK A;  3TOT A;  3QMX A;  1R5A A;  3US3 A;  1M9A A;  5GAP D;  3J7Y b;  2C0E A;  3F4T A;  2IFQ A;  3L4N A;  1W4V A;  1R26 A;  2D2Z A;  4E8E A;  2E2G A;  4X1U A;  4EE0 A;  1AQW A;  4NPB A;  3GX0 A;  1H75 A;  1NHO A;  4F03 A;  2PUK C;  2C3T A;  3TJF A;  3C7M A;  2XHF A;  3ZML A;  3DIE A;  1PX7 A;  3O6T A;  5DVB A;  2XPD A;  2OE1 A;  3M8N A;  1YDK A;  4MF7 A;  2HNL A;  4KB3 A;  3DD3 A;  2VL2 A;  4IQ1 A;  4ACS A;  5J41 A;  1ZYE A;  3FKF A;  2BMX A;  3C1S A;  3HXS A;  18GS A;  1THX A;  4HOJ A;  3RHB A;  3DGQ A;  2DJ3 A;  3DML A;  4OO5 A;  1V98 A;  3IA1 A;  1YJ6 A;  1KBN A;  4BVX B;  5IMA A;  3VWV A;  4ZXG A;  4EVM A;  4DVC A;  4MA9 A;  3VWX A;  1VF2 A;  1GSE A;  5D9T A;  2JAC A;  4POL A;  4HI7 A;  4WBR D;  2ZUP A;  2AUV A;  3TKS A;  2FHE A;  5AN1 A;  2REM A;  3A2V A;  1K0A A;  2PWJ A;  3LSZ A;  2WGR A;  4HQS A;  4N0Z A;  1V9W A;  3VPT A;  2VUP A;  5DAK B;  3HZ4 A;  4AJ8 A;  2C0D A;  4F82 A;  4Z2R A;  4YH2 A;  5J3R A;  2KLX A;  2YWN A;  1MTC A;  2JU5 A;  5B8A A;  3GL3 A;  4G2E A;  3W8J A;  3P7X A;  4KCA A;  4KH7 A;  3L9S A;  2JZR A;  5DJL A;  4IEL A;  5E59 A;  2GZZ A;  6GSV A;  3PH9 A;  2JL4 A;  2CV4 A;  3U6V A;  4QL7 A;  5KN1 A;  1GSQ A;  2VCX A;  2DJJ A;  4FO5 A;  2X8H A;  4LL1 B;  2LJR A;  2H1D A;  4BVY A;  1J0F A;  3VUR A;  2VCV A;  4ML6 A;  4NAX A;  2GLR A;  3DKS A;  4PQH A;  4WXT A;  3KD0 A;  3E0U A;  3HCZ A;  1A0F A;  1USB A;  1X5C A;  2P5R A;  1IYH A;  2EIO A;  3LOR A;  4DEJ A;  3TJK A;  1B8X A;  3ERG A;  1ZL9 A;  1PSQ A;  2F9S A;  4K2D A;  2B5Y A;  1WMJ A;  1XWK A;  3LEF A;  3VWU A;  2CZ3 A;  3D21 A;  3ZFB A;  2QA1 A;  3KH9 A;  4KE3 A;  3TB2 A;  2CAI A;  3GRX A;  3UBL A;  4OO4 A;  1K3O A;  5IM9 A;  3HY2 A;  4K6X A;  2PVQ A;  1EP8 A;  4JZQ A;  5KOX A;  2CAQ A;  3ME7 A;  3WGX A;  5D9V A;  1PL1 A;  2V2G A;  4BWS A;  2UZ8 A;  1AQV A;  1EOH A;  5G1L A;  1AXD A;  1DSB A;  2YZH A;  1QUW A;  5ECO B;  3WT1 A;  3GN3 A;  4OWY A;  1HNA A;  2YPM A;  5J9B A;  2LTK A;  3R3E A;  1PMT A;  1T3B A;  3UOM A;  2PN8 A;  3A2X A;  2V6K A;  1PFO A;  5IOX A;  3UVT A;  4L8E A;  3I43 A;  3DVW A;  1F2E A;  3F63 A;  3KCM A;  1ERW A;  3KZQ A;  2VCT A;  1O81 A;  2VD0 A;  3BOA A;  2C0G A;  2M72 A;  4KUN A;  1JZD A;  4K7O A;  1TKD B;  4NXI A;  4QL9 A;  4IS0 A;  1ZCP A;  2MMA A;  5CRD A;  3ED3 A;  1M2B A;  5D96 A;  2FWG A;  3ERW A;  6GST A;  5FHI A;  4KW6 A;  1EWX A;  2LQO A;  4X43 A;  5D93 A;  4KCE A;  2CX4 A;  4FYU A;  4DSS A;  2DIY A;  3G7I A;  1NW2 A;  2GQM A;  1F9M A;  2AJQ B;  3P90 A;  1SKS B;  6GSU A;  4NV5 A;  1XOA A;  3KP8 A;  2CT6 A;  3IK7 A;  3KJY A;  5A4U A;  2FNO A;  4IQA A;  1YEX A;  3Q74 A;  3FW2 A;  1K0N A;  2F8A A;  2GQL A;  1OC9 A;  2J9H A;  3TJJ A;  1ZYN A;  5HR1 A;  4BPY A;  1R7H A;  5AIV A;  4TRX A;  4O7H A;  1RK4 A;  3G7Y A;  4MJA A;  2B7J A;  5AGY A;  2KP1 A;  3RAZ A;  1X9W B;  1U88 A;  5JCU A;  5ECM B;  2O85 A;  1UA5 A;  5F0G A;  1XW6 A;  1EGR A;  4O92 A;  3HZ8 A;  2GSR A;  2RM6 A;  1GUK A;  5J4U A;  2WDU A;  5ECQ B;  3ZIJ A;  2H0H A;  2LJA A;  3EU4 A;  3QFB C;  5J5N A;  1A8Y A;  2H70 A;  3FZA A;  1TRU A;  1ZYQ B;  1O8X A;  3P8W A;  3G9B A;  5IOW A;  3HJO A;  1Z7R A;  5A4V A;  3IRA A;  3LWA A;  4ICY A;  4EKZ A;  2DLX A;  4POK A;  1OE7 A;  3IC8 A;  2L4Q A;  2RM5 A;  2F8F A;  5D9X A;  4LL4 B;  2B3S A;  5IPH A;  2QGV A;  1SJI A;  1SJZ A;  1MDJ A;  1BED A;  4TR0 A;  5AIS A;  4D73 A;  4MNN A;  3QPM A;  4CY8 A;  3GFK A;  3ZRE A;  2VCZ A;  2TRC P;  5DDL A;  1SD9 A;  1BYE A;  4OCF A;  1M3I A;  2WCI A;  4JBB A;  1QMV A;  