1TI3A

Solution structure of the thioredoxin h1 from poplar, a cppc active site variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
AEEGQVIACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin H
publication title Solution structure of a natural CPPC active site variant, the reduced form of thioredoxin h1 from poplar.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ti3A00
4PQIA 3L9UA 3W8SA 2J9HA 5HFIA 1TW9A 3GV1A 3FZ4A 2A4VA 4KUNA 4G10A 3P90A 3ZFLA 3DIEA 1E6BA 4MA9A 4NMUA 2H75A 2H72A 3M9JA 2KP1A 3W6GA 1XVQA 2J23A 1OKTA 1XWKA 2XPEA 4F2IA 1OE7A 2PERA 5A5KA 2XC2A 4EL1A 3Q19A 2VD1A 3F4TA 2LNTA 6GSXA 3I9V2 4BWSA 2CAQA 2R37A 3SWLA 3WGEA 1OKDA 1VF1A 2B7JA 2VCVA 4I2UA 2VM2A 2OKAA 3GKKA 1GP1A 3QAVA 1K0DA 4L5LA 1TRWA 1WWJA 1JZOA 3F63A 3KTLA 1ERWA 3BBYA 3KXOA 3D5JA 3MWHA 1EEMA 2VCTA 3EMXA 3QD9A 3N9JA 3E9JB 3L9VA 4MZCA 2PMTA 2YJ7A 4I6XA 4IN0A 2WB9A 2B7KA 3HJPA 2B5XA 4PUAA 3WGDA 2FNOA 1V40A 2VAFA 1XWAA 2VCXA 5DAKB 1R7HA 3DD3A 2N5AA 4N0VA 4RI7A 5KEJA 1T8EB 4BWQA 4E8EA 2YZUA 3VK9A 4MJCA 2LV3A 2YWOA 3UMAA 1GLQA 4XS4B 5IOXA 4XRDA 5ELGA 1OC3A 4G2EA 2JACA 1UA5A 1YF0A 1SL2B 1TP9A 2JZTA 3KP8A 3ZL5A 1F2EA 2F9SA 1GTBA 3GSTA 4N30A 4IW9A 1X5CA 5ABRA 3CTGA 5CP1A 1A8YA 4ZL8A 4WBJA 2CZ2A 4NHZA 4TRXA 2R5GA 3VWXA 3GHAA 1YF1A 2EIQA 1S3AA 4MF6A 4GTUA 5CREA 2AV4A 5IIZA 2LRTA 2N5BA 1PMTA 2NVLA 2WDUA 2MMNA 2O87A 4D73A 5GAPD 2GVPA 5G5FA 1ZZYA 1M2BA 5DJLA 5ECOB 1OC9B 3DXBA 4EXJA 2I9HA 4NXIA 2LKUA 2EIOA 3VWWA 3MDKA 4HUAA 5H5RA 4GSSA 3ZMLA 3E3EA 3ZZXA 3C1SA 1O6JA 3VLNA 1A0FA 1V2AA 1I9DA 2VLUA 1OE8A 1G7OA 3HHVA 2HZEB 13GSA 4TN8A 1XIYA 1ST9A 1BAYA 3F6FA 1AXDA 4DEJA 2WS2A 2PUKC 2QGVA 2B5YA 4MZBA 3EMPA 3IK9A 4HJMA 3UL3A 4Q5RA 1FHEA 4OWYA 3DKSA 4DVCA 1C72A 1O8WA 5HR0A 2Z9SA 3RHCA 3LXTA 1PL1A 2G0FA 5GAND 2B3SA 3WT2A 2BJXA 2XPDA 5COHA 3H79A 2JSYA 2OE0A 3TRQA 2K6VA 3UJ1A 1NM3A 4HQZA 1SK2A 2DSAA 3CTFA 5IO2A 4WR4A 2LRNA 4FO5A 4IP1A 3CRUA 2OACA 2VL3A 4EDYA 2H6ZA 2YV7A 1U3IA 6GSTA 2DJ0A 1X5EA 3P7XA 1M9AA 4IP6A 3LYPA 4ILFA 3G9BA 3TRPA 4FH8A 5DQSA 22GSA 1PKZA 4XTSA 3QOUA 1A2JA 4JEDA 4IVFA 4ZB6A 4NPBA 2GT6A 1YEPA 1M2DA 4KCAA 3IDVA 2C0EA 1GTUA 5KN3A 2LNSA 16GSA 2K8VA 5F05A 1K0MA 3WD6A 1JZDA 3EINA 3KGKA 1SL1B 3NIVA 3ERFA 3LORA 4ZBAA 3ME7A 1WRYA 4AGSA 2IMFA 2X8HA 5IPGA 4KSOA 4PQ1A 4GQCA 5IO0A 1W89A 1T7PB 3IOSA 1EGRA 2LS5A 2B1LA 3TDGA 1Z3EA 3FR6A 3TKSC 4GCIA 4O5RA 4ZXGA 2GTUA 4JRRA 2ALBA 1HQOA 1GSSA 5AGYA 5IMDA 1CQHA 3M1GA 2HRFA 3CSHA 1G0TA 2RUFA 4ML1A 3FK8A 5AN1A 3GSSA 5DCGA 2RIIA 3TGZA 1V9WA 1K0OA 1TU8A 4AJ6A 3GYKA 5LNKe 2IN3A 5HR2A 3GKMA 3EU4A 5JCGA 4KA0A 2H66A 2HNLA 2GQLA 1WIKA 3D4MA 3P2AA 8GSSA 4EKZA 5FWGA 3CXGA 2CZ3A 3ZVJD 1HYUA 2PN8A 2YNXA 1GSDA 5HQPA 5B8BA 3F8UA 1MTCA 3DWVA 4POKA 5AIVA 4IQAA 2LQQA 3OR5A 5G1KA 1X0RA 1R26A 4OMVA 3HVXA 1MDIA 1XW9A 2VLVA 3TKRA 2VUPA 2IFQB 4XS6A 3UAPA 2JZRA 3F9UA 2YP6A 2AHEA 2E7PA 1THXA 3TJJA 4NWYA 2R4VA 5J41A 1Y6EA 1SKWB 5F0GA 2VD0A 2ZNMA 3CSJA 2V1MA 2NBSA 2V6OA 3LFLA 4DSRA 3C8EA 1IYHA 1GSFA 4KGIA 1SJ6A 3F6DA 4MPFA 3M9KA 5DALB 5ELAA 3BJ5A 2DMMA 3VWVA 5ID2A 1BQ7A 1PRXA 2H19A 3GA4A 3L78A 2WFCA 3IHQA 2KHPA 1PQNA 2H1GA 1XFLA 3GKXA 4TXOA 1ZL9A 4YQUA 3GH6A 4N11A 4RQXA 1VF2A 1UVZA 1SYRA 5CRGA 3V1WA 3TJKA 19GSA 2GSTA 1ZGNA 1X5DA 2C1YA 1YKCA 3FRCA 3KIJA 3PINA 1HNAA 1SK1A 1LU4A 4HU9A 4GWRA 4N0ZA 2YWNA 1JHBA 1Z9HA 3RAZA 4E8HA 3LEFA 3O3TA 1TDIA 4I97A 2V2GA 2XBIA 3TKSA 2C3QA 3C71A 1K0AA 1XOAA 3TUEA 1V58A 1JFUA 1SKSB 5HFGA 5IMVA 3VURA 3C73A 3IPZA 3FZAA 1T1VA 4N10A 4V1Ag 4JE1A 1AQVA 5G1LA 1Z5YE 1B4QA 5F07A 1WOUA 1XWCA 3A2XA 1X9SB 5H5QA 3CMIA 2QKEA 4MJBA 4K7NA 3KCMA 2VL9A 5HR1A 1DE1A 5J9BA 4G9HA 4GF0A 2OA7A 1KTEA 1OC8A 2PWJA 5D9TA 2EC4A 3UVTA 4HOJA 2E2MA 2LUSA 9GSSA 3FR3A 4CDOA 2I4AA 1A2MA 2DIYA 2DJ1A 1NHYA 4LMWA 1TJDA 4OD7A 2DIZA 2PVOC 3IV4A 2R3XA 1VF4A 2VL2A 4ID0A 1YY7A 4XCSA 1YZXA 2HRNA 1ZOFA 4MF7A 1JZRA 2MMAA 1XW6A 1Z7PA 4OFNA 3DEXA 2P0GA 3O76A 1TTZA 4MZWA 1QMVA 1AQWA 2I81A 3ZRDA 1XWBA 5DDLA 2JL4A 1JLVA 5DAKA 4AF2A 1FB6A 2H76A 1PX6A 3WGXA 1G7EA 2R6KA 4XS4A 3GL5A 1M99A 2N5FA 1R5AA 3RPNA 3K8NA 1N8JA 5A4UA 2QSIA 4K7IA 3J7Yk 4X1UA 1J0FA 5DVBA 3HJOA 5CRHA 1SU9A 17GSA 3GTUB 3IR4A 4PURA 1HNBA 1OAZA 3N5OA 3LG6A 1RQMA 3F4RA 4ZB8A 4F03A 2F8FA 2O89A 3KD0A 3GURA 3IXRA 3LQ7A 5IM9A 3EC3A 1GSUA 2HYXA 4PNFA 4MK3A 2PBJA 1S3DA 1AC1A 4JR4A 2LSTA 1OC9A 2R2JA 1M7TA 1GUHA 3CSIA 4RI6A 1SL0B 2WGRA 3EWLA 1HD2A 1YDKA 2JU5A 3ZYWA 2IMKA 1THOA 5HFKA 5ECIB 1YQ1A 3KJYA 4NHWA 1U3AA 2VOCA 1GSYA 5JCUA 1YKAA 4HU7A 4TKYA 3L9SA 3EE2A 1BEDA 2LQOA 2H71A 3ZIJA 1TRUA 3DVXA 4ISDA 4IBPA 2HZFA 1V98A 1T4YA 4JR6A 3ZFBA 2LJKA 5A4VA 3GMFA 3IK7A 4O32A 5B6NA 2JADA 3GKNA 1S3CA 2AYTA 1XXUA 4V2NA 1DUGA 2B5EA 2YOIA 4YAPA 4TR1B 3TOTA 4FYBA 4OCFA 4HZ2A 2GQMA 1GRXA 1GSQA 2I1UA 3ZIVA 4HI7A 1ILOA 3GL3A 5CNWA 1QUWA 3ZVJA 4IJIA 1FG4A 5ENUA 3IA1A 3HDCA 2YCDA 2CVDA 3GX8A 5IOWA 5JWRB 1SJZA 2MMZA 1N2AA 4I8BA 2GZYA 2VCQA 2GZZA 4O92A 1F9MA 3QR6A 4L0WA 3SBCA 3TJGA 2TRCP 5D9XA 1ABAA 1U88A 1AAZA 2FD3A 3GIXA 1GNWA 5C04A 2C3NA 4L0UA 3VFIA 3D6IA 4ULXA 3QAWA 2AAWA 3HYPA 4BPYA 4LL1B 3ZREA 3Q18A 3HZ8A 1RW1A 2P31A 2LEGA 1GUKA 3H1NA 2FWFA 1EV4A 5DJMA 3GNJA 4F0CA 2ZCTA 1A24A 2C0DA 4IKHA 1O73A 5LD0A 2C80A 10GSA 3WYWA 4NAXA 1NHOA 2K18A 3MSZA 1OVNA 4H86A 4RUVA 3FKFA 3JCML 5KN0A 3APSA 4XS1A 4GQFA 4POBA 2H70A 5J4UA 4IJ3A 2O85A 4FYUA 3IAS2 2YV9A 4KNDA 1XZOA 4V2LA 2FWHA 3R2QA 3DMLA 1A23A 18GSA 2O8VB 2JZSA 4KH7A 5D8IA 1YJ6A 2CVKA 1PL2A 2FLSA 1K0BA 1XVWA 4J57E 5A4WA 4MPGA 1RK4A 4Q5FA 3E0UA 3Q6OA 3ZITA 3VI5A 2X99A 4EUYA 2H30A 2LJRA 3TB2A 1GWCA 1R5PA 4XRAA 1DE2A 1QK8A 4V2MA 4CHSA 5GZZB 4EF0A 3EU3A 3HCZA 5ECNB 1GSEA 3TKQA 3ERWA 1DSBA 1G6WA 1GUMA 1B48A 3D22A 3QFAC 4MH3A 5ECSA 4TR3A 5C00A 2L6DA 3P8WA 2F8AA 1H4OA 3PGTA 1M2AA 3TJFA 3TKSE 3TJBA 4MH2A 1XCCA 1K0NA 1TI3A 4F9ZA 2NDOA 4J2FA 1Z7RA 2CX3A 4HZ4A 3ZTLA 5F8BA 1NSWA 2IFQA 5D9VA 2H1AA 5CO3A 1IYIA 4KDUA 2VL2C 4WF5A 2ON5A 2PU9C 2DJKA 5ECHB 4DSSB 2REMA 3LXZA 2GLRA 3BCIA 2V41A 5B7CA 4ZILA 1EOGA 5GSSA 1Z6MA 3KM6A 4KB3A 2KLXA 4IGJA 1TRVA 2LJAA 4K2DA 4NV5A 4IS0A 2FA4A 1R4WA 2MBSA 2X8GA 2KUCA 3U6VA 1SENA 4JU5A 1H75A 4ZL7A 4ZL9A 5EL8A 4KSMA 4CW9A 4TXVA 2XBQA 3KEBA 2G2QA 1LBKA 4X43A 4EVMA 2FUG2 2GDRA 5IMAA 5B8AA 1JLWA 4I5QA 1GTAA 1ACVA 5JWOB 1PX7A 1BX9A 3KH9A 2MMOA 2OADA 2FY6A 2DJ3A 3KZQA 4K0NA 5GSTA 2X8CA 4ACSA 2VLTA 2FWGA 3GUSA 2OJLA 4TVEA 3QCPA 3O6TA 2OBKA 4I2TA 3C7MA 5B6MA 2C4JA 3QPMA 5IMZA 1W4VA 1XOBA 4KW6A 3G7YA 5J3RA 3HXSA 5H5SA 2L4QA 1BG5A 2H8LA 2YN1A 1K3LA 4JBBA 1ML6A 5G31A 3VPQA 4ECIA 3ISOA 4Q5QA 3LSZA 1V57A 1SYXA 1BJXA 5EPFA 2O7KA 5LCZA 2DC5A 3ED3A 1A8LA 3HJMA 1SD9A 1TXXA 4EO3A 2CVBA 1UN2A 5KN1A 1AW9A 4QQ7A 3A2VA 4YAVA 4KDYA 2RLIA 3US3A 2M72A 2KOKA 1SD8A 4F82A 2NTOA 3TOUA 2C0GA 1TK5B 1ON4A 1Q98A 3IRAA 4ECCA 3APQA 4O7HA 2VIMA 1PKWA 3M3MA 2X64A 1TRSA 3ZLPA 1E2YA 3QAGA 1M0UA 1VF3A 3WT1A 1EV9A 4EDZA 5IMFA 2GS3A 1G6YA 5L71A 3CBUA 2YWMA 3GFKA 3EVIA 2H1DA 2L5OA 4YQMA 5ECLB 12GSA 3QDNA 1A0RP 4K1FA 4NV2A 1U87A 3HZ4A 1VGLA 1QXHA 3EURA 4IQ1A 2MYGA 2IMIA 1KEBA 5ECRB 2TRXA 3UEMA 4KX4A 4QL7A 2WCIA 1GL8A 3FR9A 3GTUA 4IELA 4P3YB 2D2ZA 2CT6A 5ECKB 2K8SA 1SK0A 1WPIA 4QL9A 1I5GA 2CAIA 5JWQB 1ERUA 5G30A 1GULA 2C8UA 1NW2A 1FB0A 1DBYA 2I3YA 1M9BA 1FVJA 1ZYQB 3RPPA 2IL3A 2YPMA 2AB6A 1GNEA 2GQKA 2H0HA 2CQ9A 1SKRB 2P5RA 3F0IA 2V6KA 2WJUA 5G2ZA 2H6XA 5AIXA 2B6MA 2HE3A 1O8XA 2KP2A 4TOPA 2CV4A 4POLA 2H01A 2HSHA 4DSQA 2H1BA 4K7OA 2HLSA 3UIWA 2VCWA 3U5RE 2VO4A 14GSA 1X9WB 1PGTA 4TW5A 4JZQA 4WR5A 1F3AA 3TRXA 3CRTA 1EWXA 3A2WA 4MDCA 4MABA 2H6YA 4PXOA 5ECMB 4KDXA 4F0BA 1MDKA 6GSSA 2A2RA 2B1KA 3F4SA 2OBIA 4PUFC 1HNCA 4WF4A 4Z7XA 4TR1A 7GSSA 2RUEA 3DRNA 1F3BA 1FVKA 2OE1A 3DVWA 2FWEA 2HZEA 4G19A 3AY8A 4RQRA 5D73A 1O7UA 1QFNA 2FCHA 2DBCA 2H0IA 2YZHA 2HXKA 5FT3A 3EYTA 2PPTA 1XW5A 3IAM2 1YEXA 4KE3A 1MDJA 1WMJA 4XHMA 2YWIA 5IQYA 4HQSA 3D4TA 4ZIJA 4ZBBA 3PR8A 4POMA 4XIHA 4GSTA 3FYGA 2NPBA 2LRCA 1B9YC 4FIWA 2PGTA 1TKDB 4ZB9A 4MMMA 1UC7A 4FYCA 1LJRA 3FW2A 2QC7A 4MJEA 4OFMA 20GSA 3MNGA 1ERVA 1URMA 1FO5A 2E0QA 3LGCA 4GXZA 3C1RA 4LMVA 3UOMA 1AUCA 4TR4A 4K9ZA 2EIRA 4AJ7A 5E59A 3UBLA 1K0CA 3M0FA 4D73B 6GSUA 2MBTA 2DMLA 5J5NA 1J08A 2L5LA 4HS1A 1A2LA 4OFTA 4PNGA 4HDEA 4K0GA 1T4ZA 2IPAA 1EZKA 1TI1A 2IIYA 4ZBDA 4BA7A 2L57A 1ZYEA 2BMXA 3A5WA 1T3BA 4OO5A 4L5OA 4V1Ap 4IHUA 2M80A 5HR3A 3FEUA 3FY7A 1XPVA 3IC4A 1TK8B 1B9XC 2YANA 2IMEA 2PVQA 5INYA 3F3QA 2A2SA 1PD21 3ZMKA 3FHKA 5DQYA 2F51A 3HD5A 3MAKA 3DYRA 4KAEA 4PGTA 2HI7A 1JZWA 1ERTA 2FGXA 1XBSA 1EP7A 4KCEA 5EVOA 3W8JA 1B8XA 2FA8A 1KBNA 2XHFA 2WULA 2IJYA 1GLPA 2IMDA 3Q74A 4WKWA 3S9FA 1QGVA 2C3TA 1PA3A 4YQVA 4BL7A 1O85A 2WRTA 3LYKA 1AQXA 4K8MA 4GRFA 2LTKA 5ECQB 3VWUA 2WZ9A 3BOAA 3NOFA 1PN9A 6GSYA 3GN3A 11GSA 2AUVA 1WE0A 4X0XA 2H0GA 4WBRD 1WJKA 1B4PA 2DLXA 3L4NA 4DSSA 1EEJA 1VRSD 3M8NA 1K3YA 3J7Yb 3IBHA 5G5EA 2DJJA 3TKPA 2HT9A 1F6MC 1F37A 2RM5A 1OYJA 3IE3A 2GSSA 2H73A 3LWAA 2VCZA 6GSWA 3I43A 2DJ2A 3H4KA 4MJAA 3HY2A 2MZCA 1MEKA 2ZUPA 5DBQA 3UARA 4WETA 1GTIA 1EOHA 3FZ5A 1EGOA 5J9CA 1XWGA 2L59A 4HJ2A 2YJHA 3PH9A 1TOFA 1AIUA 2P5QA 1X9MB 4EC0A 2F3MA 4BVYA 3DGQA 5IPHA 1KNGA 5IMCA 1PSQA 1CQGA 3G7IA 2GSQA 2HFDA 2BTOT 5CAXA 5AISA 4LLRA 5DALA 3APOA 5CRDA 2RM6A 3I6AA 3RDWA 2HSYA 2C0FA 2OE3A 3TCOA 1J9BA 2CA8A 2H74A 1U6TA 5EY6A 3UVHA 4YH2A 2TIRA 2VM1A 3BCKA 3G7JA 3NZNA 2L6CA 3KH7A 5CRWA 3KMNA 5FHIA 1Q4JA 3CYNA 4LA1A 1QQ2A 4HEA2 3L0HA 5D93A 5JCWA 4WXTA 1GH2A 5D9WA 3RHBA 4Q5NA 2GSRA 3BD2A 3D0ZA 3KMOA 2ON7A 4PQHA 2AJQB 4GSNA 4BVXA 4ML6A 3UBKA 1EP8A 4K6XA 3HVSA 1TK0B 6GSVA 1ZMAA 2E2GA 1SJIA 1K3OA 1USBA 5KN2A 3H93A 4J56E 3F3RA 1O81A 3HVVA 2L4CA 1MD4A 5D96A 3GRXA 5DCHA 4L8EA 3QFBC 2CX4A 3HKRA 2IWTA 4TR0A 1FOVA 3KP9A 1ZCPA 4MCUA 1FW1A 3QMXA 5ECPB 4MP4A 3FZ9A 4ECBA 5F06A 2M46A 3ERGA 4ECJA 2ES7A 1Y25A 4EE0A 1TU7A 2FHEA 3VI7A 2K9FA 5ID2B 1WP0A 1MD3A 4OO4A 1BYEA 5CYYA 1Z6NA 3A3TA 4OCEA 3LJRA 2JSZA 4TXOB 3VPTA 4WEYA 3ME8A 3D21A 3I69A 5E4WA 3KTBA 3H8QA 2GZPA 2V32A 4GLTA 3RBTA 4MF5A 1T00A 4LL4B 4PX1A 4MLYA 1FAAA 2GT5A 3GH9A 3GX0A 4AJ8A 3HA9A 2GGTA
