1TI3A

Solution structure of the thioredoxin h1 from poplar, a cppc active site variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
AEEGQVIACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin H
publication title Solution structure of a natural CPPC active site variant, the reduced form of thioredoxin h1 from poplar.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ti3A00
7GSSA 4MABA 3WT2A 5E59A 2VL2C 1X5DA 2ES7A 2HI7A 2K8VA 3IPZA 5GAPD 1PN9A 1HYUA 2N5FA 2OE0A 4ML1A 2LNSA 1G0TA 3D4TA 3M8NA 3D22A 1FOVA 2YZUA 3ZRDA 2WZ9A 1W89A 4I6XA 1GNWA 5F06A 5A4WA 5D9VA 1K0NA 1WJKA 4WR4A 1YF0A 4WETA 2YWOA 4GXZA 2C80A 4JRRA 1IYIA 5B8BA 4TRXA 1YY7A 1EGRA 1BX9A 4HU9A 1O6JA 1GTBA 3SBCA 1T4YA 1BJXA 4N11A 1X0RA 1GUKA 1TXXA 3QPMA 2C3QA 1OE7A 1O81A 1Z3EA 4OMVA 2G0FA 2DBCA 3F4SA 4YAVA 1ZGNA 1ML6A 1S3DA 1AUCA 3KTLA 3P8WA 1A0FA 1VF1A 3WT1A 3FHKA 3TKSC 3MNGA 3PH9A 5AN1A 1TRVA 4NMUA 2FHEA 4D73B 4JZQA 4QL9A 5IPGA 3HKRA 2GSQA 4AJ8A 2ON5A 4IQAA 2J9HA 4K6XA 4TOPA 3HCZA 1Y6EA 1O73A 4JU5A 3TJKA 2VM2A 4EDYA 4YQUA 5ECRB 5IOWA 2F3MA 2QC7A 1A2LA 5DQYA 3A2WA 2H6YA 1PMTA 1MTCA 1GULA 2IL3A 4ECIA 2QSIA 1QUWA 5B6MA 2CZ3A 5C04A 2ZUPA 2I81A 2I4AA 2YWMA 3TOTA 1OVNA 1ZOFA 3GKKA 2FWFA 4HUAA 4LA1A 4MF5A 2ZNMA 1FB0A 3WGEA 5IMFA 2VIMA 1MDJA 1NHYA 2IFQA 1PD21 2V1MA 3PGTA 1K0MA 2WB9A 6GSVA 1TDIA 5IMAA 1NW2A 4ZILA 1ZYQB 2FLSA 1BYEA 3GURA 3LJRA 1EZKA 2P5QA 4KGIA 5DCHA 1E2YA 2AV4A 4PQIA 2H74A 2HE3A 3TJGA 3D6IA 2L4CA 12GSA 3TGZA 3VPTA 2A2SA 2H1GA 4GTUA 5DCGA 1R4WA 2F8FA 4BVYA 2BJXA 4OFMA 1ERWA 1XW6A 2YJ7A 5HFGA 1EP7A 1OC9B 2MYGA 1AAZA 5C00A 2KLXA 1TU8A 4JE1A 5ID2A 1ERUA 4IS0A 2H0GA 3GH9A 4ZL7A 5JCUA 2IMKA 4OCEA 1X5CA 4PX1A 5KEJA 4GLTA 4CHSA 3LFLA 3NOFA 5DDLA 2LSTA 5IMCA 4LLRA 3Q6OA 2V6KA 1XW5A 1EWXA 3M9JA 4XTSA 3TDGA 3CRUA 1FO5A 1URMA 1R5PA 2OADA 2GQLA 3KMNA 2QKEA 2R37A 3GHAA 1FAAA 4V1Ap 3UOMA 1SKRB 2GS3A 3QFAC 2PMTA 6GSTA 3CSJA 5D93A 3FR9A 1USBA 3QAGA 2EIOA 1G6WA 2JSYA 4H86A 3FY7A 1XPVA 4F03A 3ERFA 3NZNA 3HA9A 1V2AA 1YF1A 1PX6A 5COHA 3FW2A 2HNLA 5F07A 1SK2A 10GSA 4POMA 3UEMA 2XPDA 4FYBA 1YEXA 4HU7A 1ABAA 2R2JA 1K0OA 1OKTA 4F0BA 2FCHA 2VLVA 3DEXA 4KW6A 1K0DA 3HXSA 1SU9A 2VM1A 2IIYA 1PKWA 1VGLA 4HQSA 3GFKA 1G6YA 4PQHA 3E0UA 2C3NA 2X64A 4WR5A 3KD0A 1JLWA 4TR0A 2B6MA 2FY6A 2FD3A 3BOAA 4O32A 5ECIB 4RI7A 5IO2A 4MZCA 3F6DA 3GUSA 1EP8A 4NV5A 1XWGA 5ECQB 4J2FA 1M99A 2LQQA 3EINA 4YAPA 2VL2A 2YANA 3CSIA 4NXIA 4HZ4A 4KE3A 5DALB 3FZAA 2HZEA 4MF7A 1AQVA 5GSSA 3IBHA 2O87A 1SENA 2VCTA 4KCEA 4Z7XA 4YQVA 2H75A 4K9ZA 1Q4JA 4ID0A 3VI7A 2VL3A 4MMMA 4ZB8A 4FIWA 4GF0A 2CVKA 1BAYA 4EKZA 3D4MA 3S9FA 1PQNA 3FZ5A 3IAM2 3APQA 3GX0A 2PUKC 5AIXA 4F0CA 4F82A 3GIXA 3KEBA 2FWEA 2DIZA 2CX3A 4MJCA 1JZOA 3RBTA 2YNXA 2DIYA 3E3EA 5J9CA 4IBPA 2M72A 2C3TA 3UBKA 3IK7A 3IRAA 3GSTA 2H19A 2LV3A 3EC3A 5ECSA 1PA3A 3ISOA 2IMIA 3EYTA 2CVDA 2B1LA 1EV4A 2O89A 4DVCA 4OFTA 4XS4B 2QGVA 5EL8A 3ZTLA 2FNOA 3DWVA 1SK0A 2HFDA 5HR1A 1SL0B 3VURA 2VO4A 4N10A 5ECLB 2AUVA 1J08A 2YP6A 2YN1A 4PQ1A 3TKSE 1Q98A 2MBTA 4IGJA 3D0ZA 4ACSA 2L59A 2LJAA 1Z7PA 3GRXA 3IXRA 2X8CA 1TK5B 4RI6A 3C73A 2GSSA 4BL7A 3EU3A 2RUFA 1WWJA 6GSUA 1F37A 1FG4A 3HD5A 1H4OA 1EOGA 2TIRA 2GZYA 3QMXA 3FR6A 1SK1A 4I5QA 1ON4A 4ZXGA 1ZMAA 5D9WA 2PERA 3NIVA 1QK8A 1F3BA 2JZTA 3HDCA 4JEDA 3DIEA 4F9ZA 2RIIA 4WF4A 3QDNA 4V1Ag 1GSFA 3F3RA 3TUEA 3LWAA 3L9SA 2M80A 6GSSA 1X9MB 1YQ1A 3UIWA 2LNTA 3US3A 2VCQA 2WRTA 3EVIA 1AXDA 2GT6A 1GTAA 8GSSA 3BD2A 4HJMA 2H66A 1V9WA 2JZSA 3TKPA 1JFUA 2B1KA 3AY8A 4I2UA 1HNBA 4LMVA 3O3TA 1GNEA 2AAWA 2JACA 3LGCA 3QFBC 4QQ7A 2VCXA 4EL1A 2JZRA 5G30A 3KZQA 2LS5A 4IJ3A 4EC0A 2YCDA 4EVMA 5J9BA 1AC1A 3C1SA 5CYYA 1UC7A 1U87A 1TU7A 2OACA 4DSQA 5CRHA 3VFIA 2V41A 3MAKA 5F8BA 1VRSD 5B6NA 4HI7A 2P5RA 4XIHA 1EEJA 3U6VA 4MH2A 2PVQA 4TR4A 3CMIA 3VPQA 5D9TA 4E8HA 5G1KA 4ZBDA 3ME7A 1F9MA 1WMJA 3HHVA 2IMDA 5DBQA 3M0FA 2I9HA 5FWGA 3A5WA 5IMZA 3JCML 4GCIA 2VAFA 2VCZA 3C7MA 5J4UA 1F3AA 2IJYA 4AJ7A 1M9AA 1YKAA 4I97A 4FYCA 1XWAA 2CAIA 1M2BA 3SWLA 3GA4A 4MF6A 3WD6A 1T4ZA 3LSZA 3FZ4A 4YH2A 3GN3A 5IQYA 4Q5FA 2F9SA 1TTZA 4AGSA 4ZL8A 3H8QA 4XS1A 1R5AA 2F8AA 2O85A 5IO0A 1G7EA 1CQGA 3I69A 2H73A 1LU4A 3J7Yb 3G7YA 4K1FA 4MJBA 19GSA 5ECHB 1SYXA 4TVEA 3GL5A 5E4WA 3DVWA 4NHWA 1OKDA 2FUG2 2IMEA 1B48A 4D73A 2O7KA 3A2XA 2AHEA 2WFCA 1T7PB 4PGTA 2CVBA 2CAQA 2JSZA 3DGQA 4L8EA 4OWYA 4IP1A 3FR3A 4V2LA 1WE0A 1TRWA 5DJLA 22GSA 1VF4A 1J0FA 3TJBA 4TXOA 4TXOB 3ZYWA 1K3LA 5G5EA 5HQPA 13GSA 4HDEA 1THXA 2REMA 2DJJA 3VK9A 3KH7A 2YWIA 1SJ6A 2TRXA 3ZLPA 1O7UA 2H6ZA 1XWKA 3F4RA 4EE0A 4OD7A 4I8BA 1EV9A 3G7JA 3IOSA 2O8VB 2LKUA 4MH3A 2OBIA 3HVXA 4KAEA 5JWOB 4HS1A 1JZDA 4EO3A 5ECMB 5DJMA 1DBYA 4WBJA 3KXOA 2PWJA 1SYRA 4PUFC 2PBJA 2DJ1A 3HVVA 1PKZA 3KM6A 4K2DA 5B7CA 3IE3A 3KMOA 4LL1B 2PU9C 4OO5A 1BEDA 1B4QA 4WF5A 3P7XA 3UVTA 2GZPA 1OC9A 1U3AA 5JWQB 3DYRA 4K7IA 3GNJA 1A8YA 4KDUA 1GLPA 1GUMA 1VF3A 2HSHA 2VD0A 2ZCTA 3ED3A 2X8HA 1QGVA 1LBKA 1PSQA 3EWLA 3CTFA 4IVFA 3BJ5A 3BCKA 2LTKA 2C0EA 3C8EA 1WIKA 2WULA 4TR1B 1HD2A 1OE8A 2OE1A 5H5QA 2V2GA 3RHBA 4DEJA 4KA0A 3TKQA 1XWCA 1ERTA 2D2ZA 3Q74A 3IR4A 3GKXA 3GV1A 1T8EB 5AISA 2TRCP 3OR5A 1XWBA 3G7IA 3P2AA 4XRDA 3GH6A 1Z5YE 1BG5A 4KUNA 3C1RA 3TRQA 1PL1A 3LXZA 2KOKA 4RQXA 2OKAA 1QQ2A 1TOFA 2FGXA 5A4UA 4HZ2A 3W6GA 1RQMA 4PUAA 1A2MA 5ENUA 3ZVJA 3PINA 4RQRA 4ZBBA 2B5YA 5INYA 4WKWA 4YQMA 2HYXA 3HJMA 1A0RP 2VOCA 3BBYA 2X8GA 5KN3A 2H0HA 2B7JA 4P3YB 2PN8A 1MDKA 4MLYA 3IDVA 2NTOA 3H1NA 1V98A 2XC2A 1UVZA 3UAPA 2MMAA 4EDZA 3I9V2 3HZ8A 4GQCA 1NM3A 4KCAA 4RUVA 3GL3A 4GQFA 2C0FA 2XHFA 3EU4A 2GSRA 3RHCA 3RPPA 1X5EA 4MJAA 1GL8A 4E8EA 3LG6A 3A3TA 3LYPA 2H1DA 2JADA 2MZCA 3F6FA 4G10A 3VWVA 5DALA 3TB2A 1TK0B 3DD3A 3ERWA 5G5FA 4KSMA 3KP9A 4HEA2 4PNFA 1XFLA 3VI5A 4ECJA 3IC4A 3GTUB 1YJ6A 1MD3A 1M7TA 1DE1A 2OE3A 2K9FA 1R7HA 5KN2A 1OAZA 4NPBA 2MMNA 4TXVA 4MA9A 3M3MA 3LQ7A 4ECBA 3CYNA 3IK9A 3IV4A 1LJRA 3FYGA 1JZRA 2H30A 16GSA 5JCWA 5LNKe 2R6KA 4GSTA 2FWHA 2L5OA 3WYWA 1OC3A 4GSNA 3ME8A 5AGYA 2ON7A 3W8SA 3TRPA 1SL1B 5CO3A 1GSQA 1A23A 4X0XA 4DSSB 2GQMA 1O8XA 1PRXA 17GSA 2VCVA 1N2AA 2FWGA 1ZL9A 3APOA 2PVOC 4JR6A 4POBA 1TK8B 3TKSA 5EPFA 2LUSA 1S3AA 3VWXA 2C8UA 1GWCA 4XS4A 3L4NA 1FB6A 5ECOB 1U3IA 3A2VA 3ZFLA 2I3YA 6GSXA 3KH9A 1XVQA 1HNCA 4KH7A 3WGDA 1W4VA 3KJYA 5HFKA 2HT9A 2N5AA 3F0IA 2GVPA 2R3XA 1TRUA 4XCSA 4TW5A 2IMFA 3L0HA 5HR3A 3UJ1A 4TR3A 5CREA 3V1WA 2GSTA 6GSYA 3H79A 1J9BA 3L9UA 3EMXA 3F4TA 2HLSA 1MEKA 2E2GA 3DVXA 2OJLA 1KEBA 1B9YC 2M46A 4OO4A 1ZCPA 3H93A 2C1YA 3ZIVA 1AW9A 1TP9A 2V6OA 2HZFA 2H1AA 1UN2A 2E7PA 4KSOA 2L6DA 1KTEA 1TI1A 2H0IA 3KTBA 3DMLA 4HJ2A 1FVJA 3EE2A 3K8NA 2C4JA 2DMMA 4GSSA 2J23A 1AQXA 1XIYA 1BQ7A 2GZZA 5DVBA 2AYTA 4Q5NA 1NHOA 2CX4A 2MMOA 3UMAA 4O7HA 3ERGA 1XVWA 2C0GA 2H1BA 5CRGA 5J41A 4MZWA 4QL7A 3ZL5A 3CRTA 5IPHA 5D8IA 2YOIA 2GTUA 2WJUA 1XCCA 4FH8A 3WGXA 1TI3A 3ZZXA 4V2MA 1M9BA 4MPGA 2WCIA 3GKNA 1ILOA 1QFNA 3HJPA 4NV2A 1I5GA 5IIZA 1EGOA 2OBKA 2CT6A 3KCMA 4K8MA 4I2TA 3F63A 4CDOA 3HJOA 1DSBA 5B8AA 5DAKA 5DAKB 5HR2A 3ZREA 1MD4A 3KP8A 4CW9A 1ZZYA 2LJRA 2XPEA 3QD9A 1GSEA 4IQ1A 20GSA 3F9UA 1Z7RA 1T3BA 4MP4A 5ABRA 4AF2A 18GSA 1GUHA 1E6BA 1GTIA 3QCPA 4LL4B 1PX7A 1Z6NA 4JBBA 1ZYEA 1K0CA 4FO5A 1K0AA 3RPNA 5D9XA 3QAWA 2IWTA 2HXKA 3IA1A 4MPFA 2I1UA 2VL9A 1GTUA 2VLTA 4L5LA 3ZVJD 3R2QA 5CRDA 3HYPA 4IP6A 3EURA 1KNGA 4JR4A 2YWNA 3APSA 4PURA 3LEFA 2H70A 3GYKA 4KDXA 1K3OA 3H4KA 2YZHA 2DJ3A 1M2DA 3ZIJA 1M2AA 2MBSA 4L5OA 1XZOA 1WPIA 1A24A 3DRNA 3UL3A 3DXBA 2G2QA 4OFNA 3D21A 3ZMLA 1DUGA 4FYUA 3C71A 2VUPA 2B7KA 4K0GA 3G9BA 1X9SB 2N5BA 1SKSB 2XBIA 2K8SA 2YV7A 4ZB6A 3VLNA 4ULXA 1Z6MA 2DLXA 2IPAA 3P90A 3M1GA 2K6VA 1TRSA 4XS6A 2P0GA 3IHQA 5CRWA 5KN0A 2DMLA 2V32A 3E9JB 4HQZA 1K0BA 3L78A 4ZIJA 1TKDB 3GSSA 2ALBA 2GQKA 3F3QA 3PR8A 5G1LA 4ECCA 4N0VA 3GMFA 2IFQB 4K7OA 1AQWA 2LRCA 3LXTA 2L6CA 4X1UA 5CAXA 5G31A 3RDWA 1R26A 1GP1A 2EIRA 2VD1A 4O5RA 4OCFA 2LJKA 3I6AA 4GRFA 14GSA 4BWSA 3ZITA 3VWUA 1B4PA 1UA5A 2DC5A 1GH2A 2E2MA 3TJFA 1ACVA 4NAXA 5GAND 5F0GA 3TJJA 2OA7A 3FKFA 3DKSA 1TJDA 3CSHA 5ID2B 2LEGA 5IMDA 2GLRA 2CV4A 2E0QA 2P31A 2YJHA 3TKRA 4BPYA 4TR1A 4J57E 2DJ0A 5ELGA 1WP0A 2L57A 2CZ2A 3CBUA 2WGRA 3HY2A 4AJ6A 3MDKA 1SJIA 1GRXA 1XOBA 2WS2A 1N8JA 2H01A 2VCWA 1GSDA 1HQOA 3I43A 4ML6A 4Q5RA 2CA8A 2B3SA 2KHPA 2GT5A 2GDRA 4N0ZA 5AIVA 1GLQA 1ST9A 5HFIA 1EEMA 1A2JA 1QXHA 2H76A 5GSTA 4N30A 2X99A 1I9DA 2DJ2A 4IKHA 3FEUA 4EF0A 1DE2A 2PPTA 1JLVA 1B8XA 3IAS2 1H75A 4POLA 2PGTA 2L5LA 4XRAA 3N5OA 2YPMA 2YV9A 2C0DA 2F51A 4L0WA 5H5SA 1TW9A 5IMVA 9GSSA 4ZL9A 4G2EA 5KN1A 2XBQA 1X9WB 1F6MC 1T00A 1G7OA 4Q5QA 5H5RA 1PGTA 4J56E 5L71A 1YEPA 4TKYA 4POKA 5LD0A 5LCZA 3W8JA 5JWRB 4V2NA 3MWHA 3UVHA 3M9KA 4KB3A 5J3RA 2NDOA 1GSYA 2A2RA 1KBNA 5DQSA 4WBRD 4NHZA 1SJZA 4MDCA 1FHEA 3GTUA 1ERVA 1SD9A 4PNGA 4KDYA 2L4QA 4EUYA 1EOHA 3MSZA 4MCUA 1XW9A 1QMVA 3HVSA 5IM9A 4ZB9A 2HZEB 4L0UA 1O85A 2AB6A 3O6TA 4ZBAA 1WOUA 4MJEA 5CNWA 1RW1A 4F2IA 5A4VA 2EIQA 3TRXA 1THOA 2RM6A 3LORA 1V58A 4X43A 4G9HA 1T1VA 4WXTA 3TOUA 1YDKA 1Y25A 2B5EA 2JL4A 3LYKA 2H8LA 3L9VA 5ECPB 3KIJA 2FA8A 2MMZA 3EMPA 2RLIA 3UBLA 1SD8A 1V40A 3CXGA 3QAVA 1JHBA 1Z9HA 2KP1A 1FVKA 2H71A 4TN8A 4DSSA 5D73A 5GZZB 3FRCA 5D96A 3RAZA 11GSA 2IN3A 4LMWA 4ILFA 3VWWA 5F05A 2HRNA 2B5XA 4IJIA 4G19A 1F2EA 1S3CA 2BTOT 3GX8A 4PXOA 1OC8A 4K7NA 4XHMA 2BMXA 1XOAA 3UARA 2DJKA 3U5RE 4MK3A 4K0NA 4IW9A 3BCIA 4DSRA 1K3YA 2KP2A 6GSWA 1OYJA 1WRYA 4HOJA 3QOUA 3CTGA 2HSYA 5J5NA 2LRNA 1U88A 4ISDA 1SKWB 2EC4A 3ZMKA 1YKCA 1JZWA 2K18A 3N9JA 2JU5A 2RM5A 1M0UA 1A8LA 3Q19A 1B9XC 1O8WA 5G2ZA 2LQOA 1PL2A 1YZXA 5ECNB 5IOXA 2A4VA 5ELAA 2VLUA 1NSWA 2WDUA 4EXJA 5EVOA 1C72A 3QR6A 3HZ4A 4KNDA 5HR0A 2AJQB 4MZBA 1AIUA 5EY6A 4IN0A 1RK4A 5ECKB 2DSAA 3FZ9A 1CQHA 2Z9SA 2RUEA 2KUCA 4O92A 1XBSA 1SL2B 5CP1A 5A5KA 2NBSA 1U6TA 1FW1A 2NVLA 2GGTA 3FK8A 3TCOA 2R4VA 3Q18A 1GSSA 2CQ9A 1GSUA 4BWQA 1XXUA 4IHUA 1V57A 4GWRA 1VF2A 4NWYA 4BVXA 1IYHA 4WEYA 3KGKA 2FA4A 2R5GA 3O76A 2H6XA 2LRTA 4KX4A 3GKMA 1MDIA 1HNAA 2HRFA 5FT3A 5JCGA 3F8UA 5FHIA 4IELA 3D5JA 4BA7A 3ZFBA 3J7Yk 2H72A 2NPBA