1XOB A;  4HJ2 A;  5ID2 A;  4MPG A;  4ZL8 A;  4BIK A;  2WB9 A;  4ZB6 A;  2DC5 A;  2DJ0 A;  1WPI A;  2LQQ A;  2H1G A;  4OFN A;  2HZE B;  2LRC A;  4MH3 A;  3GHA A;  4AJ7 A;  1Y6E A;  5DCG A;  1PD2 1;  4KX4 A;  2DMM A;  3OR5 A;  2K8V A;  2DJK A;  2A4V A;  2B6M A;  2L4C A;  1G0T A;  4V2L A;  5L71 A;  2PVO C;  1NHY A;  1FVK A;  2LJK A;  2R2J A;  2IL3 A;  5JCG A;  5D9W A;  4F0B A;  3VI7 A;  3WGD A;  1YQ1 A;  4J56 E;  3DYR A;  4HEA 2;  3KTB A;  1ML6 A;  2WZ9 A;  4K2X A;  3O3T A;  1LJR A;  3CMI A;  3CTF A;  1X5E A;  2EIR A;  1TI3 A;  1SKR B;  5ECH B;  2H66 A;  5ECK B;  1EGO A;  3F0I A;  1ERU A;  4F2I A;  2GT5 A;  3L9U A;  3LGC A;  2VLU A;  2FD3 A;  2LS5 A;  5G1K A;  2JZS A;  3UVH A;  1O6J A;  4I2U A;  1QXH A;  1WRY A;  6GSX A;  4JED A;  2JSZ A;  5BMU A;  2IFQ B;  4ECB A;  2V1M A;  5F05 A;  5IIZ A;  4A5P A;  5COH A;  5G2Z A;  3EYT A;  3TOU A;  2O7K A;  4TR1 A;  4Z2U A;  2HRA A;  2G0F A;  3MIX A;  3N5O A;  1TU7 A;  3ISO A;  5ECS A;  2H72 A;  2H6Z A;  5CAX A;  1I9D A;  2FGX A;  1JFU A;  1R5P A;  1AUC A;  2LRT A;  5IMD A;  3TKS E;  3GIX A;  3U5R E;  5CO3 A;  2ON5 A;  3FYG A;  5G5F A;  4OFM A;  3EE2 A;  4GSN A;  5B8B A;  3EMP A;  5ECP B;  4ZL9 A;  1M99 A;  5EL8 A;  2HRF A;  1WJK A;  1VF3 A;  5JWQ B;  3EPT A;  2KUC A;  1XWC A;  1XPV A;  3BCI A;  3J7Y k;  1Z6M A;  4PUR A;  2DML A;  2FA4 A;  1TDI A;  4IP1 A;  3UBK A;  1ZZY A;  2VLV A;  1JZO A;  1Q4J A;  4G0I A;  1GUL A;  1FOH A;  3KH7 A;  2B5X A;  3VLN A;  4RUV A;  1GP1 A;  3APS A;  4Z2T A;  4G19 A;  1PQN A;  2PBJ A;  1EP7 A;  1S3D A;  4K5R A;  2DKH A;  1K0C A;  1Y25 A;  3TJB A;  4TR3 A;  1SK1 A;  4BA7 A;  2QKE A;  2P0G A;  3IPZ A;  3H8Q A;  3D4M A;  4KDU A;  2VL9 A;  2OBK A;  3ZL5 A;  1M0U A;  1B48 A;  2VCQ A;  1BX9 A;  2GTU A;  3DVX A;  2XBQ A;  1QFN A;  3M3M A;  4K0G A;  4BVY B;  1VRS D;  3GUS A;  4ISD A;  1TOF A;  4K8M A;  5HR0 A;  2LRN A;  1K3Y A;  4ECC A;  1K0M A;  2ON7 A;  2YWO A;  1EEJ A;  1O8W A;  3GV1 A;  5IMZ A;  3ME8 A;  3IAM 2;  1YKA A;  4K7N A;  2MBS A;  1UVZ A;  4MZB A;  4FIW A;  4GTU A;  5G5E A;  3E3E A;  1B9X C;  2HRK A;  4HU7 A;  4TR4 A;  4K5S A;  5B6M A;  1J08 A;  1JHB A;  2EC4 A;  1TK0 B;  3IV4 A;  4TVE A;  4PNG A;  4JR6 A;  5LNK e;  2DIZ A;  4J2F A;  1A0R P;  4K0N A;  3FK8 A;  3FMW A;  5G31 A;  5BRT A;  4ULX A;  4EC0 A;  2I3Y A;  2TIR A;  5D8I A;  3C8E A;  5JCW A;  4WR5 A;  4KND A;  4ZL7 A;  3L78 A;  4ZBA A;  5H5R A;  4X4J A;  3VI5 A;  2FWH A;  3UAR A;  2DSA A;  4I2T A;  3QR6 A;  4RI6 A;  3IC4 A;  1Z9H A;  2VD1 A;  2YV9 A;  8GSS A;  4AGS A;  2H0I A;  16GS A;  3LJR A;  3AY8 A;  4O5Q A;  2AB6 A;  5DAL B;  3PPU A;  3EIN A;  4CY6 A;  2MBT A;  4PUF C;  2N5B A;  1T8E B;  1PN9 A;  3GYK A;  1K3L A;  2H76 A;  4DSR A;  1B9Y C;  2LV3 A;  3PR8 A;  1V57 A;  1KTE A;  3FZ9 A;  1GL8 A;  1ILO A;  4IVF A;  4K9Z A;  3F4R A;  4EUY A;  3GNJ A;  1ERV A;  1AW9 A;  2YOI A;  1ZOF A;  4O32 A;  1EEM A;  3E9J B;  3HVS A;  5KN0 A;  2MYG A;  1GLP A;  2OAD A;  4MF6 A;  4EIP A;  2KOK A;  1UC7 A;  3QAG A;  2MMN A;  4MF5 A;  2E2M A;  4IKH A;  3IOS A;  4RQR A;  5HFG A;  4DSS B;  14GS A;  2FY6 A;  4K7I A;  2HLS A;  2NDO A;  5DAL A;  2H01 A;  2O89 A;  4Q5Q A;  4FQU A;  4G0L A;  4EF0 A;  3QAV A;  4YKG A;  2VAF A;  1MDI A;  1GSD A;  1JZW A;  3GMF A;  3IHG A;  4IGJ A;  3ERF A;  1AIU A;  3DWV A;  3HVX A;  2GZY A;  4I5Q A;  3LYK A;  1OC9 B;  4XS6 A;  1QK8 A;  2L6D A;  4YKF A;  4F0C A;  4Q5R A;  1GWC A;  3S9F A;  2YZU A;  4P3Y B;  1H4O A;  3GST A;  4WR4 A;  4ECI A;  1OC8 A;  3VK9 A;  1XWG A;  