chains in the Genus database with same CATH superfamily
4PQIA 3L9UA 3W8SA 2J9HA 5HFIA 1TW9A 3GV1A 3FZ4A 2A4VA 4KUNA 4BIKA 4G10A 3P90A 3ZFLA 3DIEA 1E6BA 4MA9A 4NMUA 2H75A 2H72A 3M9JA 2KP1A 3W6GA 1XVQA 2J23A 1OKTA 1XWKA 2XPEA 4F2IA 1OE7A 2PERA 5A5KA 4Z2UA 2XC2A 4EL1A 3Q19A 2VD1A 3F4TA 2LNTA 6GSXA 3I9V2 4BWSA 2CAQA 2R37A 3SWLA 3WGEA 1OKDA 1VF1A 2B7JA 2VCVA 4I2UA 2VM2A 2OKAA 3GKKA 1GP1A 3QAVA 1K0DA 4L5LA 1TRWA 1WWJA 1JZOA 3F63A 3KTLA 1ERWA 3BBYA 3KXOA 3D5JA 3MWHA 1EEMA 2VCTA 3EMXA 3QD9A 3N9JA 3E9JB 3L9VA 4MZCA 2PMTA 2YJ7A 4I6XA 4IN0A 2WB9A 2B7KA 3HJPA 2B5XA 4PUAA 3WGDA 2FNOA 1V40A 2VAFA 1XWAA 2VCXA 5DAKB 1R7HA 3DD3A 2N5AA 4N0VA 4RI7A 5KEJA 1T8EB 4BWQA 4E8EA 2YZUA 3VK9A 4MJCA 2LV3A 2YWOA 3UMAA 1GLQA 4XS4B 5IOXA 4XRDA 5ELGA 1OC3A 4G2EA 2JACA 1UA5A 1YF0A 1SL2B 4K5RA 1TP9A 2JZTA 3KP8A 3ZL5A 1F2EA 2F9SA 1GTBA 3GSTA 4N30A 4IW9A 1X5CA 5ABRA 3CTGA 5CP1A 1A8YA 4ZL8A 4WBJA 2CZ2A 4YKFA 4NHZA 4TRXA 2R5GA 3VWXA 3GHAA 1YF1A 2EIQA 1S3AA 4MF6A 4GTUA 5CREA 2AV4A 5IIZA 2LRTA 2N5BA 1PMTA 2NVLA 2WDUA 2MMNA 2O87A 5KOWA 4D73A 5GAPD 2GVPA 5G5FA 1ZZYA 4KF9A 1M2BA 5DJLA 5ECOB 1OC9B 3DXBA 4EXJA 2I9HA 4NXIA 2LKUA 2EIOA 3VWWA 3MDKA 4HUAA 5H5RA 4GSSA 3ZMLA 3E3EA 2R0PA 3ZZXA 3C1SA 1O6JA 3VLNA 1A0FA 1V2AA 1I9DA 2VLUA 1OE8A 1G7OA 3HHVA 2HZEB 13GSA 4TN8A 1XIYA 1ST9A 1BAYA 3F6FA 1AXDA 4DEJA 2WS2A 2PUKC 2QGVA 2B5YA 4MZBA 3EMPA 3IK9A 4HJMA 3UL3A 4Q5RA 1FHEA 4OWYA 3DKSA 4DVCA 1C72A 1O8WA 5HR0A 2Z9SA 3RHCA 3LXTA 1PL1A 2G0FA 5GAND 2B3SA 3WT2A 2BJXA 2XPDA 5COHA 3H79A 2JSYA 2OE0A 3TRQA 2K6VA 3UJ1A 1NM3A 4HQZA 1SK2A 2DSAA 3CTFA 5IO2A 4WR4A 2LRNA 4FO5A 4IP1A 3CRUA 2OACA 2VL3A 4EDYA 2H6ZA 2YV7A 1U3IA 6GSTA 2DJ0A 1X5EA 3P7XA 1M9AA 4IP6A 3LYPA 4ILFA 3G9BA 3TRPA 4FH8A 5DQSA 22GSA 1PKZA 4XTSA 3QOUA 1A2JA 4JEDA 4IVFA 4ZB6A 4NPBA 2GT6A 1YEPA 1M2DA 4KCAA 3IDVA 2C0EA 1GTUA 5KN3A 2LNSA 16GSA 2K8VA 5F05A 1K0MA 3WD6A 1JZDA 3EINA 3KGKA 1SL1B 3NIVA 3ERFA 3LORA 3PPUA 4ZBAA 3ME7A 1WRYA 4AGSA 2IMFA 2X8HA 2HRKA 5IPGA 4KSOA 4PQ1A 4GQCA 5IO0A 1W89A 1T7PB 3IOSA 1EGRA 2LS5A 2B1LA 3TDGA 1Z3EA 3FR6A 3TKSC 4GCIA 4O5RA 4ZXGA 2GTUA 4JRRA 2ALBA 1HQOA 1GSSA 5AGYA 5IMDA 1CQHA 3M1GA 2HRFA 3CSHA 1G0TA 2HRAA 2RUFA 4ML1A 3FK8A 5AN1A 3GSSA 5DCGA 2RIIA 3TGZA 1V9WA 1K0OA 1TU8A 4AJ6A 3GYKA 5LNKe 2IN3A 5HR2A 3GKMA 3EU4A 5JCGA 4KA0A 2H66A 2HNLA 2GQLA 1WIKA 3D4MA 3P2AA 8GSSA 4EKZA 5FWGA 3CXGA 2CZ3A 3ZVJD 1HYUA 2PN8A 2YNXA 1GSDA 5HQPA 5B8BA 3F8UA 1MTCA 3DWVA 4POKA 5AIVA 4IQAA 2LQQA 3OR5A 5G1KA 1X0RA 1R26A 4OMVA 3HVXA 4G0LA 1MDIA 1XW9A 2VLVA 3TKRA 3R3EA 2VUPA 2IFQB 4XS6A 2A2PA 3UAPA 2JZRA 3F9UA 2YP6A 2AHEA 2E7PA 1THXA 3TJJA 4NWYA 2R4VA 5J41A 1Y6EA 4PTSA 1SKWB 5F0GA 2VD0A 2ZNMA 3CSJA 2V1MA 2NBSA 2V6OA 3LFLA 4DSRA 3C8EA 1IYHA 1GSFA 4KGIA 1SJ6A 3F6DA 4MPFA 3M9KA 5DALB 5ELAA 3BJ5A 2DMMA 3VWVA 5ID2A 1BQ7A 1PRXA 2H19A 3GA4A 3L78A 2WFCA 3IHQA 2KHPA 1PQNA 2H1GA 1XFLA 3GKXA 4TXOA 1ZL9A 4YQUA 3GH6A 4N11A 4RQXA 1VF2A 1UVZA 1SYRA 5CRGA 3V1WA 3TJKA 19GSA 2GSTA 1ZGNA 1X5DA 2C1YA 1YKCA 3FRCA 3KIJA 3PINA 1HNAA 1SK1A 1LU4A 4HU9A 4GWRA 4N0ZA 2YWNA 1JHBA 1Z9HA 3RAZA 4E8HA 3LEFA 3O3TA 1TDIA 4I97A 2V2GA 2XBIA 3TKSA 1ZYNA 2C3QA 3C71A 1K0AA 1XOAA 3TUEA 3LW9A 1V58A 1JFUA 1SKSB 5HFGA 5IMVA 3VURA 3C73A 3IPZA 3FZAA 1T1VA 4N10A 4V1Ag 4JE1A 1AQVA 5G1LA 1Z5YE 1B4QA 5F07A 1WOUA 1XWCA 3A2XA 1X9SB 5H5QA 3CMIA 2QKEA 4MJBA 4K7NA 3KCMA 2VL9A 5HR1A 1DE1A 5J9BA 4G9HA 4GF0A 1PN0A 2OA7A 1KTEA 1OC8A 2PWJA 5D9TA 2EC4A 3UVTA 4HOJA 2E2MA 2LUSA 9GSSA 3FR3A 4CDOA 2DKIA 2I4AA 1A2MA 2DIYA 2DJ1A 1NHYA 4LMWA 1TJDA 4OD7A 2DIZA 2PVOC 3IV4A 2R3XA 1VF4A 2VL2A 4ID0A 4EIQA 1YY7A 4XCSA 1YZXA 2HRNA 1ZOFA 4MF7A 1JZRA 2MMAA 1XW6A 1Z7PA 4ICYA 4OFNA 3DEXA 2P0GA 3O76A 1TTZA 4MZWA 1QMVA 1AQWA 2I81A 3ZRDA 1XWBA 5DDLA 2JL4A 1JLVA 5DAKA 4AF2A 1FB6A 2H76A 1PX6A 3WGXA 1G7EA 2R6KA 2R0GA 4XS4A 3GL5A 1M99A 2N5FA 1R5AA 3RPNA 3K8NA 1N8JA 5A4UA 2QSIA 4K7IA 3J7Yk 4X1UA 1J0FA 3IHGA 5DVBA 3HJOA 5CRHA 1SU9A 17GSA 3GTUB 3IR4A 4PURA 1HNBA 1OAZA 3N5OA 3LG6A 1RQMA 3F4RA 4ZB8A 4F03A 2F8FA 2O89A 3KD0A 3GURA 3IXRA 3LQ7A 5IM9A 3EC3A 1GSUA 2HYXA 4PNFA 4MK3A 2PBJA 1S3DA 1AC1A 2HSMA 4JR4A 2LSTA 1OC9A 2R2JA 1M7TA 1GUHA 3CSIA 4RI6A 4FQUA 1SL0B 2WGRA 3EWLA 1HD2A 1YDKA 2JU5A 2UZ8A 3FMWA 3ZYWA 2IMKA 1THOA 5HFKA 5ECIB 1YQ1A 3KJYA 4NHWA 1U3AA 2VOCA 1GSYA 5JCUA 1YKAA 4HU7A 4TKYA 2QA1A 3L9SA 3EE2A 1BEDA 2LQOA 2H71A 3ZIJA 1TRUA 3DVXA 4ISDA 4IBPA 2HZFA 1V98A 1T4YA 4JR6A 3ZFBA 2LJKA 4MNNA 5A4VA 3GMFA 3IK7A 4O32A 5B6NA 2JADA 3GKNA 1S3CA 2X4AA 2AYTA 1XXUA 4V2NA 1DUGA 2B5EA 2YOIA 4YAPA 4TR1B 3TOTA 4FYBA 4OCFA 4HZ2A 2GQMA 1GRXA 1GSQA 2I1UA 3ZIVA 4HI7A 1ILOA 3GL3A 5CNWA 1QUWA 3ZVJA 4IJIA 1FG4A 5ENUA 5BMUA 3IA1A 3IC8A 3HDCA 2YCDA 3MIXA 2CVDA 4Z2RA 3GX8A 5IOWA 5JWRB 1SJZA 2MMZA 1N2AA 4HSCX 4I8BA 2GZYA 2VCQA 2GZZA 4O92A 1F9MA 3QR6A 4L0WA 3SBCA 3TJGA 2TRCP 5D9XA 4YKGA 1ABAA 1U88A 1AAZA 2FD3A 3GIXA 4CY8A 1GNWA 5C04A 2C3NA 4L0UA 3VFIA 3D6IA 4ULXA 3QAWA 2AAWA 3HYPA 4BPYA 4LL1B 3ZREA 3Q18A 3HZ8A 1RW1A 2P31A 2LEGA 1GUKA 3H1NA 2FWFA 1EV4A 5DJMA 3GNJA 4F0CA 2ZCTA 1A24A 2C0DA 4IKHA 1O73A 5LD0A 2C80A 10GSA 3WYWA 4NAXA 1NHOA 2K18A 3MSZA 1OVNA 4H86A 4RUVA 3FKFA 3JCML 5KN0A 3APSA 4XS1A 4GQFA 4POBA 2H70A 5J4UA 4IJ3A 2O85A 4FYUA 3IAS2 2YV9A 4KNDA 1XZOA 4V2LA 2FWHA 3R2QA 3DMLA 1A23A 18GSA 2O8VB 2JZSA 4KH7A 4O5UA 5D8IA 1YJ6A 2CVKA 1PL2A 2FLSA 1K0BA 1XVWA 4J57E 5A4WA 4MPGA 1RK4A 4Q5FA 3E0UA 3Q6OA 4CY6A 3ZITA 3VI5A 2X99A 4EUYA 2H30A 2LJRA 3TB2A 1GWCA 1R5PA 4XRAA 1DE2A 1QK8A 4V2MA 4CHSA 5GZZB 4EF0A 3EU3A 3HCZA 5ECNB 1GSEA 3TKQA 3ERWA 1DSBA 1G6WA 1GUMA 1B48A 3D22A 3QFAC 4MH3A 5ECSA 4TR3A 5C00A 2L6DA 3P8WA 2F8AA 1H4OA 4BL7B 3PGTA 1M2AA 3TJFA 3TKSE 3TJBA 4MH2A 1XCCA 1K0NA 1TI3A 4Z2TA 4F9ZA 2NDOA 4J2FA 1Z7RA 2CX3A 4HZ4A 3ZTLA 5F8BA 1NSWA 2IFQA 5D9VA 2H1AA 5CO3A 1IYIA 4KDUA 2VL2C 4WF5A 2ON5A 2PU9C 2DJKA 5ECHB 4DSSB 2REMA 3LXZA 2GLRA 3BCIA 2V41A 5B7CA 4ZILA 1EOGA 2R0CA 5GSSA 1Z6MA 3KM6A 4KB3A 2KLXA 1FOHA 4IGJA 1TRVA 2LJAA 4K2DA 4NV5A 4IS0A 2FA4A 1R4WA 2MBSA 2X8GA 2KUCA 3U6VA 1SENA 4JU5A 1H75A 4ZL7A 4ZL9A 5EL8A 4KSMA 4BVYB 4CW9A 4TXVA 2XBQA 3KEBA 2G2QA 1LBKA 4X43A 4EVMA 4EIPA 2FUG2 2GDRA 5IMAA 5B8AA 1JLWA 4I5QA 1GTAA 1ACVA 5JWOB 1PX7A 1BX9A 3KH9A 2MMOA 2OADA 2FY6A 2DJ3A 3KZQA 4K0NA 5GSTA 2X8CA 4ACSA 2VLTA 2FWGA 3GUSA 2OJLA 4TVEA 3QCPA 3O6TA 2OBKA 4I2TA 5KOXA 3C7MA 5B6MA 2C4JA 3QPMA 5IMZA 1W4VA 1XOBA 4KW6A 3G7YA 5J3RA 3HXSA 5H5SA 2L4QA 1BG5A 2H8LA 2YN1A 1K3LA 4JBBA 1ML6A 5G31A 2X49A 3VPQA 1ZYPA 3ISOA 4ECIA 3CQFA 4Q5QA 3LSZA 4USSA 1V57A 1SYXA 1BJXA 4BVXB 5EPFA 2O7KA 5LCZA 2DC5A 3ED3A 1A8LA 3HJMA 1SD9A 1TXXA 4EO3A 2CVBA 1UN2A 5KN1A 1AW9A 4QQ7A 3A2VA 4YAVA 4KDYA 2RLIA 3US3A 2M72A 2KOKA 1SD8A 4K5SA 4F82A 2NTOA 3TOUA 2C0GA 1TK5B 1ON4A 1Q98A 3IRAA 4ECCA 3APQA 4O7HA 2VIMA 1PKWA 3M3MA 2X64A 1TRSA 3ZLPA 1E2YA 3QAGA 1M0UA 1VF3A 3WT1A 1EV9A 4EDZA 5IMFA 2GS3A 1G6YA 5L71A 3CBUA 2YWMA 3GFKA 3EVIA 2H1DA 2L5OA 4YQMA 5ECLB 12GSA 3QDNA 1A0RP 4K1FA 4NV2A 1U87A 3HZ4A 1VGLA 1QXHA 3EURA 4IQ1A 2MYGA 2IMIA 1KEBA 5ECRB 2TRXA 3UEMA 4KX4A 4QL7A 2WCIA 1GL8A 3FR9A 3GTUA 4IELA 4P3YB 2D2ZA 2CT6A 5ECKB 2K8SA 1SK0A 1WPIA 4QL9A 1I5GA 2CAIA 5JWQB 1ERUA 5G30A 1GULA 2C8UA 1NW2A 1FB0A 1DBYA 2I3YA 1M9BA 1FVJA 1ZYQB 3RPPA 2IL3A 2YPMA 2AB6A 1GNEA 2GQKA 2H0HA 2CQ9A 1SKRB 2P5RA 3F0IA 2V6KA 2WJUA 5G2ZA 2H6XA 5AIXA 2B6MA 2HE3A 1O8XA 2KP2A 4TOPA 2CV4A 4POLA 2H01A 2HSHA 4DSQA 2H1BA 4K7OA 2HLSA 3UIWA 2VCWA 3U5RE 2VO4A 14GSA 1X9WB 1PGTA 4TW5A 4JZQA 4WR5A 1F3AA 3TRXA 3CRTA 1EWXA 3A2WA 4MDCA 4K2XA 4MABA 2H6YA 4PXOA 5ECMB 4KDXA 4F0BA 1M3JA 1MDKA 6GSSA 2A2RA 2B1KA 3F4SA 2OBIA 4PUFC 1HNCA 4WF4A 4Z7XA 4TR1A 7GSSA 2RUEA 3DRNA 1F3BA 1FVKA 2OE1A 3DVWA 2FWEA 2HZEA 4G19A 4X4JA 3AY8A 4RQRA 5D73A 1O7UA 1QFNA 2FCHA 2DBCA 2H0IA 2YZHA 2HXKA 5FT3A 3EYTA 2PPTA 1XW5A 3IAM2 1YEXA 4KE3A 1MDJA 1WMJA 4XHMA 2YWIA 5IQYA 4HQSA 3D4TA 4ZIJA 4ZBBA 3PR8A 4POMA 4XIHA 4GSTA 3FYGA 2NPBA 2LRCA 1B9YC 4FIWA 2PGTA 1TKDB 4ZB9A 4MMMA 1UC7A 4FYCA 1LJRA 3FW2A 2QC7A 4MJEA 4OFMA 20GSA 3MNGA 1ERVA 1URMA 3A5IA 1FO5A 1S3RA 2E0QA 3LGCA 4GXZA 3C1RA 4LMVA 3UOMA 1AUCA 4TR4A 4K9ZA 2EIRA 4AJ7A 5E59A 3UBLA 1K0CA 3M0FA 4D73B 6GSUA 2MBTA 2DMLA 5J5NA 1J08A 2L5LA 4HS1A 1A2LA 4OFTA 4PNGA 4HDEA 4K0GA 1T4ZA 1M3IA 2IPAA 1EZKA 1TI1A 2IIYA 4ZBDA 4BA7A 2L57A 1ZYEA 2BMXA 3A5WA 1T3BA 4OO5A 4L5OA 4V1Ap 4IHUA 2M80A 5HR3A 3FEUA 3FY7A 1XPVA 3IC4A 1TK8B 1B9XC 2YANA 2IMEA 2PVQA 5INYA 3F3QA 2A2SA 1PD21 3ZMKA 3FHKA 4G0KA 5DQYA 2F51A 3HD5A 3MAKA 3DYRA 4KAEA 4PGTA 2HI7A 1JZWA 1ERTA 2FGXA 1XBSA 1EP7A 4KCEA 5EVOA 3W8JA 1B8XA 2FA8A 1KBNA 2XHFA 2WULA 2IJYA 1GLPA 2IMDA 3Q74A 4WKWA 3S9FA 1QGVA 2C3TA 1PA3A 4YQVA 4BL7A 1O85A 4A5PA 2WRTA 3LYKA 1AQXA 4K8MA 4GRFA 2LTKA 5ECQB 3VWUA 2WZ9A 3BOAA 3NOFA 