1TI3A

Solution structure of the thioredoxin h1 from poplar, a cppc active site variant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
AEEGQVIACHTVDTWKEHFEKGKGSQKLIVVDFTASWCPPCKMIAPIFAELAKKFPNVTFLKVDVDELKAVAEEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords thioredoxin H
publication title Solution structure of a natural CPPC active site variant, the reduced form of thioredoxin h1 from poplar.
pubmed doi rcsb
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1ti3A00
3CYNA 3ZIVA 2REMA 3DEXA 3P2AA 4N0VA 2LJRA 3Q18A 3GFKA 3UVTA 2H6XA 3AY8A 2MBTA 3UBLA 4IP1A 1PKZA 3KMOA 5CNWA 2VL2A 5FT3A 1MD3A 1YY7A 3LWAA 1TW9A 2YV7A 3MDKA 2CAQA 4WXTA 3BBYA 4XRDA 1RK4A 4N10A 3TRPA 2K8SA 4DEJA 2X99A 1PA3A 2C3TA 5E4WA 1QGVA 1OC9A 3LG6A 2HZEA 3TCOA 3VWUA 1PGTA 3TKSA 4TXOA 1TU7A 3ZZXA 2AV4A 3GKXA 4TOPA 2V2GA 1FB0A 1AAZA 1LBKA 1VF4A 1Z7RA 4MPGA 5IIZA 4TR0A 1H4OA 3LXTA 3F0IA 3C7MA 3C1RA 2OE1A 1DSBA 2DMLA 1AQWA 1OE7A 4MZWA 1HD2A 3NOFA 3ZVJA 2HXKA 2O85A 1MDJA 1YQ1A 2DC5A 4RI7A 2H66A 3UBKA 4HZ4A 3D6IA 2GZZA 1F37A 4MF5A 4LLRA 2X8CA 2J23A 2LRCA 4QL7A 3IE3A 1O81A 3APSA 1TRVA 3CSHA 4AJ7A 2GSTA 2PN8A 5C00A 3G7JA 1YEPA 2B7JA 1R5AA 1TRSA 1EV4A 3HJPA 1YDKA 5KN2A 1EV9A 3MAKA 20GSA 1ZL9A 4IQAA 2EIRA 3D4TA 3LQ7A 1YJ6A 2TIRA 2ZUPA 1B4QA 1M0UA 2RM5A 1Q98A 4K9ZA 4MPFA 5DAKA 1AXDA 2H71A 2GZYA 4KSMA 1EEJA 2JU5A 1G7OA 5EY6A 2RUFA 3DXBA 2AHEA 4KA0A 3BD2A 4O5RA 2FY6A 1DE2A 3ZFBA 1DUGA 1Z5YE 1KTEA 1SYXA 2VO4A 4JE1A 2CVBA 2IN3A 5D9TA 2CQ9A 2VUPA 1SKRB 3GUSA 4L0WA 5COHA 3W8SA 1I5GA 4I97A 1XZOA 2DSAA 3QPMA 3GYKA 5D93A 1A24A 5IOWA 4IELA 5B6MA 1Z6NA 1VF3A 4IN0A 1A2JA 1Y6EA 1WMJA 2K9FA 3HZ4A 2DJJA 3A3TA 2KUCA 4AJ8A 4OFMA 2H1BA 4ML1A 5C04A 1EOHA 3SBCA 2GT5A 22GSA 3A2XA 2MZCA 1GLPA 2N5AA 1TDIA 3EU4A 3TUEA 2HSHA 4D73B 4DVCA 3LEFA 1XFLA 1Z6MA 2IL3A 1XCCA 4ZIJA 1R26A 4I2UA 2LRNA 2YP6A 4KCAA 1JFUA 2H0IA 3M9KA 4PQ1A 5KN1A 3BOAA 3MWHA 1AQXA 1PX7A 1TJDA 4O7HA 1XWGA 3EC3A 1I9DA 1V58A 5ECRB 2F9SA 3VPTA 3L9VA 4XS6A 1ERTA 1USBA 2L59A 3H4KA 3GKNA 4E8EA 3Q6OA 3C8EA 2MYGA 3IK9A 2E7PA 3RPNA 3F4SA 4RI6A 1PMTA 1FVJA 2HSYA 3SWLA 5IPHA 2GSQA 1EGRA 1UN2A 3IOSA 4L0UA 4ISDA 3M0FA 3QMXA 4WEYA 2IPAA 4H86A 1GSUA 3ZMKA 1O6JA 2QSIA 2PU9C 2DBCA 1WIKA 3TB2A 2LJAA 1NHOA 3P90A 4MJEA 3GKKA 4XS4B 5KN0A 1NSWA 1SJIA 3RHCA 4DSRA 4KAEA 5ECIB 5IMFA 3KP8A 4K2DA 2GLRA 2HRNA 2I1UA 5CRDA 3ZTLA 2XHFA 4Q5QA 1SK0A 2EIOA 4GCIA 2H1AA 3HZ8A 3GSSA 5IMVA 2P5QA 1S3AA 16GSA 2OA7A 3KM6A 4POKA 1URMA 1KNGA 3WT1A 5GSTA 2B7KA 3H1NA 1FG4A 4HU7A 3UEMA 2H6ZA 3G9BA 4IBPA 4JRRA 4GQFA 3C1SA 5F8BA 2PVQA 2LSTA 3IAM2 2VCVA 2ZCTA 1GNEA 4OCEA 2YCDA 3IC4A 2I9HA 3BCKA 4I2TA 1TU8A 3LGCA 3L9SA 3TJGA 1ON4A 5H5SA 1G7EA 1PL2A 2GZPA 3HVSA 2LS5A 1QMVA 3ZFLA 5ECNB 1V40A 5HR3A 3MNGA 4QQ7A 4MABA 1UVZA 2B1LA 4IS0A 2X8HA 1O85A 1U3IA 4IW9A 3LYPA 3GL3A 1ILOA 1BG5A 4EKZA 2AUVA 1SJZA 2I81A 4WR5A 3KTBA 5HQPA 1LJRA 5ECMB 4ZL8A 6GSTA 4BPYA 2OADA 2H19A 1M2DA 4K7OA 1A8YA 4LA1A 2VCZA 3WYWA 1T7PB 4EL1A 4NHWA 5CAXA 2FHEA 2I3YA 2VCXA 1M7TA 4NHZA 4GRFA 2C0DA 18GSA 4HQSA 5B8AA 2IIYA 2AB6A 3F4RA 3E9JB 2E0QA 1QUWA 2VLTA 4NAXA 5J4UA 2BMXA 5FHIA 2LQQA 2L5LA 1O8WA 1GSQA 1N8JA 4DSQA 3M9JA 4KH7A 3CMIA 4HEA2 3GH9A 4V2NA 2E2MA 2WFCA 4WR4A 4F0CA 4ACSA 1SKWB 1X5EA 4JU5A 4ZBDA 2WB9A 3RHBA 4MJAA 14GSA 3IHQA 4IP6A 1XOBA 4HOJA 3ZIJA 3DYRA 3L0HA 2JADA 2A2RA 4YQUA 3EMPA 1GUHA 2OACA 4JR6A 5F07A 1AUCA 2H70A 13GSA 2H30A 5CRHA 1A8LA 2GTUA 1ERWA 3U6VA 4LMWA 2NBSA 5KN3A 1X5CA 2A4VA 3L4NA 4FYUA 5EPFA 3F8UA 2HYXA 4EVMA 1W89A 1H75A 1ZMAA 5LNKe 4ECBA 1XVWA 4FO5A 4MZBA 4TRXA 3US3A 4K8MA 1GRXA 3RDWA 1GWCA 5A4UA 2FWHA 2AJQB 4AGSA 4ECJA 1GNWA 3IPZA 4KSOA 1JLWA 1OVNA 1ZYEA 3QFAC 3UAPA 2L6CA 3KTLA 2C80A 2OBIA 1V57A 3KIJA 1XIYA 6GSUA 2RUEA 1X9SB 1V98A 2YWOA 1GL8A 1XXUA 1XBSA 1GSYA 3IDVA 4MF7A 3GV1A 1EGOA 3QD9A 3WGXA 2LKUA 2ZNMA 1U3AA 2IMEA 5IPGA 4KDXA 5G31A 1EEMA 2JACA 2R4VA 1M2BA 3ERFA 4WBRD 5AISA 1U88A 1FHEA 4KB3A 2BJXA 2C4JA 1NW2A 4K6XA 1M2AA 1TK0B 3EVIA 2H74A 5G1LA 1W4VA 3A2WA 2TRXA 1B9XC 2HI7A 3FZ5A 4DSSA 2V32A 5EL8A 2XC2A 3UJ1A 1FW1A 2FCHA 1WP0A 3F9UA 1TOFA 3HVXA 3FZ4A 1XW9A 6GSYA 3DMLA 4TKYA 3ZLPA 4V2LA 1BEDA 2VL9A 1PSQA 5G1KA 1MDIA 3ZMLA 1YF0A 1OKTA 1QQ2A 4NWYA 1FAAA 5ID2B 2OBKA 4PXOA 1ST9A 3F3RA 1PX6A 2O89A 1QFNA 3G7YA 1SJ6A 4F82A 1TRUA 2X64A 2VCWA 3QR6A 2L5OA 5DALB 1WWJA 2PERA 4GSSA 2GQKA 3QAVA 5CRWA 4EC0A 5F0GA 1E6BA 2I4AA 5DCHA 1SD9A 4K0NA 3TKQA 3GA4A 3TRQA 1A0FA 3BJ5A 5D8IA 3HDCA 4OCFA 5DQSA 5B6NA 5JCGA 2JL4A 3OR5A 3FEUA 4PNGA 3F6FA 1G6YA 2YOIA 3J7Yb 2VIMA 3VWXA 3HYPA 2GQMA 4V1Ap 4ZB8A 2LRTA 2KP1A 3VPQA 2GSSA 4MF6A 4Z7XA 5HR0A 4X1UA 4G19A 1Z9HA 1EOGA 2E2GA 2H6YA 3HJMA 5H5QA 4MMMA 2B5YA 3GNJA 4MZCA 3HJOA 2PUKC 1ACVA 1SKSB 4K7NA 2PVOC 2P31A 5GAND 2YWIA 4HDEA 4EUYA 1JZOA 3KMNA 4L5OA 5ENUA 5ABRA 3TKPA 3V1WA 3GH6A 2KP2A 3GIXA 3GN3A 1UC7A 3ERGA 4GF0A 3IXRA 4NV2A 1F3BA 5IOXA 4F9ZA 4Q5RA 8GSSA 3HCZA 1YKCA 4PURA 3D5JA 4MA9A 3LFLA 1VF2A 4MCUA 4G10A 3UARA 3I6AA 3LYKA 4OMVA 4IJ3A 7GSSA 3GL5A 4TR4A 2H75A 1T3BA 2ES7A 1GTIA 1OYJA 3EMXA 4PX1A 4I5QA 2VL3A 2HNLA 1V9WA 2ALBA 4ZBAA 2WRTA 2JZSA 1B8XA 3TJKA 1TK5B 5ECPB 2AAWA 5ECQB 3ERWA 5KEJA 1DBYA 1O7UA 4POMA 3A5WA 3TKRA 3HXSA 4ZL7A 5D96A 5D9WA 1OC3A 2O87A 4BWSA 1A0RP 2IMDA 3IRAA 4CDOA 3PGTA 1MTCA 2CT6A 4WBJA 3ISOA 3L9UA 4TW5A 5ECOB 5HR2A 5E59A 3KP9A 4IVFA 1TXXA 4MJCA 2IFQB 4F0BA 2V6KA 3IBHA 2VOCA 3R2QA 3I43A 3TOTA 5J41A 5J9BA 4MH3A 4ZILA 1WPIA 2F8AA 2H1DA 4TR1B 4GXZA 1X0RA 1VF1A 4NMUA 3QFBC 5G5FA 2YWMA 1K0BA 5ECKB 5ECSA 3O76A 2BTOT 3DVXA 1NM3A 1FVKA 2MBSA 1GUMA 2LUSA 2KOKA 4ILFA 3L78A 1B4PA 3CRTA 3M1GA 3DRNA 3ZL5A 5CREA 3DKSA 2FWGA 2JZRA 3W6GA 4KUNA 1OE8A 2J9HA 2A2SA 2YANA 1XWCA 1HNAA 3M8NA 3HA9A 2VCTA 1NHYA 17GSA 1Z3EA 3KZQA 3JCML 3P8WA 3GX0A 2O7KA 4LMVA 2FLSA 2OE3A 3APQA 2CA8A 5DBQA 1R5PA 2XPDA 4PUFC 2CVDA 2R2JA 2FGXA 5LCZA 2C8UA 3CTFA 5G2ZA 3LSZA 2NDOA 4TXOB 1PRXA 2X8GA 2CAIA 1TK8B 1T4YA 2YPMA 5JWOB 4JR4A 1AC1A 2DMMA 4POBA 4V1Ag 2LV3A 2VM1A 4WKWA 4P3YB 3RPPA 4GWRA 3DGQA 3FR6A 4YQVA 2F8FA 4BWQA 2G0FA 3A2VA 5IO2A 5DCGA 3VWWA 2CV4A 3TJJA 2DJKA 5G30A 2WGRA 5AN1A 3O3TA 5CYYA 3LORA 5H5RA 1GLQA 1VGLA 1HQOA 2IMIA 3EWLA 2O8VB 4I6XA 2CVKA 4CW9A 5D9XA 3FZAA 1ERVA 1FB6A 1GTAA 1MDKA 3TGZA 1J9BA 5D73A 2M72A 4XCSA 5A5KA 2WJUA 3RAZA 4MJBA 2H1GA 5IMZA 3DD3A 3E0UA 3DVWA 3FY7A 4HJMA 3S9FA 4D73A 2FNOA 1K3LA 1F9MA 2KHPA 2DJ2A 1YZXA 5JWQB 4YAVA 2H0GA 4ZBBA 4G9HA 1K3OA 2R37A 3ED3A 4QL9A 2P0GA 3CXGA 4HI7A 1T4ZA 2LTKA 1SL2B 2CX3A 4MH2A 1PN9A 1ZOFA 2WZ9A 1WJKA 2PMTA 4ZL9A 4PUAA 4O32A 3DWVA 19GSA 2M80A 4NPBA 1BQ7A 3D4MA 3FHKA 10GSA 4RQRA 1PKWA 5GSSA 2HRFA 1SENA 4X43A 1UA5A 4BVYA 4OWYA 5HFGA 1ZGNA 2CX4A 3F6DA 4HS1A 5CP1A 2JZTA 3BCIA 1ZZYA 2PBJA 3NIVA 2IMFA 2IJYA 2LJKA 1OC8A 2FWFA 3VLNA 3EE2A 1M9BA 3K8NA 4XS4A 4ZB6A 3HVVA 4JZQA 5ECHB 4L8EA 2D2ZA 4OO4A 1TI1A 5A4VA 1JZWA 3KH9A 4GQCA 3FZ9A 1T00A 2N5BA 4ZB9A 5GZZB 3GX8A 5CO3A 1K0MA 1GSDA 4O92A 1T8EB 3F4TA 2EIQA 4NV5A 4CHSA 2RLIA 4FYBA 1YF1A 3D22A 2GGTA 1X9MB 4TVEA 1SU9A 5EVOA 3FYGA 2H76A 1U87A 1HNCA 2MMZA 4HJ2A 3I9V2 1K3YA 1CQHA 1KEBA 2K8VA 3FR9A 1K0NA 1XW5A 4IQ1A 1XVQA 1THOA 4N0ZA 4EDYA 4EXJA 4J2FA 1SL1B 2L57A 2DIZA 4Q5FA 4OD7A 2V6OA 3KJYA 2ON7A 1XW6A 3FKFA 3NZNA 4X0XA 1RW1A 5IMDA 1Y25A 5INYA 3F3QA 3EURA 2IMKA 4GTUA 5B8BA 1GULA 1ZCPA 3WGDA 4KX4A 2V1MA 2H01A 1WRYA 3FW2A 1VRSD 3GHAA 5AIXA 1CQGA 1K0CA 4IHUA 3UIWA 2H8LA 5FWGA 4FIWA 2C1YA 3ZITA 3VK9A 3WT2A 2LQOA 1EP8A 1O8XA 2WDUA 3ZREA 1V2AA 1GTUA 3U5RE 4TN8A 2C0FA 4RUVA 2VLUA 4ECCA 5B7CA 1G6WA 4IGJA 3FRCA 3GMFA 4BVXA 4IKHA 2GT6A 3C71A 4GLTA 2WCIA 5DQYA 3F63A 5GAPD 2OKAA 2H72A 4K0GA 2VLVA 1E2YA 2H0HA 2VD1A 3PINA 3ZRDA 4EO3A 2HZFA 1GUKA 3HY2A 3DIEA 1XPVA 1HNBA 4KDYA 1TTZA 3QCPA 1J08A 1TRWA 3APOA 4EDZA 1JHBA 1X5DA 4K7IA 2GDRA 4FYCA 3WGEA 3ME8A 2LNTA 2JSYA 3UOMA 11GSA 5J9CA 1SD8A 1IYIA 2C0EA 3KD0A 5ECLB 4F03A 3C73A 1ERUA 2VM2A 1OAZA 4G2EA 3LJRA 4GSTA 1S3CA 1RQMA 2B6MA 3VFIA 3GTUB 2G2QA 4YAPA 5IMCA 6GSWA 1SK2A 1F3AA 4XRAA 3CSJA 2N5FA 1R7HA 3I69A 1M99A 4KDUA 2DJ3A 1AIUA 4J56E 2MMNA 5F05A 2FA4A 4WETA 3H93A 4ECIA 3H8QA 3IV4A 3TDGA 3LXZA 4HQZA 1G0TA 2C0GA 4TR3A 4PQIA 1WOUA 3QDNA 2LNSA 3TOUA 1QK8A 1M9AA 1Q4JA 2MMOA 2PPTA 3IR4A 2QKEA 2FD3A 3VI5A 5D9VA 1U6TA 1O73A 1QXHA 1MD4A 4MK3A 4PQHA 2YNXA 1YKAA 1LU4A 4KE3A 4LL1B 1ML6A 6GSSA 2HFDA 3CSIA 1K0DA 5DVBA 1GP1A 3ZYWA 