1VF4 A;  3MDK A;  1X5D A;  1BAY A;  1M9B A;  1SK0 A;  1XXU A;  2R0P A;  3CTG A;  1XZO A;  2X99 A;  1BJX A;  4OCE A;  1ZGN A;  2GS3 A;  3KMO A;  2DBC A;  1WOU A;  3RDW A;  4V2M A;  13GS A;  3KIJ A;  3TDG A;  4ZB9 A;  2IPA A;  1SYX A;  4EO3 A;  1YEP A;  1ACV A;  2FWE A;  1SJ6 A;  2YAN A;  3NZN A;  2OJL A;  5CRW A;  3QCP A;  3F8U A;  3QOU A;  1M2D A;  2DJ1 A;  2VIM A;  2HFD A;  2AYT A;  5HFI A;  1O73 A;  1F3A A;  4GWR A;  2X4A A;  3LFL A;  4HU9 A;  2CQ9 A;  4XS1 A;  3SWL A;  2H6X A;  4IHU A;  2HYX A;  2HT9 A;  3RPN A;  4I6X A;  4EXJ A;  1YF0 A;  2H71 A;  3EC3 A;  4D73 B;  4XTS A;  4BWQ A;  4N30 A;  2IN3 A;  2NPB A;  4JR4 A;  2MMO A;  1T1V A;  2ALB A;  2LEG A;  2HE3 A;  3KP9 A;  4IP6 A;  3UEM A;  3K8N A;  1EZK A;  1GUM A;  1Z6N A;  1DE2 A;  2FLS A;  5ID2 B;  3QAW A;  4WKW A;  1TXX A;  1A8L A;  3BD2 A;  1V2A A;  1T4Y A;  3GKN A;  1MEK A;  1PRX A;  3TCO A;  5ABR A;  1OAZ A;  1OKD A;  1FVJ A;  5H5S A;  2V41 A;  4HJM A;  1Q98 A;  3DRN A;  2IMI A;  2X8G A;  4LLR A;  1B4Q A;  4HSC X;  5EY6 A;  2AHE A;  1PL2 A;  1SD8 A;  1XWA A;  5J9C A;  1T7P B;  4KA0 A;  3TKQ A;  1X9M B;  2GSS A;  3IE3 A;  6GSW A;  1MD3 A;  2GDR A;  4CW9 A;  4MPF A;  1HNB A;  3FZ5 A;  1XW9 A;  4ID0 A;  4XS4 A;  3O76 A;  3RPP A;  3FR6 A;  4TXO A;  1WE0 A;  1F6M C;  5A4W A;  1HNC A;  2P5Q A;  1EV9 A;  1T00 A;  1FO5 A;  3L0H A;  6GSS A;  1AC1 A;  1ZMA A;  3FHK A;  1N8J A;  3TUE A;  4ZBB A;  1XG8 A;  3GH9 A;  4YAP A;  3NIV A;  3Q6O A;  5AIX A;  4JU5 A;  4HUA A;  4NMU A;  1K0D A;  2HI7 A;  2LST A;  4XCS A;  5HFK A;  4POB A;  1OKT A;  1FOV A;  4BL7 A;  1TK8 B;  2RUF A;  4V2N A;  1N2A A;  4O5U A;  3HVN A;  4HZ4 A;  5CNW A;  4TR1 B;  2GSQ A;  3HHV A;  4TN8 A;  3HA9 A;  2CVK A;  5ELG A;  1EOG A;  3KTL A;  4XIH A;  2OE0 A;  3EU3 A;  3A3T A;  3JCM L;  2LKU A;  1G7O A;  4PNF A;  2L57 A;  5C00 A;  2IMD A;  3GTU A;  2H74 A;  2R37 A;  4XRD A;  2IME A;  1Z5Y E;  3HVV A;  2HSM A;  5INY A;  4EL1 A;  4ILF A;  1G6Y A;  1U87 A;  2ES7 A;  3EWL A;  5G30 A;  4XHM A;  2L5O A;  1B4P A;  4TOP A;  1A2M A;  1XCC A;  3KGK A;  1YKC A;  3QFA C;  2IJY A;  3CBU A;  4NV2 A;  4PQI A;  3RHC A;  3FEU A;  2VLT A;  3EUR A;  1PKW A;  5DQY A;  1J9B A;  2WFC A;  3A5W A;  4F9Z A;  4PXO A;  4WF5 A;  1JLW A;  1TU8 A;  3GKK A;  4X0X A;  3TRP A;  2VCW A;  4ZBD A;  1O7U A;  2H1A A;  1GUH A;  4MP4 A;  3UIW A;  4PX1 A;  4PGT A;  3VWW A;  3A2W A;  3WYW A;  4IN0 A;  3CSI A;  4FH8 A;  1TJD A;  3TJG A;  1CQH A;  3H93 A;  1GNE A;  4L5O A;  1W89 A;  4XRA A;  1VGL A;  4LA1 A;  3F4S A;  1S3A A;  1U3A A;  2E7P A;  1A2L A;  3F9U A;  2C0F A;  2LUS A;  1SK2 A;  3MAK A;  2C8U A;  4MK3 A;  3FZ4 A;  1GSS A;  4HS1 A;  2I9H A;  1G6W A;  2KHP A;  1PA3 A;  2R0G A;  3ZMK A;  1A2J A;  2MZC A;  3ZIV A;  1X9S B;  3APQ A;  4Q5F A;  1S3R A;  4V1A p;  5DBQ A;  4WET A;  2HSY A;  2Z9S A;  3UAP A;  1V58 A;  5GSS A;  2N5A A;  2CVB A;  3GH6 A;  2GT6 A;  2JSY A;  4ML1 A;  2H19 A;  2JZT A;  3N9J A;  2H8L A;  2N5F A;  4AF2 A;  1TTZ A;  1OYJ A;  2R5G A;  1G7E A;  3PGT A;  4LMV A;  1PGT A;  4PQ1 A;  1SU9 A;  2E0Q A;  1F3B A;  3LXZ A;  1GSF A;  2WRT A;  4V1A g;  3CYN A;  3D0Z A;  11GS A;  2R0C A;  1M7T A;  2PPT A;  4MJB A;  1JLV A;  4FYC A;  3V1W A;  3ZZX A;  4WEY A;  3ZFL A;  2B5E A;  2BJX A;  2L6C A;  5A5K A;  3W8S A;  1XVW A;  4YAV A;  4MLY A;  3KEB A;  2NVL A;  2PER A;  3BCK A;  1UN2 A;  2B7K A;  4RI7 A;  3TKR A;  1FG4 A;  3TKP A;  3H1N A;  1HQO A;  1F37 A;  4YQM A;  3D4T A;  10GS A;  4JE1 A;  3UMA A;  5ECR B;  1YY7 A;  2OA7 