chains in the Genus database with same CATH superfamily
7GSSA 4MABA 3WT2A 5E59A 2VL2C 1X5DA 2ES7A 2HI7A 2K8VA 3IPZA 5GAPD 1PN9A 1HYUA 2N5FA 2OE0A 4ML1A 2LNSA 1G0TA 3D4TA 3M8NA 3D22A 1FOVA 2YZUA 3ZRDA 2WZ9A 1W89A 4I6XA 1GNWA 5F06A 5A4WA 5D9VA 1K0NA 1WJKA 4WR4A 1YF0A 4WETA 2YWOA 4GXZA 2C80A 4JRRA 1IYIA 5B8BA 4TRXA 1YY7A 1EGRA 1BX9A 4HU9A 1O6JA 1GTBA 3SBCA 1T4YA 1BJXA 4N11A 1X0RA 1GUKA 1TXXA 3QPMA 2C3QA 1OE7A 1O81A 1Z3EA 4OMVA 2G0FA 2DBCA 3F4SA 4YAVA 2A4HA 1ZGNA 1ML6A 1S3DA 1AUCA 3KTLA 3P8WA 1A0FA 1VF1A 3WT1A 4A5PA 3FHKA 3TKSC 3MNGA 3PH9A 5AN1A 1TRVA 4NMUA 2FHEA 4D73B 4JZQA 4QL9A 5IPGA 3HKRA 2GSQA 4AJ8A 2ON5A 4IQAA 2J9HA 4K6XA 4TOPA 3HCZA 1Y6EA 1O73A 4JU5A 1M3JA 3TJKA 2VM2A 4EDYA 4YQUA 4HSCX 5ECRB 5IOWA 2F3MA 2QC7A 1A2LA 5DQYA 3A2WA 2H6YA 1PMTA 1MTCA 1GULA 2IL3A 4ECIA 2QSIA 1QUWA 5B6MA 2CZ3A 5C04A 2ZUPA 2I81A 2I4AA 2YWMA 3TOTA 1OVNA 1ZOFA 3GKKA 2FWFA 4HUAA 4LA1A 4MF5A 2ZNMA 1FB0A 3WGEA 5IMFA 2VIMA 1MDJA 1NHYA 2IFQA 1PD21 2V1MA 3PGTA 1K0MA 2WB9A 6GSVA 1TDIA 5IMAA 1NW2A 4ZILA 1ZYQB 2FLSA 1BYEA 3GURA 3LJRA 4EIQA 1EZKA 2P5QA 4KGIA 5DCHA 1E2YA 2HRKA 2AV4A 4PQIA 2H74A 2HE3A 3TJGA 3D6IA 2L4CA 12GSA 3TGZA 3VPTA 2A2SA 2H1GA 4GTUA 5KOXA 5DCGA 1R4WA 2F8FA 4BVYA 2BJXA 4OFMA 1ERWA 1XW6A 2UZ8A 2YJ7A 5HFGA 1EP7A 1OC9B 2MYGA 1AAZA 5C00A 2KLXA 1TU8A 4JE1A 5ID2A 1ERUA 4IS0A 2H0GA 3GH9A 4ZL7A 5JCUA 2IMKA 4OCEA 1X5CA 4PX1A 5KEJA 4GLTA 4CHSA 3LFLA 3NOFA 5DDLA 2LSTA 5IMCA 4LLRA 3Q6OA 2V6KA 1XW5A 1EWXA 3M9JA 4XTSA 3TDGA 3CRUA 1FO5A 1URMA 1R5PA 2OADA 2GQLA 3KMNA 2QKEA 2R37A 3GHAA 1FAAA 4V1Ap 3UOMA 1SKRB 2GS3A 3QFAC 2PMTA 6GSTA 3CSJA 5D93A 3FR9A 1USBA 3QAGA 2EIOA 1G6WA 2JSYA 4H86A 3FY7A 1XPVA 4F03A 3ERFA 3NZNA 3HA9A 1V2AA 1YF1A 1PX6A 5COHA 3FW2A 2HNLA 5F07A 1SK2A 10GSA 4POMA 4KF9A 3UEMA 2XPDA 4FYBA 1YEXA 4HU7A 1ABAA 2R2JA 1K0OA 1OKTA 4F0BA 2FCHA 2VLVA 3DEXA 4KW6A 1K0DA 3HXSA 1SU9A 2VM1A 2IIYA 1PKWA 1VGLA 4HQSA 4YKFA 3GFKA 1G6YA 4PQHA 3E0UA 2C3NA 2X64A 4WR5A 3KD0A 1JLWA 4TR0A 2B6MA 2FY6A 2FD3A 3BOAA 4O32A 5ECIB 4RI7A 5IO2A 4MZCA 3F6DA 3GUSA 1EP8A 4NV5A 1XWGA 5ECQB 4J2FA 1M99A 2LQQA 3EINA 4YAPA 2VL2A 2YANA 3CSIA 4NXIA 3HVNA 4HZ4A 4KE3A 5DALB 3FZAA 2HZEA 4MF7A 1AQVA 5GSSA 3IBHA 2O87A 1SENA 2VCTA 4KCEA 4Z7XA 2QA2A 4YQVA 2H75A 4K9ZA 1Q4JA 4ID0A 3VI7A 2VL3A 4MMMA 4ZB8A 1ZYNA 4FIWA 4GF0A 2CVKA 1BAYA 4EKZA 3D4MA 3S9FA 2HSMA 1PQNA 3FZ5A 3IAM2 3APQA 3GX0A 2PUKC 5AIXA 4F0CA 4F82A 3GIXA 3KEBA 2FWEA 2DIZA 2CX3A 4MJCA 1JZOA 3RBTA 2YNXA 2DIYA 3E3EA 5J9CA 4IBPA 2M72A 2C3TA 3UBKA 3IK7A 3IRAA 3GSTA 2H19A 2LV3A 3EC3A 5ECSA 1PA3A 3ISOA 2IMIA 3EYTA 2CVDA 2B1LA 1EV4A 3IC8A 2O89A 4DVCA 4OFTA 4XS4B 2QGVA 5EL8A 3ZTLA 2FNOA 3DWVA 1SK0A 2HFDA 5HR1A 1SL0B 3VURA 2VO4A 4N10A 5ECLB 2AUVA 1J08A 2YP6A 2YN1A 4PQ1A 3TKSE 1Q98A 2MBTA 4IGJA 3D0ZA 4ACSA 2L59A 2LJAA 1Z7PA 3GRXA 3IXRA 2X8CA 1TK5B 4RI6A 3C73A 2GSSA 4BL7A 3EU3A 2RUFA 1WWJA 6GSUA 1F37A 1FG4A 3HD5A 1H4OA 1EOGA 2TIRA 2GZYA 3QMXA 3FR6A 1SK1A 4I5QA 1ON4A 4ZXGA 4PTSA 1ZMAA 5D9WA 2PERA 3NIVA 1QK8A 1F3BA 2JZTA 3HDCA 4JEDA 3DIEA 4F9ZA 2RIIA 4WF4A 3FMWA 3QDNA 4V1Ag 1GSFA 3F3RA 3TUEA 3LWAA 3L9SA 2M80A 6GSSA 1X9MB 1YQ1A 3UIWA 2LNTA 3US3A 2VCQA 2WRTA 3EVIA 1AXDA 2GT6A 1GTAA 8GSSA 3BD2A 4HJMA 2H66A 1V9WA 2JZSA 3TKPA 1JFUA 2B1KA 3AY8A 4I2UA 1HNBA 4O5UA 4LMVA 3O3TA 1GNEA 2AAWA 2JACA 3LGCA 3QFBC 4QQ7A 2VCXA 4EL1A 2JZRA 5G30A 3KZQA 2LS5A 4IJ3A 4EC0A 2YCDA 4EVMA 5J9BA 1AC1A 3C1SA 5CYYA 1UC7A 1U87A 1TU7A 2OACA 2X4AA 4DSQA 5CRHA 3VFIA 2V41A 3MAKA 5F8BA 1VRSD 5B6NA 4HI7A 2P5RA 4ICYA 4XIHA 1EEJA 3U6VA 4MH2A 2PVQA 4TR4A 3CMIA 3VPQA 5D9TA 4E8HA 5G1KA 4ZBDA 3ME7A 1F9MA 1WMJA 3HHVA 2IMDA 5DBQA 3M0FA 2I9HA 5FWGA 3A5WA 5IMZA 3JCML 4GCIA 2VAFA 2VCZA 3C7MA 5J4UA 1F3AA 2IJYA 4AJ7A 1M9AA 1YKAA 4K5RA 2HRAA 4I97A 4FYCA 1XWAA 2CAIA 1M2BA 3SWLA 3GA4A 4MF6A 3WD6A 1T4ZA 3LSZA 3FZ4A 2QA1A 4YH2A 3GN3A 1FOHA 5IQYA 4Q5FA 2F9SA 1TTZA 4AGSA 4ZL8A 3H8QA 4XS1A 1R5AA 2F8AA 2O85A 5IO0A 1G7EA 1CQGA 3I69A 2H73A 1LU4A 3IHGA 3J7Yb 3G7YA 4K1FA 4MJBA 19GSA 5ECHB 1SYXA 4TVEA 3GL5A 5E4WA 3DVWA 4NHWA 1OKDA 2FUG2 2IMEA 1B48A 4D73A 2O7KA 3A2XA 2AHEA 2WFCA 1T7PB 4PGTA 2CVBA 2CAQA 2JSZA 3DGQA 4L8EA 4OWYA 4IP1A 3FR3A 4V2LA 1WE0A 1TRWA 5DJLA 22GSA 1VF4A 1J0FA 3TJBA 4TXOA 4TXOB 3ZYWA 1K3LA 5G5EA 5HQPA 13GSA 4HDEA 1THXA 2REMA 2DJJA 3VK9A 3KH7A 2YWIA 1SJ6A 2TRXA 3ZLPA 1O7UA 2H6ZA 1XWKA 3F4RA 4EE0A 4OD7A 4I8BA 1EV9A 3G7JA 3IOSA 2O8VB 2LKUA 4MH3A 2OBIA 3HVXA 4KAEA 5JWOB 4HS1A 1JZDA 4EO3A 5ECMB 5DJMA 1DBYA 4CY6A 4WBJA 3KXOA 2PWJA 1SYRA 4PUFC 2PBJA 2DJ1A 3HVVA 1PKZA 3KM6A 4K2DA 5B7CA 3IE3A 3KMOA 4LL1B 2PU9C 4OO5A 1BEDA 1B4QA 4WF5A 3P7XA 3UVTA 2GZPA 1OC9A 1S3RA 1U3AA 5JWQB 3DYRA 4K7IA 4FQUA 3GNJA 1A8YA 4KDUA 1GLPA 1GUMA 1VF3A 2HSHA 2VD0A 2ZCTA 3ED3A 2X8HA 1QGVA 1LBKA 1PSQA 3EWLA 3CTFA 4IVFA 3BJ5A 3BCKA 2LTKA 2C0EA 3C8EA 1WIKA 2WULA 4TR1B 1HD2A 1ZYPA 1OE8A 2OE1A 5H5QA 2V2GA 3RHBA 4DEJA 4KA0A 3TKQA 1XWCA 4K2XA 1ERTA 2D2ZA 3Q74A 3IR4A 3GKXA 3GV1A 1T8EB 5AISA 2TRCP 3OR5A 1XWBA 3G7IA 3P2AA 4XRDA 3GH6A 1Z5YE 1BG5A 4KUNA 3C1RA 3TRQA 1PL1A 3LXZA 2KOKA 4RQXA 2OKAA 1QQ2A 1TOFA 2FGXA 5A4UA 4HZ2A 3W6GA 1RQMA 4PUAA 1A2MA 5ENUA 3ZVJA 3PINA 4RQRA 4ZBBA 2B5YA 5INYA 4WKWA 4YQMA 5KOWA 2HYXA 3HJMA 1A0RP 2VOCA 3BBYA 2X8GA 5KN3A 2H0HA 2B7JA 4P3YB 2PN8A 1MDKA 4MLYA 3IDVA 2NTOA 3H1NA 1V98A 2XC2A 1UVZA 3UAPA 2MMAA 4EDZA 3I9V2 3HZ8A 4GQCA 1NM3A 4KCAA 4RUVA 3GL3A 4GQFA 2C0FA 2XHFA 3EU4A 2GSRA 3RHCA 3RPPA 1X5EA 4MJAA 1GL8A 4YKGA 4E8EA 3LG6A 3A3TA 3LYPA 2H1DA 2JADA 2MZCA 2X49A 3F6FA 4G10A 3VWVA 5DALA 3TB2A 1TK0B 3DD3A 3ERWA 5G5FA 4KSMA 5BRTA 3KP9A 4HEA2 4PNFA 1XFLA 3VI5A 4ECJA 3IC4A 3GTUB 4O5QA 1YJ6A 1MD3A 1M7TA 1DE1A 3CQFA 2OE3A 2K9FA 1R7HA 5KN2A 1OAZA 4NPBA 2MMNA 4TXVA 4MA9A 3M3MA 3LQ7A 4ECBA 3CYNA 2DKIA 3IK9A 3IV4A 1LJRA 3FYGA 1JZRA 2H30A 16GSA 5JCWA 5LNKe 2R6KA 4GSTA 2FWHA 2L5OA 3WYWA 1OC3A 4GSNA 3ME8A 5AGYA 2ON7A 3W8SA 3TRPA 1SL1B 5CO3A 1GSQA 1A23A 4X0XA 4DSSB 2GQMA 1O8XA 1PRXA 17GSA 2VCVA 1N2AA 2FWGA 1ZL9A 3APOA 2PVOC 4JR6A 4POBA 1TK8B 3TKSA 5EPFA 2LUSA 1S3AA 3VWXA 2C8UA 1GWCA 4XS4A 3L4NA 1FB6A 1U3IA 3A2VA 5ECOB 3ZFLA 2I3YA 6GSXA 3KH9A 1XVQA 1HNCA 4KH7A 3WGDA 1W4VA 3KJYA 5HFKA 2HT9A 2N5AA 3F0IA 2GVPA 2R3XA 1TRUA 4XCSA 4TW5A 2IMFA 3L0HA 5HR3A 3UJ1A 4TR3A 3MYDA 5CREA 3V1WA 2GSTA 4BIKA 6GSYA 3H79A 1J9BA 5BMUA 4USSA 3L9UA 3EMXA 3F4TA 2HLSA 1MEKA 2E2GA 3DVXA 2OJLA 1KEBA 1B9YC 2M46A 4OO4A 1ZCPA 3H93A 2C1YA 3ZIVA 1PN0A 1AW9A 1TP9A 2V6OA 2HZFA 2H1AA 1UN2A 2E7PA 4KSOA 2L6DA 1KTEA 1TI1A 2H0IA 3KTBA 3DMLA 4HJ2A 1FVJA 3EE2A 3K8NA 2C4JA 2DMMA 4GSSA 2J23A 1AQXA 1XIYA 1BQ7A 2GZZA 5DVBA 2AYTA 4G0IA 4Q5NA 1NHOA 2CX4A 2MMOA 3UMAA 4O7HA 3ERGA 1XVWA 2C0GA 2H1BA 5CRGA 5J41A 4MZWA 4QL7A 3ZL5A 3CRTA 5IPHA 5D8IA 2YOIA 2GTUA 2WJUA 1XCCA 4FH8A 3WGXA 1TI3A 3ZZXA 4V2MA 1M9BA 2R0PA 4MPGA 2WCIA 3GKNA 1ILOA 1QFNA 3HJPA 4NV2A 1I5GA 5IIZA 1EGOA 2OBKA 2CT6A 3KCMA 4K8MA 4I2TA 3F63A 4CDOA 3HJOA 1DSBA 5B8AA 5DAKA 5DAKB 5HR2A 3ZREA 1MD4A 3KP8A 4CW9A 1ZZYA 2LJRA 2XPEA 3QD9A 1GSEA 4IQ1A 20GSA 3F9UA 1Z7RA 1T3BA 4MP4A 5ABRA 4AF2A 18GSA 1GUHA 1E6BA 1GTIA 3QCPA 4LL4B 1PX7A 1Z6NA 4JBBA 1ZYEA 1K0CA 4FO5A 1K0AA 3RPNA 5D9XA 3QAWA 2IWTA 2HXKA 3IA1A 4MPFA 2I1UA 4Z2RA 2VL9A 1GTUA 2VLTA 4L5LA 3ZVJD 3R2QA 5CRDA 3HYPA 4IP6A 3EURA 1KNGA 4JR4A 2YWNA 3APSA 4PURA 3LEFA 2H70A 3GYKA 4KDXA 1K3OA 3H4KA 2YZHA 2DJ3A 1M2DA 3ZIJA 1M2AA 2MBSA 4L5OA 1XZOA 1WPIA 1A24A 3DRNA 3UL3A 3DXBA 2G2QA 4OFNA 3D21A 3ZMLA 1DUGA 4FYUA 3C71A 2VUPA 2B7KA 4K0GA 3G9BA 1X9SB 2N5BA 2R0CA 1SKSB 2XBIA 2K8SA 2YV7A 4ZB6A 3VLNA 4ULXA 1Z6MA 4G0KA 2DLXA 2IPAA 3P90A 3M1GA 2K6VA 1TRSA 4XS6A 2P0GA 3IHQA 5CRWA 5KN0A 2DMLA 2V32A 3E9JB 4HQZA 1K0BA 3L78A 4ZIJA 1TKDB 3GSSA 2ALBA 2GQKA 3F3QA 3PR8A 5G1LA 4ECCA 4N0VA 3GMFA 2IFQB 4K7OA 1AQWA 2LRCA 3LXTA 2L6CA 4X1UA 5CAXA 5G31A 3RDWA 1R26A 1GP1A 2EIRA 2VD1A 4O5RA 4OCFA 2LJKA 3I6AA 4GRFA 14GSA 4BWSA 3ZITA 4BVYB 3VWUA 1B4PA 1UA5A 2DC5A 1GH2A 2E2MA 3TJFA 1ACVA 4NAXA 5GAND 5F0GA 3TJJA 2OA7A 3MIXA 3FKFA 3DKSA 1TJDA 3CSHA 5ID2B 2LEGA 5IMDA 2GLRA 2CV4A 2E0QA 2P31A 2YJHA 3TKRA 4BPYA 4TR1A 4J57E 2DJ0A 5ELGA 1WP0A 2L57A 3PPUA 2CZ2A 3CBUA 2WGRA 3HY2A 4AJ6A 3MDKA 1SJIA 1GRXA 1XOBA 2WS2A 1N8JA 2H01A 2VCWA 1GSDA 1HQOA 3I43A 4ML6A 4Q5RA 3EPTA 2CA8A 2B3SA 2KHPA 2GT5A 2GDRA 4N0ZA 5AIVA 1GLQA 1ST9A 5HFIA 1EEMA 1A2JA 1QXHA 2H76A 5GSTA 4CY8A 4N30A 2X99A 1I9DA 2DJ2A 4IKHA 3FEUA 4EF0A 1DE2A 2PPTA 1JLVA 1PFOA 1B8XA 3IAS2 1H75A 4POLA 2PGTA 2L5LA 4XRAA 3N5OA 4Z2TA 2YPMA 2YV9A 2C0DA 2F51A 4L0WA 5H5SA 1TW9A 5IMVA 9GSSA 4Z2UA 4ZL9A 4G2EA 5KN1A 2XBQA 1X9WB 1F6MC 3LW9A 1T00A 1G7OA 4Q5QA 5H5RA 1PGTA 4J56E 5L71A 4EIPA 1YEPA 4TKYA 4POKA 5LD0A 5LCZA 3W8JA 5JWRB 4V2NA 3MWHA 3UVHA 3M9KA 4KB3A 5J3RA 2NDOA 1GSYA 2A2RA 1KBNA 5DQSA 