4ID0A 2EC4A 3VURA 3J7Yk 3MSZA 4TXVA 2FWEA 3EYTA 1AQVA 1MEKA 2R3XA 5IM9A 4KW6A 1K0OA 1BYEA 4EF0A 4EE0A 5DDLA 3Q19A 2R6KA 3TRXA 3CBUA 3VWVA 4Q5NA 1EP7A 2LEGA 1TP9A 2DIYA 3GRXA 2GSRA 4XHMA 4J57E 1SK1A 3D0ZA 3GSTA 2XBQA 1PD21 3VI7A 9GSSA 1GSEA 1TI3A 2HLSA 2OJLA 4AJ6A 1T1VA 4F2IA 2RIIA 2MMAA 3UVHA 4L5LA 4WF5A 1GTBA 2F51A 2F3MA 2YZUA 5ID2A 1AW9A 1R4WA 3H79A 5DJMA 2CZ2A 1A2MA 5ELGA 5DALA 2PWJA 3P7XA 1A23A 4GSNA 2GQLA 6GSVA 3PH9A 4OFNA 4KCEA 3N5OA 2PGTA 2WULA 2QGVA 1XWAA 3CTGA 3HKRA 1N2AA 1XWKA 2C3QA 4RQXA 5A4WA 5L71A 1S3DA 4DSSB 5AGYA 1OC9B 5J3RA 2M46A 3FR3A 2HZEB 1C72A 3IA1A 2V41A 1EZKA 3FK8A 2YZHA 2VD0A 4NXIA 4YQMA 1BAYA 3HHVA 4POLA 1DE1A 1SYRA 2CZ3A 2C3NA 5JCUA 3W8JA 1YEXA 1A2LA 5JCWA 4HU9A 2QC7A 4ML6A 2K6VA 4AF2A 1BJXA 1K0AA 3TJFA 2VAFA 3O6TA 3KH7A 4V2MA 3GKMA 3N9JA 5AIVA 3EU3A 4JEDA 1JZRA 2ON5A 2VL2C 4FH8A 3EINA 1XWBA 5JWRB 2YJHA 2YWNA 4N11A 4BL7A 3GTUA 5G5EA 1JZDA 3D21A 1GH2A 3G7IA 1JLVA 5LD0A 3UMAA 3TKSC 1GSSA 2WS2A 2L4QA 4E8HA 3HD5A 2P5RA 2R5GA 3M3MA 2B5EA 4MDCA 1PQNA 4BA7A 6GSXA 2YN1A 3Q74A 5IQYA 2GS3A 2FUG2 4KNDA 5DAKB 3GURA 2HT9A 4K1FA 3WD6A 4OO5A 3KCMA 2HE3A 2GVPA 5HR1A 3IAS2 12GSA 2AYTA 5DJLA 3UL3A 1PL1A 3CRUA 2B3SA 4YH2A 1IYHA 2DLXA 2K18A 3QOUA 3KXOA 3E3EA 1J0FA 4XIHA 2NVLA 3PR8A 1WE0A 1KBNA 2B5XA 4WF4A 4ULXA 4OFTA 2OE0A 1GSFA 4ZXGA 1HYUA 2RM6A 2Z9SA 5HFIA 2KLXA 1EWXA 4PGTA 2FA8A 1B9YC 2YJ7A 1X9WB 2IFQA 1F6MC 1TKDB 3RBTA 4HUAA 3QAGA 1FO5A 2DJ0A 4PNFA 2XBIA 1B48A 2XPEA 4MLYA 5CRGA 2YV9A 1ZYQB 1ABAA 2VCQA 5HFKA 4MP4A 4KGIA 2TRCP 4TR1A 2IWTA 5ELAA 4HZ2A 5J5NA 1OKDA 5IO0A 4IJIA 3ZVJD 4I8BA 1XOAA 2JSZA 3TJBA 3KEBA 2NTOA 4JBBA 1F2EA 1THXA 2DJ1A 5IMAA 4XTSA 3QAWA 1Z7PA 3ME7A 2H73A 3TKSE 4LL4B 4XS1A 4N30A 1FOVA 1BX9A 2B1KA 3IK7A 1SL0B 3KGKA 5F06A 2NPBA 2L4CA 2L6DA
chains in the Genus database with same CATH superfamily
3MIXA 3CYNA 3ZIVA 2REMA 3DEXA 3P2AA 4N0VA 2LJRA 3Q18A 3GFKA 3UVTA 2H6XA 3AY8A 1ZYNA 2MBTA 3UBLA 4IP1A 1PKZA 3KMOA 5CNWA 2VL2A 5FT3A 1MD3A 1YY7A 3LWAA 1TW9A 2YV7A 3MDKA 2CAQA 4WXTA 3BBYA 4XRDA 1RK4A 4N10A 3TRPA 2K8SA 4DEJA 2X99A 1PA3A 2C3TA 5E4WA 1QGVA 1OC9A 3LG6A 2HZEA 3TCOA 3VWUA 1PGTA 3TKSA 4TXOA 1TU7A 3ZZXA 2AV4A 3GKXA 4TOPA 2V2GA 1FB0A 1AAZA 1LBKA 1VF4A 1Z7RA 4MPGA 5IIZA 4TR0A 1H4OA 3LXTA 4PTSA 3F0IA 3C7MA 3C1RA 2OE1A 1DSBA 2DMLA 1AQWA 1OE7A 4MZWA 1HD2A 3NOFA 3ZVJA 2HXKA 2O85A 1MDJA 1YQ1A 2DC5A 4RI7A 2H66A 3UBKA 4HZ4A 3D6IA 2GZZA 1F37A 4FQUA 4MF5A 3LW9A 2X8CA 4LLRA 2J23A 2LRCA 4QL7A 3IE3A 1O81A 3APSA 1TRVA 3CSHA 4AJ7A 2GSTA 2PN8A 5C00A 3G7JA 1YEPA 2B7JA 1R5AA 1TRSA 1EV4A 3HJPA 1YDKA 5KN2A 1EV9A 3MAKA 20GSA 1ZL9A 4IQAA 2EIRA 3D4TA 3LQ7A 1YJ6A 2TIRA 2ZUPA 1B4QA 1M0UA 2RM5A 1Q98A 4K9ZA 4MPFA 5DAKA 1AXDA 2H71A 2GZYA 4KSMA 1EEJA 2JU5A 1G7OA 3FMWA 5EY6A 2RUFA 3DXBA 2AHEA 4KA0A 3BD2A 2HSMA 4O5RA 2FY6A 1DE2A 3ZFBA 1DUGA 1Z5YE 1KTEA 1SYXA 2VO4A 4JE1A 2CVBA 2IN3A 5D9TA 2CQ9A 2VUPA 1SKRB 3GUSA 4L0WA 5COHA 3W8SA 1I5GA 4Z2TA 4I97A 1XZOA 2DSAA 3QPMA 4G0IA 3GYKA 5D93A 1A24A 5IOWA 4IELA 5B6MA 1Z6NA 1VF3A 4IN0A 1A2JA 1Y6EA 1WMJA 2K9FA 3HZ4A 2DJJA 3A3TA 2KUCA 4AJ8A 4OFMA 2H1BA 4ML1A 5C04A 1EOHA 3IHGA 3SBCA 2GT5A 22GSA 3A2XA 2MZCA 1GLPA 2N5AA 1TDIA 2UZ8A 3EU4A 3TUEA 2HSHA 4D73B 2QA1A 4DVCA 3LEFA 1XFLA 1Z6MA 2IL3A 1XCCA 4ZIJA 1PN0A 1R26A 4I2UA 4ICYA 2LRNA 2YP6A 4KCAA 1JFUA 2H0IA 3M9KA 4PQ1A 5KN1A 3BOAA 3MWHA 1AQXA 1PX7A 1TJDA 4O7HA 1XWGA 3EC3A 1I9DA 1V58A 5ECRB 2F9SA 3VPTA 3L9VA 4XS6A 1ERTA 1USBA 2L59A 3H4KA 3GKNA 4E8EA 3Q6OA 3C8EA 2MYGA 3IK9A 2E7PA 3RPNA 3F4SA 4RI6A 1PMTA 1FVJA 2HSYA 3SWLA 5IPHA 2GSQA 1EGRA 1UN2A 3IOSA 4L0UA 4ISDA 1FOHA 3M0FA 3QMXA 4WEYA 2IPAA 4H86A 1GSUA 3ZMKA 1O6JA 2QSIA 2PU9C 2DBCA 1WIKA 3TB2A 2LJAA 1NHOA 3P90A 4MJEA 3GKKA 4XS4B 5KN0A 1NSWA 1SJIA 3RHCA 4DSRA 4KAEA 5ECIB 5IMFA 3KP8A 4K2DA 2GLRA 2HRNA 2I1UA 5CRDA 3ZTLA 2XHFA 4Q5QA 1SK0A 2EIOA 4GCIA 2H1AA 3HZ8A 3GSSA 5IMVA 2P5QA 1S3AA 16GSA 2OA7A 3KM6A 4POKA 1URMA 1KNGA 3WT1A 5GSTA 2B7KA 3H1NA 1FG4A 4HU7A 3UEMA 2H6ZA 3G9BA 4IBPA 4JRRA 4GQFA 3C1SA 5F8BA 2PVQA 2LSTA 3IAM2 2VCVA 2ZCTA 1GNEA 4OCEA 2YCDA 3IC4A 2I9HA 3BCKA 4I2TA 1TU8A 3LGCA 3L9SA 3TJGA 1ON4A 5H5SA 1G7EA 1PL2A 2GZPA 3HVSA 2LS5A 1QMVA 3ZFLA 5ECNB 1V40A 5HR3A 3MNGA 4QQ7A 4MABA 1UVZA 2B1LA 4IS0A 2X8HA 1O85A 1U3IA 4IW9A 3LYPA 3GL3A 1ILOA 1BG5A 4EKZA 2AUVA 1SJZA 2I81A 4WR5A 3KTBA 5HQPA 1LJRA 5ECMB 4ZL8A 6GSTA 4Z2RA 4BPYA 2OADA 2H19A 1M2DA 4K7OA 1A8YA 4LA1A 2VCZA 3WYWA 1T7PB 4EL1A 4NHWA 5CAXA 2FHEA 2I3YA 2VCXA 1M7TA 4NHZA 4GRFA 2C0DA 18GSA 4HQSA 5B8AA 2IIYA 2AB6A 3F4RA 3E9JB 4EIPA 2E0QA 1QUWA 2VLTA 4NAXA 5J4UA 4O5QA 2BMXA 5FHIA 2LQQA 2L5LA 1O8WA 1GSQA 1N8JA 4DSQA 3M9JA 4KH7A 2A4HA 3CMIA 4BVXB 4KF9A 4HEA2 3GH9A 4V2NA 2E2MA 2WFCA 4WR4A 4F0CA 4ACSA 1SKWB 1X5EA 4JU5A 2DKIA 4ZBDA 2WB9A 2X49A 3RHBA 4MJAA 14GSA 3IHQA 1PFOA 4IP6A 1XOBA 4HOJA 3ZIJA 3DYRA 3L0HA 2JADA 2A2RA 4YQUA 3EMPA 1GUHA 2OACA 4JR6A 5F07A 2DKHA 1AUCA 2H70A 13GSA 2H30A 5CRHA 1A8LA 2GTUA 1ERWA 3U6VA 4LMWA 2NBSA 5KN3A 1X5CA 2A4VA 3L4NA 4FYUA 4O5UA 5EPFA 3F8UA 2HYXA 4EVMA 1W89A 1H75A 1ZMAA 4K5RA 5LNKe 4ECBA 1XVWA 4FO5A 4MZBA 4TRXA 3US3A 4K8MA 1GRXA 3RDWA 1GWCA 5A4UA 2FWHA 2AJQB 3IC8A 4AGSA 4ECJA 1GNWA 3IPZA 4KSOA 1JLWA 1OVNA 1ZYEA 3QFAC 3UAPA 2L6CA 3KTLA 2C80A 2OBIA 1V57A 3KIJA 1XIYA 6GSUA 2RUEA 1X9SB 1V98A 2YWOA 1GL8A 1XXUA 1XBSA 1GSYA 3IDVA 4MF7A 3GV1A 1EGOA 3QD9A 3WGXA 2LKUA 2ZNMA 1U3AA 2IMEA 5IPGA 4KDXA 5G31A 1EEMA 2JACA 2R4VA 1M2BA 3ERFA 4WBRD 5AISA 1U88A 1FHEA 4KB3A 2BJXA 2C4JA 1NW2A 4K6XA 1M2AA 1TK0B 3EVIA 2H74A 5G1LA 1W4VA 3A2WA 2TRXA 1B9XC 2HI7A 3FZ5A 4DSSA 2V32A 5EL8A 2XC2A 3UJ1A 1FW1A 2FCHA 1WP0A 3F9UA 5BMUA 1TOFA 3HVXA 2X4AA 3FZ4A 1XW9A 6GSYA 3DMLA 4TKYA 3ZLPA 4V2LA 1BEDA 2VL9A 1PSQA 5G1KA 1MDIA 3ZMLA 1YF0A 1OKTA 1QQ2A 4NWYA 1FAAA 5ID2B 2OBKA 4PXOA 1ST9A 3F3RA 1PX6A 2O89A 1QFNA 3G7YA 1SJ6A 4F82A 1TRUA 2X64A 2VCWA 3QR6A 2L5OA 1WWJA 2PERA 4GSSA 5DALB 2GQKA 3QAVA 5CRWA 4EC0A 4Z2UA 5F0GA 1E6BA 2I4AA 5DCHA 1SD9A 4K0NA 3TKQA 3GA4A 3TRQA 1A0FA 3BJ5A 5D8IA 3HDCA 4OCFA 5DQSA 5B6NA 5JCGA 2JL4A 3OR5A 3FEUA 4PNGA 3F6FA 1G6YA 2YOIA 3J7Yb 2VIMA 3VWXA 3HYPA 2GQMA 4V1Ap 4ZB8A 2LRTA 2KP1A 3VPQA 2GSSA 4MF6A 4Z7XA 5HR0A 4X1UA 4G19A 1Z9HA 1EOGA 2E2GA 2H6YA 3HJMA 5H5QA 4MMMA 2B5YA 3GNJA 4MZCA 3HJOA 2PUKC 1ACVA 1SKSB 4K7NA 2PVOC 2P31A 5GAND 2YWIA 4HDEA 4EUYA 1JZOA 3KMNA 4L5OA 5ENUA 5ABRA 3TKPA 3V1WA 3GH6A 2KP2A 3GIXA 3GN3A 1UC7A 3ERGA 4GF0A 3IXRA 4BIKA 4NV2A 1F3BA 5IOXA 4F9ZA 4Q5RA 8GSSA 3HCZA 1YKCA 4BL7B 4PURA 3D5JA 4MA9A 3LFLA 1VF2A 4MCUA 4G10A 3UARA 3I6AA 3LYKA 4OMVA 4IJ3A 7GSSA 3GL5A 4TR4A 2H75A 1T3BA 2ES7A 1GTIA 4PX1A 1OYJA 3EMXA 4I5QA 2VL3A 2HNLA 1V9WA 1M3IA 2ALBA 4ZBAA 2WRTA 2JZSA 1B8XA 3TJKA 1TK5B 5ECPB 2AAWA 5ECQB 3ERWA 5KEJA 1DBYA 1O7UA 4POMA 3A5WA 3TKRA 3HXSA 4ZL7A 5D96A 5BRTA 5D9WA 1OC3A 2O87A 4BWSA 1A0RP 2IMDA 3IRAA 4CDOA 3PGTA 1MTCA 2CT6A 4WBJA 3ISOA 3L9UA 4TW5A 5ECOB 5HR2A 5E59A 3KP9A 4IVFA 1TXXA 4X4JA 4MJCA 4HSCX 2IFQB 4F0BA 4BVYB 2V6KA 3IBHA 2VOCA 3R2QA 3I43A 3TOTA 5J41A 5J9BA 4MH3A 4ZILA 1WPIA 2F8AA 2H1DA 4TR1B 4GXZA 1X0RA 1VF1A 4NMUA 3QFBC 5G5FA 2YWMA 1K0BA 5ECKB 5ECSA 3O76A 2BTOT 3DVXA 4YKFA 1NM3A 1FVKA 2MBSA 1GUMA 2LUSA 2KOKA 4ILFA 3L78A 1B4PA 3CRTA 3M1GA 3DRNA 3ZL5A 5CREA 3DKSA 2FWGA 2JZRA 3W6GA 4KUNA 1OE8A 2J9HA 2A2SA 2YANA 1XWCA 1HNAA 3M8NA 3HA9A 2VCTA 1NHYA 17GSA 1Z3EA 3KZQA 3CQFA 3JCML 3P8WA 3GX0A 2O7KA 4LMVA 2FLSA 2OE3A 3APQA 2CA8A 5DBQA 1R5PA 2XPDA 4PUFC 2CVDA 2R2JA 2FGXA 4USSA 5LCZA 2C8UA 3CTFA 5G2ZA 3LSZA 2NDOA 4TXOB 1PRXA 2X8GA 2CAIA 1TK8B 1T4YA 4G0LA 2YPMA 5JWOB 4JR4A 1AC1A 2DMMA 4POBA 4V1Ag 2LV3A 2VM1A 4WKWA 4P3YB 3RPPA 4GWRA 3DGQA 3FR6A 4YQVA 2F8FA 4BWQA 2G0FA 3A2VA 5IO2A 5DCGA 3VWWA 2CV4A 3TJJA 2DJKA 5G30A 2WGRA 5AN1A 3O3TA 5CYYA 3LORA 5H5RA 1GLQA 1VGLA 1HQOA 2IMIA 3EWLA 2O8VB 4I6XA 2CVKA 4CW9A 5D9XA 3FZAA 1ERVA 1FB6A 1GTAA 1MDKA 1ZYPA 3TGZA 1J9BA 5D73A 2M72A 4XCSA 5A5KA 2WJUA 3RAZA 4MJBA 2H1GA 5IMZA 3DD3A 3E0UA 3DVWA 3FY7A 4HJMA 4A5PA 3S9FA 2HRAA 4D73A 2FNOA 1K3LA 1F9MA 2KHPA 2DJ2A 1YZXA 5JWQB 4YAVA 2H0GA 4ZBBA 2HRKA 4G9HA 1K3OA 2R37A 3ED3A 4QL9A 2P0GA 3CXGA 4HI7A 1T4ZA 2LTKA 1SL2B 2CX3A 4MH2A 1PN9A 1ZOFA 2WZ9A 1WJKA 2PMTA 4ZL9A 4PUAA 4O32A 3DWVA 19GSA 2M80A 4NPBA 3R3EA 1BQ7A 3D4MA 3FHKA 10GSA 4RQRA 1PKWA 5GSSA 2HRFA 1SENA 4X43A 1UA5A 4BVYA 4OWYA 5HFGA 1ZGNA 2CX4A 3F6DA 4HS1A 5CP1A 2JZTA 3BCIA 