A;  2R4V A;  2O87 A;  1HYU A;  3P2A A;  5EPF A;  3H79 A;  2F51 A;  1GSU A;  3GKX A;  1Z7P A;  1GTB A;  4E8H A;  3L9V A;  3C1R A;  3C73 A;  3GUR A;  4BVX A;  1XIY A;  4MMM A;  2MMZ A;  1OE8 A;  2VO4 A;  5EVO A;  2HXK A;  2VM2 A;  4ZIL A;  1GTU A;  5IMC A;  4ZIJ A;  3ZLP A;  5KN2 A;  1U3I A;  2F3M A;  1V40 A;  3EMX A;  2G2Q A;  2QC7 A;  5GST A;  2B1L A;  4HZ2 A;  2GST A;  4KDY A;  3R2Q A;  5H5Q A;  2C3Q A;  2NBS A;  3ZVJ A;  4N10 A;  3ZRD A;  2RLI A;  5CRH A;  1BQ7 A;  3MSZ A;  5DAK A;  2C4J A;  3BBY A;  2I81 A;  4H86 A;  4MCU A;  1OC3 A;  2QA2 A;  1GNW A;  1TI1 A;  2HRN A;  3WD6 A;  2EIQ A;  2OBI A;  2K18 A;  2AV4 A;  1LU4 A;  3GX8 A;  5KEJ A;  3KXO A;  3F6D A;  3FY7 A;  2TRX A;  3QD9 A;  3IAS 2;  1YF1 A;  2GZP A;  2RUE A;  4L5L A;  2WUL A;  4GCI A;  2M46 A;  1SYR A;  1T4Z A;  2A2S A;  5F8B A;  1TK5 B;  1WIK A;  1DE1 A;  3FRC A;  1PKZ A;  3SBC A;  1ABA A;  4KSM A;  2BTO T;  2CVD A;  4IJI A;  1URM A;  4IBP A;  5IQY A;  2VL2 C;  1XFL A;  3UJ1 A;  3D22 A;  1S3C A;  1GRX A;  1SL2 B;  2VM1 A;  1TW9 A;  1NSW A;  2H0G A;  4MZW A;  2P31 A;  4GQF A;  3VPQ A;  2HZF A;  5D73 A;  5DQS A;  2CA8 A;  4KDX A;  3EVI A;  1E2Y A;  1YZX A;  5F06 A;  5LCZ A;  2X8C A;  4Q5N A;  4MZC A;  3LW9 A;  2YJH A;  1ZYP A;  2V32 A;  5HR2 A;  4MDC A;  3QDN A;  1TRW A;  2XBI A;  3ZIT A;  3IXR A;  3D6I A;  4GF0 A;  1WP0 A;  4OD7 A;  5JWO B;  3GA4 A;  2H75 A;  4OMV A;  3ZTL A;  2YJ7 A;  1U6T A;  2YP6 A;  4NHW A;  5B6N A;  1K0O A;  1AQX A;  2IWT A;  3DXB A;  5IPG A;  1DUG A;  3LG6 A;  3TKS C;  5GZZ B;  1MDK A;  3UL3 A;  5ECI B;  3CQF A;  5B7C A;  9GSS A;  4GST A;  4CHS A;  3APO A;  4KAE A;  1C72 A;  1QQ2 A;  1KEB A;  1TRS A;  1FAA A;  3WT2 A;  4MJE A;  4N0V A;  4FYB A;  2H1B A;  4TXV A;  3M1G A;  3HYP A;  2CZ2 A;  2PGT A;  3TGZ A;  2R6K A;  3F6F A;  1TRV A;  5FT3 A;  3C71 A;  4OFT A;  2L59 A;  4WF4 A;  3KMN A;  1WWJ A;  4G10 A;  4POM A;  1XBS A;  3TRQ A;  5HR3 A;  3FR9 A;  3M9J A;  3HJM A;  4EDZ A;  2DKI A;  2B1K A;  2A2P A;  3VFI A;  2LNS A;  2GVP A;  1RW1 A;  2FUG 2;  2RII A;  3HJP A;  1M2A A;  1A24 A;  1X0R A;  3I6A A;  3Q18 A;  3CSH A;  4ECJ A;  4KF9 A;  5LD0 A;  1CQG A;  4CDO A;  5KOW A;  2I1U A;  2A4H A;  3KM6 A;  2I4A A;  4K1F A;  3HKR A;  1RQM A;  2R3X A;  5CYY A;  3BJ5 A;  1GTA A;  5CP1 A;  4LMW A;  2A2R A;  4RQX A;  1SKW B;  5GAN D;  2H30 A;  2LNT A;  4USS A;  4G0K A;  3ZVJ D;  2YV7 A;  4XS4 B;  4MJC A;  4KGI A;  4TXO B;  4IW9 A;  4HQZ A;  5IMV A;  2ZNM A;  1SEN A;  3GL5 A;  4L0W A;  1DBY A;  3NOF A;  5IO0 A;  1SL1 B;  4JRR A;  3HDC A;  4GSS A;  5FWG A;  4GQC A;  4MH2 A;  1TP9 A;  2H6Y A;  2OKA A;  1XVQ A;  1ON4 A;  4GRF A;  2OE3 A;  1KNG A;  3ZYW A;  3IBH A;  2CX3 A;  4WBJ A; 
#chains in the Genus database with same CATH homology
 2M80 A;  2QSI A;  4AJ6 A;  5KN3 A;  1O85 A;  3IR4 A;  3A5I A;  5E4W A;  1XWB A;  4EIQ A;  3CSJ A;  22GS A;  5F07 A;  4MAB A;  4DSQ A;  1OVN A;  2X49 A;  2H73 A;  4BL7 B;  2K9F A;  5JWR B;  2C3N A;  2PMT A;  1K0B A;  5CRG A;  4GLT A;  5DJM A;  3G7J A;  4YQV A;  19GS A;  3TRX A;  3MNG A;  3GKM A;  1GSY A;  1VF1 A;  1MD4 A;  2K6V A;  3Q19 A;  4O5R A;  3F3Q A;  4IJ3 A;  4J57 E;  2V6O A;  1FB0 A;  3GTU B;  1JZR A;  1GLQ A;  2YNX A;  2OAC A;  2GQK A;  2YWM A;  2O8V B;  5ELA A;  3I69 A;  4GXZ A;  3W6G A;  4I97 A;  2K8S A;  1QGV A;  1THO A;  3F3R A;  1IYI A;  1FW1 A;  1PN0 A;  3MYD A;  1PX6 A;  1FB6 A;  1I5G A;  2WJU A;  2VOC A;  3FR3 A;  2KP2 A;  2NTO A;  5IO2 A;  4QQ7 A;  1EV4 A;  3CRT A;  2XPE A;  2JAD A;  4PUA