4WBRD 4NHZA 1SJZA 4MDCA 1FHEA 3GTUA 1ERVA 1SD9A 4PNGA 4KDYA 2L4QA 4EUYA 1EOHA 3MSZA 4MCUA 1XW9A 1QMVA 3HVSA 5IM9A 4ZB9A 2HZEB 4L0UA 1O85A 2AB6A 3O6TA 4ZBAA 1WOUA 4MJEA 5CNWA 1RW1A 4F2IA 5A4VA 1M3IA 2EIQA 3TRXA 1THOA 2RM6A 3LORA 1V58A 4X43A 2R0GA 4G9HA 1T1VA 4WXTA 3TOUA 1YDKA 1Y25A 2B5EA 2JL4A 3LYKA 3A5IA 2H8LA 3L9VA 5ECPB 3KIJA 2FA8A 2MMZA 3EMPA 2RLIA 3UBLA 1XG8A 1SD8A 1V40A 3CXGA 3QAVA 1JHBA 1Z9HA 4G0LA 2KP1A 1FVKA 2H71A 4TN8A 4DSSA 5D73A 5GZZB 3FRCA 5D96A 3RAZA 11GSA 2IN3A 2A2PA 4LMWA 4ILFA 3VWWA 5F05A 2HRNA 2B5XA 4IJIA 4G19A 1F2EA 1S3CA 2BTOT 3GX8A 4PXOA 1OC8A 4K7NA 4XHMA 2BMXA 1XOAA 3UARA 2DJKA 3U5RE 4MK3A 4K0NA 4IW9A 3BCIA 4DSRA 1K3YA 2KP2A 6GSWA 1OYJA 1WRYA 4HOJA 3QOUA 3CTGA 2HSYA 5J5NA 2LRNA 1U88A 4ISDA 1SKWB 2EC4A 3ZMKA 1YKCA 1JZWA 2K18A 3N9JA 2JU5A 2RM5A 1M0UA 1A8LA 3Q19A 4BL7B 1B9XC 1O8WA 5G2ZA 2LQOA 1PL2A 1YZXA 5ECNB 5IOXA 2A4VA 5ELAA 2VLUA 1NSWA 2WDUA 4EXJA 5EVOA 4MNNA 1C72A 3QR6A 3HZ4A 4KNDA 5HR0A 2AJQB 4MZBA 1AIUA 5EY6A 4IN0A 2DKHA 1RK4A 5ECKB 2DSAA 3FZ9A 1CQHA 2Z9SA 2RUEA 2KUCA 4O92A 1XBSA 1SL2B 5CP1A 5A5KA 2NBSA 1U6TA 1FW1A 2NVLA 2GGTA 3FK8A 3TCOA 2R4VA 3R3EA 3Q18A 1GSSA 2CQ9A 1GSUA 4BWQA 1XXUA 4IHUA 1V57A 4GWRA 1VF2A 4NWYA 4BVXA 4BVXB 1IYHA 4WEYA 3KGKA 2FA4A 2R5GA 3O76A 2H6XA 2LRTA 4KX4A 3GKMA 1MDIA 1HNAA 2HRFA 5FT3A 5JCGA 3F8UA 5FHIA 4K5SA 4IELA 3D5JA 4BA7A 3ZFBA 3J7Yk 2H72A 2NPBA 4X4JA
chains in the Genus database with same CATH topology
7GSSA 4MABA 3WT2A 5E59A 2VL2C 1X5DA 2ES7A 2HI7A 2K8VA 3IPZA 5GAPD 1PN9A 1HYUA 2N5FA 2OE0A 4ML1A 2LNSA 1G0TA 3D4TA 3M8NA 3D22A 1FOVA 2YZUA 3ZRDA 2WZ9A 1W89A 4I6XA 1GNWA 5F06A 5A4WA 5D9VA 1K0NA 1WJKA 4WR4A 1YF0A 4WETA 2YWOA 4GXZA 2C80A 4JRRA 1IYIA 5B8BA 4TRXA 1YY7A 1EGRA 1BX9A 4HU9A 1O6JA 1GTBA 3SBCA 1T4YA 1BJXA 4N11A 1X0RA 1GUKA 1TXXA 3QPMA 2C3QA 1OE7A 1O81A 1Z3EA 4OMVA 2G0FA 2DBCA 3F4SA 4YAVA 2A4HA 1ZGNA 1ML6A 1S3DA 1AUCA 3KTLA 3P8WA 1A0FA 1VF1A 3WT1A 4A5PA 3FHKA 3TKSC 3MNGA 3PH9A 5AN1A 1TRVA 4NMUA 2FHEA 4D73B 4JZQA 4QL9A 5IPGA 3HKRA 2GSQA 4AJ8A 2ON5A 4IQAA 2J9HA 4K6XA 4TOPA 3HCZA 1Y6EA 1O73A 4JU5A 3TJKA 2VM2A 4EDYA 4YQUA 5ECRB 5IOWA 2F3MA 2QC7A 1A2LA 5DQYA 3A2WA 2H6YA 1PMTA 1MTCA 1GULA 2IL3A 4ECIA 2QSIA 1QUWA 5B6MA 2CZ3A 5C04A 2ZUPA 2I81A 2I4AA 2YWMA 3TOTA 1OVNA 1ZOFA 3GKKA 2FWFA 4HUAA 4LA1A 4MF5A 2ZNMA 1FB0A 3WGEA 5IMFA 2VIMA 1MDJA 1NHYA 2IFQA 1PD21 2V1MA 3PGTA 1K0MA 2WB9A 6GSVA 1TDIA 5IMAA 1NW2A 4ZILA 1ZYQB 2FLSA 1BYEA 3GURA 3LJRA 4EIQA 1EZKA 2P5QA 4KGIA 5DCHA 1E2YA 2HRKA 2AV4A 4PQIA 2H74A 2HE3A 3TJGA 3D6IA 2L4CA 12GSA 3TGZA 3VPTA 2A2SA 2H1GA 4GTUA 5KOXA 5DCGA 1R4WA 2F8FA 4BVYA 2BJXA 4OFMA 1ERWA 1XW6A 2UZ8A 2YJ7A 5HFGA 1EP7A 1OC9B 2MYGA 1AAZA 5C00A 2KLXA 1TU8A 4JE1A 5ID2A 1ERUA 4IS0A 2H0GA 3GH9A 4ZL7A 5JCUA 2IMKA 4OCEA 1X5CA 4PX1A 5KEJA 4GLTA 4CHSA 3LFLA 3NOFA 5DDLA 2LSTA 5IMCA 4LLRA 3Q6OA 2V6KA 1XW5A 1EWXA 3M9JA 4XTSA 3TDGA 3CRUA 1FO5A 1URMA 1R5PA 2OADA 2GQLA 3KMNA 2QKEA 2R37A 3GHAA 1FAAA 4V1Ap 3UOMA 1SKRB 2GS3A 3QFAC 2PMTA 6GSTA 3CSJA 5D93A 3FR9A 1USBA 3QAGA 2EIOA 1G6WA 2JSYA 4H86A 3FY7A 1XPVA 4F03A 3ERFA 3NZNA 3HA9A 1V2AA 1YF1A 1PX6A 5COHA 3FW2A 2HNLA 5F07A 1SK2A 10GSA 4POMA 4KF9A 3UEMA 2XPDA 4FYBA 1YEXA 4HU7A 1ABAA 2R2JA 1K0OA 1OKTA 4F0BA 2FCHA 2VLVA 3DEXA 4KW6A 1K0DA 3HXSA 1SU9A 2VM1A 2IIYA 1PKWA 1VGLA 4HQSA 4YKFA 3GFKA 1G6YA 4PQHA 3E0UA 2C3NA 2X64A 4WR5A 3KD0A 1JLWA 4TR0A 2B6MA 2FY6A 2FD3A 3BOAA 4O32A 5ECIB 4RI7A 5IO2A 4MZCA 3F6DA 3GUSA 1EP8A 4NV5A 1XWGA 5ECQB 4J2FA 1M99A 2LQQA 3EINA 4YAPA 2VL2A 2YANA 3CSIA 4NXIA 4HZ4A 4KE3A 5DALB 3FZAA 2HZEA 4MF7A 1AQVA 5GSSA 3IBHA 2O87A 1SENA 2VCTA 4KCEA 4Z7XA 2QA2A 4YQVA 2H75A 4K9ZA 1Q4JA 4ID0A 3VI7A 2VL3A 4MMMA 4ZB8A 1ZYNA 4FIWA 4GF0A 2CVKA 1BAYA 4EKZA 3D4MA 3S9FA 2HSMA 1PQNA 3FZ5A 3IAM2 3APQA 3GX0A 2PUKC 5AIXA 4F0CA 4F82A 3GIXA 3KEBA 2FWEA 2DIZA 2CX3A 4MJCA 1JZOA 3RBTA 2YNXA 2DIYA 3E3EA 5J9CA 4IBPA 2M72A 2C3TA 3UBKA 3IK7A 3IRAA 3GSTA 2H19A 2LV3A 3EC3A 5ECSA 1PA3A 3ISOA 2IMIA 3EYTA 2CVDA 2B1LA 1EV4A 3IC8A 2O89A 4DVCA 4OFTA 4XS4B 2QGVA 5EL8A 3ZTLA 2FNOA 3DWVA 1SK0A 2HFDA 5HR1A 1SL0B 3VURA 2VO4A 4N10A 5ECLB 2AUVA 1J08A 2YP6A 2YN1A 4PQ1A 3TKSE 1Q98A 2MBTA 4IGJA 3D0ZA 4ACSA 2L59A 2LJAA 1Z7PA 3GRXA 3IXRA 2X8CA 1TK5B 4RI6A 3C73A 2GSSA 4BL7A 3EU3A 2RUFA 1WWJA 6GSUA 1F37A 1FG4A 3HD5A 1H4OA 1EOGA 2TIRA 2GZYA 3QMXA 3FR6A 1SK1A 4I5QA 1ON4A 4ZXGA 4PTSA 1ZMAA 5D9WA 2PERA 3NIVA 1QK8A 1F3BA 2JZTA 3HDCA 4JEDA 3DIEA 4F9ZA 2RIIA 4WF4A 3FMWA 3QDNA 4V1Ag 1GSFA 3F3RA 3TUEA 3LWAA 3L9SA 2M80A 6GSSA 1X9MB 1YQ1A 3UIWA 2LNTA 3US3A 2VCQA 2WRTA 3EVIA 1AXDA 2GT6A 1GTAA 8GSSA 3BD2A 4HJMA 2H66A 1V9WA 2JZSA 3TKPA 1JFUA 2B1KA 3AY8A 4I2UA 1HNBA 4O5UA 4LMVA 3O3TA 1GNEA 2AAWA 2JACA 3LGCA 3QFBC 4QQ7A 2VCXA 4EL1A 2JZRA 5G30A 3KZQA 2LS5A 4IJ3A 4EC0A 2YCDA 4EVMA 5J9BA 1AC1A 3C1SA 5CYYA 1UC7A 1U87A 1TU7A 2OACA 2X4AA 4DSQA 5CRHA 3VFIA 2V41A 3MAKA 5F8BA 1VRSD 5B6NA 4HI7A 2P5RA 4ICYA 4XIHA 1EEJA 3U6VA 4MH2A 2PVQA 4TR4A 3CMIA 3VPQA 5D9TA 4E8HA 5G1KA 4ZBDA 3ME7A 1F9MA 1WMJA 3HHVA 2IMDA 5DBQA 3M0FA 2I9HA 5FWGA 3A5WA 5IMZA 3JCML 4GCIA 2VAFA 2VCZA 3C7MA 5J4UA 1F3AA 2IJYA 4AJ7A 1M9AA 1YKAA 4K5RA 2HRAA 4I97A 4FYCA 1XWAA 2CAIA 1M2BA 3SWLA 3GA4A 4MF6A 3WD6A 1T4ZA 3LSZA 3FZ4A 2QA1A 4YH2A 3GN3A 1FOHA 5IQYA 4Q5FA 2F9SA 1TTZA 4AGSA 4ZL8A 3H8QA 4XS1A 1R5AA 2F8AA 2O85A 5IO0A 1G7EA 1CQGA 3I69A 2H73A 1LU4A 3IHGA 3J7Yb 3G7YA 4K1FA 4MJBA 19GSA 5ECHB 1SYXA 4TVEA 3GL5A 5E4WA 3DVWA 4NHWA 1OKDA 2FUG2 2IMEA 1B48A 4D73A 2O7KA 3A2XA 2AHEA 2WFCA 1T7PB 4PGTA 2CVBA 2CAQA 2JSZA 3DGQA 4L8EA 4OWYA 4IP1A 3FR3A 4V2LA 1WE0A 1TRWA 5DJLA 22GSA 1VF4A 1J0FA 3TJBA 4TXOA 4TXOB 3ZYWA 1K3LA 5G5EA 5HQPA 13GSA 4HDEA 1THXA 2REMA 2DJJA 3VK9A 3KH7A 2YWIA 1SJ6A 2TRXA 3ZLPA 1O7UA 2H6ZA 1XWKA 3F4RA 4EE0A 4OD7A 4I8BA 1EV9A 3G7JA 3IOSA 2O8VB 2LKUA 4MH3A 2OBIA 3HVXA 4KAEA 5JWOB 4HS1A 1JZDA 4EO3A 5ECMB 5DJMA 1DBYA 4CY6A 4WBJA 3KXOA 2PWJA 1SYRA 4PUFC 2PBJA 2DJ1A 3HVVA 1PKZA 3KM6A 4K2DA 5B7CA 3IE3A 3KMOA 4LL1B 2PU9C 4OO5A 1BEDA 1B4QA 4WF5A 3P7XA 3UVTA 2GZPA 1OC9A 1U3AA 5JWQB 3DYRA 4K7IA 4FQUA 3GNJA 1A8YA 4KDUA 1GLPA 1GUMA 1VF3A 2HSHA 2VD0A 2ZCTA 3ED3A 2X8HA 1QGVA 1LBKA 1PSQA 3EWLA 3CTFA 4IVFA 3BJ5A 3BCKA 2LTKA 2C0EA 3C8EA 1WIKA 2WULA 4TR1B 1HD2A 1ZYPA 1OE8A 2OE1A 5H5QA 2V2GA 3RHBA 4DEJA 4KA0A 3TKQA 1XWCA 4K2XA 1ERTA 2D2ZA 3Q74A 3IR4A 3GKXA 3GV1A 1T8EB 5AISA 2TRCP 3OR5A 1XWBA 3G7IA 3P2AA 4XRDA 3GH6A 1Z5YE 1BG5A 4KUNA 3C1RA 3TRQA 1PL1A 3LXZA 2KOKA 4RQXA 2OKAA 1QQ2A 1TOFA 2FGXA 5A4UA 4HZ2A 3W6GA 1RQMA 4PUAA 1A2MA 5ENUA 3ZVJA 3PINA 4RQRA 4ZBBA 2B5YA 5INYA 4WKWA 4YQMA 5KOWA 2HYXA 3HJMA 1A0RP 2VOCA 3BBYA 2X8GA 5KN3A 2H0HA 2B7JA 4P3YB 2PN8A 1MDKA 4MLYA 3IDVA 2NTOA 3H1NA 1V98A 2XC2A 1UVZA 3UAPA 2MMAA 4EDZA 3I9V2 3HZ8A 4GQCA 1NM3A 4KCAA 4RUVA 3GL3A 4GQFA 2C0FA 2XHFA 3EU4A 2GSRA 3RHCA 3RPPA 1X5EA 4MJAA 1GL8A 4YKGA 4E8EA 3LG6A 3A3TA 3LYPA 2H1DA 2JADA 2MZCA 2X49A 3F6FA 4G10A 3VWVA 5DALA 3TB2A 1TK0B 3DD3A 3ERWA 5G5FA 4KSMA 5BRTA 3KP9A 4HEA2 4PNFA 1XFLA 3VI5A 4ECJA 3IC4A 3GTUB 4O5QA 1YJ6A 1MD3A 1M7TA 1DE1A 2OE3A 2K9FA 1R7HA 5KN2A 1OAZA 4NPBA 2MMNA 4TXVA 4MA9A 3M3MA 3LQ7A 4ECBA 3CYNA 2DKIA 3IK9A 3IV4A 1LJRA 3FYGA 1JZRA 2H30A 16GSA 5JCWA 5LNKe 2R6KA 4GSTA 2FWHA 2L5OA 3WYWA 1OC3A 4GSNA 3ME8A 5AGYA 2ON7A 3W8SA 3TRPA 1SL1B 5CO3A 1GSQA 1A23A 4X0XA 4DSSB 2GQMA 1O8XA 1PRXA 17GSA 2VCVA 1N2AA 2FWGA 1ZL9A 3APOA 2PVOC 4JR6A 4POBA 1TK8B 3TKSA 5EPFA 2LUSA 1S3AA 3VWXA 2C8UA 1GWCA 4XS4A 3L4NA 1FB6A 1U3IA 3A2VA 5ECOB 3ZFLA 2I3YA 6GSXA 3KH9A 1XVQA 1HNCA 4KH7A 3WGDA 1W4VA 3KJYA 5HFKA 2HT9A 2N5AA 3F0IA 2GVPA 2R3XA 1TRUA 4XCSA 4TW5A 2IMFA 3L0HA 5HR3A 3UJ1A 4TR3A 3MYDA 5CREA 3V1WA 2GSTA 6GSYA 3H79A 1J9BA 5BMUA 4USSA 3L9UA 3EMXA 3F4TA 2HLSA 1MEKA 2E2GA 3DVXA 2OJLA 1KEBA 1B9YC 2M46A 4OO4A 1ZCPA 3H93A 2C1YA 3ZIVA 1PN0A 1AW9A 1TP9A 2V6OA 2HZFA 2H1AA 1UN2A 2E7PA 4KSOA 2L6DA 1KTEA 1TI1A 2H0IA 3KTBA 3DMLA 4HJ2A 1FVJA 3EE2A 3K8NA 2C4JA 2DMMA 4GSSA 2J23A 1AQXA 1XIYA 1BQ7A 2GZZA 5DVBA 2AYTA 4G0IA 4Q5NA 1NHOA 2CX4A 2MMOA 3UMAA 4O7HA 3ERGA 1XVWA 2C0GA 2H1BA 5CRGA 5J41A 4MZWA 4QL7A 3ZL5A 3CRTA 5IPHA 5D8IA 2YOIA 2GTUA 2WJUA 1XCCA 4FH8A 3WGXA 1TI3A 3ZZXA 4V2MA 1M9BA 2R0PA 4MPGA 2WCIA 3GKNA 1ILOA 1QFNA 3HJPA 4NV2A 1I5GA 5IIZA 1EGOA 2OBKA 2CT6A 3KCMA 4K8MA 4I2TA 3F63A 4CDOA 3HJOA 1DSBA 5B8AA 5DAKA 5DAKB 5HR2A 3ZREA 1MD4A 3KP8A 4CW9A 1ZZYA 2LJRA 2XPEA 3QD9A 1GSEA 4IQ1A 20GSA 3F9UA 1Z7RA 1T3BA 4MP4A 5ABRA 4AF2A 18GSA 1GUHA 1E6BA 1GTIA 3QCPA 4LL4B 1PX7A 1Z6NA 4JBBA 1ZYEA 1K0CA 4FO5A 1K0AA 3RPNA 5D9XA 3QAWA 2IWTA 2HXKA 3IA1A 4MPFA 2I1UA 4Z2RA 2VL9A 1GTUA 2VLTA 4L5LA 3ZVJD 3R2QA 5CRDA 3HYPA 4IP6A 3EURA 1KNGA 4JR4A 2YWNA 3APSA 4PURA 3LEFA 2H70A 3GYKA 4KDXA 1K3OA 3H4KA 2YZHA 2DJ3A 1M2DA 3ZIJA 1M2AA 2MBSA 4L5OA 1XZOA 1WPIA 1A24A 3DRNA 3UL3A 3DXBA 2G2QA 4OFNA 3D21A 3ZMLA 1DUGA 4FYUA 3C71A 2VUPA 2B7KA 4K0GA 3G9BA 1X9SB 2N5BA 2R0CA 1SKSB 2XBIA 2K8SA 2YV7A 4ZB6A 3VLNA 4ULXA 1Z6MA 4G0KA 2DLXA 2IPAA 3P90A 3M1GA 2K6VA 1TRSA 4XS6A 2P0GA 3IHQA 5CRWA 5KN0A 2DMLA 2V32A 3E9JB 4HQZA 1K0BA 3L78A 4ZIJA 1TKDB 3GSSA 2ALBA 2GQKA 3F3QA 3PR8A 5G1LA 4ECCA 4N0VA 3GMFA 2IFQB 4K7OA 1AQWA 2LRCA 3LXTA 2L6CA 4X1UA 5CAXA 5G31A 3RDWA 1R26A 1GP1A 2EIRA 2VD1A 4O5RA 4OCFA 2LJKA 3I6AA 4GRFA 14GSA 4BWSA 3ZITA 4BVYB 3VWUA 1B4PA 1UA5A 2DC5A 1GH2A 2E2MA 3TJFA 1ACVA 4NAXA 5GAND 5F0GA 3TJJA 2OA7A 3MIXA 3FKFA 3DKSA 1TJDA 3CSHA 5ID2B 2LEGA 5IMDA 