1ZZYA 2PBJA 3NIVA 2IMFA 2IJYA 4YKGA 2LJKA 1OC8A 2FWFA 3VLNA 3EE2A 3MYDA 1M9BA 3K8NA 4XS4A 4ZB6A 3HVVA 4JZQA 5ECHB 4L8EA 2D2ZA 4OO4A 1TI1A 5A4VA 1JZWA 3KH9A 4GQCA 3FZ9A 1T00A 2N5BA 4ZB9A 5GZZB 3GX8A 5CO3A 1K0MA 1GSDA 4O92A 1T8EB 3F4TA 2EIQA 4NV5A 4CHSA 2RLIA 4FYBA 1YF1A 3D22A 2GGTA 1X9MB 4TVEA 1SU9A 5EVOA 3FYGA 2H76A 1U87A 1HNCA 2MMZA 4HJ2A 3I9V2 1K3YA 1CQHA 1KEBA 2K8VA 3FR9A 1K0NA 1XW5A 4IQ1A 1XVQA 1THOA 4N0ZA 4EDYA 4EXJA 4J2FA 1SL1B 2L57A 2DIZA 4Q5FA 4OD7A 2V6OA 3KJYA 2ON7A 1XW6A 3FKFA 3NZNA 4X0XA 1RW1A 2R0GA 5IMDA 1Y25A 5INYA 1S3RA 3F3QA 3EURA 2IMKA 4GTUA 5B8BA 1GULA 1ZCPA 4CY6A 3WGDA 4KX4A 2V1MA 2H01A 4G0KA 1WRYA 3FW2A 1VRSD 3GHAA 5AIXA 1CQGA 1K0CA 4IHUA 3UIWA 2H8LA 2A2PA 5FWGA 4FIWA 2C1YA 3ZITA 3VK9A 3WT2A 2LQOA 1EP8A 1O8XA 2WDUA 3ZREA 1V2AA 5KOWA 1GTUA 3U5RE 4TN8A 2C0FA 4RUVA 2VLUA 4ECCA 5B7CA 1G6WA 4IGJA 3FRCA 3GMFA 4BVXA 4IKHA 2GT6A 3C71A 4GLTA 2WCIA 5DQYA 3F63A 5GAPD 2OKAA 2H72A 4K0GA 2VLVA 1E2YA 2H0HA 2VD1A 3PINA 3ZRDA 4EO3A 2HZFA 1GUKA 3HY2A 3DIEA 1XPVA 1HNBA 4KDYA 1TTZA 3QCPA 1J08A 1TRWA 3APOA 4K2XA 4EDZA 1JHBA 1X5DA 4K7IA 2GDRA 4FYCA 3WGEA 3ME8A 2LNTA 2JSYA 3UOMA 11GSA 5J9CA 1SD8A 1IYIA 2C0EA 3KD0A 5ECLB 4F03A 3C73A 1ERUA 2VM2A 1OAZA 4G2EA 3LJRA 4GSTA 1S3CA 1RQMA 2B6MA 3VFIA 3GTUB 2G2QA 4YAPA 5IMCA 6GSWA 1SK2A 1F3AA 4XRAA 3CSJA 2N5FA 1R7HA 3I69A 1M99A 4KDUA 2DJ3A 1AIUA 4J56E 2MMNA 5F05A 4K5SA 2FA4A 4WETA 4CY8A 3H93A 4ECIA 3H8QA 3IV4A 3A5IA 3TDGA 3LXZA 4HQZA 1G0TA 2C0GA 4TR3A 4PQIA 1WOUA 3QDNA 2LNSA 3TOUA 1QK8A 1M9AA 1Q4JA 2MMOA 2PPTA 3IR4A 2QKEA 2FD3A 3VI5A 5D9VA 1U6TA 1O73A 1QXHA 1MD4A 4MK3A 4PQHA 2YNXA 1YKAA 1LU4A 4KE3A 4LL1B 1ML6A 6GSSA 2HFDA 2QA2A 3CSIA 1K0DA 5DVBA 1GP1A 3ZYWA 4ID0A 2EC4A 3VURA 3J7Yk 3MSZA 4TXVA 2FWEA 3EYTA 1AQVA 1MEKA 2R3XA 5IM9A 4KW6A 1K0OA 1BYEA 4EF0A 4EE0A 5DDLA 3Q19A 2R6KA 3TRXA 3CBUA 3VWVA 4Q5NA 1EP7A 2LEGA 1TP9A 2DIYA 3GRXA 1XG8A 2GSRA 4XHMA 4J57E 1SK1A 3EPTA 3D0ZA 3GSTA 2XBQA 1PD21 3VI7A 9GSSA 1GSEA 1TI3A 2HLSA 2OJLA 4AJ6A 1T1VA 4F2IA 2RIIA 2MMAA 3UVHA 4L5LA 4WF5A 4EIQA 1GTBA 2F51A 2F3MA 2YZUA 5ID2A 1AW9A 1R4WA 3H79A 5DJMA 2CZ2A 1A2MA 5ELGA 5DALA 2PWJA 3P7XA 1A23A 4GSNA 2GQLA 6GSVA 3PH9A 4OFNA 4KCEA 3N5OA 2PGTA 2WULA 2QGVA 1XWAA 3CTGA 3HKRA 1N2AA 1XWKA 2C3QA 4RQXA 5A4WA 5L71A 1S3DA 4DSSB 5AGYA 1OC9B 5J3RA 2M46A 3FR3A 2HZEB 1C72A 3HVNA 3PPUA 3IA1A 2V41A 1EZKA 3FK8A 2YZHA 2VD0A 4NXIA 4YQMA 1BAYA 3HHVA 4POLA 1DE1A 1SYRA 2CZ3A 2C3NA 5JCUA 3W8JA 1YEXA 1A2LA 5JCWA 4HU9A 2QC7A 4ML6A 2K6VA 4AF2A 1BJXA 1K0AA 3TJFA 2VAFA 3O6TA 3KH7A 4V2MA 3GKMA 3N9JA 5AIVA 3EU3A 4JEDA 1JZRA 2ON5A 2VL2C 4FH8A 3EINA 1XWBA 5JWRB 2YJHA 2YWNA 4N11A 4BL7A 3GTUA 5G5EA 1JZDA 3D21A 1GH2A 3G7IA 1JLVA 5LD0A 3UMAA 3TKSC 1GSSA 2WS2A 2L4QA 4E8HA 3HD5A 2P5RA 2R5GA 3M3MA 2B5EA 4MDCA 1PQNA 4MNNA 4BA7A 6GSXA 2YN1A 3Q74A 5IQYA 2GS3A 5KOXA 2FUG2 4KNDA 3GURA 5DAKB 2HT9A 4K1FA 3WD6A 4OO5A 3KCMA 2HE3A 2GVPA 5HR1A 3IAS2 12GSA 2AYTA 5DJLA 3UL3A 1PL1A 3CRUA 2B3SA 4YH2A 1IYHA 2DLXA 2K18A 3QOUA 3KXOA 3E3EA 1J0FA 4XIHA 2NVLA 3PR8A 1WE0A 1KBNA 2B5XA 4WF4A 4ULXA 4OFTA 2OE0A 1GSFA 4ZXGA 1HYUA 2RM6A 2Z9SA 5HFIA 1M3JA 2R0CA 2KLXA 1EWXA 4PGTA 2FA8A 1B9YC 2YJ7A 1X9WB 2IFQA 1F6MC 1TKDB 3RBTA 4HUAA 3QAGA 1FO5A 2DJ0A 2R0PA 4PNFA 2XBIA 1B48A 2XPEA 4MLYA 5CRGA 2YV9A 1ZYQB 1ABAA 2VCQA 5HFKA 4MP4A 4KGIA 2TRCP 4TR1A 2IWTA 5ELAA 4HZ2A 5J5NA 1OKDA 5IO0A 4IJIA 3ZVJD 4I8BA 1XOAA 2JSZA 3TJBA 3KEBA 2NTOA 4JBBA 1F2EA 1THXA 2DJ1A 5IMAA 4XTSA 3QAWA 1Z7PA 3ME7A 2H73A 3TKSE 4LL4B 4XS1A 4N30A 1FOVA 1BX9A 2B1KA 3IK7A 1SL0B 3KGKA 5F06A 2NPBA 2L4CA 2L6DA
chains in the Genus database with same CATH topology
3MIXA 3CYNA 3ZIVA 2REMA 3DEXA 3P2AA 4N0VA 2LJRA 3Q18A 3GFKA 3UVTA 2H6XA 3AY8A 1ZYNA 2MBTA 3UBLA 4IP1A 1PKZA 3KMOA 5CNWA 2VL2A 5FT3A 1MD3A 1YY7A 3LWAA 1TW9A 2YV7A 3MDKA 2CAQA 4WXTA 3BBYA 4XRDA 1RK4A 4N10A 3TRPA 2K8SA 4DEJA 2X99A 1PA3A 2C3TA 5E4WA 1QGVA 1OC9A 3LG6A 2HZEA 3TCOA 3VWUA 1PGTA 3TKSA 4TXOA 1TU7A 3ZZXA 2AV4A 3GKXA 4TOPA 2V2GA 1FB0A 1AAZA 1LBKA 1VF4A 1Z7RA 4MPGA 5IIZA 4TR0A 1H4OA 3LXTA 4PTSA 3F0IA 3C7MA 3C1RA 2OE1A 1DSBA 2DMLA 1AQWA 1OE7A 4MZWA 1HD2A 3NOFA 3ZVJA 2HXKA 2O85A 1MDJA 1YQ1A 2DC5A 4RI7A 2H66A 3UBKA 4HZ4A 3D6IA 2GZZA 1F37A 4FQUA 4MF5A 3LW9A 2X8CA 4LLRA 2J23A 2LRCA 4QL7A 3IE3A 1O81A 3APSA 1TRVA 3CSHA 4AJ7A 2GSTA 2PN8A 5C00A 3G7JA 1YEPA 2B7JA 1R5AA 1TRSA 1EV4A 3HJPA 1YDKA 5KN2A 1EV9A 3MAKA 20GSA 1ZL9A 4IQAA 2EIRA 3D4TA 3LQ7A 1YJ6A 2TIRA 2ZUPA 1B4QA 1M0UA 2RM5A 1Q98A 4K9ZA 4MPFA 5DAKA 1AXDA 2H71A 2GZYA 4KSMA 1EEJA 2JU5A 1G7OA 3FMWA 5EY6A 2RUFA 3DXBA 2AHEA 4KA0A 3BD2A 2HSMA 4O5RA 2FY6A 1DE2A 3ZFBA 1DUGA 1Z5YE 1KTEA 1SYXA 2VO4A 4JE1A 2CVBA 2IN3A 5D9TA 2CQ9A 2VUPA 1SKRB 3GUSA 4L0WA 5COHA 3W8SA 1I5GA 4Z2TA 4I97A 1XZOA 2DSAA 3QPMA 4G0IA 3GYKA 5D93A 1A24A 5IOWA 4IELA 5B6MA 1Z6NA 1VF3A 4IN0A 1A2JA 1Y6EA 1WMJA 2K9FA 3HZ4A 2DJJA 3A3TA 2KUCA 4AJ8A 4OFMA 2H1BA 4ML1A 5C04A 1EOHA 3IHGA 3SBCA 2GT5A 22GSA 3A2XA 2MZCA 1GLPA 2N5AA 1TDIA 2UZ8A 3EU4A 3TUEA 2HSHA 4D73B 2QA1A 4DVCA 3LEFA 1XFLA 1Z6MA 2IL3A 1XCCA 4ZIJA 1PN0A 1R26A 4I2UA 4ICYA 2LRNA 2YP6A 4KCAA 1JFUA 2H0IA 3M9KA 4PQ1A 5KN1A 3BOAA 3MWHA 1AQXA 1PX7A 1TJDA 4O7HA 1XWGA 3EC3A 1I9DA 1V58A 5ECRB 2F9SA 3VPTA 3L9VA 4XS6A 1ERTA 1USBA 2L59A 3H4KA 3GKNA 4E8EA 3Q6OA 3C8EA 2MYGA 3IK9A 2E7PA 3RPNA 3F4SA 4RI6A 1PMTA 1FVJA 2HSYA 3SWLA 5IPHA 2GSQA 1EGRA 1UN2A 3IOSA 4L0UA 4ISDA 1FOHA 3M0FA 3QMXA 4WEYA 2IPAA 4H86A 1GSUA 3ZMKA 1O6JA 2QSIA 2PU9C 2DBCA 1WIKA 3TB2A 2LJAA 1NHOA 3P90A 4MJEA 3GKKA 4XS4B 5KN0A 1NSWA 1SJIA 3RHCA 4DSRA 4KAEA 5ECIB 5IMFA 3KP8A 4K2DA 2GLRA 2HRNA 2I1UA 5CRDA 3ZTLA 2XHFA 4Q5QA 1SK0A 2EIOA 4GCIA 2H1AA 3HZ8A 3GSSA 5IMVA 2P5QA 1S3AA 16GSA 2OA7A 3KM6A 4POKA 1URMA 1KNGA 3WT1A 5GSTA 2B7KA 3H1NA 1FG4A 4HU7A 3UEMA 2H6ZA 3G9BA 4IBPA 4JRRA 4GQFA 3C1SA 5F8BA 2PVQA 2LSTA 3IAM2 2VCVA 2ZCTA 1GNEA 4OCEA 2YCDA 3IC4A 2I9HA 3BCKA 4I2TA 1TU8A 3LGCA 3L9SA 3TJGA 1ON4A 5H5SA 1G7EA 1PL2A 2GZPA 3HVSA 2LS5A 1QMVA 3ZFLA 5ECNB 1V40A 5HR3A 3MNGA 4QQ7A 4MABA 1UVZA 2B1LA 4IS0A 2X8HA 1O85A 1U3IA 4IW9A 3LYPA 3GL3A 1ILOA 1BG5A 4EKZA 2AUVA 1SJZA 2I81A 4WR5A 3KTBA 5HQPA 1LJRA 5ECMB 4ZL8A 6GSTA 4Z2RA 4BPYA 2OADA 2H19A 1M2DA 4K7OA 1A8YA 4LA1A 2VCZA 3WYWA 1T7PB 4EL1A 4NHWA 5CAXA 2FHEA 2I3YA 2VCXA 1M7TA 4NHZA 4GRFA 2C0DA 18GSA 4HQSA 5B8AA 2IIYA 2AB6A 3F4RA 3E9JB 4EIPA 2E0QA 1QUWA 2VLTA 4NAXA 5J4UA 4O5QA 2BMXA 5FHIA 2LQQA 2L5LA 1O8WA 1GSQA 1N8JA 4DSQA 3M9JA 4KH7A 2A4HA 3CMIA 4BVXB 4KF9A 4HEA2 3GH9A 4V2NA 2E2MA 2WFCA 4WR4A 4F0CA 4ACSA 1SKWB 1X5EA 4JU5A 2DKIA 4ZBDA 2WB9A 2X49A 3RHBA 4MJAA 14GSA 3IHQA 4IP6A 1XOBA 4HOJA 3ZIJA 3DYRA 3L0HA 2JADA 2A2RA 4YQUA 3EMPA 1GUHA 2OACA 4JR6A 5F07A 2DKHA 1AUCA 2H70A 13GSA 2H30A 5CRHA 1A8LA 2GTUA 1ERWA 3U6VA 4LMWA 2NBSA 5KN3A 1X5CA 2A4VA 3L4NA 4FYUA 4O5UA 5EPFA 3F8UA 2HYXA 4EVMA 1W89A 1H75A 1ZMAA 4K5RA 5LNKe 4ECBA 1XVWA 4FO5A 4MZBA 4TRXA 3US3A 4K8MA 1GRXA 3RDWA 1GWCA 5A4UA 2FWHA 2AJQB 3IC8A 4AGSA 4ECJA 1GNWA 3IPZA 4KSOA 1JLWA 1OVNA 1ZYEA 3QFAC 3UAPA 2L6CA 3KTLA 2C80A 2OBIA 1V57A 3KIJA 1XIYA 6GSUA 2RUEA 1X9SB 1V98A 2YWOA 1GL8A 1XXUA 1XBSA 1GSYA 3IDVA 4MF7A 3GV1A 1EGOA 3QD9A 3WGXA 2LKUA 2ZNMA 1U3AA 2IMEA 5IPGA 4KDXA 5G31A 1EEMA 2JACA 2R4VA 1M2BA 3ERFA 4WBRD 5AISA 1U88A 1FHEA 4KB3A 2BJXA 2C4JA 1NW2A 4K6XA 1M2AA 1TK0B 3EVIA 2H74A 5G1LA 1W4VA 3A2WA 2TRXA 1B9XC 2HI7A 3FZ5A 4DSSA 2V32A 5EL8A 2XC2A 3UJ1A 1FW1A 2FCHA 1WP0A 3F9UA 5BMUA 1TOFA 3HVXA 2X4AA 3FZ4A 1XW9A 6GSYA 3DMLA 4TKYA 3ZLPA 4V2LA 1BEDA 2VL9A 1PSQA 5G1KA 1MDIA 3ZMLA 1YF0A 1OKTA 1QQ2A 4NWYA 1FAAA 5ID2B 2OBKA 4PXOA 1ST9A 3F3RA 1PX6A 2O89A 1QFNA 3G7YA 1SJ6A 4F82A 1TRUA 2X64A 2VCWA 3QR6A 2L5OA 1WWJA 2PERA 4GSSA 5DALB 2GQKA 3QAVA 5CRWA 4EC0A 4Z2UA 5F0GA 1E6BA 2I4AA 5DCHA 1SD9A 4K0NA 3TKQA 3GA4A 3TRQA 1A0FA 3BJ5A 5D8IA 3HDCA 4OCFA 5DQSA 5B6NA 5JCGA 2JL4A 3OR5A 3FEUA 4PNGA 3F6FA 1G6YA 2YOIA 3J7Yb 2VIMA 3VWXA 3HYPA 2GQMA 4V1Ap 4ZB8A 2LRTA 2KP1A 3VPQA 2GSSA 4MF6A 4Z7XA 5HR0A 4X1UA 4G19A 1Z9HA 1EOGA 2E2GA 2H6YA 3HJMA 5H5QA 4MMMA 2B5YA 3GNJA 4MZCA 3HJOA 2PUKC 1ACVA 1SKSB 4K7NA 2PVOC 2P31A 5GAND 2YWIA 4HDEA 4EUYA 1JZOA 3KMNA 4L5OA 5ENUA 5ABRA 3TKPA 3V1WA 3GH6A 2KP2A 3GIXA 3GN3A 1UC7A 3ERGA 4GF0A 3IXRA 4NV2A 1F3BA 5IOXA 4F9ZA 4Q5RA 8GSSA 3HCZA 1YKCA 4BL7B 4PURA 3D5JA 4MA9A 3LFLA 1VF2A 4MCUA 4G10A 3UARA 3I6AA 3LYKA 4OMVA 4IJ3A 7GSSA 3GL5A 4TR4A 