A;  3LQ7 A;  1Z3E A;  5DCH A;  3LYP A;  3IK9 A;  1FHE A;  1BG5 A;  2FA8 A;  3LXT A;  5ECL B;  2J23 A;  1GTI A;  2HSH A;  5ENU A;  2X64 A;  2IIY A;  3IHQ A;  1E6B A;  2C80 A;  4YQU A;  5ECN B;  1A23 A;  4TW5 A;  17GS A;  1NM3 A;  5IMF A;  5CRE A;  2PU9 C;  3RBT A;  3CRU A;  3IDV A;  1SL0 B;  3D5J A;  1R4W A;  2YN1 A;  4NHZ A;  1HD2 A;  4HDE A;  2FWF A;  7GSS A;  2YCD A;  3HD5 A;  2HZE A;  1ERT A;  3MWH A;  6GSY A;  2FCH A;  4PTS A;  2ZCT A;  1ST9 A;  3M0F A;  2VL3 A;  2GGT A;  4L0U A;  4G9H A;  2L5L A;  2YWI A;  4NWY A;  4Z7X A;  4KSO A;  4I8B A;  4ZB8 A;  1GH2 A;  3GSS A;  3H4K A;  12GS A;  5HQP A;  5C04 A;  20GS A;  3WGE A;  2WS2 A;  2C1Y A;  4EDY A;  3I9V 2;  3M9K A;  3PIN A;  2DJ2 A;  1AAZ A;  1LBK A;  1XW5 A;  3DEX A;  3CXG A;  2AAW A;  4TKY A;  2IMF A;  2XC2 A;  4N11 A;  2IMK A;  3TOT A;  3QMX A;  1R5A A;  3US3 A;  1M9A A;  5GAP D;  3J7Y b;  2C0E A;  3F4T A;  2IFQ A;  3L4N A;  1W4V A;  1R26 A;  2D2Z A;  4E8E A;  2E2G A;  4X1U A;  4EE0 A;  1AQW A;  4NPB A;  3GX0 A;  1H75 A;  1NHO A;  4F03 A;  2PUK C;  2C3T A;  3TJF A;  3C7M A;  2XHF A;  3ZML A;  3DIE A;  1PX7 A;  3O6T A;  5DVB A;  2XPD A;  2OE1 A;  3M8N A;  1YDK A;  4MF7 A;  2HNL A;  4KB3 A;  3DD3 A;  2VL2 A;  4IQ1 A;  4ACS A;  5J41 A;  1ZYE A;  3FKF A;  2BMX A;  3C1S A;  3HXS A;  18GS A;  1THX A;  4HOJ A;  3RHB A;  3DGQ A;  2DJ3 A;  3DML A;  4OO5 A;  1V98 A;  3IA1 A;  1YJ6 A;  1KBN A;  4BVX B;  5IMA A;  3VWV A;  4ZXG A;  4EVM A;  4DVC A;  4MA9 A;  3VWX A;  1VF2 A;  1GSE A;  5D9T A;  2JAC A;  4POL A;  4HI7 A;  4WBR D;  2ZUP A;  2AUV A;  3TKS A;  2FHE A;  5AN1 A;  2REM A;  3A2V A;  1K0A A;  2PWJ A;  3LSZ A;  2WGR A;  4HQS A;  4N0Z A;  1V9W A;  3VPT A;  2VUP A;  5DAK B;  3HZ4 A;  4AJ8 A;  2C0D A;  4F82 A;  4Z2R A;  4YH2 A;  5J3R A;  2KLX A;  2YWN A;  1MTC A;  2JU5 A;  5B8A A;  3GL3 A;  4G2E A;  3W8J A;  3P7X A;  4KCA A;  4KH7 A;  3L9S A;  2JZR A;  5DJL A;  4IEL A;  5E59 A;  2GZZ A;  6GSV A;  3PH9 A;  2JL4 A;  2CV4 A;  3U6V A;  4QL7 A;  5KN1 A;  1GSQ A;  2VCX A;  2DJJ A;  4FO5 A;  2X8H A;  4LL1 B;  2LJR A;  2H1D A;  4BVY A;  1J0F A;  3VUR A;  2VCV A;  4ML6 A;  4NAX A;  2GLR A;  3DKS A;  4PQH A;  4WXT A;  3KD0 A;  3E0U A;  3HCZ A;  1A0F A;  1USB A;  1X5C A;  2P5R A;  1IYH A;  2EIO A;  3LOR A;  4DEJ A;  3TJK A;  1B8X A;  3ERG A;  1ZL9 A;  1PSQ A;  2F9S A;  4K2D A;  2B5Y A;  1WMJ A;  1XWK A;  3LEF A;  3VWU A;  2CZ3 A;  3D21 A;  3ZFB A;  2QA1 A;  3KH9 A;  4KE3 A;  3TB2 A;  2CAI A;  3GRX A;  3UBL A;  4OO4 A;  1K3O A;  5IM9 A;  3HY2 A;  4K6X A;  2PVQ A;  1EP8 A;  4JZQ A;  5KOX A;  2CAQ A;  3ME7 A;  3WGX A;  5D9V A;  1PL1 A;  2V2G A;  4BWS A;  2UZ8 A;  1AQV A;  1EOH A;  5G1L A;  1AXD A;  1DSB A;  2YZH A;  1QUW A;  5ECO B;  3WT1 A;  3GN3 A;  4OWY A;  1HNA A;  2YPM A;  5J9B A;  2LTK A;  3R3E A;  1PMT A;  1T3B A;  3UOM A;  2PN8 A;  3A2X A;  2V6K A;  5IOX A;  3UVT A;  4L8E A;  3I43 A;  3DVW A;  1F2E A;  3F63 A;  3KCM A;  1ERW A;  3KZQ A;  2VCT A;  1O81 A;  2VD0 A;  3BOA A;  2C0G A;  2M72 A;  4KUN A;  1JZD A;  4K7O A;  1TKD B;  4NXI A;  4QL9 A;  4IS0 A;  1ZCP A;  2MMA A;  5CRD A;  3ED3 A;  1M2B A;  5D96 A;  2FWG A;  3ERW A;  6GST A;  5FHI A;  4KW6 A;  1EWX A;  2LQO A;  4X43 A;  5D93 A;  4KCE A;  2CX4 A;  4FYU A;  4DSS A;  2DIY A;  3G7I A;  1NW2 A;  2GQM A;  1F9M A;  2AJQ B;  3P90 A;  1SKS B;  6GSU A;  4NV5 A;  1XOA A;  3KP8 A;  2CT6 A;  3IK7 A;  3KJY A;  5A4U A;  2FNO A;  4IQA A;  1YEX A;  3Q74 A;  3FW2 A;  1K0N A;  2F8A A;  2GQL A;  1OC9 A;  2J9H A;  3TJJ A;  