1PN9A 6GSYA 3GN3A 11GSA 2AUVA 1WE0A 4X0XA 2H0GA 4WBRD 1WJKA 1B4PA 2DLXA 3L4NA 4DSSA 1EEJA 1VRSD 3M8NA 1K3YA 3J7Yb 3IBHA 5G5EA 2DJJA 3TKPA 3MYDA 2HT9A 4G0IA 1F6MC 1F37A 2RM5A 1OYJA 3IE3A 2GSSA 2H73A 3LWAA 2VCZA 6GSWA 2QA2A 3I43A 2DJ2A 3H4KA 4MJAA 3HY2A 2MZCA 1MEKA 2ZUPA 5DBQA 3UARA 4WETA 1GTIA 1EOHA 3FZ5A 1EGOA 5J9CA 1XWGA 2L59A 4HJ2A 2YJHA 3PH9A 1TOFA 1PFOA 1AIUA 2P5QA 1X9MB 4EC0A 2F3MA 4BVYA 3DGQA 5IPHA 1KNGA 5IMCA 1PSQA 1CQGA 3G7IA 2GSQA 2HFDA 2BTOT 5CAXA 5AISA 4LLRA 4O5QA 5DALA 3APOA 5CRDA 2RM6A 3I6AA 3RDWA 2HSYA 2C0FA 2OE3A 3TCOA 1J9BA 2CA8A 2H74A 1U6TA 5EY6A 3UVHA 4YH2A 2TIRA 2VM1A 3BCKA 3G7JA 3NZNA 2L6CA 3KH7A 5CRWA 3KMNA 5FHIA 1Q4JA 3CYNA 4LA1A 1QQ2A 4HEA2 3L0HA 5D93A 5JCWA 4WXTA 1GH2A 5D9WA 3RHBA 4Q5NA 2GSRA 3BD2A 3D0ZA 3KMOA 2ON7A 4PQHA 2AJQB 4GSNA 4BVXA 4ML6A 3UBKA 1EP8A 4K6XA 3HVSA 1TK0B 6GSVA 1ZMAA 2E2GA 1SJIA 1K3OA 1USBA 5KN2A 3H93A 4J56E 3F3RA 1O81A 3HVVA 2L4CA 1MD4A 5D96A 3GRXA 5DCHA 4L8EA 3QFBC 2CX4A 3HKRA 2IWTA 4TR0A 1FOVA 3KP9A 1ZCPA 1XG8A 4MCUA 1FW1A 3QMXA 5ECPB 3HVNA 4MP4A 3FZ9A 4ECBA 5F06A 2M46A 3ERGA 4ECJA 2ES7A 1Y25A 4EE0A 5BRTA 1TU7A 2FHEA 3VI7A 3EPTA 2K9FA 5ID2B 2A4HA 1WP0A 1MD3A 4OO4A 1BYEA 5CYYA 1Z6NA 3A3TA 4OCEA 3LJRA 2JSZA 2DKHA 4TXOB 3VPTA 4WEYA 3ME8A 3D21A 3I69A 5E4WA 3KTBA 3H8QA 2GZPA 2V32A 4GLTA 3RBTA 4MF5A 1T00A 4LL4B 4PX1A 4MLYA 1FAAA 2GT5A 3GH9A 3GX0A 4AJ8A 3HA9A 2GGTA
chains in the Genus database with same CATH topology
4PQIA 3L9UA 3W8SA 2J9HA 5HFIA 1TW9A 3GV1A 3FZ4A 2A4VA 4KUNA 4G10A 3P90A 3ZFLA 3DIEA 1E6BA 4MA9A 4NMUA 2H75A 2H72A 3M9JA 2KP1A 3W6GA 1XVQA 2J23A 1OKTA 1XWKA 2XPEA 4F2IA 1OE7A 2PERA 5A5KA 4Z2UA 2XC2A 4EL1A 3Q19A 2VD1A 3F4TA 2LNTA 6GSXA 3I9V2 4BWSA 2CAQA 2R37A 3SWLA 3WGEA 1OKDA 1VF1A 2B7JA 2VCVA 4I2UA 2VM2A 2OKAA 3GKKA 1GP1A 3QAVA 1K0DA 4L5LA 1TRWA 1WWJA 1JZOA 3F63A 3KTLA 1ERWA 3BBYA 3KXOA 3D5JA 3MWHA 1EEMA 2VCTA 3EMXA 3QD9A 3N9JA 3E9JB 3L9VA 4MZCA 2PMTA 2YJ7A 4I6XA 4IN0A 2WB9A 2B7KA 3HJPA 2B5XA 4PUAA 3WGDA 2FNOA 1V40A 2VAFA 1XWAA 2VCXA 5DAKB 1R7HA 3DD3A 2N5AA 4N0VA 4RI7A 5KEJA 1T8EB 4BWQA 4E8EA 2YZUA 3VK9A 4MJCA 2LV3A 2YWOA 3UMAA 1GLQA 4XS4B 5IOXA 4XRDA 5ELGA 1OC3A 4G2EA 2JACA 1UA5A 1YF0A 1SL2B 4K5RA 1TP9A 2JZTA 3KP8A 3ZL5A 1F2EA 2F9SA 1GTBA 3GSTA 4N30A 4IW9A 1X5CA 5ABRA 3CTGA 5CP1A 1A8YA 4ZL8A 4WBJA 2CZ2A 4YKFA 4NHZA 4TRXA 2R5GA 3VWXA 3GHAA 1YF1A 2EIQA 1S3AA 4MF6A 4GTUA 5CREA 2AV4A 5IIZA 2LRTA 2N5BA 1PMTA 2NVLA 2WDUA 2MMNA 2O87A 5KOWA 4D73A 5GAPD 2GVPA 5G5FA 1ZZYA 4KF9A 1M2BA 5DJLA 5ECOB 1OC9B 3DXBA 4EXJA 2I9HA 4NXIA 2LKUA 2EIOA 3VWWA 3MDKA 4HUAA 5H5RA 4GSSA 3ZMLA 3E3EA 2R0PA 3ZZXA 3C1SA 1O6JA 3VLNA 1A0FA 1V2AA 1I9DA 2VLUA 1OE8A 1G7OA 3HHVA 2HZEB 13GSA 4TN8A 1XIYA 1ST9A 1BAYA 3F6FA 1AXDA 4DEJA 2WS2A 2PUKC 2QGVA 2B5YA 4MZBA 3EMPA 3IK9A 4HJMA 3UL3A 4Q5RA 1FHEA 4OWYA 3DKSA 4DVCA 1C72A 1O8WA 5HR0A 2Z9SA 3RHCA 3LXTA 1PL1A 2G0FA 5GAND 2B3SA 3WT2A 2BJXA 2XPDA 5COHA 3H79A 2JSYA 2OE0A 3TRQA 2K6VA 3UJ1A 1NM3A 4HQZA 1SK2A 2DSAA 3CTFA 5IO2A 4WR4A 2LRNA 4FO5A 4IP1A 3CRUA 2OACA 2VL3A 4EDYA 2H6ZA 2YV7A 1U3IA 6GSTA 2DJ0A 1X5EA 3P7XA 1M9AA 4IP6A 3LYPA 4ILFA 3G9BA 3TRPA 4FH8A 5DQSA 22GSA 1PKZA 4XTSA 3QOUA 1A2JA 4JEDA 4IVFA 4ZB6A 4NPBA 2GT6A 1YEPA 1M2DA 4KCAA 3IDVA 2C0EA 1GTUA 5KN3A 2LNSA 16GSA 2K8VA 5F05A 1K0MA 3WD6A 1JZDA 3EINA 3KGKA 1SL1B 3NIVA 3ERFA 3LORA 3PPUA 4ZBAA 3ME7A 1WRYA 4AGSA 2IMFA 2X8HA 2HRKA 5IPGA 4KSOA 4PQ1A 4GQCA 5IO0A 1W89A 1T7PB 3IOSA 1EGRA 2LS5A 2B1LA 3TDGA 1Z3EA 3FR6A 3TKSC 4GCIA 4O5RA 4ZXGA 2GTUA 4JRRA 2ALBA 1HQOA 1GSSA 5AGYA 5IMDA 1CQHA 3M1GA 2HRFA 3CSHA 1G0TA 2HRAA 2RUFA 4ML1A 3FK8A 5AN1A 3GSSA 5DCGA 2RIIA 3TGZA 1V9WA 1K0OA 1TU8A 4AJ6A 3GYKA 5LNKe 2IN3A 5HR2A 3GKMA 3EU4A 5JCGA 4KA0A 2H66A 2HNLA 2GQLA 1WIKA 3D4MA 3P2AA 8GSSA 4EKZA 5FWGA 3CXGA 2CZ3A 3ZVJD 1HYUA 2PN8A 2YNXA 1GSDA 5HQPA 5B8BA 3F8UA 1MTCA 3DWVA 4POKA 5AIVA 4IQAA 2LQQA 3OR5A 5G1KA 1X0RA 1R26A 4OMVA 3HVXA 4G0LA 1MDIA 1XW9A 2VLVA 3TKRA 3R3EA 2VUPA 2IFQB 4XS6A 2A2PA 3UAPA 2JZRA 3F9UA 2YP6A 2AHEA 2E7PA 1THXA 3TJJA 4NWYA 2R4VA 5J41A 1Y6EA 4PTSA 1SKWB 5F0GA 2VD0A 2ZNMA 3CSJA 2V1MA 2NBSA 2V6OA 3LFLA 4DSRA 3C8EA 1IYHA 1GSFA 4KGIA 1SJ6A 3F6DA 4MPFA 3M9KA 5DALB 5ELAA 3BJ5A 2DMMA 3VWVA 5ID2A 1BQ7A 1PRXA 2H19A 3GA4A 3L78A 2WFCA 3IHQA 2KHPA 1PQNA 2H1GA 1XFLA 3GKXA 4TXOA 1ZL9A 4YQUA 3GH6A 4N11A 4RQXA 1VF2A 1UVZA 1SYRA 5CRGA 3V1WA 3TJKA 19GSA 2GSTA 1ZGNA 1X5DA 2C1YA 1YKCA 3FRCA 3KIJA 3PINA 1HNAA 1SK1A 1LU4A 4HU9A 4GWRA 4N0ZA 2YWNA 1JHBA 1Z9HA 3RAZA 4E8HA 3LEFA 3O3TA 1TDIA 4I97A 2V2GA 2XBIA 3TKSA 1ZYNA 2C3QA 3C71A 1K0AA 1XOAA 3TUEA 3LW9A 1V58A 1JFUA 1SKSB 5HFGA 5IMVA 3VURA 3C73A 3IPZA 3FZAA 1T1VA 4N10A 4V1Ag 4JE1A 1AQVA 5G1LA 1Z5YE 1B4QA 5F07A 1WOUA 1XWCA 3A2XA 1X9SB 5H5QA 3CMIA 2QKEA 4MJBA 4K7NA 3KCMA 2VL9A 5HR1A 1DE1A 5J9BA 4G9HA 4GF0A 1PN0A 2OA7A 1KTEA 1OC8A 2PWJA 5D9TA 2EC4A 3UVTA 4HOJA 2E2MA 2LUSA 9GSSA 3FR3A 4CDOA 2DKIA 2I4AA 1A2MA 2DIYA 2DJ1A 1NHYA 4LMWA 1TJDA 4OD7A 2DIZA 2PVOC 3IV4A 2R3XA 1VF4A 2VL2A 4ID0A 4EIQA 1YY7A 4XCSA 1YZXA 2HRNA 1ZOFA 4MF7A 1JZRA 2MMAA 1XW6A 1Z7PA 4ICYA 4OFNA 3DEXA 2P0GA 3O76A 1TTZA 4MZWA 1QMVA 1AQWA 2I81A 3ZRDA 1XWBA 5DDLA 2JL4A 1JLVA 5DAKA 4AF2A 1FB6A 2H76A 1PX6A 3WGXA 1G7EA 2R6KA 2R0GA 4XS4A 3GL5A 1M99A 2N5FA 1R5AA 3RPNA 3K8NA 1N8JA 5A4UA 2QSIA 4K7IA 3J7Yk 4X1UA 1J0FA 3IHGA 5DVBA 3HJOA 5CRHA 1SU9A 17GSA 3GTUB 3IR4A 4PURA 1HNBA 1OAZA 3N5OA 3LG6A 1RQMA 3F4RA 4ZB8A 4F03A 2F8FA 2O89A 3KD0A 3GURA 3IXRA 3LQ7A 5IM9A 3EC3A 1GSUA 2HYXA 4PNFA 4MK3A 2PBJA 1S3DA 1AC1A 2HSMA 4JR4A 2LSTA 1OC9A 2R2JA 1M7TA 1GUHA 3CSIA 4RI6A 4FQUA 1SL0B 2WGRA 3EWLA 1HD2A 1YDKA 2JU5A 2UZ8A 3FMWA 3ZYWA 2IMKA 1THOA 5HFKA 5ECIB 1YQ1A 3KJYA 4NHWA 1U3AA 2VOCA 1GSYA 5JCUA 1YKAA 4HU7A 4TKYA 2QA1A 3L9SA 3EE2A 1BEDA 2LQOA 2H71A 3ZIJA 1TRUA 3DVXA 4ISDA 4IBPA 2HZFA 1V98A 1T4YA 4JR6A 3ZFBA 2LJKA 4MNNA 5A4VA 3GMFA 3IK7A 4O32A 5B6NA 2JADA 3GKNA 1S3CA 2X4AA 2AYTA 1XXUA 4V2NA 1DUGA 2B5EA 2YOIA 4YAPA 4TR1B 3TOTA 4FYBA 4OCFA 4HZ2A 2GQMA 1GRXA 1GSQA 2I1UA 3ZIVA 4HI7A 1ILOA 3GL3A 5CNWA 1QUWA 3ZVJA 4IJIA 1FG4A 5ENUA 5BMUA 3IA1A 3IC8A 3HDCA 2YCDA 3MIXA 2CVDA 4Z2RA 3GX8A 5IOWA 5JWRB 1SJZA 2MMZA 1N2AA 4I8BA 2GZYA 2VCQA 2GZZA 4O92A 1F9MA 3QR6A 4L0WA 3SBCA 3TJGA 2TRCP 5D9XA 4YKGA 1ABAA 1U88A 1AAZA 2FD3A 3GIXA 4CY8A 1GNWA 5C04A 2C3NA 4L0UA 3VFIA 3D6IA 4ULXA 3QAWA 2AAWA 3HYPA 4BPYA 4LL1B 3ZREA 3Q18A 3HZ8A 1RW1A 2P31A 2LEGA 1GUKA 3H1NA 2FWFA 1EV4A 5DJMA 3GNJA 4F0CA 2ZCTA 1A24A 2C0DA 4IKHA 1O73A 5LD0A 2C80A 10GSA 3WYWA 4NAXA 1NHOA 2K18A 3MSZA 1OVNA 4H86A 4RUVA 3FKFA 3JCML 5KN0A 3APSA 4XS1A 4GQFA 4POBA 2H70A 5J4UA 4IJ3A 2O85A 4FYUA 3IAS2 2YV9A 4KNDA 1XZOA 4V2LA 2FWHA 3R2QA 3DMLA 1A23A 18GSA 2O8VB 2JZSA 4KH7A 4O5UA 5D8IA 1YJ6A 2CVKA 1PL2A 2FLSA 1K0BA 1XVWA 4J57E 5A4WA 4MPGA 1RK4A 4Q5FA 3E0UA 3Q6OA 4CY6A 3ZITA 3VI5A 2X99A 4EUYA 2H30A 2LJRA 3TB2A 1GWCA 1R5PA 4XRAA 1DE2A 1QK8A 4V2MA 4CHSA 5GZZB 4EF0A 3EU3A 3HCZA 5ECNB 1GSEA 3TKQA 3ERWA 1DSBA 1G6WA 1GUMA 1B48A 3D22A 3QFAC 4MH3A 5ECSA 4TR3A 5C00A 2L6DA 3P8WA 2F8AA 1H4OA 4BL7B 3PGTA 1M2AA 3TJFA 3TKSE 3TJBA 4MH2A 1XCCA 1K0NA 1TI3A 4Z2TA 4F9ZA 2NDOA 4J2FA 1Z7RA 2CX3A 4HZ4A 3ZTLA 5F8BA 1NSWA 2IFQA 5D9VA 2H1AA 5CO3A 1IYIA 4KDUA 2VL2C 4WF5A 2ON5A 2PU9C 2DJKA 5ECHB 4DSSB 2REMA 3LXZA 2GLRA 3BCIA 2V41A 5B7CA 4ZILA 1EOGA 2R0CA 5GSSA 1Z6MA 3KM6A 4KB3A 2KLXA 1FOHA 4IGJA 1TRVA 2LJAA 4K2DA 4NV5A 4IS0A 2FA4A 1R4WA 2MBSA 2X8GA 2KUCA 3U6VA 1SENA 4JU5A 1H75A 4ZL7A 4ZL9A 5EL8A 4KSMA 4BVYB 4CW9A 4TXVA 2XBQA 3KEBA 2G2QA 1LBKA 4X43A 4EVMA 4EIPA 2FUG2 2GDRA 5IMAA 5B8AA 1JLWA 4I5QA 1GTAA 1ACVA 5JWOB 1PX7A 1BX9A 3KH9A 2MMOA 2OADA 2FY6A 2DJ3A 3KZQA 4K0NA 5GSTA 2X8CA 4ACSA 2VLTA 2FWGA 3GUSA 2OJLA 4TVEA 3QCPA 3O6TA 2OBKA 4I2TA 5KOXA 3C7MA 5B6MA 2C4JA 3QPMA 5IMZA 1W4VA 1XOBA 4KW6A 3G7YA 5J3RA 3HXSA 5H5SA 2L4QA 1BG5A 2H8LA 2YN1A 1K3LA 4JBBA 1ML6A 5G31A 2X49A 3VPQA 1ZYPA 3ISOA 4ECIA 4Q5QA 3LSZA 4USSA 1V57A 1SYXA 1BJXA 4BVXB 5EPFA 2O7KA 5LCZA 2DC5A 3ED3A 1A8LA 3HJMA 1SD9A 1TXXA 4EO3A 2CVBA 1UN2A 5KN1A 1AW9A 4QQ7A 3A2VA 4YAVA 4KDYA 2RLIA 3US3A 2M72A 2KOKA 1SD8A 4K5SA 4F82A 2NTOA 3TOUA 2C0GA 1TK5B 1ON4A 1Q98A 3IRAA 4ECCA 3APQA 4O7HA 2VIMA 1PKWA 3M3MA 2X64A 1TRSA 3ZLPA 1E2YA 3QAGA 1M0UA 1VF3A 3WT1A 1EV9A 4EDZA 5IMFA 2GS3A 1G6YA 5L71A 3CBUA 2YWMA 3GFKA 3EVIA 2H1DA 2L5OA 4YQMA 5ECLB 12GSA 3QDNA 1A0RP 4K1FA 4NV2A 1U87A 3HZ4A 1VGLA 1QXHA 3EURA 4IQ1A 2MYGA 2IMIA 1KEBA 5ECRB 2TRXA 3UEMA 4KX4A 4QL7A 2WCIA 1GL8A 3FR9A 3GTUA 4IELA 4P3YB 2D2ZA 2CT6A 5ECKB 2K8SA 1SK0A 1WPIA 4QL9A 1I5GA 2CAIA 5JWQB 1ERUA 5G30A 1GULA 2C8UA 1NW2A 1FB0A 1DBYA 2I3YA 1M9BA 1FVJA 1ZYQB 3RPPA 2IL3A 2YPMA 2AB6A 1GNEA 2GQKA 2H0HA 2CQ9A 1SKRB 2P5RA 3F0IA 2V6KA 2WJUA 5G2ZA 2H6XA 5AIXA 2B6MA 2HE3A 1O8XA 2KP2A 4TOPA 2CV4A 4POLA 2H01A 2HSHA 4DSQA 2H1BA 4K7OA 2HLSA 3UIWA 2VCWA 3U5RE 2VO4A 14GSA 1X9WB 1PGTA 4TW5A 4JZQA 4WR5A 1F3AA 3TRXA 3CRTA 1EWXA 3A2WA 4MDCA 4K2XA 4MABA 2H6YA 4PXOA 5ECMB 4KDXA 4F0BA 1MDKA 6GSSA 2A2RA 2B1KA 3F4SA 2OBIA 4PUFC 1HNCA 4WF4A 4Z7XA 4TR1A 7GSSA 2RUEA 3DRNA 1F3BA 1FVKA 2OE1A 3DVWA 2FWEA 2HZEA 4G19A 4X4JA 3AY8A 4RQRA 5D73A 1O7UA 1QFNA 2FCHA 2DBCA 2H0IA 2YZHA 2HXKA 5FT3A 3EYTA 2PPTA 1XW5A 3IAM2 1YEXA 4KE3A 1MDJA 1WMJA 4XHMA 2YWIA 5IQYA 4HQSA 3D4TA 4ZIJA 4ZBBA 3PR8A 4POMA 4XIHA 4GSTA 3FYGA 2NPBA 2LRCA 1B9YC 4FIWA 2PGTA 1TKDB 4ZB9A 4MMMA 1UC7A 4FYCA 1LJRA 3FW2A 2QC7A 4MJEA 4OFMA 20GSA 