2H75A 1T3BA 2ES7A 1GTIA 4PX1A 1OYJA 3EMXA 4I5QA 2VL3A 2HNLA 1V9WA 2ALBA 4ZBAA 2WRTA 2JZSA 1B8XA 3TJKA 1TK5B 5ECPB 2AAWA 5ECQB 3ERWA 5KEJA 1DBYA 1O7UA 4POMA 3A5WA 3TKRA 3HXSA 4ZL7A 5D96A 5BRTA 5D9WA 1OC3A 2O87A 4BWSA 1A0RP 2IMDA 3IRAA 4CDOA 3PGTA 1MTCA 2CT6A 4WBJA 3ISOA 3L9UA 4TW5A 5ECOB 5HR2A 5E59A 3KP9A 4IVFA 1TXXA 4X4JA 4MJCA 2IFQB 4F0BA 4BVYB 2V6KA 3IBHA 2VOCA 3R2QA 3I43A 3TOTA 5J41A 5J9BA 4MH3A 4ZILA 1WPIA 2F8AA 2H1DA 4TR1B 4GXZA 1X0RA 1VF1A 4NMUA 3QFBC 5G5FA 2YWMA 1K0BA 5ECKB 5ECSA 3O76A 2BTOT 3DVXA 4YKFA 1NM3A 1FVKA 2MBSA 1GUMA 2LUSA 2KOKA 4ILFA 3L78A 1B4PA 3CRTA 3M1GA 3DRNA 3ZL5A 5CREA 3DKSA 2FWGA 2JZRA 3W6GA 4KUNA 1OE8A 2J9HA 2A2SA 2YANA 1XWCA 1HNAA 3M8NA 3HA9A 2VCTA 1NHYA 17GSA 1Z3EA 3KZQA 3JCML 3P8WA 3GX0A 2O7KA 4LMVA 2FLSA 2OE3A 3APQA 2CA8A 5DBQA 1R5PA 2XPDA 4PUFC 2CVDA 2R2JA 2FGXA 4USSA 5LCZA 2C8UA 3CTFA 5G2ZA 3LSZA 2NDOA 4TXOB 1PRXA 2X8GA 2CAIA 1TK8B 1T4YA 4G0LA 2YPMA 5JWOB 4JR4A 1AC1A 2DMMA 4POBA 4V1Ag 2LV3A 2VM1A 4WKWA 4P3YB 3RPPA 4GWRA 3DGQA 3FR6A 4YQVA 2F8FA 4BWQA 2G0FA 3A2VA 5IO2A 5DCGA 3VWWA 2CV4A 3TJJA 2DJKA 5G30A 2WGRA 5AN1A 3O3TA 5CYYA 3LORA 5H5RA 1GLQA 1VGLA 1HQOA 2IMIA 3EWLA 2O8VB 4I6XA 2CVKA 4CW9A 5D9XA 3FZAA 1ERVA 1FB6A 1GTAA 1MDKA 1ZYPA 3TGZA 1J9BA 5D73A 2M72A 4XCSA 5A5KA 2WJUA 3RAZA 4MJBA 2H1GA 5IMZA 3DD3A 3E0UA 3DVWA 3FY7A 4HJMA 4A5PA 3S9FA 2HRAA 4D73A 2FNOA 1K3LA 1F9MA 2KHPA 2DJ2A 1YZXA 5JWQB 4YAVA 2H0GA 4ZBBA 2HRKA 4G9HA 1K3OA 2R37A 3ED3A 4QL9A 2P0GA 3CXGA 4HI7A 1T4ZA 2LTKA 1SL2B 2CX3A 4MH2A 1PN9A 1ZOFA 2WZ9A 1WJKA 2PMTA 4ZL9A 4PUAA 4O32A 3DWVA 19GSA 2M80A 4NPBA 3R3EA 1BQ7A 3D4MA 3FHKA 10GSA 4RQRA 1PKWA 5GSSA 2HRFA 1SENA 4X43A 1UA5A 4BVYA 4OWYA 5HFGA 1ZGNA 2CX4A 3F6DA 4HS1A 5CP1A 2JZTA 3BCIA 1ZZYA 2PBJA 3NIVA 2IMFA 2IJYA 4YKGA 2LJKA 1OC8A 2FWFA 3VLNA 3EE2A 3MYDA 1M9BA 3K8NA 4XS4A 4ZB6A 3HVVA 4JZQA 5ECHB 4L8EA 2D2ZA 4OO4A 1TI1A 5A4VA 1JZWA 3KH9A 4GQCA 3FZ9A 1T00A 2N5BA 4ZB9A 5GZZB 3GX8A 5CO3A 1K0MA 1GSDA 4O92A 1T8EB 3F4TA 2EIQA 4NV5A 4CHSA 2RLIA 4FYBA 1YF1A 3D22A 2GGTA 1X9MB 4TVEA 1SU9A 5EVOA 3FYGA 2H76A 1U87A 1HNCA 2MMZA 4HJ2A 3I9V2 1K3YA 1CQHA 1KEBA 2K8VA 3FR9A 1K0NA 1XW5A 4IQ1A 1XVQA 1THOA 4N0ZA 4EDYA 4EXJA 4J2FA 1SL1B 2L57A 2DIZA 4Q5FA 4OD7A 2V6OA 3KJYA 2ON7A 1XW6A 3FKFA 3NZNA 4X0XA 1RW1A 2R0GA 5IMDA 1Y25A 5INYA 3F3QA 3EURA 2IMKA 4GTUA 5B8BA 1GULA 1ZCPA 4CY6A 3WGDA 4KX4A 2V1MA 2H01A 4G0KA 1WRYA 3FW2A 1VRSD 3GHAA 5AIXA 1CQGA 1K0CA 4IHUA 3UIWA 2H8LA 2A2PA 5FWGA 4FIWA 2C1YA 3ZITA 3VK9A 3WT2A 2LQOA 1EP8A 1O8XA 2WDUA 3ZREA 1V2AA 5KOWA 1GTUA 3U5RE 4TN8A 2C0FA 4RUVA 2VLUA 4ECCA 5B7CA 1G6WA 4IGJA 3FRCA 3GMFA 4BVXA 4IKHA 2GT6A 3C71A 4GLTA 2WCIA 5DQYA 3F63A 5GAPD 2OKAA 2H72A 4K0GA 2VLVA 1E2YA 2H0HA 2VD1A 3PINA 3ZRDA 4EO3A 2HZFA 1GUKA 3HY2A 3DIEA 1XPVA 1HNBA 4KDYA 1TTZA 3QCPA 1J08A 1TRWA 3APOA 4K2XA 4EDZA 1JHBA 1X5DA 4K7IA 2GDRA 4FYCA 3WGEA 3ME8A 2LNTA 2JSYA 3UOMA 11GSA 5J9CA 1SD8A 1IYIA 2C0EA 3KD0A 5ECLB 4F03A 3C73A 1ERUA 2VM2A 1OAZA 4G2EA 3LJRA 4GSTA 1S3CA 1RQMA 2B6MA 3VFIA 3GTUB 2G2QA 4YAPA 5IMCA 6GSWA 1SK2A 1F3AA 4XRAA 3CSJA 2N5FA 1R7HA 3I69A 1M99A 4KDUA 2DJ3A 1AIUA 4J56E 2MMNA 5F05A 4K5SA 2FA4A 4WETA 4CY8A 3H93A 4ECIA 3H8QA 3IV4A 3A5IA 3TDGA 3LXZA 4HQZA 1G0TA 2C0GA 4TR3A 4PQIA 1WOUA 3QDNA 2LNSA 3TOUA 1QK8A 1M9AA 1Q4JA 2MMOA 2PPTA 3IR4A 2QKEA 2FD3A 3VI5A 5D9VA 1U6TA 1O73A 1QXHA 1MD4A 4MK3A 4PQHA 2YNXA 1YKAA 1LU4A 4KE3A 4LL1B 1ML6A 6GSSA 2HFDA 2QA2A 3CSIA 1K0DA 5DVBA 1GP1A 3ZYWA 4ID0A 2EC4A 3VURA 3J7Yk 3MSZA 4TXVA 2FWEA 3EYTA 1AQVA 1MEKA 2R3XA 5IM9A 4KW6A 1K0OA 1BYEA 4EF0A 4EE0A 5DDLA 3Q19A 2R6KA 3TRXA 3CBUA 3VWVA 4Q5NA 1EP7A 2LEGA 1TP9A 2DIYA 3GRXA 2GSRA 4XHMA 4J57E 1SK1A 3EPTA 3D0ZA 3GSTA 2XBQA 1PD21 3VI7A 9GSSA 1GSEA 1TI3A 2HLSA 2OJLA 4AJ6A 1T1VA 4F2IA 2RIIA 2MMAA 3UVHA 4L5LA 4WF5A 4EIQA 1GTBA 2F51A 2F3MA 2YZUA 5ID2A 1AW9A 1R4WA 3H79A 5DJMA 2CZ2A 1A2MA 5ELGA 5DALA 2PWJA 3P7XA 1A23A 4GSNA 2GQLA 6GSVA 3PH9A 4OFNA 4KCEA 3N5OA 2PGTA 2WULA 2QGVA 1XWAA 3CTGA 3HKRA 1N2AA 1XWKA 2C3QA 4RQXA 5A4WA 5L71A 1S3DA 4DSSB 5AGYA 1OC9B 5J3RA 2M46A 3FR3A 2HZEB 1C72A 3PPUA 3IA1A 2V41A 1EZKA 3FK8A 2YZHA 2VD0A 4NXIA 4YQMA 1BAYA 3HHVA 4POLA 1DE1A 1SYRA 2CZ3A 2C3NA 5JCUA 3W8JA 1YEXA 1A2LA 5JCWA 4HU9A 2QC7A 4ML6A 2K6VA 4AF2A 1BJXA 1K0AA 3TJFA 2VAFA 3O6TA 3KH7A 4V2MA 3GKMA 3N9JA 5AIVA 3EU3A 4JEDA 1JZRA 2ON5A 2VL2C 4FH8A 3EINA 1XWBA 5JWRB 2YJHA 2YWNA 4N11A 4BL7A 3GTUA 5G5EA 1JZDA 3D21A 1GH2A 3G7IA 1JLVA 5LD0A 3UMAA 3TKSC 1GSSA 2WS2A 2L4QA 4E8HA 3HD5A 2P5RA 2R5GA 3M3MA 2B5EA 4MDCA 1PQNA 4MNNA 4BA7A 6GSXA 2YN1A 3Q74A 5IQYA 2GS3A 5KOXA 2FUG2 4KNDA 3GURA 5DAKB 2HT9A 4K1FA 3WD6A 4OO5A 3KCMA 2HE3A 2GVPA 5HR1A 3IAS2 12GSA 2AYTA 5DJLA 3UL3A 1PL1A 3CRUA 2B3SA 4YH2A 1IYHA 2DLXA 2K18A 3QOUA 3KXOA 3E3EA 1J0FA 4XIHA 2NVLA 3PR8A 1WE0A 1KBNA 2B5XA 4WF4A 4ULXA 4OFTA 2OE0A 1GSFA 4ZXGA 1HYUA 2RM6A 2Z9SA 5HFIA 2R0CA 2KLXA 1EWXA 4PGTA 2FA8A 1B9YC 2YJ7A 1X9WB 2IFQA 1F6MC 1TKDB 3RBTA 4HUAA 3QAGA 1FO5A 2DJ0A 2R0PA 4PNFA 2XBIA 1B48A 2XPEA 4MLYA 5CRGA 2YV9A 1ZYQB 1ABAA 2VCQA 5HFKA 4MP4A 4KGIA 2TRCP 4TR1A 2IWTA 5ELAA 4HZ2A 5J5NA 1OKDA 5IO0A 4IJIA 3ZVJD 4I8BA 1XOAA 2JSZA 3TJBA 3KEBA 2NTOA 4JBBA 1F2EA 1THXA 2DJ1A 5IMAA 4XTSA 3QAWA 1Z7PA 3ME7A 2H73A 3TKSE 4LL4B 4XS1A 4N30A 1FOVA 1BX9A 2B1KA 3IK7A 1SL0B 3KGKA 5F06A 2NPBA 2L4CA 2L6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYN A;  3ZIV A;  2REM A;  3DEX A;  3P2A A;  4N0V A;  2LJR A;  3Q18 A;  3GFK A;  3UVT A;  2H6X A;  3AY8 A;  2MBT A;  3UBL A;  4IP1 A;  1PKZ A;  3KMO A;  5CNW A;  2VL2 A;  5FT3 A;  1MD3 A;  1YY7 A;  3LWA A;  1TW9 A;  2YV7 A;  3MDK A;  2CAQ A;  4WXT A;  3BBY A;  4XRD A;  1RK4 A;  4N10 A;  3TRP A;  2K8S A;  4DEJ A;  2X99 A;  1PA3 A;  2C3T A;  5E4W A;  1QGV A;  1OC9 A;  3LG6 A;  2HZE A;  3TCO A;  3VWU A;  1PGT A;  3TKS A;  4TXO A;  1TU7 A;  3ZZX A;  2AV4 A;  3GKX A;  4TOP A;  2V2G A;  1FB0 A;  1AAZ A;  1LBK A;  1VF4 A;  1Z7R A;  4MPG A;  5IIZ A;  4TR0 A;  1H4O A;  3LXT A;  3F0I A;  3C7M A;  3C1R A;  2OE1 A;  1DSB A;  2DML A;  1AQW A;  1OE7 A;  4MZW A;  1HD2 A;  3NOF A;  3ZVJ A;  2HXK A;  2O85 A;  1MDJ A;  1YQ1 A;  2DC5 A;  4RI7 A;  2H66 A;  3UBK A;  4HZ4 A;  3D6I A;  2GZZ A;  1F37 A;  4MF5 A;  4LLR A;  2X8C A;  2J23 A;  2LRC A;  4QL7 A;  3IE3 A;  1O81 A;  3APS A;  1TRV A;  3CSH A;  4AJ7 A;  2GST A;  2PN8 A;  5C00 A;  3G7J A;  1YEP A;  2B7J A;  1R5A A;  1TRS A;  1EV4 A;  3HJP A;  1YDK A;  5KN2 A;  1EV9 A;  3MAK A;  20GS A;  1ZL9 A;  4IQA A;  2EIR A;  3D4T A;  3LQ7 A;  1YJ6 A;  2TIR A;  2ZUP A;  1B4Q A;  1M0U A;  2RM5 A;  1Q98 A;  4K9Z A;  4MPF A;  5DAK A;  1AXD A;  2H71 A;  2GZY A;  4KSM A;  1EEJ A;  2JU5 A;  1G7O A;  5EY6 A;  2RUF A;  3DXB A;  2AHE A;  4KA0 A;  3BD2 A;  4O5R A;  2FY6 A;  1DE2 A;  3ZFB A;  1DUG A;  1Z5Y E;  1KTE A;  1SYX A;  2VO4 A;  4JE1 A;  2CVB A;  2IN3 A;  5D9T A;  2CQ9 A;  2VUP A;  1SKR B;  3GUS A;  4L0W A;  5COH A;  3W8S A;  1I5G A;  4I97 A;  1XZO A;  2DSA A;  3QPM A;  3GYK A;  5D93 A;  1A24 A;  5IOW A;  4IEL A;  5B6M A;  1Z6N A;  1VF3 A;  4IN0 A;  1A2J A;  1Y6E A;  1WMJ A;  2K9F A;  3HZ4 A;  2DJJ A;  3A3T A;  2KUC A;  4AJ8 A;  4OFM A;  2H1B A;  4ML1 A;  5C04 A;  1EOH A;  3SBC A;  2GT5 A;  22GS A;  3A2X A;  2MZC A;  1GLP A;  2N5A A;  1TDI A;  3EU4 A;  3TUE A;  2HSH A;  4D73 B;  4DVC A;  3LEF A;  1XFL A;  1Z6M A;  2IL3 A;  1XCC A;  4ZIJ A;  1R26 A;  4I2U A;  2LRN A;  2YP6 A;  4KCA A;  1JFU A;  2H0I A;  3M9K A;  4PQ1 A;  5KN1 A;  3BOA A;  3MWH A;  1AQX A;  1PX7 A;  1TJD A;  4O7H A;  1XWG A;  3EC3 A;  1I9D A;  1V58 A;  5ECR B;  2F9S A;  3VPT A;  3L9V A;  4XS6 A;  1ERT A;  1USB A;  2L59 A;  3H4K A;  3GKN A;  4E8E A;  3Q6O A;  3C8E A;  2MYG A;  3IK9 A;  2E7P A;  3RPN A;  3F4S A;  4RI6 A;  1PMT A;  1FVJ A;  2HSY A;  3SWL A;  5IPH A;  2GSQ A;  1EGR A;  1UN2 A;  3IOS A;  4L0U A;  4ISD A;  3M0F A;  3QMX A;  4WEY A;  2IPA A;  4H86 A;  1GSU A;  3ZMK A;  1O6J A;  2QSI A;  2PU9 C;  2DBC A;  1WIK A;  3TB2 A;  2LJA A;  1NHO A;  3P90 A;  4MJE A;  3GKK A;  4XS4 B;  5KN0 A;  1NSW A;  1SJI A;  3RHC A;  4DSR A;  4KAE A;  5ECI B;  5IMF A;  3KP8 A;  4K2D A;  2GLR A;  2HRN A;  2I1U A;  5CRD A;  3ZTL A;  2XHF A;  4Q5Q A;  1SK0 A;  2EIO A;  4GCI A;  2H1A A;  3HZ8 A;  3GSS A;  5IMV A;  2P5Q A;  1S3A A;  16GS A;  2OA7 A;  3KM6 A;  4POK A;  1URM A;  1KNG A;  