1ZYN A;  5HR1 A;  4BPY A;  1R7H A;  5AIV A;  4TRX A;  4O7H A;  1RK4 A;  3G7Y A;  4MJA A;  2B7J A;  5AGY A;  2KP1 A;  3RAZ A;  1X9W B;  1U88 A;  5JCU A;  5ECM B;  2O85 A;  1UA5 A;  5F0G A;  1XW6 A;  1EGR A;  4O92 A;  3HZ8 A;  2GSR A;  2RM6 A;  1GUK A;  5J4U A;  2WDU A;  5ECQ B;  3ZIJ A;  2H0H A;  2LJA A;  3EU4 A;  3QFB C;  5J5N A;  1A8Y A;  2H70 A;  3FZA A;  1TRU A;  1ZYQ B;  1O8X A;  3P8W A;  3G9B A;  5IOW A;  3HJO A;  1Z7R A;  5A4V A;  3IRA A;  3LWA A;  4ICY A;  4EKZ A;  2DLX A;  4POK A;  1OE7 A;  3IC8 A;  2L4Q A;  2RM5 A;  2F8F A;  5D9X A;  4LL4 B;  2B3S A;  5IPH A;  2QGV A;  1SJI A;  1SJZ A;  1MDJ A;  1BED A;  4TR0 A;  5AIS A;  4D73 A;  4MNN A;  3QPM A;  4CY8 A;  3GFK A;  3ZRE A;  2VCZ A;  2TRC P;  5DDL A;  1SD9 A;  1BYE A;  4OCF A;  2WCI A;  4JBB A;  1QMV A;  1XOB A;  4HJ2 A;  5ID2 A;  4MPG A;  4ZL8 A;  2WB9 A;  4ZB6 A;  2DC5 A;  2DJ0 A;  1WPI A;  2LQQ A;  2H1G A;  4OFN A;  2HZE B;  2LRC A;  4MH3 A;  3GHA A;  4AJ7 A;  1Y6E A;  5DCG A;  1PD2 1;  4KX4 A;  2DMM A;  3OR5 A;  2K8V A;  2DJK A;  2A4V A;  2B6M A;  2L4C A;  1G0T A;  4V2L A;  5L71 A;  2PVO C;  1NHY A;  1FVK A;  2LJK A;  2R2J A;  2IL3 A;  5JCG A;  5D9W A;  4F0B A;  3VI7 A;  3WGD A;  1YQ1 A;  4J56 E;  3DYR A;  4HEA 2;  3KTB A;  1ML6 A;  2WZ9 A;  4K2X A;  3O3T A;  1LJR A;  3CMI A;  3CTF A;  1X5E A;  2EIR A;  1TI3 A;  1SKR B;  5ECH B;  2H66 A;  5ECK B;  1EGO A;  3F0I A;  1ERU A;  4F2I A;  2GT5 A;  3L9U A;  3LGC A;  2VLU A;  2FD3 A;  2LS5 A;  5G1K A;  2JZS A;  3UVH A;  1O6J A;  4I2U A;  1QXH A;  1WRY A;  6GSX A;  4JED A;  2JSZ A;  5BMU A;  2IFQ B;  4ECB A;  2V1M A;  5F05 A;  5IIZ A;  4A5P A;  5COH A;  5G2Z A;  3EYT A;  3TOU A;  2O7K A;  4TR1 A;  4Z2U A;  2HRA A;  2G0F A;  3MIX A;  3N5O A;  1TU7 A;  3ISO A;  5ECS A;  2H72 A;  2H6Z A;  5CAX A;  1I9D A;  2FGX A;  1JFU A;  1R5P A;  1AUC A;  2LRT A;  5IMD A;  3TKS E;  3GIX A;  3U5R E;  5CO3 A;  2ON5 A;  3FYG A;  5G5F A;  4OFM A;  3EE2 A;  4GSN A;  5B8B A;  3EMP A;  5ECP B;  4ZL9 A;  1M99 A;  5EL8 A;  2HRF A;  1WJK A;  1VF3 A;  5JWQ B;  3EPT A;  2KUC A;  1XWC A;  1XPV A;  3BCI A;  3J7Y k;  1Z6M A;  4PUR A;  2DML A;  2FA4 A;  1TDI A;  4IP1 A;  3UBK A;  1ZZY A;  2VLV A;  1JZO A;  1Q4J A;  4G0I A;  1GUL A;  1FOH A;  3KH7 A;  2B5X A;  3VLN A;  4RUV A;  1GP1 A;  3APS A;  4Z2T A;  4G19 A;  1PQN A;  2PBJ A;  1EP7 A;  1S3D A;  4K5R A;  2DKH A;  1K0C A;  1Y25 A;  3TJB A;  4TR3 A;  1SK1 A;  4BA7 A;  2QKE A;  2P0G A;  3IPZ A;  3H8Q A;  3D4M A;  4KDU A;  2VL9 A;  2OBK A;  3ZL5 A;  1M0U A;  1B48 A;  2VCQ A;  1BX9 A;  2GTU A;  3DVX A;  2XBQ A;  1QFN A;  3M3M A;  4K0G A;  4BVY B;  1VRS D;  3GUS A;  4ISD A;  1TOF A;  4K8M A;  5HR0 A;  2LRN A;  1K3Y A;  4ECC A;  1K0M A;  2ON7 A;  2YWO A;  1EEJ A;  1O8W A;  3GV1 A;  5IMZ A;  3ME8 A;  3IAM 2;  1YKA A;  4K7N A;  2MBS A;  1UVZ A;  4MZB A;  4FIW A;  4GTU A;  5G5E A;  3E3E A;  1B9X C;  2HRK A;  4HU7 A;  4TR4 A;  4K5S A;  5B6M A;  1J08 A;  1JHB A;  2EC4 A;  1TK0 B;  3IV4 A;  4TVE A;  4PNG A;  4JR6 A;  5LNK e;  2DIZ A;  4J2F A;  1A0R P;  4K0N A;  3FK8 A;  3FMW A;  5G31 A;  5BRT A;  4ULX A;  4EC0 A;  2I3Y A;  2TIR A;  5D8I A;  3C8E A;  5JCW A;  4WR5 A;  4KND A;  4ZL7 A;  3L78 A;  4ZBA A;  5H5R A;  4X4J A;  3VI5 A;  2FWH A;  3UAR A;  2DSA A;  4I2T A;  3QR6 A;  4RI6 A;  3IC4 A;  1Z9H A;  2VD1 A;  2YV9 A;  8GSS A;  4AGS A;  2H0I A;  16GS A;  3LJR A;  3AY8 A;  4O5Q A;  2AB6 A;  5DAL B;  3PPU A;  3EIN A;  4CY6 A;  2MBT A;  4PUF C;  2N5B A;  1T8E B;  1PN9 A;  3GYK A;  1K3L A;  2H76 A;  