3MNGA 1ERVA 1URMA 3A5IA 1FO5A 2E0QA 3LGCA 4GXZA 3C1RA 4LMVA 3UOMA 1AUCA 4TR4A 4K9ZA 2EIRA 4AJ7A 5E59A 3UBLA 1K0CA 3M0FA 4D73B 6GSUA 2MBTA 2DMLA 5J5NA 1J08A 2L5LA 4HS1A 1A2LA 4OFTA 4PNGA 4HDEA 4K0GA 1T4ZA 2IPAA 1EZKA 1TI1A 2IIYA 4ZBDA 4BA7A 2L57A 1ZYEA 2BMXA 3A5WA 1T3BA 4OO5A 4L5OA 4V1Ap 4IHUA 2M80A 5HR3A 3FEUA 3FY7A 1XPVA 3IC4A 1TK8B 1B9XC 2YANA 2IMEA 2PVQA 5INYA 3F3QA 2A2SA 1PD21 3ZMKA 3FHKA 4G0KA 5DQYA 2F51A 3HD5A 3MAKA 3DYRA 4KAEA 4PGTA 2HI7A 1JZWA 1ERTA 2FGXA 1XBSA 1EP7A 4KCEA 5EVOA 3W8JA 1B8XA 2FA8A 1KBNA 2XHFA 2WULA 2IJYA 1GLPA 2IMDA 3Q74A 4WKWA 3S9FA 1QGVA 2C3TA 1PA3A 4YQVA 4BL7A 1O85A 4A5PA 2WRTA 3LYKA 1AQXA 4K8MA 4GRFA 2LTKA 5ECQB 3VWUA 2WZ9A 3BOAA 3NOFA 1PN9A 6GSYA 3GN3A 11GSA 2AUVA 1WE0A 4X0XA 2H0GA 4WBRD 1WJKA 1B4PA 2DLXA 3L4NA 4DSSA 1EEJA 1VRSD 3M8NA 1K3YA 3J7Yb 3IBHA 5G5EA 2DJJA 3TKPA 3MYDA 2HT9A 4G0IA 1F6MC 1F37A 2RM5A 1OYJA 3IE3A 2GSSA 2H73A 3LWAA 2VCZA 6GSWA 2QA2A 3I43A 2DJ2A 3H4KA 4MJAA 3HY2A 2MZCA 1MEKA 2ZUPA 5DBQA 3UARA 4WETA 1GTIA 1EOHA 3FZ5A 1EGOA 5J9CA 1XWGA 2L59A 4HJ2A 2YJHA 3PH9A 1TOFA 1AIUA 2P5QA 1X9MB 4EC0A 2F3MA 4BVYA 3DGQA 5IPHA 1KNGA 5IMCA 1PSQA 1CQGA 3G7IA 2GSQA 2HFDA 2BTOT 5CAXA 5AISA 4LLRA 4O5QA 5DALA 3APOA 5CRDA 2RM6A 3I6AA 3RDWA 2HSYA 2C0FA 2OE3A 3TCOA 1J9BA 2CA8A 2H74A 1U6TA 5EY6A 3UVHA 4YH2A 2TIRA 2VM1A 3BCKA 3G7JA 3NZNA 2L6CA 3KH7A 5CRWA 3KMNA 5FHIA 1Q4JA 3CYNA 4LA1A 1QQ2A 4HEA2 3L0HA 5D93A 5JCWA 4WXTA 1GH2A 5D9WA 3RHBA 4Q5NA 2GSRA 3BD2A 3D0ZA 3KMOA 2ON7A 4PQHA 2AJQB 4GSNA 4BVXA 4ML6A 3UBKA 1EP8A 4K6XA 3HVSA 1TK0B 6GSVA 1ZMAA 2E2GA 1SJIA 1K3OA 1USBA 5KN2A 3H93A 4J56E 3F3RA 1O81A 3HVVA 2L4CA 1MD4A 5D96A 3GRXA 5DCHA 4L8EA 3QFBC 2CX4A 3HKRA 2IWTA 4TR0A 1FOVA 3KP9A 1ZCPA 4MCUA 1FW1A 3QMXA 5ECPB 4MP4A 3FZ9A 4ECBA 5F06A 2M46A 3ERGA 4ECJA 2ES7A 1Y25A 4EE0A 5BRTA 1TU7A 2FHEA 3VI7A 3EPTA 2K9FA 5ID2B 2A4HA 1WP0A 1MD3A 4OO4A 1BYEA 5CYYA 1Z6NA 3A3TA 4OCEA 3LJRA 2JSZA 2DKHA 4TXOB 3VPTA 4WEYA 3ME8A 3D21A 3I69A 5E4WA 3KTBA 3H8QA 2GZPA 2V32A 4GLTA 3RBTA 4MF5A 1T00A 4LL4B 4PX1A 4MLYA 1FAAA 2GT5A 3GH9A 3GX0A 4AJ8A 3HA9A 2GGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQI A;  3L9U A;  3W8S A;  2J9H A;  5HFI A;  1TW9 A;  3GV1 A;  3FZ4 A;  2A4V A;  4KUN A;  4G10 A;  3P90 A;  3ZFL A;  3DIE A;  1E6B A;  4MA9 A;  4NMU A;  2H75 A;  2H72 A;  3M9J A;  2KP1 A;  3W6G A;  1XVQ A;  2J23 A;  1OKT A;  1XWK A;  2XPE A;  4F2I A;  1OE7 A;  2PER A;  5A5K A;  2XC2 A;  4EL1 A;  3Q19 A;  2VD1 A;  3F4T A;  2LNT A;  6GSX A;  3I9V 2;  4BWS A;  2CAQ A;  2R37 A;  3SWL A;  3WGE A;  1OKD A;  1VF1 A;  2B7J A;  2VCV A;  4I2U A;  2VM2 A;  2OKA A;  3GKK A;  1GP1 A;  3QAV A;  1K0D A;  4L5L A;  1TRW A;  1WWJ A;  1JZO A;  3F63 A;  3KTL A;  1ERW A;  3BBY A;  3KXO A;  3D5J A;  3MWH A;  1EEM A;  2VCT A;  3EMX A;  3QD9 A;  3N9J A;  3E9J B;  3L9V A;  4MZC A;  2PMT A;  2YJ7 A;  4I6X A;  4IN0 A;  2WB9 A;  2B7K A;  3HJP A;  2B5X A;  4PUA A;  3WGD A;  2FNO A;  1V40 A;  2VAF A;  1XWA A;  2VCX A;  5DAK B;  1R7H A;  3DD3 A;  2N5A A;  4N0V A;  4RI7 A;  5KEJ A;  1T8E B;  4BWQ A;  4E8E A;  2YZU A;  3VK9 A;  4MJC A;  2LV3 A;  2YWO A;  3UMA A;  1GLQ A;  4XS4 B;  5IOX A;  4XRD A;  5ELG A;  1OC3 A;  4G2E A;  2JAC A;  1UA5 A;  1YF0 A;  1SL2 B;  1TP9 A;  2JZT A;  3KP8 A;  3ZL5 A;  1F2E A;  2F9S A;  1GTB A;  3GST A;  4N30 A;  4IW9 A;  1X5C A;  5ABR A;  3CTG A;  5CP1 A;  1A8Y A;  4ZL8 A;  4WBJ A;  2CZ2 A;  4NHZ A;  4TRX A;  2R5G A;  3VWX A;  3GHA A;  1YF1 A;  2EIQ A;  1S3A A;  4MF6 A;  4GTU A;  5CRE A;  2AV4 A;  5IIZ A;  2LRT A;  2N5B A;  1PMT A;  2NVL A;  2WDU A;  2MMN A;  2O87 A;  4D73 A;  5GAP D;  2GVP A;  5G5F A;  1ZZY A;  1M2B A;  5DJL A;  5ECO B;  1OC9 B;  3DXB A;  4EXJ A;  2I9H A;  4NXI A;  2LKU A;  2EIO A;  3VWW A;  3MDK A;  4HUA A;  5H5R A;  4GSS A;  3ZML A;  3E3E A;  3ZZX A;  3C1S A;  1O6J A;  3VLN A;  1A0F A;  1V2A A;  1I9D A;  2VLU A;  1OE8 A;  1G7O A;  3HHV A;  2HZE B;  13GS A;  4TN8 A;  1XIY A;  1ST9 A;  1BAY A;  3F6F A;  1AXD A;  4DEJ A;  2WS2 A;  2PUK C;  2QGV A;  2B5Y A;  4MZB A;  3EMP A;  3IK9 A;  4HJM A;  3UL3 A;  4Q5R A;  1FHE A;  4OWY A;  3DKS A;  4DVC A;  1C72 A;  1O8W A;  5HR0 A;  2Z9S A;  3RHC A;  3LXT A;  1PL1 A;  2G0F A;  5GAN D;  2B3S A;  3WT2 A;  2BJX A;  2XPD A;  5COH A;  3H79 A;  2JSY A;  2OE0 A;  3TRQ A;  2K6V A;  3UJ1 A;  1NM3 A;  4HQZ A;  1SK2 A;  2DSA A;  3CTF A;  5IO2 A;  4WR4 A;  2LRN A;  4FO5 A;  4IP1 A;  3CRU A;  2OAC A;  2VL3 A;  4EDY A;  2H6Z A;  2YV7 A;  1U3I A;  6GST A;  2DJ0 A;  1X5E A;  3P7X A;  1M9A A;  4IP6 A;  3LYP A;  4ILF A;  3G9B A;  3TRP A;  4FH8 A;  5DQS A;  22GS A;  1PKZ A;  4XTS A;  3QOU A;  1A2J A;  4JED A;  4IVF A;  4ZB6 A;  4NPB A;  2GT6 A;  1YEP A;  1M2D A;  4KCA A;  3IDV A;  2C0E A;  1GTU A;  5KN3 A;  2LNS A;  16GS A;  2K8V A;  5F05 A;  1K0M A;  3WD6 A;  1JZD A;  3EIN A;  3KGK A;  1SL1 B;  3NIV A;  3ERF A;  3LOR A;  4ZBA A;  3ME7 A;  1WRY A;  4AGS A;  2IMF A;  2X8H A;  5IPG A;  4KSO A;  4PQ1 A;  4GQC A;  5IO0 A;  1W89 A;  1T7P B;  3IOS A;  1EGR A;  2LS5 A;  2B1L A;  3TDG A;  1Z3E A;  3FR6 A;  3TKS C;  4GCI A;  4O5R A;  4ZXG A;  2GTU A;  4JRR A;  2ALB A;  1HQO A;  1GSS A;  5AGY A;  5IMD A;  1CQH A;  3M1G A;  2HRF A;  3CSH A;  1G0T A;  2RUF A;  4ML1 A;  3FK8 A;  5AN1 A;  3GSS A;  5DCG A;  2RII A;  3TGZ A;  1V9W A;  1K0O A;  1TU8 A;  4AJ6 A;  3GYK A;  5LNK e;  2IN3 A;  5HR2 A;  3GKM A;  3EU4 A;  5JCG A;  4KA0 A;  2H66 A;  2HNL A;  2GQL A;  1WIK A;  3D4M A;  3P2A A;  8GSS A;  4EKZ A;  5FWG A;  3CXG A;  2CZ3 A;  3ZVJ D;  1HYU A;  2PN8 A;  2YNX A;  1GSD A;  5HQP A;  5B8B A;  3F8U A;  1MTC A;  3DWV A;  4POK A;  5AIV A;  4IQA A;  2LQQ A;  3OR5 A;  5G1K A;  1X0R A;  1R26 A;  4OMV A;  3HVX A;  1MDI A;  1XW9 A;  2VLV A;  3TKR A;  2VUP A;  2IFQ B;  4XS6 A;  3UAP A;  2JZR A;  3F9U A;  2YP6 A;  2AHE A;  2E7P A;  1THX A;  3TJJ A;  4NWY A;  2R4V A;  5J41 A;  1Y6E A;  1SKW B;  5F0G A;  2VD0 A;  2ZNM A;  3CSJ A;  2V1M A;  2NBS A;  2V6O A;  3LFL A;  4DSR A;  3C8E A;  1IYH A;  1GSF A;  4KGI A;  1SJ6 A;  3F6D A;  4MPF A;  3M9K A;  5DAL B;  5ELA A;  3BJ5 A;  2DMM A;  3VWV A;  5ID2 A;  1BQ7 A;  1PRX A;  2H19 A;  3GA4 A;  3L78 A;  2WFC A;  3IHQ A;  2KHP A;  1PQN A;  2H1G A;  1XFL A;  3GKX A;  4TXO A;  1ZL9 A;  4YQU A;  3GH6 A;  4N11 A;  4RQX A;  1VF2 A;  1UVZ A;  1SYR A;  5CRG A;  3V1W A;  3TJK A;  19GS A;  2GST A;  1ZGN A;  1X5D A;  2C1Y A;  1YKC A;  3FRC A;  3KIJ A;  3PIN A;  1HNA A;  1SK1 A;  1LU4 A;  4HU9 A;  4GWR A;  4N0Z A;  2YWN A;  1JHB A;  1Z9H A;  3RAZ A;  4E8H A;  3LEF A;  3O3T A;  1TDI A;  4I97 A;  2V2G A;  2XBI A;  3TKS A;  2C3Q A;  3C71 A;  1K0A A;  1XOA A;  3TUE A;  1V58 A;  1JFU A;  1SKS B;  5HFG A;  5IMV A;  3VUR A;  3C73 A;  3IPZ A;  3FZA A;  1T1V A;  4N10 A;  4V1A g;  4JE1 A;  1AQV A;  5G1L A;  1Z5Y E;  1B4Q A;  5F07 A;  1WOU A;  1XWC A;  3A2X A;  1X9S B;  5H5Q A;  3CMI A;  2QKE A;  4MJB A;  4K7N A;  3KCM A;  2VL9 A;  5HR1 A;  1DE1 A;  5J9B A;  4G9H A;  4GF0 A;  2OA7 A;  1KTE A;  1OC8 A;  2PWJ A;  5D9T A;  2EC4 A;  3UVT A;  4HOJ A;  2E2M A;  2LUS A;  9GSS A;  3FR3 A;  4CDO A;  2I4A A;  1A2M A;  2DIY A;  2DJ1 A;  1NHY A;  4LMW A;  1TJD A;  4OD7 A;  2DIZ A;  2PVO C;  3IV4 A;  2R3X A;  1VF4 A;  2VL2 A;  4ID0 A;  1YY7 A;  4XCS A;  1YZX A;  2HRN A;  1ZOF A;  4MF7 A;  1JZR A;  2MMA A;  1XW6 A;  1Z7P A;  4OFN A;  3DEX A;  2P0G A;  3O76 A;  1TTZ A;  4MZW A;  1QMV A;  1AQW A;  2I81 A;  3ZRD A;  1XWB A;  5DDL A;  2JL4 A;  1JLV A;  5DAK A;  4AF2 A;  1FB6 A;  2H76 A;  1PX6 A;  3WGX A;  1G7E A;  2R6K A;  4XS4 A;  3GL5 A;  1M99 A;  2N5F A;  1R5A A;  3RPN A;  3K8N A;  1N8J A;  5A4U A;  2QSI A;  4K7I A;  3J7Y k;  4X1U A;  1J0F A;  5DVB A;  3HJO A;  5CRH A;  1SU9 A;  17GS A;  3GTU B;  3IR4 A;  4PUR A;  1HNB A;  1OAZ A;  3N5O A;  3LG6 A;  1RQM A;  3F4R A;  4ZB8 A;  4F03 A;  2F8F A;  2O89 A;  3KD0 A;  3GUR A;  3IXR A;  3LQ7 A;  5IM9 A;  3EC3 A;  1GSU A;  2HYX A;  4PNF A;  4MK3 A;  2PBJ A;  1S3D A;  1AC1 A;  4JR4 A;  2LST A;  1OC9 A;  2R2J A;  1M7T A;  1GUH A;  3CSI A;  4RI6 A;  1SL0 B;  2WGR A;  3EWL A;  1HD2 A;  1YDK A;  2JU5 A;  3ZYW A;  2IMK A;  1THO A;  5HFK A;  5ECI B;  1YQ1 A;  3KJY A;  4NHW A;  1U3A A;  2VOC A;  1GSY A;  5JCU A;  1YKA A;  4HU7 A;  4TKY A;  3L9S A;  3EE2 A;  1BED A;  2LQO A;  2H71 A;  3ZIJ A;  1TRU A;  3DVX A;  4ISD A;  4IBP A;  2HZF A;  1V98 A;  1T4Y A;  4JR6 A;  3ZFB A;  2LJK A;  5A4V A;  3GMF A;  3IK7 A;  4O32 A;  5B6N A;  2JAD A;  3GKN A;  1S3C A;  2AYT A;  1XXU A;  4V2N A;  1DUG A;  2B5E A;  2YOI A;  4YAP A;  4TR1 B;  3TOT A;  4FYB A;  4OCF A;  4HZ2 A;  2GQM A;  1GRX A;  1GSQ A;  2I1U A;  3ZIV A;  4HI7 A;  1ILO A;  3GL3 A;  5CNW A;  1QUW A;  3ZVJ A;  4IJI A;  1FG4 A;  5ENU A;  3IA1 A;  3HDC A;  2YCD A;  2CVD A;  3GX8 A;  5IOW A;  5JWR B;  1SJZ A;  2MMZ A;  1N2A A;  4I8B A;  2GZY A;  2VCQ A;  2GZZ A;  4O92 A;  1F9M A;  3QR6 A;  4L0W A;  3SBC A;  3TJG A;  2TRC P;  5D9X A;  1ABA A;  1U88 A;  1AAZ A;  2FD3 A;  3GIX A;  1GNW A;  5C04 A;  2C3N A;  4L0U A;  3VFI A;  3D6I A;  4ULX A;  3QAW A;  2AAW A;  3HYP A;  4BPY A;  4LL1 B;  3ZRE A;  3Q18 A;  3HZ8 A;  1RW1 A;  2P31 A;  2LEG A;  1GUK A;  3H1N A;  2FWF A;  1EV4 A;  5DJM A;  3GNJ A;  4F0C A;  2ZCT A;  1A24 A;  2C0D A;  4IKH A;  1O73 A;  5LD0 A;  2C80 A;  10GS A;  3WYW A;  4NAX