3WT1 A;  5GST A;  2B7K A;  3H1N A;  1FG4 A;  4HU7 A;  3UEM A;  2H6Z A;  3G9B A;  4IBP A;  4JRR A;  4GQF A;  3C1S A;  5F8B A;  2PVQ A;  2LST A;  3IAM 2;  2VCV A;  2ZCT A;  1GNE A;  4OCE A;  2YCD A;  3IC4 A;  2I9H A;  3BCK A;  4I2T A;  1TU8 A;  3LGC A;  3L9S A;  3TJG A;  1ON4 A;  5H5S A;  1G7E A;  1PL2 A;  2GZP A;  3HVS A;  2LS5 A;  1QMV A;  3ZFL A;  5ECN B;  1V40 A;  5HR3 A;  3MNG A;  4QQ7 A;  4MAB A;  1UVZ A;  2B1L A;  4IS0 A;  2X8H A;  1O85 A;  1U3I A;  4IW9 A;  3LYP A;  3GL3 A;  1ILO A;  1BG5 A;  4EKZ A;  2AUV A;  1SJZ A;  2I81 A;  4WR5 A;  3KTB A;  5HQP A;  1LJR A;  5ECM B;  4ZL8 A;  6GST A;  4BPY A;  2OAD A;  2H19 A;  1M2D A;  4K7O A;  1A8Y A;  4LA1 A;  2VCZ A;  3WYW A;  1T7P B;  4EL1 A;  4NHW A;  5CAX A;  2FHE A;  2I3Y A;  2VCX A;  1M7T A;  4NHZ A;  4GRF A;  2C0D A;  18GS A;  4HQS A;  5B8A A;  2IIY A;  2AB6 A;  3F4R A;  3E9J B;  2E0Q A;  1QUW A;  2VLT A;  4NAX A;  5J4U A;  2BMX A;  5FHI A;  2LQQ A;  2L5L A;  1O8W A;  1GSQ A;  1N8J A;  4DSQ A;  3M9J A;  4KH7 A;  3CMI A;  4HEA 2;  3GH9 A;  4V2N A;  2E2M A;  2WFC A;  4WR4 A;  4F0C A;  4ACS A;  1SKW B;  1X5E A;  4JU5 A;  4ZBD A;  2WB9 A;  3RHB A;  4MJA A;  14GS A;  3IHQ A;  4IP6 A;  1XOB A;  4HOJ A;  3ZIJ A;  3DYR A;  3L0H A;  2JAD A;  2A2R A;  4YQU A;  3EMP A;  1GUH A;  2OAC A;  4JR6 A;  5F07 A;  1AUC A;  2H70 A;  13GS A;  2H30 A;  5CRH A;  1A8L A;  2GTU A;  1ERW A;  3U6V A;  4LMW A;  2NBS A;  5KN3 A;  1X5C A;  2A4V A;  3L4N A;  4FYU A;  5EPF A;  3F8U A;  2HYX A;  4EVM A;  1W89 A;  1H75 A;  1ZMA A;  5LNK e;  4ECB A;  1XVW A;  4FO5 A;  4MZB A;  4TRX A;  3US3 A;  4K8M A;  1GRX A;  3RDW A;  1GWC A;  5A4U A;  2FWH A;  2AJQ B;  4AGS A;  4ECJ A;  1GNW A;  3IPZ A;  4KSO A;  1JLW A;  1OVN A;  1ZYE A;  3QFA C;  3UAP A;  2L6C A;  3KTL A;  2C80 A;  2OBI A;  1V57 A;  3KIJ A;  1XIY A;  6GSU A;  2RUE A;  1X9S B;  1V98 A;  2YWO A;  1GL8 A;  1XXU A;  1XBS A;  1GSY A;  3IDV A;  4MF7 A;  3GV1 A;  1EGO A;  3QD9 A;  3WGX A;  2LKU A;  2ZNM A;  1U3A A;  2IME A;  5IPG A;  4KDX A;  5G31 A;  1EEM A;  2JAC A;  2R4V A;  1M2B A;  3ERF A;  4WBR D;  5AIS A;  1U88 A;  1FHE A;  4KB3 A;  2BJX A;  2C4J A;  1NW2 A;  4K6X A;  1M2A A;  1TK0 B;  3EVI A;  2H74 A;  5G1L A;  1W4V A;  3A2W A;  2TRX A;  1B9X C;  2HI7 A;  3FZ5 A;  4DSS A;  2V32 A;  5EL8 A;  2XC2 A;  3UJ1 A;  1FW1 A;  2FCH A;  1WP0 A;  3F9U A;  1TOF A;  3HVX A;  3FZ4 A;  1XW9 A;  6GSY A;  3DML A;  4TKY A;  3ZLP A;  4V2L A;  1BED A;  2VL9 A;  1PSQ A;  5G1K A;  1MDI A;  3ZML A;  1YF0 A;  1OKT A;  1QQ2 A;  4NWY A;  1FAA A;  5ID2 B;  2OBK A;  4PXO A;  1ST9 A;  3F3R A;  1PX6 A;  2O89 A;  1QFN A;  3G7Y A;  1SJ6 A;  4F82 A;  1TRU A;  2X64 A;  2VCW A;  3QR6 A;  2L5O A;  5DAL B;  1WWJ A;  2PER A;  4GSS A;  2GQK A;  3QAV A;  5CRW A;  4EC0 A;  5F0G A;  1E6B A;  2I4A A;  5DCH A;  1SD9 A;  4K0N A;  3TKQ A;  3GA4 A;  3TRQ A;  1A0F A;  3BJ5 A;  5D8I A;  3HDC A;  4OCF A;  5DQS A;  5B6N A;  5JCG A;  2JL4 A;  3OR5 A;  3FEU A;  4PNG A;  3F6F A;  1G6Y A;  2YOI A;  3J7Y b;  2VIM A;  3VWX A;  3HYP A;  2GQM A;  4V1A p;  4ZB8 A;  2LRT A;  2KP1 A;  3VPQ A;  2GSS A;  4MF6 A;  4Z7X A;  5HR0 A;  4X1U A;  4G19 A;  1Z9H A;  1EOG A;  2E2G A;  2H6Y A;  3HJM A;  5H5Q A;  4MMM A;  2B5Y A;  3GNJ A;  4MZC A;  3HJO A;  2PUK C;  1ACV A;  1SKS B;  4K7N A;  2PVO C;  2P31 A;  5GAN D;  2YWI A;  4HDE A;  4EUY A;  1JZO A;  3KMN A;  4L5O A;  5ENU A;  5ABR A;  3TKP A;  3V1W A;  3GH6 A;  2KP2 A;  3GIX A;  3GN3 A;  1UC7 A;  3ERG A;  4GF0 A;  3IXR A;  4NV2 A;  1F3B A;  5IOX A;  4F9Z A;  4Q5R A;  8GSS A;  3HCZ A;  1YKC A;  4PUR A;  3D5J A;  4MA9 A;  3LFL A;  1VF2 A;  4MCU A;  4G10 A;  3UAR A;  3I6A A;  3LYK A;  4OMV A;  4IJ3 A;  7GSS A;  3GL5 A;  4TR4 A;  2H75 A;  1T3B A;  2ES7 A;  1GTI A;  1OYJ A;  3EMX A;  4PX1 A;  4I5Q A;  2VL3 A;  2HNL A;  1V9W A;  2ALB A;  4ZBA A;  2WRT A;  2JZS A;  1B8X A;  3TJK A;  1TK5 B;  5ECP B;  2AAW A;  5ECQ B;  3ERW A;  5KEJ A;  1DBY A;  1O7U A;  4POM A;  3A5W A;  3TKR A;  3HXS A;  4ZL7 A;  5D96 A;  5D9W A;  1OC3 A;  2O87 A;  4BWS A;  1A0R P;  2IMD A;  3IRA A;  4CDO A;  3PGT A;  1MTC A;  2CT6 A;  4WBJ A;  3ISO A;  3L9U A;  4TW5 A;  5ECO B;  5HR2 A;  5E59 A;  3KP9 A;  4IVF A;  1TXX A;  4MJC A;  2IFQ B;  4F0B A;  2V6K A;  3IBH A;  2VOC A;  3R2Q A;  3I43 A;  3TOT A;  5J41 A;  5J9B A;  4MH3 A;  4ZIL A;  1WPI A;  2F8A A;  2H1D A;  4TR1 B;  4GXZ A;  1X0R A;  1VF1 A;  4NMU A;  3QFB C;  5G5F A;  2YWM A;  1K0B A;  5ECK B;  5ECS A;  3O76 A;  2BTO T;  3DVX A;  1NM3 A;  1FVK A;  2MBS A;  1GUM A;  2LUS A;  2KOK A;  4ILF A;  3L78 A;  1B4P A;  3CRT A;  3M1G A;  3DRN A;  3ZL5 A;  5CRE A;  3DKS A;  2FWG A;  2JZR A;  3W6G A;  4KUN A;  1OE8 A;  2J9H A;  2A2S A;  2YAN A;  1XWC A;  1HNA A;  3M8N A;  3HA9 A;  2VCT A;  1NHY A;  17GS A;  1Z3E A;  3KZQ A;  3JCM L;  3P8W A;  3GX0 A;  2O7K A;  4LMV A;  2FLS A;  2OE3 A;  3APQ A;  2CA8 A;  5DBQ A;  1R5P A;  2XPD A;  4PUF C;  2CVD A;  2R2J A;  2FGX A;  5LCZ A;  2C8U A;  3CTF A;  5G2Z A;  3LSZ A;  2NDO A;  4TXO B;  1PRX A;  2X8G A;  2CAI A;  1TK8 B;  1T4Y A;  2YPM A;  5JWO B;  4JR4 A;  1AC1 A;  2DMM A;  4POB A;  4V1A g;  2LV3 A;  2VM1 A;  4WKW A;  4P3Y B;  3RPP A;  4GWR A;  3DGQ A;  3FR6 A;  4YQV A;  2F8F A;  4BWQ A;  2G0F A;  3A2V A;  5IO2 A;  5DCG A;  3VWW A;  2CV4 A;  3TJJ A;  2DJK A;  5G30 A;  2WGR A;  5AN1 A;  3O3T A;  5CYY A;  3LOR A;  5H5R A;  1GLQ A;  1VGL A;  1HQO A;  2IMI A;  3EWL A;  2O8V B;  4I6X A;  2CVK A;  4CW9 A;  5D9X A;  3FZA A;  1ERV A;  1FB6 A;  1GTA A;  1MDK A;  3TGZ A;  1J9B A;  5D73 A;  2M72 A;  4XCS A;  5A5K A;  2WJU A;  3RAZ A;  4MJB A;  2H1G A;  5IMZ A;  3DD3 A;  3E0U A;  3DVW A;  3FY7 A;  4HJM A;  3S9F A;  4D73 A;  2FNO A;  1K3L A;  1F9M A;  2KHP A;  2DJ2 A;  1YZX A;  5JWQ B;  4YAV A;  2H0G A;  4ZBB A;  4G9H A;  1K3O A;  2R37 A;  3ED3 A;  4QL9 A;  2P0G A;  3CXG A;  4HI7 A;  1T4Z A;  2LTK A;  1SL2 B;  2CX3 A;  4MH2 A;  1PN9 A;  1ZOF A;  2WZ9 A;  1WJK A;  2PMT A;  4ZL9 A;  4PUA A;  4O32 A;  3DWV A;  19GS A;  2M80 A;  4NPB A;  1BQ7 A;  3D4M A;  3FHK A;  10GS A;  4RQR A;  1PKW A;  5GSS A;  2HRF A;  1SEN A;  4X43 A;  1UA5 A;  4BVY A;  4OWY A;  5HFG A;  1ZGN A;  2CX4 A;  3F6D A;  4HS1 A;  5CP1 A;  2JZT A;  3BCI A;  1ZZY A;  2PBJ A;  3NIV A;  2IMF A;  2IJY A;  2LJK A;  1OC8 A;  2FWF A;  3VLN A;  3EE2 A;  1M9B A;  3K8N A;  4XS4 A;  4ZB6 A;  3HVV A;  4JZQ A;  5ECH B;  4L8E A;  2D2Z A;  4OO4 A;  1TI1 A;  5A4V A;  1JZW A;  3KH9 A;  4GQC A;  3FZ9 A;  1T00 A;  2N5B A;  4ZB9 A;  5GZZ B;  3GX8 A;  5CO3 A;  1K0M A;  1GSD A;  4O92 A;  1T8E B;  3F4T A;  2EIQ A;  4NV5 A;  4CHS A;  2RLI A;  4FYB A;  1YF1 A;  3D22 A;  2GGT A;  1X9M B;  4TVE A;  1SU9 A;  5EVO A;  3FYG A;  2H76 A;  1U87 A;  1HNC A;  2MMZ A;  4HJ2 A;  3I9V 2;  1K3Y A;  1CQH A;  1KEB A;  2K8V A;  3FR9 A;  1K0N A;  1XW5 A;  4IQ1 A;  1XVQ A;  1THO A;  4N0Z A;  4EDY A;  4EXJ A;  4J2F A;  1SL1 B;  2L57 A;  2DIZ A;  4Q5F A;  4OD7 A;  2V6O A;  3KJY A;  2ON7 A;  1XW6 A;  3FKF A;  3NZN A;  4X0X A;  1RW1 A;  5IMD A;  1Y25 A;  5INY A;  3F3Q A;  3EUR A;  2IMK A;  4GTU A;  5B8B A;  1GUL A;  1ZCP A;  3WGD A;  4KX4 A;  2V1M A;  2H01 A;  1WRY A;  3FW2 A;  1VRS D;  3GHA A;  5AIX A;  1CQG A;  1K0C A;  4IHU A;  3UIW A;  2H8L A;  5FWG A;  4FIW A;  2C1Y A;  3ZIT A;  3VK9 A;  3WT2 A;  2LQO A;  1EP8 A;  1O8X A;  2WDU A;  3ZRE A;  1V2A A;  1GTU A;  3U5R E;  4TN8 A;  2C0F A;  4RUV A;  2VLU A;  4ECC A;  5B7C A;  1G6W A;  4IGJ A;  3FRC A;  3GMF A;  4BVX A;  4IKH A;  2GT6 A;  3C71 A;  4GLT A;  2WCI A;  5DQY A;  3F63 A;  5GAP D;  2OKA A;  2H72 A;  4K0G A;  2VLV A;  1E2Y A;  2H0H A;  2VD1 A;  3PIN A;  3ZRD A;  4EO3 A;  2HZF A;  1GUK A;  3HY2 A;  3DIE A;  1XPV A;  1HNB A;  4KDY A;  1TTZ A;  3QCP A;  1J08 A;  1TRW A;  3APO A;  4EDZ A;  1JHB A;  1X5D A;  4K7I A;  2GDR A;  4FYC A;  3WGE A;  3ME8 A;  2LNT A;  2JSY A;  3UOM A;  11GS A;  5J9C A;  1SD8 A;  1IYI A;  2C0E A;  3KD0 A;  5ECL B;  4F03 A;  3C73 A;  1ERU A;  2VM2 A;  1OAZ A;  4G2E A;  3LJR A;  4GST A;  1S3C A;  1RQM A;  2B6M A;  3VFI A;  3GTU B;  2G2Q A;  4YAP A;  5IMC A;  6GSW A;  1SK2 A;  1F3A A;  4XRA A;  3CSJ A;  2N5F A;  1R7H A;  3I69 A;  1M99 A;  4KDU A;  2DJ3 A;  1AIU A;  4J56 E;  2MMN A;  5F05 A;  2FA4 A;  4WET A;  3H93 