4DSR A;  1B9Y C;  2LV3 A;  3PR8 A;  1V57 A;  1KTE A;  3FZ9 A;  1GL8 A;  1ILO A;  4IVF A;  4K9Z A;  3F4R A;  4EUY A;  3GNJ A;  1ERV A;  1AW9 A;  2YOI A;  1ZOF A;  4O32 A;  1EEM A;  3E9J B;  3HVS A;  5KN0 A;  2MYG A;  1GLP A;  2OAD A;  4MF6 A;  4EIP A;  2KOK A;  1UC7 A;  3QAG A;  2MMN A;  4MF5 A;  2E2M A;  4IKH A;  3IOS A;  4RQR A;  5HFG A;  4DSS B;  14GS A;  2FY6 A;  4K7I A;  2HLS A;  2NDO A;  5DAL A;  2H01 A;  2O89 A;  4Q5Q A;  4FQU A;  4G0L A;  4EF0 A;  3QAV A;  4YKG A;  2VAF A;  1MDI A;  1GSD A;  1JZW A;  3GMF A;  3IHG A;  4IGJ A;  3ERF A;  1AIU A;  3DWV A;  3HVX A;  2GZY A;  4I5Q A;  3LYK A;  1OC9 B;  4XS6 A;  1QK8 A;  2L6D A;  4YKF A;  4F0C A;  4Q5R A;  1GWC A;  3S9F A;  2YZU A;  4P3Y B;  1H4O A;  3GST A;  4WR4 A;  4ECI A;  1OC8 A;  3VK9 A;  1XWG A;  1VF4 A;  3MDK A;  1X5D A;  1BAY A;  1M9B A;  1SK0 A;  1XXU A;  2R0P A;  3CTG A;  1XZO A;  2X99 A;  1BJX A;  4OCE A;  1ZGN A;  2GS3 A;  3KMO A;  2DBC A;  1WOU A;  3RDW A;  4V2M A;  13GS A;  3KIJ A;  3TDG A;  4ZB9 A;  2IPA A;  1SYX A;  4EO3 A;  1YEP A;  1ACV A;  2FWE A;  1SJ6 A;  2YAN A;  3NZN A;  2OJL A;  5CRW A;  3QCP A;  3F8U A;  3QOU A;  1M2D A;  2DJ1 A;  2VIM A;  2HFD A;  2AYT A;  5HFI A;  1O73 A;  1F3A A;  4GWR A;  2X4A A;  3LFL A;  4HU9 A;  2CQ9 A;  4XS1 A;  3SWL A;  2H6X A;  4IHU A;  2HYX A;  2HT9 A;  3RPN A;  4I6X A;  4EXJ A;  1YF0 A;  2H71 A;  3EC3 A;  4D73 B;  4XTS A;  4BWQ A;  4N30 A;  2IN3 A;  2NPB A;  4JR4 A;  2MMO A;  1T1V A;  2ALB A;  2LEG A;  2HE3 A;  3KP9 A;  4IP6 A;  3UEM A;  3K8N A;  1EZK A;  1GUM A;  1Z6N A;  1DE2 A;  2FLS A;  5ID2 B;  3QAW A;  4WKW A;  1TXX A;  1A8L A;  3BD2 A;  1V2A A;  1T4Y A;  3GKN A;  1MEK A;  1PRX A;  3TCO A;  5ABR A;  1OAZ A;  1OKD A;  1FVJ A;  5H5S A;  2V41 A;  4HJM A;  1Q98 A;  3DRN A;  2IMI A;  2X8G A;  4LLR A;  1B4Q A;  5EY6 A;  2AHE A;  1PL2 A;  1SD8 A;  1XWA A;  5J9C A;  1T7P B;  4KA0 A;  3TKQ A;  1X9M B;  2GSS A;  3IE3 A;  6GSW A;  1MD3 A;  2GDR A;  4CW9 A;  4MPF A;  1HNB A;  3FZ5 A;  1XW9 A;  4ID0 A;  4XS4 A;  3O76 A;  3RPP A;  3FR6 A;  4TXO A;  1WE0 A;  1F6M C;  5A4W A;  1HNC A;  2P5Q A;  1EV9 A;  1T00 A;  1FO5 A;  3L0H A;  6GSS A;  1AC1 A;  1ZMA A;  3FHK A;  1N8J A;  3TUE A;  4ZBB A;  4YAP A;  3GH9 A;  3NIV A;  3Q6O A;  5AIX A;  4JU5 A;  4HUA A;  4NMU A;  1K0D A;  2HI7 A;  2LST A;  4XCS A;  5HFK A;  4POB A;  1OKT A;  1FOV A;  4BL7 A;  1TK8 B;  2RUF A;  4V2N A;  1N2A A;  4O5U A;  4HZ4 A;  5CNW A;  4TR1 B;  2GSQ A;  3HHV A;  4TN8 A;  3HA9 A;  2CVK A;  5ELG A;  1EOG A;  3KTL A;  4XIH A;  2OE0 A;  3EU3 A;  3A3T A;  3JCM L;  2LKU A;  1G7O A;  4PNF A;  2L57 A;  5C00 A;  2IMD A;  3GTU A;  2H74 A;  2R37 A;  4XRD A;  2IME A;  1Z5Y E;  3HVV A;  2HSM A;  5INY A;  4EL1 A;  4ILF A;  1G6Y A;  1U87 A;  2ES7 A;  3EWL A;  5G30 A;  4XHM A;  2L5O A;  1B4P A;  4TOP A;  1A2M A;  1XCC A;  3KGK A;  1YKC A;  3QFA C;  2IJY A;  3CBU A;  4NV2 A;  4PQI A;  3RHC A;  3FEU A;  2VLT A;  3EUR A;  1PKW A;  5DQY A;  1J9B A;  2WFC A;  3A5W A;  4F9Z A;  4PXO A;  4WF5 A;  1JLW A;  1TU8 A;  3GKK A;  4X0X A;  3TRP A;  2VCW A;  4ZBD A;  1O7U A;  2H1A A;  1GUH A;  4MP4 A;  3UIW A;  4PX1 A;  4PGT A;  3VWW A;  3A2W A;  3WYW A;  4IN0 A;  3CSI A;  4FH8 A;  1TJD A;  3TJG A;  1CQH A;  3H93 A;  1GNE A;  4L5O A;  1W89 A;  4XRA A;  1VGL A;  4LA1 A;  3F4S A;  1S3A A;  1U3A A;  2E7P A;  1A2L A;  3F9U A;  2C0F A;  2LUS A;  1SK2 A;  3MAK A;  2C8U A;  4MK3 A;  3FZ4 A;  1GSS A;  4HS1 A;  2I9H A;  1G6W A;  2KHP A;  1PA3 A;  2R0G A;  3ZMK A;  1A2J A;  2MZC