A;  1NHO A;  2K18 A;  3MSZ A;  1OVN A;  4H86 A;  4RUV A;  3FKF A;  3JCM L;  5KN0 A;  3APS A;  4XS1 A;  4GQF A;  4POB A;  2H70 A;  5J4U A;  4IJ3 A;  2O85 A;  4FYU A;  3IAS 2;  2YV9 A;  4KND A;  1XZO A;  4V2L A;  2FWH A;  3R2Q A;  3DML A;  1A23 A;  18GS A;  2O8V B;  2JZS A;  4KH7 A;  5D8I A;  1YJ6 A;  2CVK A;  1PL2 A;  2FLS A;  1K0B A;  1XVW A;  4J57 E;  5A4W A;  4MPG A;  1RK4 A;  4Q5F A;  3E0U A;  3Q6O A;  3ZIT A;  3VI5 A;  2X99 A;  4EUY A;  2H30 A;  2LJR A;  3TB2 A;  1GWC A;  1R5P A;  4XRA A;  1DE2 A;  1QK8 A;  4V2M A;  4CHS A;  5GZZ B;  4EF0 A;  3EU3 A;  3HCZ A;  5ECN B;  1GSE A;  3TKQ A;  3ERW A;  1DSB A;  1G6W A;  1GUM A;  1B48 A;  3D22 A;  3QFA C;  4MH3 A;  5ECS A;  4TR3 A;  5C00 A;  2L6D A;  3P8W A;  2F8A A;  1H4O A;  3PGT A;  1M2A A;  3TJF A;  3TKS E;  3TJB A;  4MH2 A;  1XCC A;  1K0N A;  1TI3 A;  4F9Z A;  2NDO A;  4J2F A;  1Z7R A;  2CX3 A;  4HZ4 A;  3ZTL A;  5F8B A;  1NSW A;  2IFQ A;  5D9V A;  2H1A A;  5CO3 A;  1IYI A;  4KDU A;  2VL2 C;  4WF5 A;  2ON5 A;  2PU9 C;  2DJK A;  5ECH B;  4DSS B;  2REM A;  3LXZ A;  2GLR A;  3BCI A;  2V41 A;  5B7C A;  4ZIL A;  1EOG A;  5GSS A;  1Z6M A;  3KM6 A;  4KB3 A;  2KLX A;  4IGJ A;  1TRV A;  2LJA A;  4K2D A;  4NV5 A;  4IS0 A;  2FA4 A;  1R4W A;  2MBS A;  2X8G A;  2KUC A;  3U6V A;  1SEN A;  4JU5 A;  1H75 A;  4ZL7 A;  4ZL9 A;  5EL8 A;  4KSM A;  4CW9 A;  4TXV A;  2XBQ A;  3KEB A;  2G2Q A;  1LBK A;  4X43 A;  4EVM A;  2FUG 2;  2GDR A;  5IMA A;  5B8A A;  1JLW A;  4I5Q A;  1GTA A;  1ACV A;  5JWO B;  1PX7 A;  1BX9 A;  3KH9 A;  2MMO A;  2OAD A;  2FY6 A;  2DJ3 A;  3KZQ A;  4K0N A;  5GST A;  2X8C A;  4ACS A;  2VLT A;  2FWG A;  3GUS A;  2OJL A;  4TVE A;  3QCP A;  3O6T A;  2OBK A;  4I2T A;  3C7M A;  5B6M A;  2C4J A;  3QPM A;  5IMZ A;  1W4V A;  1XOB A;  4KW6 A;  3G7Y A;  5J3R A;  3HXS A;  5H5S A;  2L4Q A;  1BG5 A;  2H8L A;  2YN1 A;  1K3L A;  4JBB A;  1ML6 A;  5G31 A;  3VPQ A;  4ECI A;  3ISO A;  4Q5Q A;  3LSZ A;  1V57 A;  1SYX A;  1BJX A;  5EPF A;  2O7K A;  5LCZ A;  2DC5 A;  3ED3 A;  1A8L A;  3HJM A;  1SD9 A;  1TXX A;  4EO3 A;  2CVB A;  1UN2 A;  5KN1 A;  1AW9 A;  4QQ7 A;  3A2V A;  4YAV A;  4KDY A;  2RLI A;  3US3 A;  2M72 A;  2KOK A;  1SD8 A;  4F82 A;  2NTO A;  3TOU A;  2C0G A;  1TK5 B;  1ON4 A;  1Q98 A;  3IRA A;  4ECC A;  3APQ A;  4O7H A;  2VIM A;  1PKW A;  3M3M A;  2X64 A;  1TRS A;  3ZLP A;  1E2Y A;  3QAG A;  1M0U A;  1VF3 A;  3WT1 A;  1EV9 A;  4EDZ A;  5IMF A;  2GS3 A;  1G6Y A;  5L71 A;  3CBU A;  2YWM A;  3GFK A;  3EVI A;  2H1D A;  2L5O A;  4YQM A;  5ECL B;  12GS A;  3QDN A;  1A0R P;  4K1F A;  4NV2 A;  1U87 A;  3HZ4 A;  1VGL A;  1QXH A;  3EUR A;  4IQ1 A;  2MYG A;  2IMI A;  1KEB A;  5ECR B;  2TRX A;  3UEM A;  4KX4 A;  4QL7 A;  2WCI A;  1GL8 A;  3FR9 A;  3GTU A;  4IEL A;  4P3Y B;  2D2Z A;  2CT6 A;  5ECK B;  2K8S A;  1SK0 A;  1WPI A;  4QL9 A;  1I5G A;  2CAI A;  5JWQ B;  1ERU A;  5G30 A;  1GUL A;  2C8U A;  1NW2 A;  1FB0 A;  1DBY A;  2I3Y A;  1M9B A;  1FVJ A;  1ZYQ B;  3RPP A;  2IL3 A;  2YPM A;  2AB6 A;  1GNE A;  2GQK A;  2H0H A;  2CQ9 A;  1SKR B;  2P5R A;  3F0I A;  2V6K A;  2WJU A;  5G2Z A;  2H6X A;  5AIX A;  2B6M A;  2HE3 A;  1O8X A;  2KP2 A;  4TOP A;  2CV4 A;  4POL A;  2H01 A;  2HSH A;  4DSQ A;  2H1B A;  4K7O A;  2HLS A;  3UIW A;  2VCW A;  3U5R E;  2VO4 A;  14GS A;  1X9W B;  1PGT A;  4TW5 A;  4JZQ A;  4WR5 A;  1F3A A;  3TRX A;  3CRT A;  1EWX A;  3A2W A;  4MDC A;  4MAB A;  2H6Y A;  4PXO A;  5ECM B;  4KDX A;  4F0B A;  1MDK A;  6GSS A;  2A2R A;  2B1K A;  3F4S A;  2OBI A;  4PUF C;  1HNC A;  4WF4 A;  4Z7X A;  4TR1 A;  7GSS A;  2RUE A;  3DRN A;  1F3B A;  1FVK A;  2OE1 A;  3DVW A;  2FWE A;  2HZE A;  4G19 A;  3AY8 A;  4RQR A;  5D73 A;  1O7U A;  1QFN A;  2FCH A;  2DBC A;  2H0I A;  2YZH A;  2HXK A;  5FT3 A;  3EYT A;  2PPT A;  1XW5 A;  3IAM 2;  1YEX A;  4KE3 A;  1MDJ A;  1WMJ A;  4XHM A;  2YWI A;  5IQY A;  4HQS A;  3D4T A;  4ZIJ A;  4ZBB A;  3PR8 A;  4POM A;  4XIH A;  4GST A;  3FYG A;  2NPB A;  2LRC A;  1B9Y C;  4FIW A;  2PGT A;  1TKD B;  4ZB9 A;  4MMM A;  1UC7 A;  4FYC A;  1LJR A;  3FW2 A;  2QC7 A;  4MJE A;  4OFM A;  20GS A;  3MNG A;  1ERV A;  1URM A;  1FO5 A;  2E0Q A;  3LGC A;  4GXZ A;  3C1R A;  4LMV A;  3UOM A;  1AUC A;  4TR4 A;  4K9Z A;  2EIR A;  4AJ7 A;  5E59 A;  3UBL A;  1K0C A;  3M0F A;  4D73 B;  6GSU A;  2MBT A;  2DML A;  5J5N A;  1J08 A;  2L5L A;  4HS1 A;  1A2L A;  4OFT A;  4PNG A;  4HDE A;  4K0G A;  1T4Z A;  2IPA A;  1EZK A;  1TI1 A;  2IIY A;  4ZBD A;  4BA7 A;  2L57 A;  1ZYE A;  2BMX A;  3A5W A;  1T3B A;  4OO5 A;  4L5O A;  4V1A p;  4IHU A;  2M80 A;  5HR3 A;  3FEU A;  3FY7 A;  1XPV A;  3IC4 A;  1TK8 B;  1B9X C;  2YAN A;  2IME A;  2PVQ A;  5INY A;  3F3Q A;  2A2S A;  1PD2 1;  3ZMK A;  3FHK A;  5DQY A;  2F51 A;  3HD5 A;  3MAK A;  3DYR A;  4KAE A;  4PGT A;  2HI7 A;  1JZW A;  1ERT A;  2FGX A;  1XBS A;  1EP7 A;  4KCE A;  5EVO A;  3W8J A;  1B8X A;  2FA8 A;  1KBN A;  2XHF A;  2WUL A;  2IJY A;  1GLP A;  2IMD A;  3Q74 A;  4WKW A;  3S9F A;  1QGV A;  2C3T A;  1PA3 A;  4YQV A;  4BL7 A;  1O85 A;  2WRT A;  3LYK A;  1AQX A;  4K8M A;  4GRF A;  2LTK A;  5ECQ B;  3VWU A;  2WZ9 A;  3BOA A;  3NOF A;  1PN9 A;  6GSY A;  3GN3 A;  11GS A;  2AUV A;  1WE0 A;  4X0X A;  2H0G A;  4WBR D;  1WJK A;  1B4P A;  2DLX A;  3L4N A;  4DSS A;  1EEJ A;  1VRS D;  3M8N A;  1K3Y A;  3J7Y b;  3IBH A;  5G5E A;  2DJJ A;  3TKP A;  2HT9 A;  1F6M C;  1F37 A;  2RM5 A;  1OYJ A;  3IE3 A;  2GSS A;  2H73 A;  3LWA A;  2VCZ A;  6GSW A;  3I43 A;  2DJ2 A;  3H4K A;  4MJA A;  3HY2 A;  2MZC A;  1MEK A;  2ZUP A;  5DBQ A;  3UAR A;  4WET A;  1GTI A;  1EOH A;  3FZ5 A;  1EGO A;  5J9C A;  1XWG A;  2L59 A;  4HJ2 A;  2YJH A;  3PH9 A;  1TOF A;  1AIU A;  2P5Q A;  1X9M B;  4EC0 A;  2F3M A;  4BVY A;  3DGQ A;  5IPH A;  1KNG A;  5IMC A;  1PSQ A;  1CQG A;  3G7I A;  2GSQ A;  2HFD A;  2BTO T;  5CAX A;  5AIS A;  4LLR A;  5DAL A;  3APO A;  5CRD A;  2RM6 A;  3I6A A;  3RDW A;  2HSY A;  2C0F A;  2OE3 A;  3TCO A;  1J9B A;  2CA8 A;  2H74 A;  1U6T A;  5EY6 A;  3UVH A;  4YH2 A;  2TIR A;  2VM1 A;  3BCK A;  3G7J A;  3NZN A;  2L6C A;  3KH7 A;  5CRW A;  3KMN A;  5FHI A;  1Q4J A;  3CYN A;  4LA1 A;  1QQ2 A;  4HEA 2;  3L0H A;  5D93 A;  5JCW A;  4WXT A;  1GH2 A;  5D9W A;  3RHB A;  4Q5N A;  2GSR A;  3BD2 A;  3D0Z A;  3KMO A;  2ON7 A;  4PQH A;  2AJQ B;  4GSN A;  4BVX A;  4ML6 A;  3UBK A;  1EP8 A;  4K6X A;  3HVS A;  1TK0 B;  6GSV A;  1ZMA A;  2E2G A;  1SJI A;  1K3O A;  1USB A;  5KN2 A;  3H93 A;  4J56 E;  3F3R A;  1O81 A;  3HVV A;  2L4C A;  1MD4 A;  5D96 A;  3GRX A;  5DCH A;  4L8E A;  3QFB C;  2CX4 A;  3HKR A;  2IWT A;  4TR0 A;  1FOV A;  3KP9 A;  1ZCP A;  4MCU A;  1FW1 A;  3QMX A;  5ECP B;  4MP4 A;  3FZ9 A;  4ECB A;  5F06 A;  2M46 A;  3ERG A;  4ECJ A;  2ES7 A;  1Y25 A;  4EE0 A;  1TU7 A;  2FHE A;  3VI7 A;  2K9F A;  5ID2 B;  1WP0 A;  1MD3 A;  4OO4 A;  1BYE A;  5CYY A;  1Z6N A;  3A3T A;  4OCE A;  3LJR A;  2JSZ A;  4TXO B;  3VPT A;  4WEY A;  3ME8 A;  3D21 A;  3I69 A;  5E4W A;  3KTB A;  3H8Q A;  2GZP A;  2V32 A;  4GLT A;  3RBT A;  4MF5 A;  1T00 A;  4LL4 B;  4PX1 A;  4MLY A;  1FAA A;  2GT5 A;  3GH9 A;  3GX0 A;  4AJ8 A;  3HA9 A;  2GGT A; 
#chains in the Genus database with same CATH topology
 4PQI A;  3L9U A;  3W8S A;  2J9H A;  5HFI A;  1TW9 A;  3GV1 A;  3FZ4 A;  2A4V A;  4KUN A;  4BIK A;  4G10 A;  3P90 A;  3ZFL A;  3DIE A;  1E6B A;  4MA9 A;  4NMU A;  2H75 A;  2H72 A;  3M9J A;  2KP1 A;  3W6G A;  1XVQ A;  2J23 A;  1OKT A;  1XWK A;  2XPE A;  4F2I A;  1OE7 A;  2PER A;  5A5K A;  4Z2U A;  2XC2 A;  4EL1 A;  3Q19 A;  2VD1 A;  3F4T A;  2LNT A;  6GSX A;  3I9V 2;  4BWS A;  2CAQ A;  2R37 A;  3SWL A;  3WGE A;  1OKD A;  1VF1 A;  2B7J A;  2VCV A;  4I2U A;  2VM2 A;  2OKA A;  3GKK A;  1GP1 A;  3QAV A;  1K0D A;  4L5L A;  1TRW A;  1WWJ A;  1JZO A;  3F63 A;  3KTL A;  1ERW A;  3BBY A;  3KXO A;  3D5J A;  3MWH A;  1EEM A;  2VCT A;  3EMX A;  3QD9 A;  3N9J A;  3E9J B;  3L9V A;  4MZC A;  2PMT A;  2YJ7 A;  4I6X A;  4IN0 A;  2WB9 A;  2B7K A;  3HJP A;  2B5X A;  4PUA A;  3WGD A;  2FNO A;  1V40 A;  2VAF A;  1XWA A;  2VCX A;  5DAK B;  1R7H A;  3DD3 A;  2N5A A;  4N0V A;  4RI7 A;  5KEJ A;  1T8E B;  4BWQ A;  4E8E A;  2YZU A;  3VK9 A;  4MJC A;  2LV3 A;  2YWO A;  3UMA A;  1GLQ A;  4XS4 B;  5IOX A;  4XRD A;  5ELG A;  1OC3 A;  4G2E A;  2JAC A;  1UA5 A;  1YF0 A;  1SL2 B;  4K5R A;  1TP9 A;  2JZT A;  3KP8 A;  3ZL5 A;  1F2E A;  2F9S A;  1GTB A;  3GST A;  4N30 A;  4IW9 A;  1X5C A;  5ABR A;  3CTG A;  5CP1 A;  1A8Y A;  4ZL8 A;  4WBJ A;  2CZ2 A;  4YKF A;  4NHZ A;  4TRX A;  2R5G A;  3VWX A;  3GHA A;  1YF1 A;  2EIQ A;  1S3A A;  4MF6 A;  4GTU A;  5CRE A;  2AV4 A;  5IIZ A;  2LRT A;  2N5B A;  1PMT A;  2NVL A;  2WDU A;  2MMN A;  2O87 A;  5KOW A;  4D73 A;  5GAP D;  2GVP A;  5G5F A;  1ZZY A;  4KF9 A;  1M2B A;  5DJL A;  5ECO B;  1OC9 B;  3DXB A;  4EXJ A;  2I9H A;  4NXI A;  2LKU A;  2EIO A;  3VWW A;  3MDK A;  4HUA A;  5H5R A;  4GSS A;  3ZML A;  3E3E A;  2R0P A;  3ZZX A;  3C1S A;  1O6J A;  3VLN A;  1A0F A;  1V2A A;  1I9D A;  2VLU A;  1OE8 A;  1G7O A;  3HHV A;  2HZE B;  13GS A;  4TN8 A;  1XIY A;  1ST9 A;  1BAY A;  3F6F A;  1AXD A;  4DEJ A;  2WS2 A;  2PUK C;  2QGV A;  2B5Y A;  4MZB A;  3EMP A;  3IK9 A;  4HJM A;  3UL3 A;  4Q5R A;  1FHE A;  4OWY A;  3DKS A;  4DVC A;  1C72 A;  1O8W A;  5HR0 A;  