A;  4ECI A;  3H8Q A;  3IV4 A;  3TDG A;  3LXZ A;  4HQZ A;  1G0T A;  2C0G A;  4TR3 A;  4PQI A;  1WOU A;  3QDN A;  2LNS A;  3TOU A;  1QK8 A;  1M9A A;  1Q4J A;  2MMO A;  2PPT A;  3IR4 A;  2QKE A;  2FD3 A;  3VI5 A;  5D9V A;  1U6T A;  1O73 A;  1QXH A;  1MD4 A;  4MK3 A;  4PQH A;  2YNX A;  1YKA A;  1LU4 A;  4KE3 A;  4LL1 B;  1ML6 A;  6GSS A;  2HFD A;  3CSI A;  1K0D A;  5DVB A;  1GP1 A;  3ZYW A;  4ID0 A;  2EC4 A;  3VUR A;  3J7Y k;  3MSZ A;  4TXV A;  2FWE A;  3EYT A;  1AQV A;  1MEK A;  2R3X A;  5IM9 A;  4KW6 A;  1K0O A;  1BYE A;  4EF0 A;  4EE0 A;  5DDL A;  3Q19 A;  2R6K A;  3TRX A;  3CBU A;  3VWV A;  4Q5N A;  1EP7 A;  2LEG A;  1TP9 A;  2DIY A;  3GRX A;  2GSR A;  4XHM A;  4J57 E;  1SK1 A;  3D0Z A;  3GST A;  2XBQ A;  1PD2 1;  3VI7 A;  9GSS A;  1GSE A;  1TI3 A;  2HLS A;  2OJL A;  4AJ6 A;  1T1V A;  4F2I A;  2RII A;  2MMA A;  3UVH A;  4L5L A;  4WF5 A;  1GTB A;  2F51 A;  2F3M A;  2YZU A;  5ID2 A;  1AW9 A;  1R4W A;  3H79 A;  5DJM A;  2CZ2 A;  1A2M A;  5ELG A;  5DAL A;  2PWJ A;  3P7X A;  1A23 A;  4GSN A;  2GQL A;  6GSV A;  3PH9 A;  4OFN A;  4KCE A;  3N5O A;  2PGT A;  2WUL A;  2QGV A;  1XWA A;  3CTG A;  3HKR A;  1N2A A;  1XWK A;  2C3Q A;  4RQX A;  5A4W A;  5L71 A;  1S3D A;  4DSS B;  5AGY A;  1OC9 B;  5J3R A;  2M46 A;  3FR3 A;  2HZE B;  1C72 A;  3IA1 A;  2V41 A;  1EZK A;  3FK8 A;  2YZH A;  2VD0 A;  4NXI A;  4YQM A;  1BAY A;  3HHV A;  4POL A;  1DE1 A;  1SYR A;  2CZ3 A;  2C3N A;  5JCU A;  3W8J A;  1YEX A;  1A2L A;  5JCW A;  4HU9 A;  2QC7 A;  4ML6 A;  2K6V A;  4AF2 A;  1BJX A;  1K0A A;  3TJF A;  2VAF A;  3O6T A;  3KH7 A;  4V2M A;  3GKM A;  3N9J A;  5AIV A;  3EU3 A;  4JED A;  1JZR A;  2ON5 A;  2VL2 C;  4FH8 A;  3EIN A;  1XWB A;  5JWR B;  2YJH A;  2YWN A;  4N11 A;  4BL7 A;  3GTU A;  5G5E A;  1JZD A;  3D21 A;  1GH2 A;  3G7I A;  1JLV A;  5LD0 A;  3UMA A;  3TKS C;  1GSS A;  2WS2 A;  2L4Q A;  4E8H A;  3HD5 A;  2P5R A;  2R5G A;  3M3M A;  2B5E A;  4MDC A;  1PQN A;  4BA7 A;  6GSX A;  2YN1 A;  3Q74 A;  5IQY A;  2GS3 A;  2FUG 2;  4KND A;  5DAK B;  3GUR A;  2HT9 A;  4K1F A;  3WD6 A;  4OO5 A;  3KCM A;  2HE3 A;  2GVP A;  5HR1 A;  3IAS 2;  12GS A;  2AYT A;  5DJL A;  3UL3 A;  1PL1 A;  3CRU A;  2B3S A;  4YH2 A;  1IYH A;  2DLX A;  2K18 A;  3QOU A;  3KXO A;  3E3E A;  1J0F A;  4XIH A;  2NVL A;  3PR8 A;  1WE0 A;  1KBN A;  2B5X A;  4WF4 A;  4ULX A;  4OFT A;  2OE0 A;  1GSF A;  4ZXG A;  1HYU A;  2RM6 A;  2Z9S A;  5HFI A;  2KLX A;  1EWX A;  4PGT A;  2FA8 A;  1B9Y C;  2YJ7 A;  1X9W B;  2IFQ A;  1F6M C;  1TKD B;  3RBT A;  4HUA A;  3QAG A;  1FO5 A;  2DJ0 A;  4PNF A;  2XBI A;  1B48 A;  2XPE A;  4MLY A;  5CRG A;  2YV9 A;  1ZYQ B;  1ABA A;  2VCQ A;  5HFK A;  4MP4 A;  4KGI A;  2TRC P;  4TR1 A;  2IWT A;  5ELA A;  4HZ2 A;  5J5N A;  1OKD A;  5IO0 A;  4IJI A;  3ZVJ D;  4I8B A;  1XOA A;  2JSZ A;  3TJB A;  3KEB A;  2NTO A;  4JBB A;  1F2E A;  1THX A;  2DJ1 A;  5IMA A;  4XTS A;  3QAW A;  1Z7P A;  3ME7 A;  2H73 A;  3TKS E;  4LL4 B;  4XS1 A;  4N30 A;  1FOV A;  1BX9 A;  2B1K A;  3IK7 A;  1SL0 B;  3KGK A;  5F06 A;  2NPB A;  2L4C A;  2L6D A; 
#chains in the Genus database with same CATH topology
 3MIX A;  3CYN A;  3ZIV A;  2REM A;  3DEX A;  3P2A A;  4N0V A;  2LJR A;  3Q18 A;  3GFK A;  3UVT A;  2H6X A;  3AY8 A;  1ZYN A;  2MBT A;  3UBL A;  4IP1 A;  1PKZ A;  3KMO A;  5CNW A;  2VL2 A;  5FT3 A;  1MD3 A;  1YY7 A;  3LWA A;  1TW9 A;  2YV7 A;  3MDK A;  2CAQ A;  4WXT A;  3BBY A;  4XRD A;  1RK4 A;  4N10 A;  3TRP A;  2K8S A;  4DEJ A;  2X99 A;  1PA3 A;  2C3T A;  5E4W A;  1QGV A;  1OC9 A;  3LG6 A;  2HZE A;  3TCO A;  3VWU A;  1PGT A;  3TKS A;  4TXO A;  1TU7 A;  3ZZX A;  2AV4 A;  3GKX A;  4TOP A;  2V2G A;  1FB0 A;  1AAZ A;  1LBK A;  1VF4 A;  1Z7R A;  4MPG A;  5IIZ A;  4TR0 A;  1H4O A;  3LXT A;  4PTS A;  3F0I A;  3C7M A;  3C1R A;  2OE1 A;  1DSB A;  2DML A;  1AQW A;  1OE7 A;  4MZW A;  1HD2 A;  3NOF A;  3ZVJ A;  2HXK A;  2O85 A;  1MDJ A;  1YQ1 A;  2DC5 A;  4RI7 A;  2H66 A;  3UBK A;  4HZ4 A;  3D6I A;  2GZZ A;  1F37 A;  4FQU A;  4MF5 A;  3LW9 A;  2X8C A;  4LLR A;  2J23 A;  2LRC A;  4QL7 A;  3IE3 A;  1O81 A;  3APS A;  1TRV A;  3CSH A;  4AJ7 A;  2GST A;  2PN8 A;  5C00 A;  3G7J A;  1YEP A;  2B7J A;  1R5A A;  1TRS A;  1EV4 A;  3HJP A;  1YDK A;  5KN2 A;  1EV9 A;  3MAK A;  20GS A;  1ZL9 A;  4IQA A;  2EIR A;  3D4T A;  3LQ7 A;  1YJ6 A;  2TIR A;  2ZUP A;  1B4Q A;  1M0U A;  2RM5 A;  1Q98 A;  4K9Z A;  4MPF A;  5DAK A;  1AXD A;  2H71 A;  2GZY A;  4KSM A;  1EEJ A;  2JU5 A;  1G7O A;  3FMW A;  5EY6 A;  2RUF A;  3DXB A;  2AHE A;  4KA0 A;  3BD2 A;  2HSM A;  4O5R A;  2FY6 A;  1DE2 A;  3ZFB A;  1DUG A;  1Z5Y E;  1KTE A;  1SYX A;  2VO4 A;  4JE1 A;  2CVB A;  2IN3 A;  5D9T A;  2CQ9 A;  2VUP A;  1SKR B;  3GUS A;  4L0W A;  5COH A;  3W8S A;  1I5G A;  4Z2T A;  4I97 A;  1XZO A;  2DSA A;  3QPM A;  4G0I A;  3GYK A;  5D93 A;  1A24 A;  5IOW A;  4IEL A;  5B6M A;  1Z6N A;  1VF3 A;  4IN0 A;  1A2J A;  1Y6E A;  1WMJ A;  2K9F A;  3HZ4 A;  2DJJ A;  3A3T A;  2KUC A;  4AJ8 A;  4OFM A;  2H1B A;  4ML1 A;  5C04 A;  1EOH A;  3IHG A;  3SBC A;  2GT5 A;  22GS A;  3A2X A;  2MZC A;  1GLP A;  2N5A A;  1TDI A;  2UZ8 A;  3EU4 A;  3TUE A;  2HSH A;  4D73 B;  2QA1 A;  4DVC A;  3LEF A;  1XFL A;  1Z6M A;  2IL3 A;  1XCC A;  4ZIJ A;  1PN0 A;  1R26 A;  4I2U A;  4ICY A;  2LRN A;  2YP6 A;  4KCA A;  1JFU A;  2H0I A;  3M9K A;  4PQ1 A;  5KN1 A;  3BOA A;  3MWH A;  1AQX A;  1PX7 A;  1TJD A;  4O7H A;  1XWG A;  3EC3 A;  1I9D A;  1V58 A;  5ECR B;  2F9S A;  3VPT A;  3L9V A;  4XS6 A;  1ERT A;  1USB A;  2L59 A;  3H4K A;  3GKN A;  4E8E A;  3Q6O A;  3C8E A;  2MYG A;  3IK9 A;  2E7P A;  3RPN A;  3F4S A;  4RI6 A;  1PMT A;  1FVJ A;  2HSY A;  3SWL A;  5IPH A;  2GSQ A;  1EGR A;  1UN2 A;  3IOS A;  4L0U A;  4ISD A;  1FOH A;  3M0F A;  3QMX A;  4WEY A;  2IPA A;  4H86 A;  1GSU A;  3ZMK A;  1O6J A;  2QSI A;  2PU9 C;  2DBC A;  1WIK A;  3TB2 A;  2LJA A;  1NHO A;  3P90 A;  4MJE A;  3GKK A;  4XS4 B;  5KN0 A;  1NSW A;  1SJI A;  3RHC A;  4DSR A;  4KAE A;  5ECI B;  5IMF A;  3KP8 A;  4K2D A;  2GLR A;  2HRN A;  2I1U A;  5CRD A;  3ZTL A;  2XHF A;  4Q5Q A;  1SK0 A;  2EIO A;  4GCI A;  2H1A A;  3HZ8 A;  3GSS A;  5IMV A;  2P5Q A;  1S3A A;  16GS A;  2OA7 A;  3KM6 A;  4POK A;  1URM A;  1KNG A;  3WT1 A;  5GST A;  2B7K A;  3H1N A;  1FG4 A;  4HU7 A;  3UEM A;  2H6Z A;  3G9B A;  4IBP A;  4JRR A;  4GQF A;  3C1S A;  5F8B A;  2PVQ A;  2LST A;  3IAM 2;  2VCV A;  2ZCT A;  1GNE A;  4OCE A;  2YCD A;  3IC4 A;  2I9H A;  3BCK A;  4I2T A;  1TU8 A;  3LGC A;  3L9S A;  3TJG A;  1ON4 A;  5H5S A;  1G7E A;  1PL2 A;  2GZP A;  3HVS A;  2LS5 A;  1QMV A;  3ZFL A;  5ECN B;  1V40 A;  5HR3 A;  3MNG A;  4QQ7 A;  4MAB A;  1UVZ A;  2B1L A;  4IS0 A;  2X8H A;  1O85 A;  1U3I A;  4IW9 A;  3LYP A;  3GL3 A;  1ILO A;  1BG5 A;  4EKZ A;  2AUV A;  1SJZ A;  2I81 A;  4WR5 A;  3KTB A;  5HQP A;  1LJR A;  5ECM B;  4ZL8 A;  6GST A;  4Z2R A;  4BPY A;  2OAD A;  2H19 A;  1M2D A;  4K7O A;  1A8Y A;  4LA1 A;  2VCZ A;  3WYW A;  1T7P B;  4EL1 A;  4NHW A;  5CAX A;  2FHE A;  2I3Y A;  2VCX A;  1M7T A;  4NHZ A;  4GRF A;  2C0D A;  18GS A;  4HQS A;  5B8A A;  2IIY A;  2AB6 A;  3F4R A;  3E9J B;  4EIP A;  2E0Q A;  1QUW A;  2VLT A;  4NAX A;  5J4U A;  4O5Q A;  2BMX A;  5FHI A;  2LQQ A;  2L5L A;  1O8W A;  1GSQ A;  1N8J A;  4DSQ A;  3M9J A;  4KH7 A;  2A4H A;  3CMI A;  4BVX B;  4KF9 A;  4HEA 2;  3GH9 A;  4V2N A;  2E2M A;  2WFC A;  4WR4 A;  4F0C A;  4ACS A;  1SKW B;  1X5E A;  4JU5 A;  2DKI A;  4ZBD A;  2WB9 A;  2X49 A;  3RHB A;  4MJA A;  14GS A;  3IHQ A;  1PFO A;  4IP6 A;  1XOB A;  4HOJ A;  3ZIJ A;  3DYR A;  3L0H A;  2JAD A;  2A2R A;  4YQU A;  3EMP A;  1GUH A;  2OAC A;  4JR6 A;  5F07 A;  2DKH A;  1AUC A;  2H70 A;  13GS A;  2H30 A;  5CRH A;  1A8L A;  2GTU A;  1ERW A;  3U6V A;  4LMW A;  2NBS A;  5KN3 A;  1X5C A;  2A4V A;  3L4N A;  4FYU A;  4O5U A;  5EPF A;  3F8U A;  2HYX A;  4EVM A;  1W89 A;  1H75 A;  1ZMA A;  4K5R A;  5LNK e;  4ECB A;  1XVW A;  4FO5 A;  4MZB A;  4TRX A;  3US3 A;  4K8M A;  1GRX A;  3RDW A;  1GWC A;  5A4U A;  2FWH A;  2AJQ B;  3IC8 A;  4AGS A;  4ECJ A;  1GNW A;  3IPZ A;  4KSO A;  1JLW A;  1OVN A;  1ZYE A;  3QFA C;  3UAP A;  2L6C A;  3KTL A;  2C80 A;  2OBI A;  1V57 A;  3KIJ A;  1XIY A;  6GSU A;  2RUE A;  1X9S B;  1V98 A;  2YWO A;  1GL8 