2GLRA 2CV4A 2E0QA 2P31A 2YJHA 3TKRA 4BPYA 4TR1A 4J57E 2DJ0A 5ELGA 1WP0A 2L57A 3PPUA 2CZ2A 3CBUA 2WGRA 3HY2A 4AJ6A 3MDKA 1SJIA 1GRXA 1XOBA 2WS2A 1N8JA 2H01A 2VCWA 1GSDA 1HQOA 3I43A 4ML6A 4Q5RA 3EPTA 2CA8A 2B3SA 2KHPA 2GT5A 2GDRA 4N0ZA 5AIVA 1GLQA 1ST9A 5HFIA 1EEMA 1A2JA 1QXHA 2H76A 5GSTA 4CY8A 4N30A 2X99A 1I9DA 2DJ2A 4IKHA 3FEUA 4EF0A 1DE2A 2PPTA 1JLVA 1B8XA 3IAS2 1H75A 4POLA 2PGTA 2L5LA 4XRAA 3N5OA 4Z2TA 2YPMA 2YV9A 2C0DA 2F51A 4L0WA 5H5SA 1TW9A 5IMVA 9GSSA 4Z2UA 4ZL9A 4G2EA 5KN1A 2XBQA 1X9WB 1F6MC 3LW9A 1T00A 1G7OA 4Q5QA 5H5RA 1PGTA 4J56E 5L71A 4EIPA 1YEPA 4TKYA 4POKA 5LD0A 5LCZA 3W8JA 5JWRB 4V2NA 3MWHA 3UVHA 3M9KA 4KB3A 5J3RA 2NDOA 1GSYA 2A2RA 1KBNA 5DQSA 4WBRD 4NHZA 1SJZA 4MDCA 1FHEA 3GTUA 1ERVA 1SD9A 4PNGA 4KDYA 2L4QA 4EUYA 1EOHA 3MSZA 4MCUA 1XW9A 1QMVA 3HVSA 5IM9A 4ZB9A 2HZEB 4L0UA 1O85A 2AB6A 3O6TA 4ZBAA 1WOUA 4MJEA 5CNWA 1RW1A 4F2IA 5A4VA 2EIQA 3TRXA 1THOA 2RM6A 3LORA 1V58A 4X43A 2R0GA 4G9HA 1T1VA 4WXTA 3TOUA 1YDKA 1Y25A 2B5EA 2JL4A 3LYKA 3A5IA 2H8LA 3L9VA 5ECPB 3KIJA 2FA8A 2MMZA 3EMPA 2RLIA 3UBLA 1SD8A 1V40A 3CXGA 3QAVA 1JHBA 1Z9HA 4G0LA 2KP1A 1FVKA 2H71A 4TN8A 4DSSA 5D73A 5GZZB 3FRCA 5D96A 3RAZA 11GSA 2IN3A 2A2PA 4LMWA 4ILFA 3VWWA 5F05A 2HRNA 2B5XA 4IJIA 4G19A 1F2EA 1S3CA 2BTOT 3GX8A 4PXOA 1OC8A 4K7NA 4XHMA 2BMXA 1XOAA 3UARA 2DJKA 3U5RE 4MK3A 4K0NA 4IW9A 3BCIA 4DSRA 1K3YA 2KP2A 6GSWA 1OYJA 1WRYA 4HOJA 3QOUA 3CTGA 2HSYA 5J5NA 2LRNA 1U88A 4ISDA 1SKWB 2EC4A 3ZMKA 1YKCA 1JZWA 2K18A 3N9JA 2JU5A 2RM5A 1M0UA 1A8LA 3Q19A 4BL7B 1B9XC 1O8WA 5G2ZA 2LQOA 1PL2A 1YZXA 5ECNB 5IOXA 2A4VA 5ELAA 2VLUA 1NSWA 2WDUA 4EXJA 5EVOA 4MNNA 1C72A 3QR6A 3HZ4A 4KNDA 5HR0A 2AJQB 4MZBA 1AIUA 5EY6A 4IN0A 2DKHA 1RK4A 5ECKB 2DSAA 3FZ9A 1CQHA 2Z9SA 2RUEA 2KUCA 4O92A 1XBSA 1SL2B 5CP1A 5A5KA 2NBSA 1U6TA 1FW1A 2NVLA 2GGTA 3FK8A 3TCOA 2R4VA 3R3EA 3Q18A 1GSSA 2CQ9A 1GSUA 4BWQA 1XXUA 4IHUA 1V57A 4GWRA 1VF2A 4NWYA 4BVXA 4BVXB 1IYHA 4WEYA 3KGKA 2FA4A 2R5GA 3O76A 2H6XA 2LRTA 4KX4A 3GKMA 1MDIA 1HNAA 2HRFA 5FT3A 5JCGA 3F8UA 5FHIA 4K5SA 4IELA 3D5JA 4BA7A 3ZFBA 3J7Yk 2H72A 2NPBA 4X4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7GSS A;  4MAB A;  3WT2 A;  5E59 A;  2VL2 C;  1X5D A;  2ES7 A;  2HI7 A;  2K8V A;  3IPZ A;  5GAP D;  1PN9 A;  1HYU A;  2N5F A;  2OE0 A;  4ML1 A;  2LNS A;  1G0T A;  3D4T A;  3M8N A;  3D22 A;  1FOV A;  2YZU A;  3ZRD A;  2WZ9 A;  1W89 A;  4I6X A;  1GNW A;  5F06 A;  5A4W A;  5D9V A;  1K0N A;  1WJK A;  4WR4 A;  1YF0 A;  4WET A;  2YWO A;  4GXZ A;  2C80 A;  4JRR A;  1IYI A;  5B8B A;  4TRX A;  1YY7 A;  1EGR A;  1BX9 A;  4HU9 A;  1O6J A;  1GTB A;  3SBC A;  1T4Y A;  1BJX A;  4N11 A;  1X0R A;  1GUK A;  1TXX A;  3QPM A;  2C3Q A;  1OE7 A;  1O81 A;  1Z3E A;  4OMV A;  2G0F A;  2DBC A;  3F4S A;  4YAV A;  1ZGN A;  1ML6 A;  1S3D A;  1AUC A;  3KTL A;  3P8W A;  1A0F A;  1VF1 A;  3WT1 A;  3FHK A;  3TKS C;  3MNG A;  3PH9 A;  5AN1 A;  1TRV A;  4NMU A;  2FHE A;  4D73 B;  4JZQ A;  4QL9 A;  5IPG A;  3HKR A;  2GSQ A;  4AJ8 A;  2ON5 A;  4IQA A;  2J9H A;  4K6X A;  4TOP A;  3HCZ A;  1Y6E A;  1O73 A;  4JU5 A;  3TJK A;  2VM2 A;  4EDY A;  4YQU A;  5ECR B;  5IOW A;  2F3M A;  2QC7 A;  1A2L A;  5DQY A;  3A2W A;  2H6Y A;  1PMT A;  1MTC A;  1GUL A;  2IL3 A;  4ECI A;  2QSI A;  1QUW A;  5B6M A;  2CZ3 A;  5C04 A;  2ZUP A;  2I81 A;  2I4A A;  2YWM A;  3TOT A;  1OVN A;  1ZOF A;  3GKK A;  2FWF A;  4HUA A;  4LA1 A;  4MF5 A;  2ZNM A;  1FB0 A;  3WGE A;  5IMF A;  2VIM A;  1MDJ A;  1NHY A;  2IFQ A;  1PD2 1;  2V1M A;  3PGT A;  1K0M A;  2WB9 A;  6GSV A;  1TDI A;  5IMA A;  1NW2 A;  4ZIL A;  1ZYQ B;  2FLS A;  1BYE A;  3GUR A;  3LJR A;  1EZK A;  2P5Q A;  4KGI A;  5DCH A;  1E2Y A;  2AV4 A;  4PQI A;  2H74 A;  2HE3 A;  3TJG A;  3D6I A;  2L4C A;  12GS A;  3TGZ A;  3VPT A;  2A2S A;  2H1G A;  4GTU A;  5DCG A;  1R4W A;  2F8F A;  4BVY A;  2BJX A;  4OFM A;  1ERW A;  1XW6 A;  2YJ7 A;  5HFG A;  1EP7 A;  1OC9 B;  2MYG A;  1AAZ A;  5C00 A;  2KLX A;  1TU8 A;  4JE1 A;  5ID2 A;  1ERU A;  4IS0 A;  2H0G A;  3GH9 A;  4ZL7 A;  5JCU A;  2IMK A;  4OCE A;  1X5C A;  4PX1 A;  5KEJ A;  4GLT A;  4CHS A;  3LFL A;  3NOF A;  5DDL A;  2LST A;  5IMC A;  4LLR A;  3Q6O A;  2V6K A;  1XW5 A;  1EWX A;  3M9J A;  4XTS A;  3TDG A;  3CRU A;  1FO5 A;  1URM A;  1R5P A;  2OAD A;  2GQL A;  3KMN A;  2QKE A;  2R37 A;  3GHA A;  1FAA A;  4V1A p;  3UOM A;  1SKR B;  2GS3 A;  3QFA C;  2PMT A;  6GST A;  3CSJ A;  5D93 A;  3FR9 A;  1USB A;  3QAG A;  2EIO A;  1G6W A;  2JSY A;  4H86 A;  3FY7 A;  1XPV A;  4F03 A;  3ERF A;  3NZN A;  3HA9 A;  1V2A A;  1YF1 A;  1PX6 A;  5COH A;  3FW2 A;  2HNL A;  5F07 A;  1SK2 A;  10GS A;  4POM A;  3UEM A;  2XPD A;  4FYB A;  1YEX A;  4HU7 A;  1ABA A;  2R2J A;  1K0O A;  1OKT A;  4F0B A;  2FCH A;  2VLV A;  3DEX A;  4KW6 A;  1K0D A;  3HXS A;  1SU9 A;  2VM1 A;  2IIY A;  1PKW A;  1VGL A;  4HQS A;  3GFK A;  1G6Y A;  4PQH A;  3E0U A;  2C3N A;  2X64 A;  4WR5 A;  3KD0 A;  1JLW A;  4TR0 A;  2B6M A;  2FY6 A;  2FD3 A;  3BOA A;  4O32 A;  5ECI B;  4RI7 A;  5IO2 A;  4MZC A;  3F6D A;  3GUS A;  1EP8 A;  4NV5 A;  1XWG A;  5ECQ B;  4J2F A;  1M99 A;  2LQQ A;  3EIN A;  4YAP A;  2VL2 A;  2YAN A;  3CSI A;  4NXI A;  4HZ4 A;  4KE3 A;  5DAL B;  3FZA A;  2HZE A;  4MF7 A;  1AQV A;  5GSS A;  3IBH A;  2O87 A;  1SEN A;  2VCT A;  4KCE A;  4Z7X A;  4YQV A;  2H75 A;  4K9Z A;  1Q4J A;  4ID0 A;  3VI7 A;  2VL3 A;  4MMM A;  4ZB8 A;  4FIW A;  4GF0 A;  2CVK A;  1BAY A;  4EKZ A;  3D4M A;  3S9F A;  1PQN A;  3FZ5 A;  3IAM 2;  3APQ A;  3GX0 A;  2PUK C;  5AIX A;  4F0C A;  4F82 A;  3GIX A;  3KEB A;  2FWE A;  2DIZ A;  2CX3 A;  4MJC A;  1JZO A;  3RBT A;  2YNX A;  2DIY A;  3E3E A;  5J9C A;  4IBP A;  2M72 A;  2C3T A;  3UBK A;  3IK7 A;  3IRA A;  3GST A;  2H19 A;  2LV3 A;  3EC3 A;  5ECS A;  1PA3 A;  3ISO A;  2IMI A;  3EYT A;  2CVD A;  2B1L A;  1EV4 A;  2O89 A;  4DVC A;  4OFT A;  4XS4 B;  2QGV A;  5EL8 A;  3ZTL A;  2FNO A;  3DWV A;  1SK0 A;  2HFD A;  5HR1 A;  1SL0 B;  3VUR A;  2VO4 A;  4N10 A;  5ECL B;  2AUV A;  1J08 A;  2YP6 A;  2YN1 A;  4PQ1 A;  3TKS E;  1Q98 A;  2MBT A;  4IGJ A;  3D0Z A;  4ACS A;  2L59 A;  2LJA A;  1Z7P A;  3GRX A;  3IXR A;  2X8C A;  1TK5 B;  4RI6 A;  3C73 A;  2GSS A;  4BL7 A;  3EU3 A;  2RUF A;  1WWJ A;  6GSU A;  1F37 A;  1FG4 A;  3HD5 A;  1H4O A;  1EOG A;  2TIR A;  2GZY A;  3QMX A;  3FR6 A;  1SK1 A;  4I5Q A;  1ON4 A;  4ZXG A;  1ZMA A;  5D9W A;  2PER A;  3NIV A;  1QK8 A;  1F3B A;  2JZT A;  3HDC A;  4JED A;  3DIE A;  4F9Z A;  2RII A;  4WF4 A;  3QDN A;  4V1A g;  1GSF A;  3F3R A;  3TUE A;  3LWA A;  3L9S A;  2M80 A;  6GSS A;  1X9M B;  1YQ1 A;  3UIW A;  2LNT A;  3US3 A;  2VCQ A;  2WRT A;  3EVI A;  1AXD A;  2GT6 A;  1GTA A;  8GSS A;  3BD2 A;  4HJM A;  2H66 A;  1V9W A;  2JZS A;  3TKP A;  1JFU A;  2B1K A;  3AY8 A;  4I2U A;  1HNB A;  4LMV A;  3O3T A;  1GNE A;  2AAW A;  2JAC A;  3LGC A;  3QFB C;  4QQ7 A;  2VCX A;  4EL1 A;  2JZR A;  5G30 A;  3KZQ A;  2LS5 A;  4IJ3 A;  4EC0 A;  2YCD A;  4EVM A;  5J9B A;  1AC1 A;  3C1S A;  5CYY A;  1UC7 A;  1U87 A;  1TU7 A;  2OAC A;  4DSQ A;  5CRH A;  3VFI A;  2V41 A;  3MAK A;  5F8B A;  1VRS D;  5B6N A;  4HI7 A;  2P5R A;  4XIH A;  1EEJ A;  3U6V A;  4MH2 A;  2PVQ A;  4TR4 A;  3CMI A;  3VPQ A;  5D9T A;  4E8H A;  5G1K A;  4ZBD A;  3ME7 A;  1F9M A;  1WMJ A;  3HHV A;  2IMD A;  5DBQ A;  3M0F A;  2I9H A;  5FWG A;  3A5W A;  5IMZ A;  3JCM L;  4GCI A;  2VAF A;  2VCZ A;  3C7M A;  5J4U A;  1F3A A;  2IJY A;  4AJ7 A;  1M9A A;  1YKA A;  4I97 A;  4FYC A;  1XWA A;  2CAI A;  1M2B A;  3SWL A;  3GA4 A;  4MF6 A;  3WD6 A;  1T4Z A;  3LSZ A;  3FZ4 A;  4YH2 A;  3GN3 A;  5IQY A;  4Q5F A;  2F9S A;  1TTZ A;  4AGS A;  4ZL8 A;  3H8Q A;  4XS1 A;  1R5A A;  2F8A A;  2O85 A;  5IO0 A;  1G7E A;  1CQG A;  3I69 A;  2H73 A;  1LU4 A;  3J7Y b;  3G7Y A;  4K1F A;  4MJB A;  19GS A;  5ECH B;  1SYX A;  4TVE A;  3GL5 A;  5E4W A;  3DVW A;  4NHW A;  1OKD A;  2FUG 2;  2IME A;  1B48 A;  4D73 A;  2O7K A;  3A2X A;  2AHE A;  2WFC A;  1T7P B;  4PGT A;  2CVB A;  2CAQ A;  2JSZ A;  3DGQ A;  4L8E A;  4OWY A;  4IP1 A;  3FR3 A;  4V2L A;  1WE0 A;  1TRW A;  5DJL A;  22GS A;  1VF4 A;  1J0F A;  3TJB A;  4TXO A;  4TXO B;  3ZYW A;  1K3L A;  5G5E A;  5HQP A;  13GS A;  4HDE A;  1THX A;  2REM A;  2DJJ A;  3VK9 A;  3KH7 A;  2YWI A;  1SJ6 A;  2TRX A;  3ZLP A;  1O7U A;  2H6Z A;  1XWK A;  3F4R A;  4EE0 A;  4OD7 A;  4I8B A;  1EV9 A;  3G7J A;  3IOS A;  2O8V B;  2LKU A;  4MH3 A;  2OBI A;  3HVX A;  4KAE A;  5JWO B;  4HS1 A;  1JZD A;  4EO3 A;  5ECM B;  5DJM A;  1DBY A;  4WBJ A;  3KXO A;  2PWJ A;  1SYR A;  4PUF C;  2PBJ A;  2DJ1 A;  3HVV A;  1PKZ A;  3KM6 A;  4K2D A;  5B7C A;  3IE3 A;  3KMO A;  4LL1 B;  2PU9 C;  4OO5 A;  1BED A;  1B4Q A;  4WF5 A;  3P7X A;  3UVT A;  2GZP A;  1OC9 A;  1U3A A;  5JWQ B;  3DYR A;  4K7I A;  3GNJ A;  1A8Y A;  4KDU A;  1GLP A;  1GUM A;  1VF3 A;  2HSH A;  2VD0 A;  2ZCT A;  3ED3 A;  2X8H A;  1QGV A;  1LBK A;  1PSQ A;  3EWL A;  3CTF A;  4IVF A;  3BJ5 A;  3BCK A;  2LTK A;  2C0E A;  3C8E A;  1WIK A;  2WUL A;  4TR1 B;  1HD2 A;  1OE8 A;  2OE1 A;  5H5Q A;  2V2G A;  3RHB A;  4DEJ A;  4KA0 A;  3TKQ A;  1XWC A;  1ERT A;  2D2Z A;  3Q74 A;  3IR4 A;  3GKX A;  3GV1 A;  1T8E B;  5AIS A;  2TRC P;  3OR5 A;  1XWB A;  3G7I A;  3P2A A;  4XRD A;  3GH6 A;  1Z5Y E;  1BG5 A;  4KUN A;  3C1R A;  3TRQ A;  1PL1 A;  3LXZ A;  2KOK A;  4RQX