2Z9S A;  3RHC A;  3LXT A;  1PL1 A;  2G0F A;  5GAN D;  2B3S A;  3WT2 A;  2BJX A;  2XPD A;  5COH A;  3H79 A;  2JSY A;  2OE0 A;  3TRQ A;  2K6V A;  3UJ1 A;  1NM3 A;  4HQZ A;  1SK2 A;  2DSA A;  3CTF A;  5IO2 A;  4WR4 A;  2LRN A;  4FO5 A;  4IP1 A;  3CRU A;  2OAC A;  2VL3 A;  4EDY A;  2H6Z A;  2YV7 A;  1U3I A;  6GST A;  2DJ0 A;  1X5E A;  3P7X A;  1M9A A;  4IP6 A;  3LYP A;  4ILF A;  3G9B A;  3TRP A;  4FH8 A;  5DQS A;  22GS A;  1PKZ A;  4XTS A;  3QOU A;  1A2J A;  4JED A;  4IVF A;  4ZB6 A;  4NPB A;  2GT6 A;  1YEP A;  1M2D A;  4KCA A;  3IDV A;  2C0E A;  1GTU A;  5KN3 A;  2LNS A;  16GS A;  2K8V A;  5F05 A;  1K0M A;  3WD6 A;  1JZD A;  3EIN A;  3KGK A;  1SL1 B;  3NIV A;  3ERF A;  3LOR A;  3PPU A;  4ZBA A;  3ME7 A;  1WRY A;  4AGS A;  2IMF A;  2X8H A;  2HRK A;  5IPG A;  4KSO A;  4PQ1 A;  4GQC A;  5IO0 A;  1W89 A;  1T7P B;  3IOS A;  1EGR A;  2LS5 A;  2B1L A;  3TDG A;  1Z3E A;  3FR6 A;  3TKS C;  4GCI A;  4O5R A;  4ZXG A;  2GTU A;  4JRR A;  2ALB A;  1HQO A;  1GSS A;  5AGY A;  5IMD A;  1CQH A;  3M1G A;  2HRF A;  3CSH A;  1G0T A;  2HRA A;  2RUF A;  4ML1 A;  3FK8 A;  5AN1 A;  3GSS A;  5DCG A;  2RII A;  3TGZ A;  1V9W A;  1K0O A;  1TU8 A;  4AJ6 A;  3GYK A;  5LNK e;  2IN3 A;  5HR2 A;  3GKM A;  3EU4 A;  5JCG A;  4KA0 A;  2H66 A;  2HNL A;  2GQL A;  1WIK A;  3D4M A;  3P2A A;  8GSS A;  4EKZ A;  5FWG A;  3CXG A;  2CZ3 A;  3ZVJ D;  1HYU A;  2PN8 A;  2YNX A;  1GSD A;  5HQP A;  5B8B A;  3F8U A;  1MTC A;  3DWV A;  4POK A;  5AIV A;  4IQA A;  2LQQ A;  3OR5 A;  5G1K A;  1X0R A;  1R26 A;  4OMV A;  3HVX A;  4G0L A;  1MDI A;  1XW9 A;  2VLV A;  3TKR A;  3R3E A;  2VUP A;  2IFQ B;  4XS6 A;  2A2P A;  3UAP A;  2JZR A;  3F9U A;  2YP6 A;  2AHE A;  2E7P A;  1THX A;  3TJJ A;  4NWY A;  2R4V A;  5J41 A;  1Y6E A;  4PTS A;  1SKW B;  5F0G A;  2VD0 A;  2ZNM A;  3CSJ A;  2V1M A;  2NBS A;  2V6O A;  3LFL A;  4DSR A;  3C8E A;  1IYH A;  1GSF A;  4KGI A;  1SJ6 A;  3F6D A;  4MPF A;  3M9K A;  5DAL B;  5ELA A;  3BJ5 A;  2DMM A;  3VWV A;  5ID2 A;  1BQ7 A;  1PRX A;  2H19 A;  3GA4 A;  3L78 A;  2WFC A;  3IHQ A;  2KHP A;  1PQN A;  2H1G A;  1XFL A;  3GKX A;  4TXO A;  1ZL9 A;  4YQU A;  3GH6 A;  4N11 A;  4RQX A;  1VF2 A;  1UVZ A;  1SYR A;  5CRG A;  3V1W A;  3TJK A;  19GS A;  2GST A;  1ZGN A;  1X5D A;  2C1Y A;  1YKC A;  3FRC A;  3KIJ A;  3PIN A;  1HNA A;  1SK1 A;  1LU4 A;  4HU9 A;  4GWR A;  4N0Z A;  2YWN A;  1JHB A;  1Z9H A;  3RAZ A;  4E8H A;  3LEF A;  3O3T A;  1TDI A;  4I97 A;  2V2G A;  2XBI A;  3TKS A;  1ZYN A;  2C3Q A;  3C71 A;  1K0A A;  1XOA A;  3TUE A;  3LW9 A;  1V58 A;  1JFU A;  1SKS B;  5HFG A;  5IMV A;  3VUR A;  3C73 A;  3IPZ A;  3FZA A;  1T1V A;  4N10 A;  4V1A g;  4JE1 A;  1AQV A;  5G1L A;  1Z5Y E;  1B4Q A;  5F07 A;  1WOU A;  1XWC A;  3A2X A;  1X9S B;  5H5Q A;  3CMI A;  2QKE A;  4MJB A;  4K7N A;  3KCM A;  2VL9 A;  5HR1 A;  1DE1 A;  5J9B A;  4G9H A;  4GF0 A;  1PN0 A;  2OA7 A;  1KTE A;  1OC8 A;  2PWJ A;  5D9T A;  2EC4 A;  3UVT A;  4HOJ A;  2E2M A;  2LUS A;  9GSS A;  3FR3 A;  4CDO A;  2DKI A;  2I4A A;  1A2M A;  2DIY A;  2DJ1 A;  1NHY A;  4LMW A;  1TJD A;  4OD7 A;  2DIZ A;  2PVO C;  3IV4 A;  2R3X A;  1VF4 A;  2VL2 A;  4ID0 A;  4EIQ A;  1YY7 A;  4XCS A;  1YZX A;  2HRN A;  1ZOF A;  4MF7 A;  1JZR A;  2MMA A;  1XW6 A;  1Z7P A;  4ICY A;  4OFN A;  3DEX A;  2P0G A;  3O76 A;  1TTZ A;  4MZW A;  1QMV A;  1AQW A;  2I81 A;  3ZRD A;  1XWB A;  5DDL A;  2JL4 A;  1JLV A;  5DAK A;  4AF2 A;  1FB6 A;  2H76 A;  1PX6 A;  3WGX A;  1G7E A;  2R6K A;  2R0G A;  4XS4 A;  3GL5 A;  1M99 A;  2N5F A;  1R5A A;  3RPN A;  3K8N A;  1N8J A;  5A4U A;  2QSI A;  4K7I A;  3J7Y k;  4X1U A;  1J0F A;  3IHG A;  5DVB A;  3HJO A;  5CRH A;  1SU9 A;  17GS A;  3GTU B;  3IR4 A;  4PUR A;  1HNB A;  1OAZ A;  3N5O A;  3LG6 A;  1RQM A;  3F4R A;  4ZB8 A;  4F03 A;  2F8F A;  2O89 A;  3KD0 A;  3GUR A;  3IXR A;  3LQ7 A;  5IM9 A;  3EC3 A;  1GSU A;  2HYX A;  4PNF A;  4MK3 A;  2PBJ A;  1S3D A;  1AC1 A;  2HSM A;  4JR4 A;  2LST A;  1OC9 A;  2R2J A;  1M7T A;  1GUH A;  3CSI A;  4RI6 A;  4FQU A;  1SL0 B;  2WGR A;  3EWL A;  1HD2 A;  1YDK A;  2JU5 A;  2UZ8 A;  3FMW A;  3ZYW A;  2IMK A;  1THO A;  5HFK A;  5ECI B;  1YQ1 A;  3KJY A;  4NHW A;  1U3A A;  2VOC A;  1GSY A;  5JCU A;  1YKA A;  4HU7 A;  4TKY A;  2QA1 A;  3L9S A;  3EE2 A;  1BED A;  2LQO A;  2H71 A;  3ZIJ A;  1TRU A;  3DVX A;  4ISD A;  4IBP A;  2HZF A;  1V98 A;  1T4Y A;  4JR6 A;  3ZFB A;  2LJK A;  4MNN A;  5A4V A;  3GMF A;  3IK7 A;  4O32 A;  5B6N A;  2JAD A;  3GKN A;  1S3C A;  2X4A A;  2AYT A;  1XXU A;  4V2N A;  1DUG A;  2B5E A;  2YOI A;  4YAP A;  4TR1 B;  3TOT A;  4FYB A;  4OCF A;  4HZ2 A;  2GQM A;  1GRX A;  1GSQ A;  2I1U A;  3ZIV A;  4HI7 A;  1ILO A;  3GL3 A;  5CNW A;  1QUW A;  3ZVJ A;  4IJI A;  1FG4 A;  5ENU A;  5BMU A;  3IA1 A;  3IC8 A;  3HDC A;  2YCD A;  3MIX A;  2CVD A;  4Z2R A;  3GX8 A;  5IOW A;  5JWR B;  1SJZ A;  2MMZ A;  1N2A A;  4HSC X;  4I8B A;  2GZY A;  2VCQ A;  2GZZ A;  4O92 A;  1F9M A;  3QR6 A;  4L0W A;  3SBC A;  3TJG A;  2TRC P;  5D9X A;  4YKG A;  1ABA A;  1U88 A;  1AAZ A;  2FD3 A;  3GIX A;  4CY8 A;  1GNW A;  5C04 A;  2C3N A;  4L0U A;  3VFI A;  3D6I A;  4ULX A;  3QAW A;  2AAW A;  3HYP A;  4BPY A;  4LL1 B;  3ZRE A;  3Q18 A;  3HZ8 A;  1RW1 A;  2P31 A;  2LEG A;  1GUK A;  3H1N A;  2FWF A;  1EV4 A;  5DJM A;  3GNJ A;  4F0C A;  2ZCT A;  1A24 A;  2C0D A;  4IKH A;  1O73 A;  5LD0 A;  2C80 A;  10GS A;  3WYW A;  4NAX A;  1NHO A;  2K18 A;  3MSZ A;  1OVN A;  4H86 A;  4RUV A;  3FKF A;  3JCM L;  5KN0 A;  3APS A;  4XS1 A;  4GQF A;  4POB A;  2H70 A;  5J4U A;  4IJ3 A;  2O85 A;  4FYU A;  3IAS 2;  2YV9 A;  4KND A;  1XZO A;  4V2L A;  2FWH A;  3R2Q A;  3DML A;  1A23 A;  18GS A;  2O8V B;  2JZS A;  4KH7 A;  4O5U A;  5D8I A;  1YJ6 A;  2CVK A;  1PL2 A;  2FLS A;  1K0B A;  1XVW A;  4J57 E;  5A4W A;  4MPG A;  1RK4 A;  4Q5F A;  3E0U A;  3Q6O A;  4CY6 A;  3ZIT A;  3VI5 A;  2X99 A;  4EUY A;  2H30 A;  2LJR A;  3TB2 A;  1GWC A;  1R5P A;  4XRA A;  1DE2 A;  1QK8 A;  4V2M A;  4CHS A;  5GZZ B;  4EF0 A;  3EU3 A;  3HCZ A;  5ECN B;  1GSE A;  3TKQ A;  3ERW A;  1DSB A;  1G6W A;  1GUM A;  1B48 A;  3D22 A;  3QFA C;  4MH3 A;  5ECS A;  4TR3 A;  5C00 A;  2L6D A;  3P8W A;  2F8A A;  1H4O A;  4BL7 B;  3PGT A;  1M2A A;  3TJF A;  3TKS E;  3TJB A;  4MH2 A;  1XCC A;  1K0N A;  1TI3 A;  4Z2T A;  4F9Z A;  2NDO A;  4J2F A;  1Z7R A;  2CX3 A;  4HZ4 A;  3ZTL A;  5F8B A;  1NSW A;  2IFQ A;  5D9V A;  2H1A A;  5CO3 A;  1IYI A;  4KDU A;  2VL2 C;  4WF5 A;  2ON5 A;  2PU9 C;  2DJK A;  5ECH B;  4DSS B;  2REM A;  3LXZ A;  2GLR A;  3BCI A;  2V41 A;  5B7C A;  4ZIL A;  1EOG A;  2R0C A;  5GSS A;  1Z6M A;  3KM6 A;  4KB3 A;  2KLX A;  1FOH A;  4IGJ A;  1TRV A;  2LJA A;  4K2D A;  4NV5 A;  4IS0 A;  2FA4 A;  1R4W A;  2MBS A;  2X8G A;  2KUC A;  3U6V A;  1SEN A;  4JU5 A;  1H75 A;  4ZL7 A;  4ZL9 A;  5EL8 A;  4KSM A;  4BVY B;  4CW9 A;  4TXV A;  2XBQ A;  3KEB A;  2G2Q A;  1LBK A;  4X43 A;  4EVM A;  4EIP A;  2FUG 2;  2GDR A;  5IMA A;  5B8A A;  1JLW A;  4I5Q A;  1GTA A;  1ACV A;  5JWO B;  1PX7 A;  1BX9 A;  3KH9 A;  2MMO A;  2OAD A;  2FY6 A;  2DJ3 A;  3KZQ A;  4K0N A;  5GST A;  2X8C A;  4ACS A;  2VLT A;  2FWG A;  3GUS A;  2OJL A;  4TVE A;  3QCP A;  3O6T A;  2OBK A;  4I2T A;  5KOX A;  3C7M A;  5B6M A;  2C4J A;  3QPM A;  5IMZ A;  1W4V A;  1XOB A;  4KW6 A;  3G7Y A;  5J3R A;  3HXS A;  5H5S A;  2L4Q A;  1BG5 A;  2H8L A;  2YN1 A;  1K3L A;  4JBB A;  1ML6 A;  5G31 A;  2X49 A;  3VPQ A;  1ZYP A;  3ISO A;  4ECI A;  3CQF A;  4Q5Q A;  3LSZ A;  4USS A;  1V57 A;  1SYX A;  1BJX A;  4BVX B;  5EPF A;  2O7K A;  5LCZ A;  2DC5 A;  3ED3 A;  1A8L A;  3HJM A;  1SD9 A;  1TXX A;  4EO3 A;  2CVB A;  1UN2 A;  5KN1 A;  1AW9 A;  4QQ7 A;  3A2V A;  4YAV A;  4KDY A;  2RLI A;  3US3 A;  2M72 A;  2KOK A;  1SD8 A;  4K5S A;  4F82 A;  2NTO A;  3TOU A;  2C0G A;  1TK5 B;  1ON4 A;  1Q98 A;  3IRA A;  4ECC A;  3APQ A;  4O7H A;  2VIM A;  1PKW A;  3M3M A;  2X64 A;  1TRS A;  3ZLP A;  1E2Y A;  3QAG A;  1M0U A;  1VF3 A;  3WT1 A;  1EV9 A;  4EDZ A;  5IMF A;  2GS3 A;  1G6Y A;  5L71 A;  3CBU A;  2YWM A;  3GFK A;  3EVI A;  2H1D A;  2L5O A;  4YQM A;  5ECL B;  12GS A;  3QDN A;  1A0R P;  4K1F A;  4NV2 A;  1U87 A;  3HZ4 A;  1VGL A;  1QXH A;  3EUR A;  4IQ1 A;  2MYG A;  2IMI A;  1KEB A;  5ECR B;  2TRX A;  3UEM A;  4KX4 A;  4QL7 A;  2WCI A;  1GL8 A;  3FR9 A;  3GTU A;  4IEL A;  4P3Y B;  2D2Z A;  2CT6 A;  5ECK B;  2K8S A;  1SK0 A;  1WPI A;  4QL9 A;  1I5G A;  2CAI A;  5JWQ B;  1ERU A;  5G30 A;  1GUL A;  2C8U A;  1NW2 A;  1FB0 A;  1DBY A;  2I3Y A;  1M9B A;  1FVJ A;  1ZYQ B;  3RPP A;  2IL3 A;  2YPM A;  2AB6 A;  1GNE A;  2GQK A;  2H0H A;  2CQ9 A;  1SKR B;  2P5R A;  3F0I A;  2V6K A;  2WJU A;  5G2Z A;  2H6X A;  5AIX A;  2B6M A;  2HE3 A;  1O8X A;  2KP2 A;  4TOP A;  2CV4 A;  4POL A;  2H01 A;  2HSH A;  4DSQ A;  2H1B A;  4K7O A;  2HLS A;  3UIW A;  2VCW A;  3U5R E;  2VO4 A;  14GS A;  1X9W B;  1PGT A;  4TW5 A;  4JZQ A;  4WR5 A;  1F3A A;  3TRX A;  3CRT A;  1EWX A;  3A2W A;  4MDC A;  4K2X A;  4MAB A;  2H6Y A;  4PXO A;  5ECM B;  4KDX A;  4F0B A;  1M3J A;  1MDK A;  6GSS A;  2A2R A;  2B1K A;  3F4S A;  2OBI A;  4PUF C;  1HNC A;  4WF4 A;  4Z7X A;  4TR1 A;  7GSS A;  2RUE A;  3DRN A;  1F3B A;  1FVK A;  2OE1 A;  3DVW A;  2FWE A;  2HZE A;  4G19 A;  4X4J A;  3AY8 A;  4RQR A;  5D73 A;  1O7U