A;  3ZIV A;  1X9S B;  3APQ A;  4Q5F A;  4V1A p;  5DBQ A;  4WET A;  2HSY A;  2Z9S A;  3UAP A;  1V58 A;  5GSS A;  2N5A A;  2CVB A;  3GH6 A;  2GT6 A;  2JSY A;  4ML1 A;  2H19 A;  2JZT A;  3N9J A;  2H8L A;  2N5F A;  4AF2 A;  1TTZ A;  1OYJ A;  2R5G A;  1G7E A;  3PGT A;  4LMV A;  1PGT A;  4PQ1 A;  1SU9 A;  2E0Q A;  1F3B A;  3LXZ A;  1GSF A;  2WRT A;  4V1A g;  3CYN A;  3D0Z A;  11GS A;  2R0C A;  1M7T A;  2PPT A;  4MJB A;  1JLV A;  4FYC A;  3V1W A;  3ZZX A;  4WEY A;  3ZFL A;  2B5E A;  2BJX A;  2L6C A;  5A5K A;  3W8S A;  1XVW A;  4YAV A;  4MLY A;  3KEB A;  2NVL A;  2PER A;  3BCK A;  1UN2 A;  2B7K A;  4RI7 A;  3TKR A;  1FG4 A;  3TKP A;  3H1N A;  1HQO A;  1F37 A;  4YQM A;  3D4T A;  10GS A;  4JE1 A;  3UMA A;  5ECR B;  1YY7 A;  2OA7 A;  2R4V A;  2O87 A;  1HYU A;  3P2A A;  5EPF A;  3H79 A;  2F51 A;  1GSU A;  3GKX A;  1Z7P A;  1GTB A;  4E8H A;  3L9V A;  3C1R A;  3C73 A;  3GUR A;  4BVX A;  1XIY A;  4MMM A;  2MMZ A;  1OE8 A;  2VO4 A;  5EVO A;  2HXK A;  2VM2 A;  4ZIL A;  1GTU A;  5IMC A;  4ZIJ A;  3ZLP A;  5KN2 A;  1U3I A;  2F3M A;  1V40 A;  3EMX A;  2G2Q A;  2QC7 A;  5GST A;  2B1L A;  4HZ2 A;  2GST A;  4KDY A;  3R2Q A;  5H5Q A;  2C3Q A;  2NBS A;  3ZVJ A;  4N10 A;  3ZRD A;  2RLI A;  5CRH A;  1BQ7 A;  3MSZ A;  5DAK A;  2C4J A;  3BBY A;  2I81 A;  4H86 A;  4MCU A;  1OC3 A;  2QA2 A;  1GNW A;  1TI1 A;  2HRN A;  3WD6 A;  2EIQ A;  2OBI A;  2K18 A;  2AV4 A;  1LU4 A;  3GX8 A;  5KEJ A;  3KXO A;  3F6D A;  3FY7 A;  2TRX A;  3QD9 A;  3IAS 2;  1YF1 A;  2GZP A;  2RUE A;  4L5L A;  2WUL A;  4GCI A;  2M46 A;  1SYR A;  1T4Z A;  2A2S A;  5F8B A;  1TK5 B;  1WIK A;  1DE1 A;  3FRC A;  1PKZ A;  3SBC A;  1ABA A;  4KSM A;  2BTO T;  2CVD A;  4IJI A;  1URM A;  4IBP A;  5IQY A;  2VL2 C;  1XFL A;  3UJ1 A;  3D22 A;  1S3C A;  1GRX A;  1SL2 B;  2VM1 A;  1TW9 A;  1NSW A;  2H0G A;  4MZW A;  2P31 A;  4GQF A;  3VPQ A;  2HZF A;  5D73 A;  5DQS A;  2CA8 A;  4KDX A;  3EVI A;  1E2Y A;  1YZX A;  5F06 A;  5LCZ A;  2X8C A;  4Q5N A;  4MZC A;  3LW9 A;  2YJH A;  1ZYP A;  2V32 A;  5HR2 A;  4MDC A;  3QDN A;  1TRW A;  2XBI A;  3ZIT A;  3IXR A;  3D6I A;  4GF0 A;  1WP0 A;  4OD7 A;  5JWO B;  3GA4 A;  2H75 A;  4OMV A;  3ZTL A;  2YJ7 A;  1U6T A;  2YP6 A;  4NHW A;  5B6N A;  1K0O A;  1AQX A;  2IWT A;  3DXB A;  5IPG A;  1DUG A;  3LG6 A;  3TKS C;  5GZZ B;  1MDK A;  3UL3 A;  5ECI B;  5B7C A;  9GSS A;  4GST A;  4CHS A;  3APO A;  4KAE A;  1C72 A;  1QQ2 A;  1KEB A;  1TRS A;  1FAA A;  3WT2 A;  4MJE A;  4N0V A;  4FYB A;  2H1B A;  4TXV A;  3M1G A;  3HYP A;  2CZ2 A;  2PGT A;  3TGZ A;  2R6K A;  3F6F A;  1TRV A;  5FT3 A;  3C71 A;  4OFT A;  2L59 A;  4WF4 A;  3KMN A;  1WWJ A;  4G10 A;  4POM A;  1XBS A;  3TRQ A;  5HR3 A;  3FR9 A;  3M9J A;  3HJM A;  4EDZ A;  2DKI A;  2B1K A;  2A2P A;  3VFI A;  2LNS A;  2GVP A;  1RW1 A;  2FUG 2;  2RII A;  3HJP A;  1M2A A;  1A24 A;  1X0R A;  3I6A A;  3Q18 A;  3CSH A;  4ECJ A;  4KF9 A;  5LD0 A;  1CQG A;  4CDO A;  5KOW A;  2I1U A;  2A4H A;  3KM6 A;  2I4A A;  4K1F A;  3HKR A;  1RQM A;  2R3X A;  5CYY A;  3BJ5 A;  1GTA A;  5CP1 A;  4LMW A;  2A2R A;  4RQX A;  1SKW B;  5GAN D;  2H30 A;  2LNT A;  4USS A;  4G0K A;  3ZVJ D;  2YV7 A;  4XS4 B;  4MJC A;  4KGI A;  4TXO B;  4IW9 A;  4HQZ A;  5IMV A;  2ZNM A;  1SEN A;  3GL5 A;  4L0W A;  1DBY A;  3NOF A;  5IO0 A;  1SL1 B;  4JRR A;  3HDC A;  4GSS A;  5FWG A;  4GQC A;  4MH2 A;  1TP9 A;  2H6Y A;  2OKA A;  1XVQ A;  1ON4 A;  4GRF A;  2OE3 A;  1KNG A;  3ZYW A;  3IBH A;  2CX3 A;  4WBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...