A;  1XXU A;  1XBS A;  1GSY A;  3IDV A;  4MF7 A;  3GV1 A;  1EGO A;  3QD9 A;  3WGX A;  2LKU A;  2ZNM A;  1U3A A;  2IME A;  5IPG A;  4KDX A;  5G31 A;  1EEM A;  2JAC A;  2R4V A;  1M2B A;  3ERF A;  4WBR D;  5AIS A;  1U88 A;  1FHE A;  4KB3 A;  2BJX A;  2C4J A;  1NW2 A;  4K6X A;  1M2A A;  1TK0 B;  3EVI A;  2H74 A;  5G1L A;  1W4V A;  3A2W A;  2TRX A;  1B9X C;  2HI7 A;  3FZ5 A;  4DSS A;  2V32 A;  5EL8 A;  2XC2 A;  3UJ1 A;  1FW1 A;  2FCH A;  1WP0 A;  3F9U A;  5BMU A;  1TOF A;  3HVX A;  2X4A A;  3FZ4 A;  1XW9 A;  6GSY A;  3DML A;  4TKY A;  3ZLP A;  4V2L A;  1BED A;  2VL9 A;  1PSQ A;  5G1K A;  1MDI A;  3ZML A;  1YF0 A;  1OKT A;  1QQ2 A;  4NWY A;  1FAA A;  5ID2 B;  2OBK A;  4PXO A;  1ST9 A;  3F3R A;  1PX6 A;  2O89 A;  1QFN A;  3G7Y A;  1SJ6 A;  4F82 A;  1TRU A;  2X64 A;  2VCW A;  3QR6 A;  2L5O A;  1WWJ A;  2PER A;  4GSS A;  5DAL B;  2GQK A;  3QAV A;  5CRW A;  4EC0 A;  4Z2U A;  5F0G A;  1E6B A;  2I4A A;  5DCH A;  1SD9 A;  4K0N A;  3TKQ A;  3GA4 A;  3TRQ A;  1A0F A;  3BJ5 A;  5D8I A;  3HDC A;  4OCF A;  5DQS A;  5B6N A;  5JCG A;  2JL4 A;  3OR5 A;  3FEU A;  4PNG A;  3F6F A;  1G6Y A;  2YOI A;  3J7Y b;  2VIM A;  3VWX A;  3HYP A;  2GQM A;  4V1A p;  4ZB8 A;  2LRT A;  2KP1 A;  3VPQ A;  2GSS A;  4MF6 A;  4Z7X A;  5HR0 A;  4X1U A;  4G19 A;  1Z9H A;  1EOG A;  2E2G A;  2H6Y A;  3HJM A;  5H5Q A;  4MMM A;  2B5Y A;  3GNJ A;  4MZC A;  3HJO A;  2PUK C;  1ACV A;  1SKS B;  4K7N A;  2PVO C;  2P31 A;  5GAN D;  2YWI A;  4HDE A;  4EUY A;  1JZO A;  3KMN A;  4L5O A;  5ENU A;  5ABR A;  3TKP A;  3V1W A;  3GH6 A;  2KP2 A;  3GIX A;  3GN3 A;  1UC7 A;  3ERG A;  4GF0 A;  3IXR A;  4BIK A;  4NV2 A;  1F3B A;  5IOX A;  4F9Z A;  4Q5R A;  8GSS A;  3HCZ A;  1YKC A;  4BL7 B;  4PUR A;  3D5J A;  4MA9 A;  3LFL A;  1VF2 A;  4MCU A;  4G10 A;  3UAR A;  3I6A A;  3LYK A;  4OMV A;  4IJ3 A;  7GSS A;  3GL5 A;  4TR4 A;  2H75 A;  1T3B A;  2ES7 A;  1GTI A;  4PX1 A;  1OYJ A;  3EMX A;  4I5Q A;  2VL3 A;  2HNL A;  1V9W A;  1M3I A;  2ALB A;  4ZBA A;  2WRT A;  2JZS A;  1B8X A;  3TJK A;  1TK5 B;  5ECP B;  2AAW A;  5ECQ B;  3ERW A;  5KEJ A;  1DBY A;  1O7U A;  4POM A;  3A5W A;  3TKR A;  3HXS A;  4ZL7 A;  5D96 A;  5BRT A;  5D9W A;  1OC3 A;  2O87 A;  4BWS A;  1A0R P;  2IMD A;  3IRA A;  4CDO A;  3PGT A;  1MTC A;  2CT6 A;  4WBJ A;  3ISO A;  3L9U A;  4TW5 A;  5ECO B;  5HR2 A;  5E59 A;  3KP9 A;  4IVF A;  1TXX A;  4X4J A;  4MJC A;  4HSC X;  2IFQ B;  4F0B A;  4BVY B;  2V6K A;  3IBH A;  2VOC A;  3R2Q A;  3I43 A;  3TOT A;  5J41 A;  5J9B A;  4MH3 A;  4ZIL A;  1WPI A;  2F8A A;  2H1D A;  4TR1 B;  4GXZ A;  1X0R A;  1VF1 A;  4NMU A;  3QFB C;  5G5F A;  2YWM A;  1K0B A;  5ECK B;  5ECS A;  3O76 A;  2BTO T;  3DVX A;  4YKF A;  1NM3 A;  1FVK A;  2MBS A;  1GUM A;  2LUS A;  2KOK A;  4ILF A;  3L78 A;  1B4P A;  3CRT A;  3M1G A;  3DRN A;  3ZL5 A;  5CRE A;  3DKS A;  2FWG A;  2JZR A;  3W6G A;  4KUN A;  1OE8 A;  2J9H A;  2A2S A;  2YAN A;  1XWC A;  1HNA A;  3M8N A;  3HA9 A;  2VCT A;  1NHY A;  17GS A;  1Z3E A;  3KZQ A;  3CQF A;  3JCM L;  3P8W A;  3GX0 A;  2O7K A;  4LMV A;  2FLS A;  2OE3 A;  3APQ A;  2CA8 A;  5DBQ A;  1R5P A;  2XPD A;  4PUF C;  2CVD A;  2R2J A;  2FGX A;  4USS A;  5LCZ A;  2C8U A;  3CTF A;  5G2Z A;  3LSZ A;  2NDO A;  4TXO B;  1PRX A;  2X8G A;  2CAI A;  1TK8 B;  1T4Y A;  4G0L A;  2YPM A;  5JWO B;  4JR4 A;  1AC1 A;  2DMM A;  4POB A;  4V1A g;  2LV3 A;  2VM1 A;  4WKW A;  4P3Y B;  3RPP A;  4GWR A;  3DGQ A;  3FR6 A;  4YQV A;  2F8F A;  4BWQ A;  2G0F A;  3A2V A;  5IO2 A;  5DCG A;  3VWW A;  2CV4 A;  3TJJ A;  2DJK A;  5G30 A;  2WGR A;  5AN1 A;  3O3T A;  5CYY A;  3LOR A;  5H5R A;  1GLQ A;  1VGL A;  1HQO A;  2IMI A;  3EWL A;  2O8V B;  4I6X A;  2CVK A;  4CW9 A;  5D9X A;  3FZA A;  1ERV A;  1FB6 A;  1GTA A;  1MDK A;  1ZYP A;  3TGZ A;  1J9B A;  5D73 A;  2M72 A;  4XCS A;  5A5K A;  2WJU A;  3RAZ A;  4MJB A;  2H1G A;  5IMZ A;  3DD3 A;  3E0U A;  3DVW A;  3FY7 A;  4HJM A;  4A5P A;  3S9F A;  2HRA A;  4D73 A;  2FNO A;  1K3L A;  1F9M A;  2KHP A;  2DJ2 A;  1YZX A;  5JWQ B;  4YAV A;  2H0G A;  4ZBB A;  2HRK A;  4G9H A;  1K3O A;  2R37 A;  3ED3 A;  4QL9 A;  2P0G A;  3CXG A;  4HI7 A;  1T4Z A;  2LTK A;  1SL2 B;  2CX3 A;  4MH2 A;  1PN9 A;  1ZOF A;  2WZ9 A;  1WJK A;  2PMT A;  4ZL9 A;  4PUA A;  4O32 A;  3DWV A;  19GS A;  2M80 A;  4NPB A;  3R3E A;  1BQ7 A;  3D4M A;  3FHK A;  10GS A;  4RQR A;  1PKW A;  5GSS A;  2HRF A;  1SEN A;  4X43 A;  1UA5 A;  4BVY A;  4OWY A;  5HFG A;  1ZGN A;  2CX4 A;  3F6D A;  4HS1 A;  5CP1 A;  2JZT A;  3BCI A;  1ZZY A;  2PBJ A;  3NIV A;  2IMF A;  2IJY A;  4YKG A;  2LJK A;  1OC8 A;  2FWF A;  3VLN A;  3EE2 A;  3MYD A;  1M9B A;  3K8N A;  4XS4 A;  4ZB6 A;  3HVV A;  4JZQ A;  5ECH B;  4L8E A;  2D2Z A;  4OO4 A;  1TI1 A;  5A4V A;  1JZW A;  3KH9 A;  4GQC A;  3FZ9 A;  1T00 A;  2N5B A;  4ZB9 A;  5GZZ B;  3GX8 A;  5CO3 A;  1K0M A;  1GSD A;  4O92 A;  1T8E B;  3F4T A;  2EIQ A;  4NV5 A;  4CHS A;  2RLI A;  4FYB A;  1YF1 A;  3D22 A;  2GGT A;  1X9M B;  4TVE A;  1SU9 A;  5EVO A;  3FYG A;  2H76 A;  1U87 A;  1HNC A;  2MMZ A;  4HJ2 A;  3I9V 2;  1K3Y A;  1CQH A;  1KEB A;  2K8V A;  3FR9 A;  1K0N A;  1XW5 A;  4IQ1 A;  1XVQ A;  1THO A;  4N0Z A;  4EDY A;  4EXJ A;  4J2F A;  1SL1 B;  2L57 A;  2DIZ A;  4Q5F A;  4OD7 A;  2V6O A;  3KJY A;  2ON7 A;  1XW6 A;  3FKF A;  3NZN A;  4X0X A;  1RW1 A;  2R0G A;  5IMD A;  1Y25 A;  5INY A;  1S3R A;  3F3Q A;  3EUR A;  2IMK A;  4GTU A;  5B8B A;  1GUL A;  1ZCP A;  4CY6 A;  3WGD A;  4KX4 A;  2V1M A;  2H01 A;  4G0K A;  1WRY A;  3FW2 A;  1VRS D;  3GHA A;  5AIX A;  1CQG A;  1K0C A;  4IHU A;  3UIW A;  2H8L A;  2A2P A;  5FWG A;  4FIW A;  2C1Y A;  3ZIT A;  3VK9 A;  3WT2 A;  2LQO A;  1EP8 A;  1O8X A;  2WDU A;  3ZRE A;  1V2A A;  5KOW A;  1GTU A;  3U5R E;  4TN8 A;  2C0F A;  4RUV A;  2VLU A;  4ECC A;  5B7C A;  1G6W A;  4IGJ A;  3FRC A;  3GMF A;  4BVX A;  4IKH A;  2GT6 A;  3C71 A;  4GLT A;  2WCI A;  5DQY A;  3F63 A;  5GAP D;  2OKA A;  2H72 A;  4K0G A;  2VLV A;  1E2Y A;  2H0H A;  2VD1 A;  3PIN A;  3ZRD A;  4EO3 A;  2HZF A;  1GUK A;  3HY2 A;  3DIE A;  1XPV A;  1HNB A;  4KDY A;  1TTZ A;  3QCP A;  1J08 A;  1TRW A;  3APO A;  4K2X A;  4EDZ A;  1JHB A;  1X5D A;  4K7I A;  2GDR A;  4FYC A;  3WGE A;  3ME8 A;  2LNT A;  2JSY A;  3UOM A;  11GS A;  5J9C A;  1SD8 A;  1IYI A;  2C0E A;  3KD0 A;  5ECL B;  4F03 A;  3C73 A;  1ERU A;  2VM2 A;  1OAZ A;  4G2E A;  3LJR A;  4GST A;  1S3C A;  1RQM A;  2B6M A;  3VFI A;  3GTU B;  2G2Q A;  4YAP A;  5IMC A;  6GSW A;  1SK2 A;  1F3A A;  4XRA A;  3CSJ A;  2N5F A;  1R7H A;  3I69 A;  1M99 A;  4KDU A;  2DJ3 A;  1AIU A;  4J56 E;  2MMN A;  5F05 A;  4K5S A;  2FA4 A;  4WET A;  4CY8 A;  3H93 A;  4ECI A;  3H8Q A;  3IV4 A;  3A5I A;  3TDG A;  3LXZ A;  4HQZ A;  1G0T A;  2C0G A;  4TR3 A;  4PQI A;  1WOU A;  3QDN A;  2LNS A;  3TOU A;  1QK8 A;  1M9A A;  1Q4J A;  2MMO A;  2PPT A;  3IR4 A;  2QKE A;  2FD3 A;  3VI5 A;  5D9V A;  1U6T A;  1O73 A;  1QXH A;  1MD4 A;  4MK3 A;  4PQH A;  2YNX A;  1YKA A;  1LU4 A;  4KE3 A;  4LL1 B;  1ML6 A;  6GSS A;  2HFD A;  2QA2 A;  3CSI A;  1K0D A;  5DVB A;  1GP1 A;  3ZYW A;  4ID0 A;  2EC4 A;  3VUR A;  3J7Y k;  3MSZ A;  4TXV A;  2FWE A;  3EYT A;  1AQV A;  1MEK A;  2R3X A;  5IM9 A;  4KW6 A;  1K0O A;  1BYE A;  4EF0 A;  4EE0 A;  5DDL A;  3Q19 A;  2R6K A;  3TRX A;  3CBU A;  3VWV A;  4Q5N A;  1EP7 A;  2LEG A;  1TP9 A;  2DIY A;  3GRX A;  1XG8 A;  2GSR A;  4XHM A;  4J57 E;  1SK1 A;  3EPT A;  3D0Z A;  3GST A;  2XBQ A;  1PD2 1;  3VI7 A;  9GSS A;  1GSE A;  1TI3 A;  2HLS A;  2OJL A;  4AJ6 A;  1T1V A;  4F2I A;  2RII A;  2MMA A;  3UVH A;  4L5L A;  4WF5 A;  4EIQ A;  1GTB A;  2F51 A;  2F3M A;  2YZU A;  5ID2 A;  1AW9 A;  1R4W A;  3H79 A;  5DJM A;  2CZ2 A;  1A2M A;  5ELG A;  5DAL A;  2PWJ A;  3P7X A;  1A23 A;  4GSN A;  2GQL A;  6GSV A;  3PH9 A;  4OFN A;  4KCE A;  3N5O A;  2PGT A;  2WUL A;  2QGV A;  1XWA A;  3CTG A;  3HKR A;  1N2A A;  1XWK A;  2C3Q A;  4RQX A;  5A4W A;  5L71 A;  1S3D A;  4DSS B;  5AGY A;  1OC9 B;  5J3R A;  2M46 A;  3FR3 A;  2HZE B;  1C72 A;  3HVN A;  3PPU A;  3IA1 A;  2V41 A;  1EZK A;  3FK8 A;  2YZH A;  2VD0 A;  4NXI A;  4YQM A;  1BAY A;  3HHV A;  4POL A;  1DE1 A;  1SYR A;  2CZ3 A;  2C3N A;  5JCU A;  3W8J A;  1YEX A;  1A2L A;  5JCW A;  4HU9 A;  2QC7 A;  4ML6 A;  2K6V A;  4AF2 A;  