A;  1QFN A;  2FCH A;  2DBC A;  2H0I A;  2YZH A;  2HXK A;  5FT3 A;  3EYT A;  2PPT A;  1XW5 A;  3IAM 2;  1YEX A;  4KE3 A;  1MDJ A;  1WMJ A;  4XHM A;  2YWI A;  5IQY A;  4HQS A;  3D4T A;  4ZIJ A;  4ZBB A;  3PR8 A;  4POM A;  4XIH A;  4GST A;  3FYG A;  2NPB A;  2LRC A;  1B9Y C;  4FIW A;  2PGT A;  1TKD B;  4ZB9 A;  4MMM A;  1UC7 A;  4FYC A;  1LJR A;  3FW2 A;  2QC7 A;  4MJE A;  4OFM A;  20GS A;  3MNG A;  1ERV A;  1URM A;  3A5I A;  1FO5 A;  1S3R A;  2E0Q A;  3LGC A;  4GXZ A;  3C1R A;  4LMV A;  3UOM A;  1AUC A;  4TR4 A;  4K9Z A;  2EIR A;  4AJ7 A;  5E59 A;  3UBL A;  1K0C A;  3M0F A;  4D73 B;  6GSU A;  2MBT A;  2DML A;  5J5N A;  1J08 A;  2L5L A;  4HS1 A;  1A2L A;  4OFT A;  4PNG A;  4HDE A;  4K0G A;  1T4Z A;  1M3I A;  2IPA A;  1EZK A;  1TI1 A;  2IIY A;  4ZBD A;  4BA7 A;  2L57 A;  1ZYE A;  2BMX A;  3A5W A;  1T3B A;  4OO5 A;  4L5O A;  4V1A p;  4IHU A;  2M80 A;  5HR3 A;  3FEU A;  3FY7 A;  1XPV A;  3IC4 A;  1TK8 B;  1B9X C;  2YAN A;  2IME A;  2PVQ A;  5INY A;  3F3Q A;  2A2S A;  1PD2 1;  3ZMK A;  3FHK A;  4G0K A;  5DQY A;  2F51 A;  3HD5 A;  3MAK A;  3DYR A;  4KAE A;  4PGT A;  2HI7 A;  1JZW A;  1ERT A;  2FGX A;  1XBS A;  1EP7 A;  4KCE A;  5EVO A;  3W8J A;  1B8X A;  2FA8 A;  1KBN A;  2XHF A;  2WUL A;  2IJY A;  1GLP A;  2IMD A;  3Q74 A;  4WKW A;  3S9F A;  1QGV A;  2C3T A;  1PA3 A;  4YQV A;  4BL7 A;  1O85 A;  4A5P A;  2WRT A;  3LYK A;  1AQX A;  4K8M A;  4GRF A;  2LTK A;  5ECQ B;  3VWU A;  2WZ9 A;  3BOA A;  3NOF A;  1PN9 A;  6GSY A;  3GN3 A;  11GS A;  2AUV A;  1WE0 A;  4X0X A;  2H0G A;  4WBR D;  1WJK A;  1B4P A;  2DLX A;  3L4N A;  4DSS A;  1EEJ A;  1VRS D;  3M8N A;  1K3Y A;  3J7Y b;  3IBH A;  5G5E A;  2DJJ A;  3TKP A;  3MYD A;  2HT9 A;  4G0I A;  1F6M C;  1F37 A;  2RM5 A;  1OYJ A;  3IE3 A;  2GSS A;  2H73 A;  3LWA A;  2VCZ A;  6GSW A;  2QA2 A;  3I43 A;  2DJ2 A;  3H4K A;  4MJA A;  3HY2 A;  2MZC A;  1MEK A;  2ZUP A;  5DBQ A;  3UAR A;  4WET A;  1GTI A;  1EOH A;  3FZ5 A;  1EGO A;  5J9C A;  1XWG A;  2L59 A;  4HJ2 A;  2YJH A;  3PH9 A;  1TOF A;  1PFO A;  1AIU A;  2P5Q A;  1X9M B;  4EC0 A;  2F3M A;  4BVY A;  3DGQ A;  5IPH A;  1KNG A;  5IMC A;  1PSQ A;  1CQG A;  3G7I A;  2GSQ A;  2HFD A;  2BTO T;  5CAX A;  5AIS A;  4LLR A;  4O5Q A;  5DAL A;  3APO A;  5CRD A;  2RM6 A;  3I6A A;  3RDW A;  2HSY A;  2C0F A;  2OE3 A;  3TCO A;  1J9B A;  2CA8 A;  2H74 A;  1U6T A;  5EY6 A;  3UVH A;  4YH2 A;  2TIR A;  2VM1 A;  3BCK A;  3G7J A;  3NZN A;  2L6C A;  3KH7 A;  5CRW A;  3KMN A;  5FHI A;  1Q4J A;  3CYN A;  4LA1 A;  1QQ2 A;  4HEA 2;  3L0H A;  5D93 A;  5JCW A;  4WXT A;  1GH2 A;  5D9W A;  3RHB A;  4Q5N A;  2GSR A;  3BD2 A;  3D0Z A;  3KMO A;  2ON7 A;  4PQH A;  2AJQ B;  4GSN A;  4BVX A;  4ML6 A;  3UBK A;  1EP8 A;  4K6X A;  3HVS A;  1TK0 B;  6GSV A;  1ZMA A;  2E2G A;  1SJI A;  1K3O A;  1USB A;  5KN2 A;  3H93 A;  4J56 E;  3F3R A;  1O81 A;  3HVV A;  2L4C A;  1MD4 A;  5D96 A;  3GRX A;  5DCH A;  4L8E A;  3QFB C;  2CX4 A;  3HKR A;  2IWT A;  4TR0 A;  1FOV A;  3KP9 A;  1ZCP A;  1XG8 A;  4MCU A;  1FW1 A;  3QMX A;  5ECP B;  3HVN A;  4MP4 A;  3FZ9 A;  4ECB A;  5F06 A;  2M46 A;  3ERG A;  4ECJ A;  2ES7 A;  1Y25 A;  4EE0 A;  5BRT A;  1TU7 A;  2FHE A;  3VI7 A;  3EPT A;  2K9F A;  5ID2 B;  2A4H A;  1WP0 A;  1MD3 A;  4OO4 A;  1BYE A;  5CYY A;  1Z6N A;  3A3T A;  4OCE A;  3LJR A;  2JSZ A;  2DKH A;  4TXO B;  3VPT A;  4WEY A;  3ME8 A;  3D21 A;  3I69 A;  5E4W A;  3KTB A;  3H8Q A;  2GZP A;  2V32 A;  4GLT A;  3RBT A;  4MF5 A;  1T00 A;  4LL4 B;  4PX1 A;  4MLY A;  1FAA A;  2GT5 A;  3GH9 A;  3GX0 A;  4AJ8 A;  3HA9 A;  2GGT A; 
#chains in the Genus database with same CATH homology
 4PQI A;  3L9U A;  3W8S A;  2J9H A;  5HFI A;  1TW9 A;  3GV1 A;  3FZ4 A;  2A4V A;  4KUN A;  4G10 A;  3P90 A;  3ZFL A;  3DIE A;  1E6B A;  4MA9 A;  4NMU A;  2H75 A;  2H72 A;  3M9J A;  2KP1 A;  3W6G A;  1XVQ A;  2J23 A;  1OKT A;  1XWK A;  2XPE A;  4F2I A;  1OE7 A;  2PER A;  5A5K A;  4Z2U A;  2XC2 A;  4EL1 A;  3Q19 A;  2VD1 A;  3F4T A;  2LNT A;  6GSX A;  3I9V 2;  4BWS A;  2CAQ A;  2R37 A;  3SWL A;  3WGE A;  1OKD A;  1VF1 A;  2B7J A;  2VCV A;  4I2U A;  2VM2 A;  2OKA A;  3GKK A;  1GP1 A;  3QAV A;  1K0D A;  4L5L A;  1TRW A;  1WWJ A;  1JZO A;  3F63 A;  3KTL A;  1ERW A;  3BBY A;  3KXO A;  3D5J A;  3MWH A;  1EEM A;  2VCT A;  3EMX A;  3QD9 A;  3N9J A;  3E9J B;  3L9V A;  4MZC A;  2PMT A;  2YJ7 A;  4I6X A;  4IN0 A;  2WB9 A;  2B7K A;  3HJP A;  2B5X A;  4PUA A;  3WGD A;  2FNO A;  1V40 A;  2VAF A;  1XWA A;  2VCX A;  5DAK B;  1R7H A;  3DD3 A;  2N5A A;  4N0V A;  4RI7 A;  5KEJ A;  1T8E B;  4BWQ A;  4E8E A;  2YZU A;  3VK9 A;  4MJC A;  2LV3 A;  2YWO A;  3UMA A;  1GLQ A;  4XS4 B;  5IOX A;  4XRD A;  5ELG A;  1OC3 A;  4G2E A;  2JAC A;  1UA5 A;  1YF0 A;  1SL2 B;  4K5R A;  1TP9 A;  2JZT A;  3KP8 A;  3ZL5 A;  1F2E A;  2F9S A;  1GTB A;  3GST A;  4N30 A;  4IW9 A;  1X5C A;  5ABR A;  3CTG A;  5CP1 A;  1A8Y A;  4ZL8 A;  4WBJ A;  2CZ2 A;  4YKF A;  4NHZ A;  4TRX A;  2R5G A;  3VWX A;  3GHA A;  1YF1 A;  2EIQ A;  1S3A A;  4MF6 A;  4GTU A;  5CRE A;  2AV4 A;  5IIZ A;  2LRT A;  2N5B A;  1PMT A;  2NVL A;  2WDU A;  2MMN A;  2O87 A;  5KOW A;  4D73 A;  5GAP D;  2GVP A;  5G5F A;  1ZZY A;  4KF9 A;  1M2B A;  5DJL A;  5ECO B;  1OC9 B;  3DXB A;  4EXJ A;  2I9H A;  4NXI A;  2LKU A;  2EIO A;  3VWW A;  3MDK A;  4HUA A;  5H5R A;  4GSS A;  3ZML A;  3E3E A;  2R0P A;  3ZZX A;  3C1S A;  1O6J A;  3VLN A;  1A0F A;  1V2A A;  1I9D A;  2VLU A;  1OE8 A;  1G7O A;  3HHV A;  2HZE B;  13GS A;  4TN8 A;  1XIY A;  1ST9 A;  1BAY A;  3F6F A;  1AXD A;  4DEJ A;  2WS2 A;  2PUK C;  2QGV A;  2B5Y A;  4MZB A;  3EMP A;  3IK9 A;  4HJM A;  3UL3 A;  4Q5R A;  1FHE A;  4OWY A;  3DKS A;  4DVC A;  1C72 A;  1O8W A;  5HR0 A;  2Z9S A;  3RHC A;  3LXT A;  1PL1 A;  2G0F A;  5GAN D;  2B3S A;  3WT2 A;  2BJX A;  2XPD A;  5COH A;  3H79 A;  2JSY A;  2OE0 A;  3TRQ A;  2K6V A;  3UJ1 A;  1NM3 A;  4HQZ A;  1SK2 A;  2DSA A;  3CTF A;  5IO2 A;  4WR4 A;  2LRN A;  4FO5 A;  4IP1 A;  3CRU A;  2OAC A;  2VL3 A;  4EDY A;  2H6Z A;  2YV7 A;  1U3I A;  6GST A;  2DJ0 A;  1X5E A;  3P7X A;  1M9A A;  4IP6 A;  3LYP A;  4ILF A;  3G9B A;  3TRP A;  4FH8 A;  5DQS A;  22GS A;  1PKZ A;  4XTS A;  3QOU A;  1A2J A;  4JED A;  4IVF A;  4ZB6 A;  4NPB A;  2GT6 A;  1YEP A;  1M2D A;  4KCA A;  3IDV A;  2C0E A;  1GTU A;  5KN3 A;  2LNS A;  16GS A;  2K8V A;  5F05 A;  1K0M A;  3WD6 A;  1JZD A;  3EIN A;  3KGK A;  1SL1 B;  3NIV A;  3ERF A;  3LOR A;  3PPU A;  4ZBA A;  3ME7 A;  1WRY A;  4AGS A;  2IMF A;  2X8H A;  2HRK A;  5IPG A;  4KSO A;  4PQ1 A;  4GQC A;  5IO0 A;  1W89 A;  1T7P B;  3IOS A;  1EGR A;  2LS5 A;  2B1L A;  3TDG A;  1Z3E A;  3FR6 A;  3TKS C;  4GCI A;  4O5R A;  4ZXG A;  2GTU A;  4JRR A;  2ALB A;  1HQO A;  1GSS A;  5AGY A;  5IMD A;  1CQH A;  3M1G A;  2HRF A;  3CSH A;  1G0T A;  2HRA A;  2RUF A;  4ML1 A;  3FK8 A;  5AN1 A;  3GSS A;  5DCG A;  2RII A;  3TGZ A;  1V9W A;  1K0O A;  1TU8 A;  4AJ6 A;  3GYK A;  5LNK e;  2IN3 A;  5HR2 A;  3GKM A;  3EU4 A;  5JCG A;  4KA0 A;  2H66 A;  2HNL A;  2GQL A;  1WIK A;  3D4M A;  3P2A A;  8GSS A;  4EKZ A;  5FWG A;  3CXG A;  2CZ3 A;  3ZVJ D;  1HYU A;  2PN8 A;  2YNX A;  1GSD A;  5HQP A;  5B8B A;  3F8U A;  1MTC A;  3DWV A;  4POK A;  5AIV A;  4IQA A;  2LQQ A;  3OR5 A;  5G1K A;  1X0R A;  1R26 A;  4OMV A;  3HVX A;  4G0L A;  1MDI A;  1XW9 A;  2VLV A;  3TKR A;  3R3E A;  2VUP A;  2IFQ B;  4XS6 A;  2A2P A;  3UAP A;  2JZR A;  3F9U A;  2YP6 A;  2AHE A;  2E7P A;  1THX A;  3TJJ A;  4NWY A;  2R4V A;  5J41 A;  1Y6E A;  4PTS A;  1SKW B;  5F0G A;  2VD0 A;  2ZNM A;  3CSJ A;  2V1M A;  2NBS A;  2V6O A;  3LFL A;  4DSR A;  3C8E A;  1IYH A;  1GSF A;  4KGI A;  1SJ6 A;  3F6D A;  4MPF A;  3M9K A;  5DAL B;  5ELA A;  3BJ5 A;  2DMM A;  3VWV A;  5ID2 A;  1BQ7 A;  1PRX A;  2H19 A;  3GA4 A;  3L78 A;  2WFC A;  3IHQ A;  2KHP A;  1PQN A;  2H1G A;  1XFL A;  3GKX A;  4TXO A;  1ZL9 A;  4YQU A;  3GH6 A;  4N11 A;  4RQX A;  1VF2 A;  1UVZ A;  1SYR A;  5CRG A;  3V1W A;  3TJK A;  19GS A;  2GST A;  1ZGN A;  1X5D A;  2C1Y A;  1YKC A;  3FRC A;  3KIJ A;  3PIN A;  1HNA A;  1SK1 A;  1LU4 A;  4HU9 A;  4GWR A;  4N0Z A;  2YWN A;  1JHB A;  1Z9H A;  3RAZ A;  4E8H A;  3LEF A;  3O3T A;  1TDI A;  4I97 A;  2V2G A;  2XBI A;  3TKS A;  1ZYN A;  2C3Q A;  3C71 A;  1K0A A;  1XOA A;  3TUE A;  3LW9 A;  1V58 A;  1JFU A;  1SKS B;  5HFG A;  5IMV A;  3VUR A;  3C73 A;  3IPZ A;  3FZA A;  1T1V A;  4N10 A;  4V1A g;  4JE1 A;  1AQV A;  5G1L A;  1Z5Y E;  1B4Q A;  5F07 A;  1WOU A;  1XWC A;  3A2X A;  1X9S B;  5H5Q A;  3CMI A;  2QKE A;  4MJB A;  4K7N A;  3KCM A;  2VL9 A;  5HR1 A;  1DE1 A;  5J9B A;  4G9H A;  4GF0 A;  1PN0 A;  2OA7 A;  1KTE A;  1OC8 A;  2PWJ A;  5D9T A;  2EC4 A;  3UVT A;  4HOJ A;  2E2M A;  2LUS A;  9GSS A;  3FR3 A;  4CDO A;  2DKI A;  2I4A A;  1A2M A;  2DIY A;  2DJ1 A;  1NHY A;  4LMW A;  1TJD A;  4OD7 A;  2DIZ A;  2PVO C;  3IV4 A;  2R3X A;  1VF4 A;  2VL2 A;  4ID0 A;  4EIQ A;  1YY7 A;  4XCS A;  1YZX A;  2HRN A;  1ZOF A;  4MF7 A;  1JZR A;  2MMA A;  1XW6 A;  1Z7P A;  4ICY A;  4OFN A;  3DEX A;  2P0G A;  3O76 A;  1TTZ A;  4MZW A;  1QMV A;  1AQW A;  2I81 A;  3ZRD A;  1XWB A;  5DDL A;  2JL4 A;  1JLV A;  5DAK A;  4AF2 A;  1FB6 A;  2H76 A;  1PX6 A;  3WGX A;  1G7E A;  2R6K A;  2R0G A;  4XS4 A;  3GL5 A;  1M99 A;  2N5F A;  1R5A A;  3RPN A;  