A;  2OKA A;  1QQ2 A;  1TOF A;  2FGX A;  5A4U A;  4HZ2 A;  3W6G A;  1RQM A;  4PUA A;  1A2M A;  5ENU A;  3ZVJ A;  3PIN A;  4RQR A;  4ZBB A;  2B5Y A;  5INY A;  4WKW A;  4YQM A;  2HYX A;  3HJM A;  1A0R P;  2VOC A;  3BBY A;  2X8G A;  5KN3 A;  2H0H A;  2B7J A;  4P3Y B;  2PN8 A;  1MDK A;  4MLY A;  3IDV A;  2NTO A;  3H1N A;  1V98 A;  2XC2 A;  1UVZ A;  3UAP A;  2MMA A;  4EDZ A;  3I9V 2;  3HZ8 A;  4GQC A;  1NM3 A;  4KCA A;  4RUV A;  3GL3 A;  4GQF A;  2C0F A;  2XHF A;  3EU4 A;  2GSR A;  3RHC A;  3RPP A;  1X5E A;  4MJA A;  1GL8 A;  4E8E A;  3LG6 A;  3A3T A;  3LYP A;  2H1D A;  2JAD A;  2MZC A;  3F6F A;  4G10 A;  3VWV A;  5DAL A;  3TB2 A;  1TK0 B;  3DD3 A;  3ERW A;  5G5F A;  4KSM A;  3KP9 A;  4HEA 2;  4PNF A;  1XFL A;  3VI5 A;  4ECJ A;  3IC4 A;  3GTU B;  1YJ6 A;  1MD3 A;  1M7T A;  1DE1 A;  2OE3 A;  2K9F A;  1R7H A;  5KN2 A;  1OAZ A;  4NPB A;  2MMN A;  4TXV A;  4MA9 A;  3M3M A;  3LQ7 A;  4ECB A;  3CYN A;  3IK9 A;  3IV4 A;  1LJR A;  3FYG A;  1JZR A;  2H30 A;  16GS A;  5JCW A;  5LNK e;  2R6K A;  4GST A;  2FWH A;  2L5O A;  3WYW A;  1OC3 A;  4GSN A;  3ME8 A;  5AGY A;  2ON7 A;  3W8S A;  3TRP A;  1SL1 B;  5CO3 A;  1GSQ A;  1A23 A;  4X0X A;  4DSS B;  2GQM A;  1O8X A;  1PRX A;  17GS A;  2VCV A;  1N2A A;  2FWG A;  1ZL9 A;  3APO A;  2PVO C;  4JR6 A;  4POB A;  1TK8 B;  3TKS A;  5EPF A;  2LUS A;  1S3A A;  3VWX A;  2C8U A;  1GWC A;  4XS4 A;  3L4N A;  1FB6 A;  5ECO B;  1U3I A;  3A2V A;  3ZFL A;  2I3Y A;  6GSX A;  3KH9 A;  1XVQ A;  1HNC A;  4KH7 A;  3WGD A;  1W4V A;  3KJY A;  5HFK A;  2HT9 A;  2N5A A;  3F0I A;  2GVP A;  2R3X A;  1TRU A;  4XCS A;  4TW5 A;  2IMF A;  3L0H A;  5HR3 A;  3UJ1 A;  4TR3 A;  5CRE A;  3V1W A;  2GST A;  6GSY A;  3H79 A;  1J9B A;  3L9U A;  3EMX A;  3F4T A;  2HLS A;  1MEK A;  2E2G A;  3DVX A;  2OJL A;  1KEB A;  1B9Y C;  2M46 A;  4OO4 A;  1ZCP A;  3H93 A;  2C1Y A;  3ZIV A;  1AW9 A;  1TP9 A;  2V6O A;  2HZF A;  2H1A A;  1UN2 A;  2E7P A;  4KSO A;  2L6D A;  1KTE A;  1TI1 A;  2H0I A;  3KTB A;  3DML A;  4HJ2 A;  1FVJ A;  3EE2 A;  3K8N A;  2C4J A;  2DMM A;  4GSS A;  2J23 A;  1AQX A;  1XIY A;  1BQ7 A;  2GZZ A;  5DVB A;  2AYT A;  4Q5N A;  1NHO A;  2CX4 A;  2MMO A;  3UMA A;  4O7H A;  3ERG A;  1XVW A;  2C0G A;  2H1B A;  5CRG A;  5J41 A;  4MZW A;  4QL7 A;  3ZL5 A;  3CRT A;  5IPH A;  5D8I A;  2YOI A;  2GTU A;  2WJU A;  1XCC A;  4FH8 A;  3WGX A;  1TI3 A;  3ZZX A;  4V2M A;  1M9B A;  4MPG A;  2WCI A;  3GKN A;  1ILO A;  1QFN A;  3HJP A;  4NV2 A;  1I5G A;  5IIZ A;  1EGO A;  2OBK A;  2CT6 A;  3KCM A;  4K8M A;  4I2T A;  3F63 A;  4CDO A;  3HJO A;  1DSB A;  5B8A A;  5DAK A;  5DAK B;  5HR2 A;  3ZRE A;  1MD4 A;  3KP8 A;  4CW9 A;  1ZZY A;  2LJR A;  2XPE A;  3QD9 A;  1GSE A;  4IQ1 A;  20GS A;  3F9U A;  1Z7R A;  1T3B A;  4MP4 A;  5ABR A;  4AF2 A;  18GS A;  1GUH A;  1E6B A;  1GTI A;  3QCP A;  4LL4 B;  1PX7 A;  1Z6N A;  4JBB A;  1ZYE A;  1K0C A;  4FO5 A;  1K0A A;  3RPN A;  5D9X A;  3QAW A;  2IWT A;  2HXK A;  3IA1 A;  4MPF A;  2I1U A;  2VL9 A;  1GTU A;  2VLT A;  4L5L A;  3ZVJ D;  3R2Q A;  5CRD A;  3HYP A;  4IP6 A;  3EUR A;  1KNG A;  4JR4 A;  2YWN A;  3APS A;  4PUR A;  3LEF A;  2H70 A;  3GYK A;  4KDX A;  1K3O A;  3H4K A;  2YZH A;  2DJ3 A;  1M2D A;  3ZIJ A;  1M2A A;  2MBS A;  4L5O A;  1XZO A;  1WPI A;  1A24 A;  3DRN A;  3UL3 A;  3DXB A;  2G2Q A;  4OFN A;  3D21 A;  3ZML A;  1DUG A;  4FYU A;  3C71 A;  2VUP A;  2B7K A;  4K0G A;  3G9B A;  1X9S B;  2N5B A;  1SKS B;  2XBI A;  2K8S A;  2YV7 A;  4ZB6 A;  3VLN A;  4ULX A;  1Z6M A;  2DLX A;  2IPA A;  3P90 A;  3M1G A;  2K6V A;  1TRS A;  4XS6 A;  2P0G A;  3IHQ A;  5CRW A;  5KN0 A;  2DML A;  2V32 A;  3E9J B;  4HQZ A;  1K0B A;  3L78 A;  4ZIJ A;  1TKD B;  3GSS A;  2ALB A;  2GQK A;  3F3Q A;  3PR8 A;  5G1L A;  4ECC A;  4N0V A;  3GMF A;  2IFQ B;  4K7O A;  1AQW A;  2LRC A;  3LXT A;  2L6C A;  4X1U A;  5CAX A;  5G31 A;  3RDW A;  1R26 A;  1GP1 A;  2EIR A;  2VD1 A;  4O5R A;  4OCF A;  2LJK A;  3I6A A;  4GRF A;  14GS A;  4BWS A;  3ZIT A;  3VWU A;  1B4P A;  1UA5 A;  2DC5 A;  1GH2 A;  2E2M A;  3TJF A;  1ACV A;  4NAX A;  5GAN D;  5F0G A;  3TJJ A;  2OA7 A;  3FKF A;  3DKS A;  1TJD A;  3CSH A;  5ID2 B;  2LEG A;  5IMD A;  2GLR A;  2CV4 A;  2E0Q A;  2P31 A;  2YJH A;  3TKR A;  4BPY A;  4TR1 A;  4J57 E;  2DJ0 A;  5ELG A;  1WP0 A;  2L57 A;  2CZ2 A;  3CBU A;  2WGR A;  3HY2 A;  4AJ6 A;  3MDK A;  1SJI A;  1GRX A;  1XOB A;  2WS2 A;  1N8J A;  2H01 A;  2VCW A;  1GSD A;  1HQO A;  3I43 A;  4ML6 A;  4Q5R A;  2CA8 A;  2B3S A;  2KHP A;  2GT5 A;  2GDR A;  4N0Z A;  5AIV A;  1GLQ A;  1ST9 A;  5HFI A;  1EEM A;  1A2J A;  1QXH A;  2H76 A;  5GST A;  4N30 A;  2X99 A;  1I9D A;  2DJ2 A;  4IKH A;  3FEU A;  4EF0 A;  1DE2 A;  2PPT A;  1JLV A;  1B8X A;  3IAS 2;  1H75 A;  4POL A;  2PGT A;  2L5L A;  4XRA A;  3N5O A;  2YPM A;  2YV9 A;  2C0D A;  2F51 A;  4L0W A;  5H5S A;  1TW9 A;  5IMV A;  9GSS A;  4ZL9 A;  4G2E A;  5KN1 A;  2XBQ A;  1X9W B;  1F6M C;  1T00 A;  1G7O A;  4Q5Q A;  5H5R A;  1PGT A;  4J56 E;  5L71 A;  1YEP A;  4TKY A;  4POK A;  5LD0 A;  5LCZ A;  3W8J A;  5JWR B;  4V2N A;  3MWH A;  3UVH A;  3M9K A;  4KB3 A;  5J3R A;  2NDO A;  1GSY A;  2A2R A;  1KBN A;  5DQS A;  4WBR D;  4NHZ A;  1SJZ A;  4MDC A;  1FHE A;  3GTU A;  1ERV A;  1SD9 A;  4PNG A;  4KDY A;  2L4Q A;  4EUY A;  1EOH A;  3MSZ A;  4MCU A;  1XW9 A;  1QMV A;  3HVS A;  5IM9 A;  4ZB9 A;  2HZE B;  4L0U A;  1O85 A;  2AB6 A;  3O6T A;  4ZBA A;  1WOU A;  4MJE A;  5CNW A;  1RW1 A;  4F2I A;  5A4V A;  2EIQ A;  3TRX A;  1THO A;  2RM6 A;  3LOR A;  1V58 A;  4X43 A;  4G9H A;  1T1V A;  4WXT A;  3TOU A;  1YDK A;  1Y25 A;  2B5E A;  2JL4 A;  3LYK A;  2H8L A;  3L9V A;  5ECP B;  3KIJ A;  2FA8 A;  2MMZ A;  3EMP A;  2RLI A;  3UBL A;  1SD8 A;  1V40 A;  3CXG A;  3QAV A;  1JHB A;  1Z9H A;  2KP1 A;  1FVK A;  2H71 A;  4TN8 A;  4DSS A;  5D73 A;  5GZZ B;  3FRC A;  5D96 A;  3RAZ A;  11GS A;  2IN3 A;  4LMW A;  4ILF A;  3VWW A;  5F05 A;  2HRN A;  2B5X A;  4IJI A;  4G19 A;  1F2E A;  1S3C A;  2BTO T;  3GX8 A;  4PXO A;  1OC8 A;  4K7N A;  4XHM A;  2BMX A;  1XOA A;  3UAR A;  2DJK A;  3U5R E;  4MK3 A;  4K0N A;  4IW9 A;  3BCI A;  4DSR A;  1K3Y A;  2KP2 A;  6GSW A;  1OYJ A;  1WRY A;  4HOJ A;  3QOU A;  3CTG A;  2HSY A;  5J5N A;  2LRN A;  1U88 A;  4ISD A;  1SKW B;  2EC4 A;  3ZMK A;  1YKC A;  1JZW A;  2K18 A;  3N9J A;  2JU5 A;  2RM5 A;  1M0U A;  1A8L A;  3Q19 A;  1B9X C;  1O8W A;  5G2Z A;  2LQO A;  1PL2 A;  1YZX A;  5ECN B;  5IOX A;  2A4V A;  5ELA A;  2VLU A;  1NSW A;  2WDU A;  4EXJ A;  5EVO A;  1C72 A;  3QR6 A;  3HZ4 A;  4KND A;  5HR0 A;  2AJQ B;  4MZB A;  1AIU A;  5EY6 A;  4IN0 A;  1RK4 A;  5ECK B;  2DSA A;  3FZ9 A;  1CQH A;  2Z9S A;  2RUE A;  2KUC A;  4O92 A;  1XBS A;  1SL2 B;  5CP1 A;  5A5K A;  2NBS A;  1U6T A;  1FW1 A;  2NVL A;  2GGT A;  3FK8 A;  3TCO A;  2R4V A;  3Q18 A;  1GSS A;  2CQ9 A;  1GSU A;  4BWQ A;  1XXU A;  4IHU A;  1V57 A;  4GWR A;  1VF2 A;  4NWY A;  4BVX A;  1IYH A;  4WEY A;  3KGK A;  2FA4 A;  2R5G A;  3O76 A;  2H6X A;  2LRT A;  4KX4 A;  3GKM A;  1MDI A;  1HNA A;  2HRF A;  5FT3 A;  5JCG A;  3F8U A;  5FHI A;  4IEL A;  3D5J A;  4BA7 A;  3ZFB A;  3J7Y k;  2H72 A;  2NPB A; 
#chains in the Genus database with same CATH topology
 7GSS A;  4MAB A;  3WT2 A;  5E59 A;  2VL2 C;  1X5D A;  2ES7 A;  2HI7 A;  2K8V A;  3IPZ A;  5GAP D;  1PN9 A;  1HYU A;  2N5F A;  2OE0 A;  4ML1 A;  2LNS A;  1G0T A;  3D4T A;  3M8N A;  3D22 A;  1FOV A;  2YZU A;  3ZRD A;  2WZ9 A;  1W89 A;  4I6X A;  1GNW A;  5F06 A;  5A4W A;  5D9V A;  1K0N A;  1WJK A;  4WR4 A;  1YF0 A;  4WET A;  2YWO A;  4GXZ A;  2C80 A;  4JRR A;  1IYI A;  5B8B A;  4TRX A;  1YY7 A;  1EGR A;  1BX9 A;  4HU9 A;  1O6J A;  1GTB A;  3SBC A;  1T4Y A;  1BJX A;  4N11 A;  1X0R A;  1GUK A;  1TXX A;  3QPM A;  2C3Q A;  1OE7 A;  1O81 A;  1Z3E A;  4OMV A;  2G0F A;  2DBC A;  3F4S A;  4YAV A;  2A4H A;  1ZGN A;  1ML6 A;  1S3D A;  1AUC A;  3KTL A;  3P8W A;  1A0F A;  1VF1 A;  3WT1 A;  4A5P A;  3FHK A;  3TKS C;  3MNG A;  3PH9 A;  5AN1 A;  1TRV A;  4NMU A;  2FHE A;  4D73 B;  4JZQ A;  4QL9 A;  5IPG A;  3HKR A;  2GSQ A;  4AJ8 A;  2ON5 A;  4IQA A;  2J9H A;  4K6X A;  4TOP A;  3HCZ A;  1Y6E A;  1O73 A;  4JU5 A;  1M3J A;  3TJK A;  2VM2 A;  4EDY A;  4YQU A;  4HSC X;  5ECR B;  5IOW A;  2F3M A;  2QC7 A;  1A2L A;  5DQY A;  3A2W A;  2H6Y A;  1PMT A;  1MTC A;  1GUL A;  2IL3 A;  4ECI A;  2QSI A;  1QUW A;  5B6M A;  2CZ3 A;  5C04 A;  2ZUP A;  2I81 A;  2I4A A;  2YWM A;  3TOT A;  1OVN A;  1ZOF A;  3GKK A;  2FWF A;  4HUA A;  4LA1 A;  4MF5 A;  2ZNM A;  1FB0 A;  3WGE A;  5IMF A;  2VIM A;  1MDJ A;  1NHY A;  2IFQ A;  1PD2 1;  2V1M A;  3PGT A;  1K0M A;  2WB9 A;  6GSV A;  1TDI A;  5IMA A;  1NW2 A;  4ZIL A;  1ZYQ B;  2FLS A;  1BYE A;  3GUR A;  3LJR A;  4EIQ A;  1EZK A;  2P5Q A;  4KGI A;  5DCH A;  1E2Y A;  2HRK A;  2AV4 A;  4PQI A;  2H74 A;  2HE3 A;  3TJG A;  3D6I A;  2L4C A;  12GS A;  3TGZ A;  3VPT A;  2A2S A;  2H1G A;  4GTU A;  5KOX A;  5DCG A;  1R4W A;  2F8F A;  4BVY A;  2BJX A;  4OFM A;  1ERW A;  1XW6 A;  2UZ8 A;  2YJ7 A;  5HFG A;  1EP7 A;  1OC9 B;  2MYG A;  1AAZ A;  5C00 A;  2KLX A;  1TU8 A;  4JE1 A;  5ID2 A;  1ERU A;  4IS0 A;  2H0G A;  3GH9 A;  4ZL7 A;  5JCU A;  2IMK A;  4OCE A;  1X5C A;  4PX1 A;  5KEJ A;  4GLT A;  4CHS A;  3LFL A;  3NOF A;  5DDL A;  2LST A;  5IMC A;  4LLR A;  