3K8N A;  1N8J A;  5A4U A;  2QSI A;  4K7I A;  3J7Y k;  4X1U A;  1J0F A;  3IHG A;  5DVB A;  3HJO A;  5CRH A;  1SU9 A;  17GS A;  3GTU B;  3IR4 A;  4PUR A;  1HNB A;  1OAZ A;  3N5O A;  3LG6 A;  1RQM A;  3F4R A;  4ZB8 A;  4F03 A;  2F8F A;  2O89 A;  3KD0 A;  3GUR A;  3IXR A;  3LQ7 A;  5IM9 A;  3EC3 A;  1GSU A;  2HYX A;  4PNF A;  4MK3 A;  2PBJ A;  1S3D A;  1AC1 A;  2HSM A;  4JR4 A;  2LST A;  1OC9 A;  2R2J A;  1M7T A;  1GUH A;  3CSI A;  4RI6 A;  4FQU A;  1SL0 B;  2WGR A;  3EWL A;  1HD2 A;  1YDK A;  2JU5 A;  2UZ8 A;  3FMW A;  3ZYW A;  2IMK A;  1THO A;  5HFK A;  5ECI B;  1YQ1 A;  3KJY A;  4NHW A;  1U3A A;  2VOC A;  1GSY A;  5JCU A;  1YKA A;  4HU7 A;  4TKY A;  2QA1 A;  3L9S A;  3EE2 A;  1BED A;  2LQO A;  2H71 A;  3ZIJ A;  1TRU A;  3DVX A;  4ISD A;  4IBP A;  2HZF A;  1V98 A;  1T4Y A;  4JR6 A;  3ZFB A;  2LJK A;  4MNN A;  5A4V A;  3GMF A;  3IK7 A;  4O32 A;  5B6N A;  2JAD A;  3GKN A;  1S3C A;  2X4A A;  2AYT A;  1XXU A;  4V2N A;  1DUG A;  2B5E A;  2YOI A;  4YAP A;  4TR1 B;  3TOT A;  4FYB A;  4OCF A;  4HZ2 A;  2GQM A;  1GRX A;  1GSQ A;  2I1U A;  3ZIV A;  4HI7 A;  1ILO A;  3GL3 A;  5CNW A;  1QUW A;  3ZVJ A;  4IJI A;  1FG4 A;  5ENU A;  5BMU A;  3IA1 A;  3IC8 A;  3HDC A;  2YCD A;  3MIX A;  2CVD A;  4Z2R A;  3GX8 A;  5IOW A;  5JWR B;  1SJZ A;  2MMZ A;  1N2A A;  4I8B A;  2GZY A;  2VCQ A;  2GZZ A;  4O92 A;  1F9M A;  3QR6 A;  4L0W A;  3SBC A;  3TJG A;  2TRC P;  5D9X A;  4YKG A;  1ABA A;  1U88 A;  1AAZ A;  2FD3 A;  3GIX A;  4CY8 A;  1GNW A;  5C04 A;  2C3N A;  4L0U A;  3VFI A;  3D6I A;  4ULX A;  3QAW A;  2AAW A;  3HYP A;  4BPY A;  4LL1 B;  3ZRE A;  3Q18 A;  3HZ8 A;  1RW1 A;  2P31 A;  2LEG A;  1GUK A;  3H1N A;  2FWF A;  1EV4 A;  5DJM A;  3GNJ A;  4F0C A;  2ZCT A;  1A24 A;  2C0D A;  4IKH A;  1O73 A;  5LD0 A;  2C80 A;  10GS A;  3WYW A;  4NAX A;  1NHO A;  2K18 A;  3MSZ A;  1OVN A;  4H86 A;  4RUV A;  3FKF A;  3JCM L;  5KN0 A;  3APS A;  4XS1 A;  4GQF A;  4POB A;  2H70 A;  5J4U A;  4IJ3 A;  2O85 A;  4FYU A;  3IAS 2;  2YV9 A;  4KND A;  1XZO A;  4V2L A;  2FWH A;  3R2Q A;  3DML A;  1A23 A;  18GS A;  2O8V B;  2JZS A;  4KH7 A;  4O5U A;  5D8I A;  1YJ6 A;  2CVK A;  1PL2 A;  2FLS A;  1K0B A;  1XVW A;  4J57 E;  5A4W A;  4MPG A;  1RK4 A;  4Q5F A;  3E0U A;  3Q6O A;  4CY6 A;  3ZIT A;  3VI5 A;  2X99 A;  4EUY A;  2H30 A;  2LJR A;  3TB2 A;  1GWC A;  1R5P A;  4XRA A;  1DE2 A;  1QK8 A;  4V2M A;  4CHS A;  5GZZ B;  4EF0 A;  3EU3 A;  3HCZ A;  5ECN B;  1GSE A;  3TKQ A;  3ERW A;  1DSB A;  1G6W A;  1GUM A;  1B48 A;  3D22 A;  3QFA C;  4MH3 A;  5ECS A;  4TR3 A;  5C00 A;  2L6D A;  3P8W A;  2F8A A;  1H4O A;  4BL7 B;  3PGT A;  1M2A A;  3TJF A;  3TKS E;  3TJB A;  4MH2 A;  1XCC A;  1K0N A;  1TI3 A;  4Z2T A;  4F9Z A;  2NDO A;  4J2F A;  1Z7R A;  2CX3 A;  4HZ4 A;  3ZTL A;  5F8B A;  1NSW A;  2IFQ A;  5D9V A;  2H1A A;  5CO3 A;  1IYI A;  4KDU A;  2VL2 C;  4WF5 A;  2ON5 A;  2PU9 C;  2DJK A;  5ECH B;  4DSS B;  2REM A;  3LXZ A;  2GLR A;  3BCI A;  2V41 A;  5B7C A;  4ZIL A;  1EOG A;  2R0C A;  5GSS A;  1Z6M A;  3KM6 A;  4KB3 A;  2KLX A;  1FOH A;  4IGJ A;  1TRV A;  2LJA A;  4K2D A;  4NV5 A;  4IS0 A;  2FA4 A;  1R4W A;  2MBS A;  2X8G A;  2KUC A;  3U6V A;  1SEN A;  4JU5 A;  1H75 A;  4ZL7 A;  4ZL9 A;  5EL8 A;  4KSM A;  4BVY B;  4CW9 A;  4TXV A;  2XBQ A;  3KEB A;  2G2Q A;  1LBK A;  4X43 A;  4EVM A;  4EIP A;  2FUG 2;  2GDR A;  5IMA A;  5B8A A;  1JLW A;  4I5Q A;  1GTA A;  1ACV A;  5JWO B;  1PX7 A;  1BX9 A;  3KH9 A;  2MMO A;  2OAD A;  2FY6 A;  2DJ3 A;  3KZQ A;  4K0N A;  5GST A;  2X8C A;  4ACS A;  2VLT A;  2FWG A;  3GUS A;  2OJL A;  4TVE A;  3QCP A;  3O6T A;  2OBK A;  4I2T A;  5KOX A;  3C7M A;  5B6M A;  2C4J A;  3QPM A;  5IMZ A;  1W4V A;  1XOB A;  4KW6 A;  3G7Y A;  5J3R A;  3HXS A;  5H5S A;  2L4Q A;  1BG5 A;  2H8L A;  2YN1 A;  1K3L A;  4JBB A;  1ML6 A;  5G31 A;  2X49 A;  3VPQ A;  1ZYP A;  3ISO A;  4ECI A;  4Q5Q A;  3LSZ A;  4USS A;  1V57 A;  1SYX A;  1BJX A;  4BVX B;  5EPF A;  2O7K A;  5LCZ A;  2DC5 A;  3ED3 A;  1A8L A;  3HJM A;  1SD9 A;  1TXX A;  4EO3 A;  2CVB A;  1UN2 A;  5KN1 A;  1AW9 A;  4QQ7 A;  3A2V A;  4YAV A;  4KDY A;  2RLI A;  3US3 A;  2M72 A;  2KOK A;  1SD8 A;  4K5S A;  4F82 A;  2NTO A;  3TOU A;  2C0G A;  1TK5 B;  1ON4 A;  1Q98 A;  3IRA A;  4ECC A;  3APQ A;  4O7H A;  2VIM A;  1PKW A;  3M3M A;  2X64 A;  1TRS A;  3ZLP A;  1E2Y A;  3QAG A;  1M0U A;  1VF3 A;  3WT1 A;  1EV9 A;  4EDZ A;  5IMF A;  2GS3 A;  1G6Y A;  5L71 A;  3CBU A;  2YWM A;  3GFK A;  3EVI A;  2H1D A;  2L5O A;  4YQM A;  5ECL B;  12GS A;  3QDN A;  1A0R P;  4K1F A;  4NV2 A;  1U87 A;  3HZ4 A;  1VGL A;  1QXH A;  3EUR A;  4IQ1 A;  2MYG A;  2IMI A;  1KEB A;  5ECR B;  2TRX A;  3UEM A;  4KX4 A;  4QL7 A;  2WCI A;  1GL8 A;  3FR9 A;  3GTU A;  4IEL A;  4P3Y B;  2D2Z A;  2CT6 A;  5ECK B;  2K8S A;  1SK0 A;  1WPI A;  4QL9 A;  1I5G A;  2CAI A;  5JWQ B;  1ERU A;  5G30 A;  1GUL A;  2C8U A;  1NW2 A;  1FB0 A;  1DBY A;  2I3Y A;  1M9B A;  1FVJ A;  1ZYQ B;  3RPP A;  2IL3 A;  2YPM A;  2AB6 A;  1GNE A;  2GQK A;  2H0H A;  2CQ9 A;  1SKR B;  2P5R A;  3F0I A;  2V6K A;  2WJU A;  5G2Z A;  2H6X A;  5AIX A;  2B6M A;  2HE3 A;  1O8X A;  2KP2 A;  4TOP A;  2CV4 A;  4POL A;  2H01 A;  2HSH A;  4DSQ A;  2H1B A;  4K7O A;  2HLS A;  3UIW A;  2VCW A;  3U5R E;  2VO4 A;  14GS A;  1X9W B;  1PGT A;  4TW5 A;  4JZQ A;  4WR5 A;  1F3A A;  3TRX A;  3CRT A;  1EWX A;  3A2W A;  4MDC A;  4K2X A;  4MAB A;  2H6Y A;  4PXO A;  5ECM B;  4KDX A;  4F0B A;  1MDK A;  6GSS A;  2A2R A;  2B1K A;  3F4S A;  2OBI A;  4PUF C;  1HNC A;  4WF4 A;  4Z7X A;  4TR1 A;  7GSS A;  2RUE A;  3DRN A;  1F3B A;  1FVK A;  2OE1 A;  3DVW A;  2FWE A;  2HZE A;  4G19 A;  4X4J A;  3AY8 A;  4RQR A;  5D73 A;  1O7U A;  1QFN A;  2FCH A;  2DBC A;  2H0I A;  2YZH A;  2HXK A;  5FT3 A;  3EYT A;  2PPT A;  1XW5 A;  3IAM 2;  1YEX A;  4KE3 A;  1MDJ A;  1WMJ A;  4XHM A;  2YWI A;  5IQY A;  4HQS A;  3D4T A;  4ZIJ A;  4ZBB A;  3PR8 A;  4POM A;  4XIH A;  4GST A;  3FYG A;  2NPB A;  2LRC A;  1B9Y C;  4FIW A;  2PGT A;  1TKD B;  4ZB9 A;  4MMM A;  1UC7 A;  4FYC A;  1LJR A;  3FW2 A;  2QC7 A;  4MJE A;  4OFM A;  20GS A;  3MNG A;  1ERV A;  1URM A;  3A5I A;  1FO5 A;  2E0Q A;  3LGC A;  4GXZ A;  3C1R A;  4LMV A;  3UOM A;  1AUC A;  4TR4 A;  4K9Z A;  2EIR A;  4AJ7 A;  5E59 A;  3UBL A;  1K0C A;  3M0F A;  4D73 B;  6GSU A;  2MBT A;  2DML A;  5J5N A;  1J08 A;  2L5L A;  4HS1 A;  1A2L A;  4OFT A;  4PNG A;  4HDE A;  4K0G A;  1T4Z A;  2IPA A;  1EZK A;  1TI1 A;  2IIY A;  4ZBD A;  4BA7 A;  2L57 A;  1ZYE A;  2BMX A;  3A5W A;  1T3B A;  4OO5 A;  4L5O A;  4V1A p;  4IHU A;  2M80 A;  5HR3 A;  3FEU A;  3FY7 A;  1XPV A;  3IC4 A;  1TK8 B;  1B9X C;  2YAN A;  2IME A;  2PVQ A;  5INY A;  3F3Q A;  2A2S A;  1PD2 1;  3ZMK A;  3FHK A;  4G0K A;  5DQY A;  2F51 A;  3HD5 A;  3MAK A;  3DYR A;  4KAE A;  4PGT A;  2HI7 A;  1JZW A;  1ERT A;  2FGX A;  1XBS A;  1EP7 A;  4KCE A;  5EVO A;  3W8J A;  1B8X A;  2FA8 A;  1KBN A;  2XHF A;  2WUL A;  2IJY A;  1GLP A;  2IMD A;  3Q74 A;  4WKW A;  3S9F A;  1QGV A;  2C3T A;  1PA3 A;  4YQV A;  4BL7 A;  1O85 A;  4A5P A;  2WRT A;  3LYK A;  1AQX A;  4K8M A;  4GRF A;  2LTK A;  5ECQ B;  3VWU A;  2WZ9 A;  3BOA A;  3NOF A;  1PN9 A;  6GSY A;  3GN3 A;  11GS A;  2AUV A;  1WE0 A;  4X0X A;  2H0G A;  4WBR D;  1WJK A;  1B4P A;  2DLX A;  3L4N A;  4DSS A;  1EEJ A;  1VRS D;  3M8N A;  1K3Y A;  3J7Y b;  3IBH A;  5G5E A;  2DJJ A;  3TKP A;  3MYD A;  2HT9 A;  4G0I A;  1F6M C;  1F37 A;  2RM5 A;  1OYJ A;  3IE3 A;  2GSS A;  2H73 A;  3LWA A;  2VCZ A;  6GSW A;  2QA2 A;  3I43 A;  2DJ2 A;  3H4K A;  4MJA A;  3HY2 A;  2MZC A;  1MEK A;  2ZUP A;  5DBQ A;  3UAR A;  4WET A;  1GTI A;  1EOH A;  3FZ5 A;  1EGO A;  5J9C A;  1XWG A;  2L59 A;  4HJ2 A;  2YJH A;  3PH9 A;  1TOF A;  1AIU A;  2P5Q A;  1X9M B;  4EC0 A;  2F3M A;  4BVY A;  3DGQ A;  5IPH A;  1KNG A;  5IMC A;  1PSQ A;  1CQG A;  3G7I A;  2GSQ A;  2HFD A;  2BTO T;  5CAX A;  5AIS A;  4LLR A;  4O5Q A;  5DAL A;  3APO A;  5CRD A;  2RM6 A;  3I6A A;  3RDW A;  2HSY A;  2C0F A;  2OE3 A;  3TCO A;  1J9B A;  2CA8 A;  2H74 A;  1U6T A;  5EY6 A;  3UVH A;  4YH2 A;  2TIR A;  2VM1 A;  3BCK A;  3G7J A;  3NZN A;  2L6C A;  3KH7 A;  5CRW A;  3KMN A;  5FHI A;  1Q4J A;  3CYN A;  4LA1 A;  1QQ2 A;  4HEA 2;  3L0H A;  5D93 A;  5JCW A;  4WXT A;  1GH2 A;  5D9W A;  3RHB A;  4Q5N A;  2GSR A;  3BD2 A;  3D0Z A;  3KMO A;  2ON7 A;  4PQH A;  2AJQ B;  4GSN A;  4BVX A;  4ML6 A;  3UBK A;  1EP8 A;  4K6X A;  3HVS A;  1TK0 B;  6GSV A;  1ZMA A;  2E2G A;  1SJI A;  1K3O A;  1USB A;  5KN2 A;  3H93 A;  4J56 E;  3F3R A;  1O81 A;  3HVV A;  2L4C A;  1MD4 A;  5D96 A;  3GRX A;  5DCH A;  4L8E A;  3QFB C;  2CX4 A;  3HKR A;  2IWT A;  4TR0 A;  1FOV A;  3KP9 A;  1ZCP A;  4MCU A;  1FW1 A;  3QMX A;  5ECP B;  4MP4 A;  3FZ9 A;  4ECB A;  5F06 A;  2M46 A;  3ERG A;  4ECJ A;  2ES7 A;  1Y25 A;  4EE0 A;  5BRT A;  1TU7 A;  2FHE A;  3VI7 A;  3EPT A;  2K9F A;  5ID2 B;  2A4H A;  1WP0 A;  1MD3 A;  4OO4 A;  1BYE A;  5CYY A;  1Z6N A;  3A3T A;  4OCE A;  3LJR A;  2JSZ A;  2DKH A;  4TXO B;  3VPT A;  4WEY A;  3ME8 A;  3D21 A;  3I69 A;  5E4W A;  3KTB A;  3H8Q A;  2GZP A;  2V32 A;  4GLT A;  3RBT A;  4MF5 A;  1T00 A;  4LL4 B;  4PX1 A;  4MLY A;  1FAA A;  2GT5 A;  3GH9 A;  3GX0 A;  4AJ8 A;  3HA9 A;  2GGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...