3Q6O A;  2V6K A;  1XW5 A;  1EWX A;  3M9J A;  4XTS A;  3TDG A;  3CRU A;  1FO5 A;  1URM A;  1R5P A;  2OAD A;  2GQL A;  3KMN A;  2QKE A;  2R37 A;  3GHA A;  1FAA A;  4V1A p;  3UOM A;  1SKR B;  2GS3 A;  3QFA C;  2PMT A;  6GST A;  3CSJ A;  5D93 A;  3FR9 A;  1USB A;  3QAG A;  2EIO A;  1G6W A;  2JSY A;  4H86 A;  3FY7 A;  1XPV A;  4F03 A;  3ERF A;  3NZN A;  3HA9 A;  1V2A A;  1YF1 A;  1PX6 A;  5COH A;  3FW2 A;  2HNL A;  5F07 A;  1SK2 A;  10GS A;  4POM A;  4KF9 A;  3UEM A;  2XPD A;  4FYB A;  1YEX A;  4HU7 A;  1ABA A;  2R2J A;  1K0O A;  1OKT A;  4F0B A;  2FCH A;  2VLV A;  3DEX A;  4KW6 A;  1K0D A;  3HXS A;  1SU9 A;  2VM1 A;  2IIY A;  1PKW A;  1VGL A;  4HQS A;  4YKF A;  3GFK A;  1G6Y A;  4PQH A;  3E0U A;  2C3N A;  2X64 A;  4WR5 A;  3KD0 A;  1JLW A;  4TR0 A;  2B6M A;  2FY6 A;  2FD3 A;  3BOA A;  4O32 A;  5ECI B;  4RI7 A;  5IO2 A;  4MZC A;  3F6D A;  3GUS A;  1EP8 A;  4NV5 A;  1XWG A;  5ECQ B;  4J2F A;  1M99 A;  2LQQ A;  3EIN A;  4YAP A;  2VL2 A;  2YAN A;  3CSI A;  4NXI A;  3HVN A;  4HZ4 A;  4KE3 A;  5DAL B;  3FZA A;  2HZE A;  4MF7 A;  1AQV A;  5GSS A;  3IBH A;  2O87 A;  1SEN A;  2VCT A;  4KCE A;  4Z7X A;  2QA2 A;  4YQV A;  2H75 A;  4K9Z A;  1Q4J A;  4ID0 A;  3VI7 A;  2VL3 A;  4MMM A;  4ZB8 A;  1ZYN A;  4FIW A;  4GF0 A;  2CVK A;  1BAY A;  4EKZ A;  3D4M A;  3S9F A;  2HSM A;  1PQN A;  3FZ5 A;  3IAM 2;  3APQ A;  3GX0 A;  2PUK C;  5AIX A;  4F0C A;  4F82 A;  3GIX A;  3KEB A;  2FWE A;  2DIZ A;  2CX3 A;  4MJC A;  1JZO A;  3RBT A;  2YNX A;  2DIY A;  3E3E A;  5J9C A;  4IBP A;  2M72 A;  2C3T A;  3UBK A;  3IK7 A;  3IRA A;  3GST A;  2H19 A;  2LV3 A;  3EC3 A;  5ECS A;  1PA3 A;  3ISO A;  2IMI A;  3EYT A;  2CVD A;  2B1L A;  1EV4 A;  3IC8 A;  2O89 A;  4DVC A;  4OFT A;  4XS4 B;  2QGV A;  5EL8 A;  3ZTL A;  2FNO A;  3DWV A;  1SK0 A;  2HFD A;  5HR1 A;  1SL0 B;  3VUR A;  2VO4 A;  4N10 A;  5ECL B;  2AUV A;  1J08 A;  2YP6 A;  2YN1 A;  4PQ1 A;  3TKS E;  1Q98 A;  2MBT A;  4IGJ A;  3D0Z A;  4ACS A;  2L59 A;  2LJA A;  1Z7P A;  3GRX A;  3IXR A;  2X8C A;  1TK5 B;  4RI6 A;  3C73 A;  2GSS A;  4BL7 A;  3EU3 A;  2RUF A;  1WWJ A;  6GSU A;  1F37 A;  1FG4 A;  3HD5 A;  1H4O A;  1EOG A;  2TIR A;  2GZY A;  3QMX A;  3FR6 A;  1SK1 A;  4I5Q A;  1ON4 A;  4ZXG A;  4PTS A;  1ZMA A;  5D9W A;  2PER A;  3NIV A;  1QK8 A;  1F3B A;  2JZT A;  3HDC A;  4JED A;  3DIE A;  4F9Z A;  2RII A;  4WF4 A;  3FMW A;  3QDN A;  4V1A g;  1GSF A;  3F3R A;  3TUE A;  3LWA A;  3L9S A;  2M80 A;  6GSS A;  1X9M B;  1YQ1 A;  3UIW A;  2LNT A;  3US3 A;  2VCQ A;  2WRT A;  3EVI A;  1AXD A;  2GT6 A;  1GTA A;  8GSS A;  3BD2 A;  4HJM A;  2H66 A;  1V9W A;  2JZS A;  3TKP A;  1JFU A;  2B1K A;  3AY8 A;  4I2U A;  1HNB A;  4O5U A;  4LMV A;  3O3T A;  1GNE A;  2AAW A;  2JAC A;  3LGC A;  3QFB C;  4QQ7 A;  2VCX A;  4EL1 A;  2JZR A;  5G30 A;  3KZQ A;  2LS5 A;  4IJ3 A;  4EC0 A;  2YCD A;  4EVM A;  5J9B A;  1AC1 A;  3C1S A;  5CYY A;  1UC7 A;  1U87 A;  1TU7 A;  2OAC A;  2X4A A;  4DSQ A;  5CRH A;  3VFI A;  2V41 A;  3MAK A;  5F8B A;  1VRS D;  5B6N A;  4HI7 A;  2P5R A;  4ICY A;  4XIH A;  1EEJ A;  3U6V A;  4MH2 A;  2PVQ A;  4TR4 A;  3CMI A;  3VPQ A;  5D9T A;  4E8H A;  5G1K A;  4ZBD A;  3ME7 A;  1F9M A;  1WMJ A;  3HHV A;  2IMD A;  5DBQ A;  3M0F A;  2I9H A;  5FWG A;  3A5W A;  5IMZ A;  3JCM L;  4GCI A;  2VAF A;  2VCZ A;  3C7M A;  5J4U A;  1F3A A;  2IJY A;  4AJ7 A;  1M9A A;  1YKA A;  4K5R A;  2HRA A;  4I97 A;  4FYC A;  1XWA A;  2CAI A;  1M2B A;  3SWL A;  3GA4 A;  4MF6 A;  3WD6 A;  1T4Z A;  3LSZ A;  3FZ4 A;  2QA1 A;  4YH2 A;  3GN3 A;  1FOH A;  5IQY A;  4Q5F A;  2F9S A;  1TTZ A;  4AGS A;  4ZL8 A;  3H8Q A;  4XS1 A;  1R5A A;  2F8A A;  2O85 A;  5IO0 A;  1G7E A;  1CQG A;  3I69 A;  2H73 A;  1LU4 A;  3IHG A;  3J7Y b;  3G7Y A;  4K1F A;  4MJB A;  19GS A;  5ECH B;  1SYX A;  4TVE A;  3GL5 A;  5E4W A;  3DVW A;  4NHW A;  1OKD A;  2FUG 2;  2IME A;  1B48 A;  4D73 A;  2O7K A;  3A2X A;  2AHE A;  2WFC A;  1T7P B;  4PGT A;  2CVB A;  2CAQ A;  2JSZ A;  3DGQ A;  4L8E A;  4OWY A;  4IP1 A;  3FR3 A;  4V2L A;  1WE0 A;  1TRW A;  5DJL A;  22GS A;  1VF4 A;  1J0F A;  3TJB A;  4TXO A;  4TXO B;  3ZYW A;  1K3L A;  5G5E A;  5HQP A;  13GS A;  4HDE A;  1THX A;  2REM A;  2DJJ A;  3VK9 A;  3KH7 A;  2YWI A;  1SJ6 A;  2TRX A;  3ZLP A;  1O7U A;  2H6Z A;  1XWK A;  3F4R A;  4EE0 A;  4OD7 A;  4I8B A;  1EV9 A;  3G7J A;  3IOS A;  2O8V B;  2LKU A;  4MH3 A;  2OBI A;  3HVX A;  4KAE A;  5JWO B;  4HS1 A;  1JZD A;  4EO3 A;  5ECM B;  5DJM A;  1DBY A;  4CY6 A;  4WBJ A;  3KXO A;  2PWJ A;  1SYR A;  4PUF C;  2PBJ A;  2DJ1 A;  3HVV A;  1PKZ A;  3KM6 A;  4K2D A;  5B7C A;  3IE3 A;  3KMO A;  4LL1 B;  2PU9 C;  4OO5 A;  1BED A;  1B4Q A;  4WF5 A;  3P7X A;  3UVT A;  2GZP A;  1OC9 A;  1S3R A;  1U3A A;  5JWQ B;  3DYR A;  4K7I A;  4FQU A;  3GNJ A;  1A8Y A;  4KDU A;  1GLP A;  1GUM A;  1VF3 A;  2HSH A;  2VD0 A;  2ZCT A;  3ED3 A;  2X8H A;  1QGV A;  1LBK A;  1PSQ A;  3EWL A;  3CTF A;  4IVF A;  3BJ5 A;  3BCK A;  2LTK A;  2C0E A;  3C8E A;  1WIK A;  2WUL A;  4TR1 B;  1HD2 A;  1ZYP A;  1OE8 A;  2OE1 A;  5H5Q A;  2V2G A;  3RHB A;  4DEJ A;  4KA0 A;  3TKQ A;  1XWC A;  4K2X A;  1ERT A;  2D2Z A;  3Q74 A;  3IR4 A;  3GKX A;  3GV1 A;  1T8E B;  5AIS A;  2TRC P;  3OR5 A;  1XWB A;  3G7I A;  3P2A A;  4XRD A;  3GH6 A;  1Z5Y E;  1BG5 A;  4KUN A;  3C1R A;  3TRQ A;  1PL1 A;  3LXZ A;  2KOK A;  4RQX A;  2OKA A;  1QQ2 A;  1TOF A;  2FGX A;  5A4U A;  4HZ2 A;  3W6G A;  1RQM A;  4PUA A;  1A2M A;  5ENU A;  3ZVJ A;  3PIN A;  4RQR A;  4ZBB A;  2B5Y A;  5INY A;  4WKW A;  4YQM A;  5KOW A;  2HYX A;  3HJM A;  1A0R P;  2VOC A;  3BBY A;  2X8G A;  5KN3 A;  2H0H A;  2B7J A;  4P3Y B;  2PN8 A;  1MDK A;  4MLY A;  3IDV A;  2NTO A;  3H1N A;  1V98 A;  2XC2 A;  1UVZ A;  3UAP A;  2MMA A;  4EDZ A;  3I9V 2;  3HZ8 A;  4GQC A;  1NM3 A;  4KCA A;  4RUV A;  3GL3 A;  4GQF A;  2C0F A;  2XHF A;  3EU4 A;  2GSR A;  3RHC A;  3RPP A;  1X5E A;  4MJA A;  1GL8 A;  4YKG A;  4E8E A;  3LG6 A;  3A3T A;  3LYP A;  2H1D A;  2JAD A;  2MZC A;  2X49 A;  3F6F A;  4G10 A;  3VWV A;  5DAL A;  3TB2 A;  1TK0 B;  3DD3 A;  3ERW A;  5G5F A;  4KSM A;  5BRT A;  3KP9 A;  4HEA 2;  4PNF A;  1XFL A;  3VI5 A;  4ECJ A;  3IC4 A;  3GTU B;  4O5Q A;  1YJ6 A;  1MD3 A;  1M7T A;  1DE1 A;  3CQF A;  2OE3 A;  2K9F A;  1R7H A;  5KN2 A;  1OAZ A;  4NPB A;  2MMN A;  4TXV A;  4MA9 A;  3M3M A;  3LQ7 A;  4ECB A;  3CYN A;  2DKI A;  3IK9 A;  3IV4 A;  1LJR A;  3FYG A;  1JZR A;  2H30 A;  16GS A;  5JCW A;  5LNK e;  2R6K A;  4GST A;  2FWH A;  2L5O A;  3WYW A;  1OC3 A;  4GSN A;  3ME8 A;  5AGY A;  2ON7 A;  3W8S A;  3TRP A;  1SL1 B;  5CO3 A;  1GSQ A;  1A23 A;  4X0X A;  4DSS B;  2GQM A;  1O8X A;  1PRX A;  17GS A;  2VCV A;  1N2A A;  2FWG A;  1ZL9 A;  3APO A;  2PVO C;  4JR6 A;  4POB A;  1TK8 B;  3TKS A;  5EPF A;  2LUS A;  1S3A A;  3VWX A;  2C8U A;  1GWC A;  4XS4 A;  3L4N A;  1FB6 A;  1U3I A;  3A2V A;  5ECO B;  3ZFL A;  2I3Y A;  6GSX A;  3KH9 A;  1XVQ A;  1HNC A;  4KH7 A;  3WGD A;  1W4V A;  3KJY A;  5HFK A;  2HT9 A;  2N5A A;  3F0I A;  2GVP A;  2R3X A;  1TRU A;  4XCS A;  4TW5 A;  2IMF A;  3L0H A;  5HR3 A;  3UJ1 A;  4TR3 A;  3MYD A;  5CRE A;  3V1W A;  2GST A;  4BIK A;  6GSY A;  3H79 A;  1J9B A;  5BMU A;  4USS A;  3L9U A;  3EMX A;  3F4T A;  2HLS A;  1MEK A;  2E2G A;  3DVX A;  2OJL A;  1KEB A;  1B9Y C;  2M46 A;  4OO4 A;  1ZCP A;  3H93 A;  2C1Y A;  3ZIV A;  1PN0 A;  1AW9 A;  1TP9 A;  2V6O A;  2HZF A;  2H1A A;  1UN2 A;  2E7P A;  4KSO A;  2L6D A;  1KTE A;  1TI1 A;  2H0I A;  3KTB A;  3DML A;  4HJ2 A;  1FVJ A;  3EE2 A;  3K8N A;  2C4J A;  2DMM A;  4GSS A;  2J23 A;  1AQX A;  1XIY A;  1BQ7 A;  2GZZ A;  5DVB A;  2AYT A;  4G0I A;  4Q5N A;  1NHO A;  2CX4 A;  2MMO A;  3UMA A;  4O7H A;  3ERG A;  1XVW A;  2C0G A;  2H1B A;  5CRG A;  5J41 A;  4MZW A;  4QL7 A;  3ZL5 A;  3CRT A;  5IPH A;  5D8I A;  2YOI A;  2GTU A;  2WJU A;  1XCC A;  4FH8 A;  3WGX A;  1TI3 A;  3ZZX A;  4V2M A;  1M9B A;  2R0P A;  4MPG A;  2WCI A;  3GKN A;  1ILO A;  1QFN A;  3HJP A;  4NV2 A;  1I5G A;  5IIZ A;  1EGO A;  2OBK A;  2CT6 A;  3KCM A;  4K8M A;  4I2T A;  3F63 A;  4CDO A;  3HJO A;  1DSB A;  5B8A A;  5DAK A;  5DAK B;  5HR2 A;  3ZRE A;  1MD4 A;  3KP8 A;  4CW9 A;  1ZZY A;  2LJR A;  2XPE A;  3QD9 A;  1GSE A;  4IQ1 A;  20GS A;  3F9U A;  1Z7R A;  1T3B A;  4MP4 A;  5ABR A;  4AF2 A;  18GS A;  1GUH A;  1E6B A;  1GTI A;  3QCP A;  4LL4 B;  1PX7 A;  1Z6N A;  4JBB A;  1ZYE A;  1K0C A;  4FO5 A;  1K0A A;  3RPN A;  5D9X A;  3QAW A;  2IWT A;  2HXK A;  3IA1 A;  4MPF A;  2I1U A;  4Z2R A;  2VL9 A;  1GTU A;  2VLT A;  4L5L A;  3ZVJ D;  3R2Q A;  5CRD A;  3HYP A;  4IP6 A;  3EUR A;  1KNG A;  4JR4 A;  2YWN A;  3APS A;  4PUR A;  3LEF A;  2H70 A;  3GYK A;  4KDX A;  1K3O A;  3H4K A;  2YZH A;  2DJ3 A;  1M2D A;  3ZIJ A;  1M2A A;  2MBS A;  4L5O A;  1XZO A;  1WPI A;  1A24 A;  3DRN A;  3UL3 A;  3DXB A;  2G2Q A;  4OFN A;  3D21 A;  3ZML A;  1DUG A;  4FYU A;  3C71 A;  2VUP A;  2B7K A;  4K0G A;  3G9B A;  1X9S B;  2N5B A;  2R0C A;  1SKS B;  2XBI A;  2K8S A;  2YV7 A;  4ZB6 A;  3VLN A;  4ULX A;  1Z6M A;  4G0K A;  2DLX A;  2IPA A;  3P90 A;  3M1G A;  2K6V A;  1TRS A;  4XS6 A;  2P0G A;  3IHQ A;  5CRW A;  5KN0 A;  2DML A;  2V32 A;  3E9J B;  4HQZ A;  1K0B A;  3L78 A;  4ZIJ A;  1TKD B;  3GSS A;  2ALB A;  2GQK A;  3F3Q A;  3PR8 A;  5G1L A;  4ECC A;  4N0V A;  3GMF A;  2IFQ B;  4K7O A;  1AQW A;  2LRC A;  3LXT A;  2L6C A;  4X1U A;  5CAX A;  5G31 A;  3RDW A;  1R26 A;  1GP1 A;  2EIR A;  2VD1 A;  4O5R A;  4OCF A;  2LJK A;  3I6A A;  4GRF A;  14GS A;  4BWS A;  3ZIT A;  4BVY B;  3VWU A;  1B4P A;  1UA5 A;  2DC5 A;  1GH2 A;  2E2M A;  3TJF A;  1ACV A;  4NAX A;  5GAN D;  5F0G A;  3TJJ A;  2OA7 A;  3MIX A;  3FKF A;  3DKS A;  1TJD A;  3CSH A;  5ID2 B;  2LEG A;  5IMD A;  2GLR A;  2CV4 A;  2E0Q A;  2P31 A;  2YJH A;  3TKR A;  4BPY A;  4TR1 A;  4J57 E;  2DJ0 A;  5ELG A;  1WP0 A;  2L57 A;  3PPU A;  2CZ2 A;  3CBU A;  2WGR A;  3HY2 A;  4AJ6 A;  3MDK A;  1SJI A;  1GRX A;  1XOB A;  2WS2 A;  1N8J A;  2H01 A;  2VCW A;  1GSD A;  1HQO A;  3I43 A;  4ML6 A;  4Q5R A;  3EPT A;  2CA8 A;  2B3S A;  2KHP A;  2GT5 A;  2GDR A;  4N0Z A;  5AIV A;  1GLQ A;  1ST9 A;  5HFI A;  1EEM A;  1A2J A;  1QXH A;  2H76 A;  5GST A;  4CY8 A;  4N30 A;  2X99 A;  1I9D A;  2DJ2 A;  4IKH A;  3FEU A;  4EF0 A;  1DE2 A;  2PPT A;  1JLV A;  1PFO A;  1B8X A;  3IAS 2;  1H75 A;  4POL A;  2PGT A;  2L5L A;  4XRA A;  3N5O A;  4Z2T A;  2YPM A;  2YV9 A;  2C0D A;  2F51 A;  4L0W A;  5H5S A;  1TW9 A;  5IMV A;  9GSS A;  4Z2U A;  4ZL9 A;  4G2E A;  5KN1 A;  2XBQ A;  1X9W B;  1F6M C;  3LW9 A;  1T00 A;  1G7O A;  4Q5Q A;  5H5R A;  1PGT A;  4J56 E;  5L71 A;  4EIP A;  1YEP A;  4TKY A;  4POK A;  5LD0 A;  5LCZ A;  3W8J A;  5JWR B;  4V2N A;  3MWH A;  3UVH A;  3M9K A;  4KB3 A;  5J3R A;  2NDO A;  1GSY A;  2A2R A;  1KBN A;  5DQS A;  4WBR D;  4NHZ A;  1SJZ A;  4MDC A;  1FHE A;  3GTU A;  1ERV A;  1SD9 A;  4PNG A;  4KDY A;  2L4Q A;  4EUY A;  1EOH A;  3MSZ A;  4MCU A;  1XW9 A;  1QMV A;  3HVS A;  5IM9 A;  4ZB9 A;  2HZE B;  4L0U A;  1O85 A;  2AB6 A;  3O6T A;  4ZBA A;  1WOU A;  4MJE A;  5CNW A;  1RW1 A;  4F2I A;  5A4V A;  1M3I A;  2EIQ A;  3TRX A;  1THO A;  2RM6 A;  3LOR A;  1V58 A;  4X43 A;  2R0G A;  4G9H A;  1T1V A;  4WXT A;  3TOU A;  1YDK A;  1Y25 A;  2B5E A;  2JL4 A;  3LYK A;  3A5I A;  2H8L A;  3L9V A;  5ECP B;  3KIJ A;  2FA8 A;  2MMZ A;  3EMP A;  2RLI A;  3UBL A;  1XG8 A;  1SD8 A;  1V40 A;  3CXG A;  3QAV A;  1JHB A;  1Z9H A;  4G0L A;  2KP1 A;  1FVK A;  2H71 A;  4TN8 A;  4DSS A;  5D73 A;  5GZZ B;  3FRC A;  5D96 A;  3RAZ A;  11GS A;  2IN3 A;  2A2P A;  4LMW A;  4ILF A;  3VWW A;  5F05 A;  2HRN A;  2B5X A;  4IJI A;  4G19 A;  1F2E A;  1S3C A;  2BTO T;  3GX8 A;  4PXO A;  1OC8 A;  4K7N A;  4XHM A;  2BMX A;  1XOA A;  3UAR A;  2DJK A;  3U5R E;  4MK3 A;  4K0N A;  4IW9 A;  3BCI A;  4DSR A;  1K3Y A;  2KP2 A;  6GSW A;  1OYJ A;  1WRY A;  4HOJ A;  3QOU A;  3CTG A;  2HSY A;  5J5N A;  2LRN A;  1U88 A;  4ISD A;  1SKW B;  2EC4 A;  3ZMK A;  1YKC A;  1JZW A;  2K18 A;  3N9J A;  2JU5 A;  2RM5 A;  1M0U A;  1A8L A;  3Q19 A;  4BL7 B;  1B9X C;  1O8W A;  5G2Z A;  2LQO A;  1PL2 A;  1YZX A;  5ECN B;  5IOX A;  2A4V A;  5ELA A;  2VLU A;  1NSW A;  2WDU A;  4EXJ A;  5EVO A;  4MNN A;  1C72 A;  3QR6 A;  3HZ4 A;  4KND A;  5HR0 A;  2AJQ B;  4MZB A;  1AIU A;  5EY6 A;  4IN0 A;  2DKH A;  1RK4 A;  5ECK B;  2DSA A;  3FZ9 A;  1CQH A;  2Z9S A;  2RUE A;  2KUC A;  4O92 A;  1XBS A;  1SL2 B;  5CP1 A;  5A5K A;  2NBS A;  1U6T A;  1FW1 A;  2NVL A;  2GGT A;  3FK8 A;  3TCO A;  2R4V A;  3R3E A;  3Q18 A;  1GSS A;  2CQ9 A;  1GSU A;  4BWQ A;  1XXU A;  4IHU A;  1V57 A;  4GWR A;  1VF2 A;  4NWY A;  4BVX A;  4BVX B;  1IYH A;  4WEY A;  3KGK A;  2FA4 A;  2R5G A;  3O76 A;  2H6X A;  2LRT A;  4KX4 A;  3GKM A;  1MDI A;  1HNA A;  2HRF A;  5FT3 A;  5JCG A;  3F8U A;  5FHI A;  4K5S A;  4IEL A;  3D5J A;  4BA7 A;  3ZFB A;  3J7Y k;  2H72 A;  2NPB A;  4X4J A; 
#chains in the Genus database with same CATH homology
 7GSS A;  4MAB A;  3WT2 A;  5E59 A;  2VL2 C;  1X5D A;  2ES7 A;  2HI7 A;  2K8V A;  3IPZ A;  5GAP D;  1PN9 A;  1HYU A;  2N5F A;  2OE0 A;  4ML1 A;  2LNS A;  1G0T A;  3D4T A;  3M8N A;  3D22 A;  1FOV A;  2YZU A;  3ZRD A;  2WZ9 A;  1W89 A;  4I6X A;  1GNW A;  5F06 A;  5A4W A;  5D9V A;  1K0N A;  1WJK A;  4WR4 A;  1YF0 A;  4WET A;  2YWO A;  4GXZ A;  2C80 A;  4JRR A;  1IYI A;  5B8B A;  4TRX A;  1YY7 A;  1EGR A;  1BX9 A;  4HU9 A;  1O6J A;  1GTB A;  3SBC A;  1T4Y A;  1BJX A;  4N11 A;  1X0R A;  1GUK A;  1TXX A;  3QPM A;  2C3Q A;  1OE7 A;  1O81 A;  1Z3E A;  4OMV A;  2G0F A;  2DBC A;  3F4S A;  4YAV A;  2A4H A;  1ZGN A;  1ML6 A;  1S3D A;  1AUC A;  3KTL A;  3P8W A;  1A0F A;  1VF1 A;  3WT1 A;  4A5P A;  3FHK A;  3TKS C;  3MNG A;  3PH9 A;  5AN1 A;  1TRV A;  4NMU A;  2FHE A;  4D73 B;  4JZQ A;  4QL9 A;  5IPG A;  3HKR A;  2GSQ A;  4AJ8 A;  2ON5 A;  4IQA A;  2J9H A;  4K6X A;  4TOP A;  3HCZ A;  1Y6E A;  1O73 A;  4JU5 A;  3TJK A;  2VM2 A;  4EDY A;  4YQU A;  5ECR B;  5IOW A;  2F3M A;  2QC7 A;  1A2L A;  5DQY A;  3A2W A;  2H6Y A;  1PMT A;  1MTC A;  1GUL A;  2IL3 A;  4ECI A;  2QSI A;  1QUW A;  5B6M A;  2CZ3 A;  5C04 A;  2ZUP A;  2I81 A;  2I4A A;  2YWM A;  3TOT A;  1OVN A;  1ZOF A;  3GKK A;  2FWF A;  4HUA A;  4LA1 A;  4MF5 A;  2ZNM A;  1FB0 A;  3WGE A;  5IMF A;  2VIM A;  1MDJ A;  1NHY A;  2IFQ A;  1PD2 1;  2V1M A;  3PGT A;  1K0M A;  2WB9 A;  6GSV A;  1TDI A;  5IMA A;  1NW2 A;  4ZIL A;  1ZYQ B;  2FLS A;  1BYE A;  3GUR A;  3LJR A;  4EIQ A;  1EZK A;  2P5Q A;  4KGI A;  5DCH A;  1E2Y A;  2HRK A;  2AV4 A;  4PQI A;  2H74 A;  2HE3 A;  3TJG A;  3D6I A;  2L4C A;  12GS A;  3TGZ A;  3VPT A;  2A2S A;  2H1G A;  4GTU A;  5KOX A;  5DCG A;  1R4W A;  2F8F A;  4BVY A;  2BJX A;  4OFM A;  1ERW A;  1XW6 A;  2UZ8 A;  2YJ7 A;  5HFG A;  1EP7 A;  1OC9 B;  2MYG A;  1AAZ A;  5C00 A;  2KLX A;  1TU8 A;  4JE1 A;  5ID2 A;  1ERU A;  4IS0 A;  2H0G A;  3GH9 A;  4ZL7 A;  5JCU A;  2IMK A;  4OCE A;  1X5C A;  4PX1 A;  5KEJ A;  4GLT A;  4CHS A;  3LFL A;  3NOF A;  5DDL A;  2LST A;  5IMC A;  4LLR A;  3Q6O A;  2V6K A;  1XW5 A;  1EWX A;  3M9J A;  4XTS A;  3TDG A;  3CRU A;  1FO5 A;  1URM A;  1R5P A;  2OAD A;  2GQL A;  3KMN A;  2QKE A;  2R37 A;  3GHA A;  1FAA A;  4V1A p;  3UOM A;  1SKR B;  2GS3 A;  3QFA C;  2PMT A;  6GST A;  3CSJ A;  5D93 A;  3FR9 A;  1USB A;  3QAG A;  2EIO A;  1G6W A;  2JSY A;  4H86 A;  3FY7 A;  1XPV A;  4F03 A;  3ERF A;  3NZN A;  3HA9 A;  1V2A A;  1YF1 A;  1PX6 A;  5COH A;  3FW2 A;  2HNL A;  5F07 A;  1SK2 A;  10GS A;  4POM A;  4KF9 A;  3UEM A;  2XPD A;  4FYB A;  1YEX A;  4HU7 A;  1ABA A;  2R2J A;  1K0O A;  1OKT A;  4F0B A;  2FCH A;  2VLV A;  3DEX A;  4KW6 A;  1K0D A;  3HXS A;  1SU9 A;  2VM1 A;  2IIY A;  1PKW A;  1VGL A;  4HQS A;  4YKF A;  3GFK A;  1G6Y A;  4PQH A;  3E0U A;  2C3N A;  2X64 A;  4WR5 A;  3KD0 A;  1JLW A;  4TR0 A;  2B6M A;  2FY6 A;  2FD3 A;  3BOA A;  4O32 A;  5ECI B;  4RI7 A;  5IO2 A;  4MZC A;  3F6D A;  3GUS A;  1EP8 A;  4NV5 A;  1XWG A;  5ECQ B;  4J2F A;  1M99 A;  2LQQ A;  3EIN A;  4YAP A;  2VL2 A;  2YAN A;  3CSI A;  4NXI A;  4HZ4 A;  4KE3 A;  5DAL B;  3FZA A;  2HZE A;  4MF7 A;  1AQV A;  5GSS A;  3IBH A;  2O87 A;  1SEN A;  2VCT A;  4KCE A;  4Z7X A;  2QA2 A;  4YQV A;  2H75 A;  4K9Z A;  1Q4J A;  4ID0 A;  3VI7 A;  2VL3 A;  4MMM A;  4ZB8 A;  1ZYN A;  4FIW A;  4GF0 A;  2CVK A;  1BAY A;  4EKZ A;  3D4M A;  3S9F A;  2HSM A;  1PQN A;  3FZ5 A;  3IAM 2;  3APQ A;  3GX0 A;  2PUK C;  5AIX A;  4F0C A;  4F82 A;  3GIX A;  3KEB A;  2FWE A;  2DIZ A;  2CX3 A;  4MJC A;  1JZO A;  3RBT A;  2YNX A;  2DIY A;  3E3E A;  5J9C A;  4IBP A;  2M72 A;  2C3T A;  3UBK A;  3IK7 A;  3IRA A;  3GST A;  2H19 A;  2LV3 A;  3EC3 A;  5ECS A;  1PA3 A;  3ISO A;  2IMI A;  3EYT A;  2CVD A;  2B1L A;  1EV4 A;  3IC8 A;  2O89 A;  4DVC A;  4OFT A;  4XS4 B;  2QGV A;  5EL8 A;  3ZTL A;  2FNO A;  3DWV A;  1SK0 A;  2HFD A;  5HR1 A;  1SL0 B;  3VUR A;  2VO4 A;  4N10 A;  5ECL B;  2AUV A;  1J08 A;  2YP6 A;  2YN1 A;  4PQ1 A;  3TKS E;  1Q98 A;  2MBT A;  4IGJ A;  3D0Z A;  4ACS A;  2L59 A;  2LJA A;  1Z7P A;  3GRX A;  3IXR A;  2X8C A;  1TK5 B;  4RI6 A;  3C73 A;  2GSS A;  4BL7 A;  3EU3 A;  2RUF A;  1WWJ A;  6GSU A;  1F37 A;  1FG4 A;  3HD5 A;  1H4O A;  1EOG A;  2TIR A;  2GZY A;  3QMX A;  3FR6 A;  1SK1 A;  4I5Q A;  1ON4 A;  4ZXG A;  4PTS A;  1ZMA A;  5D9W A;  2PER A;  3NIV A;  1QK8 A;  1F3B A;  2JZT A;  3HDC A;  4JED A;  3DIE A;  4F9Z A;  2RII A;  4WF4 A;  3FMW A;  3QDN A;  4V1A g;  1GSF A;  3F3R A;  3TUE A;  3LWA A;  3L9S A;  2M80 A;  6GSS A;  1X9M B;  1YQ1 A;  3UIW A;  2LNT A;  3US3 A;  2VCQ A;  2WRT A;  3EVI A;  1AXD A;  2GT6 A;  1GTA A;  8GSS A;  3BD2 A;  4HJM A;  2H66 A;  1V9W A;  2JZS A;  3TKP A;  1JFU A;  2B1K A;  3AY8 A;  4I2U A;  1HNB A;  4O5U A;  4LMV A;  3O3T A;  1GNE A;  2AAW A;  2JAC A;  3LGC A;  3QFB C;  4QQ7 A;  2VCX A;  4EL1 A;  2JZR A;  5G30 A;  3KZQ A;  2LS5 A;  4IJ3 A;  4EC0 A;  2YCD A;  4EVM A;  5J9B A;  1AC1 A;  3C1S A;  5CYY A;  1UC7 A;  1U87 A;  1TU7 A;  2OAC A;  2X4A A;  4DSQ A;  5CRH A;  3VFI A;  2V41 A;  3MAK A;  5F8B A;  1VRS D;  5B6N A;  4HI7 A;  2P5R A;  4ICY A;  4XIH A;  1EEJ A;  3U6V A;  4MH2 A;  2PVQ A;  4TR4 A;  3CMI A;  3VPQ A;  5D9T A;  4E8H A;  5G1K A;  4ZBD A;  3ME7 A;  1F9M A;  1WMJ A;  3HHV A;  2IMD A;  5DBQ A;  3M0F A;  2I9H A;  5FWG A;  3A5W A;  5IMZ A;  3JCM L;  4GCI A;  2VAF A;  2VCZ A;  3C7M A;  5J4U A;  1F3A A;  2IJY A;  4AJ7 A;  1M9A A;  1YKA A;  4K5R A;  2HRA A;  4I97 A;  4FYC A;  1XWA A;  2CAI A;  1M2B A;  3SWL A;  3GA4 A;  4MF6 A;  3WD6 A;  1T4Z A;  3LSZ A;  3FZ4 A;  2QA1 A;  4YH2 A;  3GN3 A;  1FOH A;  5IQY A;  4Q5F A;  2F9S A;  1TTZ A;  4AGS A;  4ZL8 A;  3H8Q A;  4XS1 A;  1R5A A;  2F8A A;  2O85 A;  5IO0 A;  1G7E A;  1CQG A;  3I69 A;  2H73 A;  1LU4 A;  3IHG A;  3J7Y b;  3G7Y A;  4K1F A;  4MJB A;  19GS A;  5ECH B;  1SYX A;  4TVE A;  3GL5 A;  5E4W A;  3DVW A;  4NHW A;  1OKD A;  2FUG 2;  2IME A;  1B48 A;  4D73 A;  2O7K A;  3A2X A;  2AHE A;  2WFC A;  1T7P B;  4PGT A;  2CVB A;  2CAQ A;  2JSZ A;  3DGQ A;  4L8E A;  4OWY A;  4IP1 A;  3FR3 A;  4V2L A;  1WE0 A;  1TRW A;  5DJL A;  22GS A;  1VF4 A;  1J0F A;  3TJB A;  4TXO A;  4TXO B;  3ZYW A;  1K3L A;  5G5E A;  5HQP A;  13GS A;  4HDE A;  1THX A;  2REM A;  2DJJ A;  3VK9 A;  3KH7 A;  2YWI A;  1SJ6 A;  2TRX A;  3ZLP A;  1O7U A;  2H6Z A;  1XWK A;  3F4R A;  4EE0 A;  4OD7 A;  4I8B A;  1EV9 A;  3G7J A;  3IOS A;  2O8V B;  2LKU A;  4MH3 A;  2OBI A;  3HVX A;  4KAE A;  5JWO B;  4HS1 A;  1JZD A;  4EO3 A;  5ECM B;  5DJM A;  1DBY A;  4CY6 A;  4WBJ A;  3KXO A;  2PWJ A;  1SYR A;  4PUF C;  2PBJ A;  2DJ1 A;  3HVV A;  1PKZ A;  3KM6 A;  4K2D A;  5B7C A;  3IE3 A;  3KMO A;  4LL1 B;  2PU9 C;  4OO5 A;  1BED A;  1B4Q A;  4WF5 A;  3P7X A;  3UVT A;  2GZP A;  1OC9 A;  1U3A A;  5JWQ B;  3DYR A;  4K7I A;  4FQU A;  3GNJ A;  1A8Y A;  4KDU A;  1GLP A;  1GUM A;  1VF3 A;  2HSH A;  2VD0 A;  2ZCT A;  3ED3 A;  2X8H A;  1QGV A;  1LBK A;  1PSQ A;  3EWL A;  3CTF A;  4IVF A;  3BJ5 A;  3BCK A;  2LTK A;  2C0E A;  3C8E A;  1WIK A;  2WUL A;  4TR1 B;  1HD2 A;  1ZYP A;  1OE8 A;  2OE1 A;  5H5Q A;  2V2G A;  3RHB A;  4DEJ A;  4KA0 A;  3TKQ A;  1XWC A;  4K2X A;  1ERT A;  2D2Z A;  3Q74 A;  3IR4 A;  3GKX A;  3GV1 A;  1T8E B;  5AIS A;  2TRC P;  3OR5 A;  1XWB A;  3G7I A;  3P2A A;  4XRD A;  3GH6 A;  1Z5Y E;  1BG5 A;  4KUN A;  3C1R A;  3TRQ A;  1PL1 A;  3LXZ A;  2KOK A;  4RQX A;  2OKA A;  1QQ2 A;  1TOF A;  2FGX A;  5A4U A;  4HZ2 A;  3W6G A;  1RQM A;  4PUA A;  1A2M A;  5ENU A;  3ZVJ A;  3PIN A;  4RQR A;  4ZBB A;  2B5Y A;  5INY A;  4WKW A;  4YQM A;  5KOW A;  2HYX A;  3HJM A;  1A0R P;  2VOC A;  3BBY A;  2X8G A;  5KN3 A;  2H0H A;  2B7J A;  4P3Y B;  2PN8 A;  1MDK A;  4MLY A;  3IDV A;  2NTO A;  3H1N A;  1V98 A;  2XC2 A;  1UVZ A;  3UAP A;  2MMA A;  4EDZ A;  3I9V 2;  3HZ8 A;  4GQC A;  1NM3 A;  4KCA A;  4RUV A;  3GL3 A;  4GQF A;  2C0F A;  2XHF A;  3EU4 A;  2GSR A;  3RHC A;  3RPP A;  1X5E A;  4MJA A;  1GL8 A;  4YKG A;  4E8E A;  3LG6 A;  3A3T A;  3LYP A;  2H1D A;  2JAD A;  2MZC A;  2X49 A;  3F6F A;  4G10 A;  3VWV A;  5DAL A;  3TB2 A;  1TK0 B;  3DD3 A;  3ERW A;  5G5F A;  4KSM A;  5BRT A;  3KP9 A;  4HEA 2;  4PNF A;  1XFL A;  3VI5 A;  4ECJ A;  3IC4 A;  3GTU B;  4O5Q A;  1YJ6 A;  1MD3 A;  1M7T A;  1DE1 A;  2OE3 A;  2K9F A;  1R7H A;  5KN2 A;  1OAZ A;  4NPB A;  2MMN A;  4TXV A;  4MA9 A;  3M3M A;  3LQ7 A;  4ECB A;  3CYN A;  2DKI A;  3IK9 A;  3IV4 A;  1LJR A;  3FYG A;  1JZR A;  2H30 A;  16GS A;  5JCW A;  5LNK e;  2R6K A;  4GST A;  2FWH A;  2L5O A;  3WYW A;  1OC3 A;  4GSN A;  3ME8 A;  5AGY A;  2ON7 A;  3W8S A;  3TRP A;  1SL1 B;  5CO3 A;  1GSQ A;  1A23 A;  4X0X A;  4DSS B;  2GQM A;  1O8X A;  1PRX A;  17GS A;  2VCV A;  1N2A A;  2FWG A;  1ZL9 A;  3APO A;  2PVO C;  4JR6 A;  4POB A;  1TK8 B;  3TKS A;  5EPF A;  2LUS A;  1S3A A;  3VWX A;  2C8U A;  1GWC A;  4XS4 A;  3L4N A;  1FB6 A;  1U3I A;  3A2V A;  5ECO B;  3ZFL A;  2I3Y A;  6GSX A;  3KH9 A;  1XVQ A;  1HNC A;  4KH7 A;  3WGD A;  1W4V A;  3KJY A;  5HFK A;  2HT9 A;  2N5A A;  3F0I A;  2GVP A;  2R3X A;  1TRU A;  4XCS A;  4TW5 A;  2IMF A;  3L0H A;  5HR3 A;  3UJ1 A;  4TR3 A;  3MYD A;  5CRE A;  3V1W A;  2GST A;  6GSY A;  3H79 A;  1J9B A;  5BMU A;  4USS A;  3L9U A;  3EMX A;  3F4T A;  2HLS A;  1MEK A;  2E2G A;  3DVX A;  2OJL A;  1KEB A;  1B9Y C;  2M46 A;  4OO4 A;  1ZCP A;  3H93 A;  2C1Y A;  3ZIV A;  1PN0 A;  1AW9 A;  1TP9 A;  2V6O A;  2HZF A;  2H1A A;  1UN2 A;  2E7P A;  4KSO A;  2L6D A;  1KTE A;  1TI1 A;  2H0I A;  3KTB A;  3DML A;  4HJ2 A;  1FVJ A;  3EE2 A;  3K8N A;  2C4J A;  2DMM A;  4GSS A;  2J23 A;  1AQX A;  1XIY A;  1BQ7 A;  2GZZ A;  5DVB A;  2AYT A;  4G0I A;  4Q5N A;  1NHO A;  2CX4 A;  2MMO A;  3UMA A;  4O7H A;  3ERG A;  1XVW A;  2C0G A;  2H1B A;  5CRG A;  5J41 A;  4MZW A;  4QL7 A;  3ZL5 A;  3CRT A;  5IPH A;  5D8I A;  2YOI A;  2GTU A;  2WJU A;  1XCC A;  4FH8 A;  3WGX A;  1TI3 A;  3ZZX A;  4V2M A;  1M9B A;  2R0P A;  4MPG A;  2WCI A;  3GKN A;  1ILO A;  1QFN A;  3HJP A;  4NV2 A;  1I5G A;  5IIZ A;  1EGO A;  2OBK A;  2CT6 A;  3KCM A;  4K8M A;  4I2T A;  3F63 A;  4CDO A;  3HJO A;  1DSB A;  5B8A A;  5DAK A;  5DAK B;  5HR2 A;  3ZRE A;  1MD4 A;  3KP8 A;  4CW9 A;  1ZZY A;  2LJR A;  2XPE A;  3QD9 A;  1GSE A;  4IQ1 A;  20GS A;  3F9U A;  1Z7R A;  1T3B A;  4MP4 A;  5ABR A;  4AF2 A;  18GS A;  1GUH A;  1E6B A;  1GTI A;  3QCP A;  4LL4 B;  1PX7 A;  1Z6N A;  4JBB A;  1ZYE A;  1K0C A;  4FO5 A;  1K0A A;  3RPN A;  5D9X A;  3QAW A;  2IWT A;  2HXK A;  3IA1 A;  4MPF A;  2I1U A;  4Z2R A;  2VL9 A;  1GTU A;  2VLT A;  4L5L A;  3ZVJ D;  3R2Q A;  5CRD A;  3HYP A;  4IP6 A;  3EUR A;  1KNG A;  4JR4 A;  2YWN A;  3APS A;  4PUR A;  3LEF A;  2H70 A;  3GYK A;  4KDX A;  1K3O A;  3H4K A;  2YZH A;  2DJ3 A;  1M2D A;  3ZIJ A;  1M2A A;  2MBS A;  4L5O A;  1XZO A;  1WPI A;  1A24 A;  3DRN A;  3UL3 A;  3DXB A;  2G2Q A;  4OFN A;  3D21 A;  3ZML A;  1DUG A;  4FYU A;  3C71 A;  2VUP A;  2B7K A;  4K0G A;  3G9B A;  1X9S B;  2N5B A;  2R0C A;  1SKS B;  2XBI A;  2K8S A;  2YV7 A;  4ZB6 A;  3VLN A;  4ULX A;  1Z6M A;  4G0K A;  2DLX A;  2IPA A;  3P90 A;  3M1G A;  2K6V A;  1TRS A;  4XS6 A;  2P0G A;  3IHQ A;  5CRW A;  5KN0 A;  2DML A;  2V32 A;  3E9J B;  4HQZ A;  1K0B A;  3L78 A;  4ZIJ A;  1TKD B;  3GSS A;  2ALB A;  2GQK A;  3F3Q A;  3PR8 A;  5G1L A;  4ECC A;  4N0V A;  3GMF A;  2IFQ B;  4K7O A;  1AQW A;  2LRC A;  3LXT A;  2L6C A;  4X1U A;  5CAX A;  5G31 A;  3RDW A;  1R26 A;  1GP1 A;  2EIR A;  2VD1 A;  4O5R A;  4OCF A;  2LJK A;  3I6A A;  4GRF A;  14GS A;  4BWS A;  3ZIT A;  4BVY B;  3VWU A;  1B4P A;  1UA5 A;  2DC5 A;  1GH2 A;  2E2M A;  3TJF A;  1ACV A;  4NAX A;  5GAN D;  5F0G A;  3TJJ A;  2OA7 A;  3MIX A;  3FKF A;  3DKS A;  1TJD A;  3CSH A;  5ID2 B;  2LEG A;  5IMD A;  2GLR A;  2CV4 A;  2E0Q A;  2P31 A;  2YJH A;  3TKR A;  4BPY A;  4TR1 A;  4J57 E;  2DJ0 A;  5ELG A;  1WP0 A;  2L57 A;  3PPU A;  2CZ2 A;  3CBU A;  2WGR A;  3HY2 A;  4AJ6 A;  3MDK A;  1SJI A;  1GRX A;  1XOB A;  2WS2 A;  1N8J A;  2H01 A;  2VCW A;  1GSD A;  1HQO A;  3I43 A;  4ML6 A;  4Q5R A;  3EPT A;  2CA8 A;  2B3S A;  2KHP A;  2GT5 A;  2GDR A;  4N0Z A;  5AIV A;  1GLQ A;  1ST9 A;  5HFI A;  1EEM A;  1A2J A;  1QXH A;  2H76 A;  5GST A;  4CY8 A;  4N30 A;  2X99 A;  1I9D A;  2DJ2 A;  4IKH A;  3FEU A;  4EF0 A;  1DE2 A;  2PPT A;  1JLV A;  1B8X A;  3IAS 2;  1H75 A;  4POL A;  2PGT A;  2L5L A;  4XRA A;  3N5O A;  4Z2T A;  2YPM A;  2YV9 A;  2C0D A;  2F51 A;  4L0W A;  5H5S A;  1TW9 A;  5IMV A;  9GSS A;  4Z2U A;  4ZL9 A;  4G2E A;  5KN1 A;  2XBQ A;  1X9W B;  1F6M C;  3LW9 A;  1T00 A;  1G7O A;  4Q5Q A;  5H5R A;  1PGT A;  4J56 E;  5L71 A;  4EIP A;  1YEP A;  4TKY A;  4POK A;  5LD0 A;  5LCZ A;  3W8J A;  5JWR B;  4V2N A;  3MWH A;  3UVH A;  3M9K A;  4KB3 A;  5J3R A;  2NDO A;  1GSY A;  2A2R A;  1KBN A;  5DQS A;  4WBR D;  4NHZ A;  1SJZ A;  4MDC A;  1FHE A;  3GTU A;  1ERV A;  1SD9 A;  4PNG A;  4KDY A;  2L4Q A;  4EUY A;  1EOH A;  3MSZ A;  4MCU A;  1XW9 A;  1QMV A;  3HVS A;  5IM9 A;  4ZB9 A;  2HZE B;  4L0U A;  1O85 A;  2AB6 A;  3O6T A;  4ZBA A;  1WOU A;  4MJE A;  5CNW A;  1RW1 A;  4F2I A;  5A4V A;  2EIQ A;  3TRX A;  1THO A;  2RM6 A;  3LOR A;  1V58 A;  4X43 A;  2R0G A;  4G9H A;  1T1V A;  4WXT A;  3TOU A;  1YDK A;  1Y25 A;  2B5E A;  2JL4 A;  3LYK A;  3A5I A;  2H8L A;  3L9V A;  5ECP B;  3KIJ A;  2FA8 A;  2MMZ A;  3EMP A;  2RLI A;  3UBL A;  1SD8 A;  1V40 A;  3CXG A;  3QAV A;  1JHB A;  1Z9H A;  4G0L A;  2KP1 A;  1FVK A;  2H71 A;  4TN8 A;  4DSS A;  5D73 A;  5GZZ B;  3FRC A;  5D96 A;  3RAZ A;  11GS A;  2IN3 A;  2A2P A;  4LMW A;  4ILF A;  3VWW A;  5F05 A;  2HRN A;  2B5X A;  4IJI A;  4G19 A;  1F2E A;  1S3C A;  2BTO T;  3GX8 A;  4PXO A;  1OC8 A;  4K7N A;  4XHM A;  2BMX A;  1XOA A;  3UAR A;  2DJK A;  3U5R E;  4MK3 A;  4K0N A;  4IW9 A;  3BCI A;  4DSR A;  1K3Y A;  2KP2 A;  6GSW A;  1OYJ A;  1WRY A;  4HOJ A;  3QOU A;  3CTG A;  2HSY A;  5J5N A;  2LRN A;  1U88 A;  4ISD A;  1SKW B;  2EC4 A;  3ZMK A;  1YKC A;  1JZW A;  2K18 A;  3N9J A;  2JU5 A;  2RM5 A;  1M0U A;  1A8L A;  3Q19 A;  4BL7 B;  1B9X C;  1O8W A;  5G2Z A;  2LQO A;  1PL2 A;  1YZX A;  5ECN B;  5IOX A;  2A4V A;  5ELA A;  2VLU A;  1NSW A;  2WDU A;  4EXJ A;  5EVO A;  4MNN A;  1C72 A;  3QR6 A;  3HZ4 A;  4KND A;  5HR0 A;  2AJQ B;  4MZB A;  1AIU A;  5EY6 A;  4IN0 A;  2DKH A;  1RK4 A;  5ECK B;  2DSA A;  3FZ9 A;  1CQH A;  2Z9S A;  2RUE A;  2KUC A;  4O92 A;  1XBS A;  1SL2 B;  5CP1 A;  5A5K A;  2NBS A;  1U6T A;  1FW1 A;  2NVL A;  2GGT A;  3FK8 A;  3TCO A;  2R4V A;  3R3E A;  3Q18 A;  1GSS A;  2CQ9 A;  1GSU A;  4BWQ A;  1XXU A;  4IHU A;  1V57 A;  4GWR A;  1VF2 A;  4NWY A;  4BVX A;  4BVX B;  1IYH A;  4WEY A;  3KGK A;  2FA4 A;  2R5G A;  3O76 A;  2H6X A;  2LRT A;  4KX4 A;  3GKM A;  1MDI A;  1HNA A;  2HRF A;  5FT3 A;  5JCG A;  3F8U A;  5FHI A;  4K5S A;  4IEL A;  3D5J A;  4BA7 A;  3ZFB A;  3J7Y k;  2H72 A;  2NPB A;  4X4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...