1BJX A;  1K0A A;  3TJF A;  2VAF A;  3O6T A;  3KH7 A;  4V2M A;  3GKM A;  3N9J A;  5AIV A;  3EU3 A;  4JED A;  1JZR A;  2ON5 A;  2VL2 C;  4FH8 A;  3EIN A;  1XWB A;  5JWR B;  2YJH A;  2YWN A;  4N11 A;  4BL7 A;  3GTU A;  5G5E A;  1JZD A;  3D21 A;  1GH2 A;  3G7I A;  1JLV A;  5LD0 A;  3UMA A;  3TKS C;  1GSS A;  2WS2 A;  2L4Q A;  4E8H A;  3HD5 A;  2P5R A;  2R5G A;  3M3M A;  2B5E A;  4MDC A;  1PQN A;  4MNN A;  4BA7 A;  6GSX A;  2YN1 A;  3Q74 A;  5IQY A;  2GS3 A;  5KOX A;  2FUG 2;  4KND A;  3GUR A;  5DAK B;  2HT9 A;  4K1F A;  3WD6 A;  4OO5 A;  3KCM A;  2HE3 A;  2GVP A;  5HR1 A;  3IAS 2;  12GS A;  2AYT A;  5DJL A;  3UL3 A;  1PL1 A;  3CRU A;  2B3S A;  4YH2 A;  1IYH A;  2DLX A;  2K18 A;  3QOU A;  3KXO A;  3E3E A;  1J0F A;  4XIH A;  2NVL A;  3PR8 A;  1WE0 A;  1KBN A;  2B5X A;  4WF4 A;  4ULX A;  4OFT A;  2OE0 A;  1GSF A;  4ZXG A;  1HYU A;  2RM6 A;  2Z9S A;  5HFI A;  1M3J A;  2R0C A;  2KLX A;  1EWX A;  4PGT A;  2FA8 A;  1B9Y C;  2YJ7 A;  1X9W B;  2IFQ A;  1F6M C;  1TKD B;  3RBT A;  4HUA A;  3QAG A;  1FO5 A;  2DJ0 A;  2R0P A;  4PNF A;  2XBI A;  1B48 A;  2XPE A;  4MLY A;  5CRG A;  2YV9 A;  1ZYQ B;  1ABA A;  2VCQ A;  5HFK A;  4MP4 A;  4KGI A;  2TRC P;  4TR1 A;  2IWT A;  5ELA A;  4HZ2 A;  5J5N A;  1OKD A;  5IO0 A;  4IJI A;  3ZVJ D;  4I8B A;  1XOA A;  2JSZ A;  3TJB A;  3KEB A;  2NTO A;  4JBB A;  1F2E A;  1THX A;  2DJ1 A;  5IMA A;  4XTS A;  3QAW A;  1Z7P A;  3ME7 A;  2H73 A;  3TKS E;  4LL4 B;  4XS1 A;  4N30 A;  1FOV A;  1BX9 A;  2B1K A;  3IK7 A;  1SL0 B;  3KGK A;  5F06 A;  2NPB A;  2L4C A;  2L6D A; 
#chains in the Genus database with same CATH homology
 3MIX A;  3CYN A;  3ZIV A;  2REM A;  3DEX A;  3P2A A;  4N0V A;  2LJR A;  3Q18 A;  3GFK A;  3UVT A;  2H6X A;  3AY8 A;  1ZYN A;  2MBT A;  3UBL A;  4IP1 A;  1PKZ A;  3KMO A;  5CNW A;  2VL2 A;  5FT3 A;  1MD3 A;  1YY7 A;  3LWA A;  1TW9 A;  2YV7 A;  3MDK A;  2CAQ A;  4WXT A;  3BBY A;  4XRD A;  1RK4 A;  4N10 A;  3TRP A;  2K8S A;  4DEJ A;  2X99 A;  1PA3 A;  2C3T A;  5E4W A;  1QGV A;  1OC9 A;  3LG6 A;  2HZE A;  3TCO A;  3VWU A;  1PGT A;  3TKS A;  4TXO A;  1TU7 A;  3ZZX A;  2AV4 A;  3GKX A;  4TOP A;  2V2G A;  1FB0 A;  1AAZ A;  1LBK A;  1VF4 A;  1Z7R A;  4MPG A;  5IIZ A;  4TR0 A;  1H4O A;  3LXT A;  4PTS A;  3F0I A;  3C7M A;  3C1R A;  2OE1 A;  1DSB A;  2DML A;  1AQW A;  1OE7 A;  4MZW A;  1HD2 A;  3NOF A;  3ZVJ A;  2HXK A;  2O85 A;  1MDJ A;  1YQ1 A;  2DC5 A;  4RI7 A;  2H66 A;  3UBK A;  4HZ4 A;  3D6I A;  2GZZ A;  1F37 A;  4FQU A;  4MF5 A;  3LW9 A;  2X8C A;  4LLR A;  2J23 A;  2LRC A;  4QL7 A;  3IE3 A;  1O81 A;  3APS A;  1TRV A;  3CSH A;  4AJ7 A;  2GST A;  2PN8 A;  5C00 A;  3G7J A;  1YEP A;  2B7J A;  1R5A A;  1TRS A;  1EV4 A;  3HJP A;  1YDK A;  5KN2 A;  1EV9 A;  3MAK A;  20GS A;  1ZL9 A;  4IQA A;  2EIR A;  3D4T A;  3LQ7 A;  1YJ6 A;  2TIR A;  2ZUP A;  1B4Q A;  1M0U A;  2RM5 A;  1Q98 A;  4K9Z A;  4MPF A;  5DAK A;  1AXD A;  2H71 A;  2GZY A;  4KSM A;  1EEJ A;  2JU5 A;  1G7O A;  3FMW A;  5EY6 A;  2RUF A;  3DXB A;  2AHE A;  4KA0 A;  3BD2 A;  2HSM A;  4O5R A;  2FY6 A;  1DE2 A;  3ZFB A;  1DUG A;  1Z5Y E;  1KTE A;  1SYX A;  2VO4 A;  4JE1 A;  2CVB A;  2IN3 A;  5D9T A;  2CQ9 A;  2VUP A;  1SKR B;  3GUS A;  4L0W A;  5COH A;  3W8S A;  1I5G A;  4Z2T A;  4I97 A;  1XZO A;  2DSA A;  3QPM A;  4G0I A;  3GYK A;  5D93 A;  1A24 A;  5IOW A;  4IEL A;  5B6M A;  1Z6N A;  1VF3 A;  4IN0 A;  1A2J A;  1Y6E A;  1WMJ A;  2K9F A;  3HZ4 A;  2DJJ A;  3A3T A;  2KUC A;  4AJ8 A;  4OFM A;  2H1B A;  4ML1 A;  5C04 A;  1EOH A;  3IHG A;  3SBC A;  2GT5 A;  22GS A;  3A2X A;  2MZC A;  1GLP A;  2N5A A;  1TDI A;  2UZ8 A;  3EU4 A;  3TUE A;  2HSH A;  4D73 B;  2QA1 A;  4DVC A;  3LEF A;  1XFL A;  1Z6M A;  2IL3 A;  1XCC A;  4ZIJ A;  1PN0 A;  1R26 A;  4I2U A;  4ICY A;  2LRN A;  2YP6 A;  4KCA A;  1JFU A;  2H0I A;  3M9K A;  4PQ1 A;  5KN1 A;  3BOA A;  3MWH A;  1AQX A;  1PX7 A;  1TJD A;  4O7H A;  1XWG A;  3EC3 A;  1I9D A;  1V58 A;  5ECR B;  2F9S A;  3VPT A;  3L9V A;  4XS6 A;  1ERT A;  1USB A;  2L59 A;  3H4K A;  3GKN A;  4E8E A;  3Q6O A;  3C8E A;  2MYG A;  3IK9 A;  2E7P A;  3RPN A;  3F4S A;  4RI6 A;  1PMT A;  1FVJ A;  2HSY A;  3SWL A;  5IPH A;  2GSQ A;  1EGR A;  1UN2 A;  3IOS A;  4L0U A;  4ISD A;  1FOH A;  3M0F A;  3QMX A;  4WEY A;  2IPA A;  4H86 A;  1GSU A;  3ZMK A;  1O6J A;  2QSI A;  2PU9 C;  2DBC A;  1WIK A;  3TB2 A;  2LJA A;  1NHO A;  3P90 A;  4MJE A;  3GKK A;  4XS4 B;  5KN0 A;  1NSW A;  1SJI A;  3RHC A;  4DSR A;  4KAE A;  5ECI B;  5IMF A;  3KP8 A;  4K2D A;  2GLR A;  2HRN A;  2I1U A;  5CRD A;  3ZTL A;  2XHF A;  4Q5Q A;  1SK0 A;  2EIO A;  4GCI A;  2H1A A;  3HZ8 A;  3GSS A;  5IMV A;  2P5Q A;  1S3A A;  16GS A;  2OA7 A;  3KM6 A;  4POK A;  1URM A;  1KNG A;  3WT1 A;  5GST A;  2B7K A;  3H1N A;  1FG4 A;  4HU7 A;  3UEM A;  2H6Z A;  3G9B A;  4IBP A;  4JRR A;  4GQF A;  3C1S A;  5F8B A;  2PVQ A;  2LST A;  3IAM 2;  2VCV A;  2ZCT A;  1GNE A;  4OCE A;  2YCD A;  3IC4 A;  2I9H A;  3BCK A;  4I2T A;  1TU8 A;  3LGC A;  3L9S A;  3TJG A;  1ON4 A;  5H5S A;  1G7E A;  1PL2 A;  2GZP A;  3HVS A;  2LS5 A;  1QMV A;  3ZFL A;  5ECN B;  1V40 A;  5HR3 A;  3MNG A;  4QQ7 A;  4MAB A;  1UVZ A;  2B1L A;  4IS0 A;  2X8H A;  1O85 A;  1U3I A;  4IW9 A;  3LYP A;  3GL3 A;  1ILO A;  1BG5 A;  4EKZ A;  2AUV A;  1SJZ A;  2I81 A;  4WR5 A;  3KTB A;  5HQP A;  1LJR A;  5ECM B;  4ZL8 A;  6GST A;  4Z2R A;  4BPY A;  2OAD A;  2H19 A;  1M2D A;  4K7O A;  1A8Y A;  4LA1 A;  2VCZ A;  3WYW A;  1T7P B;  4EL1 A;  4NHW A;  5CAX A;  2FHE A;  2I3Y A;  2VCX A;  1M7T A;  4NHZ A;  4GRF A;  2C0D A;  18GS A;  4HQS A;  5B8A A;  2IIY A;  2AB6 A;  3F4R A;  3E9J B;  4EIP A;  2E0Q A;  1QUW A;  2VLT A;  4NAX A;  5J4U A;  4O5Q A;  2BMX A;  5FHI A;  2LQQ A;  2L5L A;  1O8W A;  1GSQ A;  1N8J A;  4DSQ A;  3M9J A;  4KH7 A;  2A4H A;  3CMI A;  4BVX B;  4KF9 A;  4HEA 2;  3GH9 A;  4V2N A;  2E2M A;  2WFC A;  4WR4 A;  4F0C A;  4ACS A;  1SKW B;  1X5E A;  4JU5 A;  2DKI A;  4ZBD A;  2WB9 A;  2X49 A;  3RHB A;  4MJA A;  14GS A;  3IHQ A;  4IP6 A;  1XOB A;  4HOJ A;  3ZIJ A;  3DYR A;  3L0H A;  2JAD A;  2A2R A;  4YQU A;  3EMP A;  1GUH A;  2OAC A;  4JR6 A;  5F07 A;  2DKH A;  1AUC A;  2H70 A;  13GS A;  2H30 A;  5CRH A;  1A8L A;  2GTU A;  1ERW A;  3U6V A;  4LMW A;  2NBS A;  5KN3 A;  1X5C A;  2A4V A;  3L4N A;  4FYU A;  4O5U A;  5EPF A;  3F8U A;  2HYX A;  4EVM A;  1W89 A;  1H75 A;  1ZMA A;  4K5R A;  5LNK e;  4ECB A;  1XVW A;  4FO5 A;  4MZB A;  4TRX A;  3US3 A;  4K8M A;  1GRX A;  3RDW A;  1GWC A;  5A4U A;  2FWH A;  2AJQ B;  3IC8 A;  4AGS A;  4ECJ A;  1GNW A;  3IPZ A;  4KSO A;  1JLW A;  1OVN A;  1ZYE A;  3QFA C;  3UAP A;  2L6C A;  3KTL A;  2C80 A;  2OBI A;  1V57 A;  3KIJ A;  1XIY A;  6GSU A;  2RUE A;  1X9S B;  1V98 A;  2YWO A;  1GL8 A;  1XXU A;  1XBS A;  1GSY A;  3IDV A;  4MF7 A;  3GV1 A;  1EGO A;  3QD9 A;  3WGX A;  2LKU A;  2ZNM A;  1U3A A;  2IME A;  5IPG A;  4KDX A;  5G31 A;  1EEM A;  2JAC A;  2R4V A;  1M2B A;  3ERF A;  4WBR D;  5AIS A;  1U88 A;  1FHE A;  4KB3 A;  2BJX A;  2C4J A;  1NW2 A;  4K6X A;  1M2A A;  1TK0 B;  3EVI A;  2H74 A;  5G1L A;  1W4V A;  3A2W A;  2TRX A;  1B9X C;  2HI7 A;  3FZ5 A;  4DSS A;  2V32 A;  5EL8 A;  2XC2 A;  3UJ1 A;  1FW1 A;  2FCH A;  1WP0 A;  3F9U A;  5BMU A;  1TOF A;  3HVX A;  2X4A A;  3FZ4 A;  1XW9 A;  6GSY A;  3DML A;  4TKY A;  3ZLP A;  4V2L A;  1BED A;  2VL9 A;  1PSQ A;  5G1K A;  1MDI A;  3ZML A;  1YF0 A;  1OKT A;  1QQ2 A;  4NWY A;  1FAA A;  5ID2 B;  2OBK A;  4PXO A;  1ST9 A;  3F3R A;  1PX6 A;  2O89 A;  1QFN A;  3G7Y A;  1SJ6 A;  4F82 A;  1TRU A;  2X64 A;  2VCW A;  3QR6 A;  2L5O A;  1WWJ A;  2PER A;  4GSS A;  5DAL B;  2GQK A;  3QAV A;  5CRW A;  4EC0 A;  4Z2U A;  5F0G A;  1E6B A;  2I4A A;  5DCH A;  1SD9 A;  4K0N A;  3TKQ A;  3GA4 A;  3TRQ A;  1A0F A;  3BJ5 A;  5D8I A;  3HDC A;  4OCF A;  5DQS A;  5B6N A;  5JCG A;  2JL4 A;  3OR5 A;  3FEU A;  4PNG A;  3F6F A;  1G6Y A;  2YOI A;  3J7Y b;  2VIM A;  3VWX A;  3HYP A;  2GQM A;  4V1A p;  4ZB8 A;  2LRT A;  2KP1 A;  3VPQ A;  2GSS A;  4MF6 A;  4Z7X A;  5HR0 A;  4X1U A;  4G19 A;  1Z9H A;  1EOG A;  2E2G A;  2H6Y A;  3HJM A;  5H5Q A;  4MMM A;  2B5Y A;  3GNJ A;  4MZC A;  3HJO A;  2PUK C;  1ACV A;  1SKS B;  4K7N A;  2PVO C;  2P31 A;  5GAN D;  2YWI A;  4HDE A;  4EUY A;  1JZO A;  3KMN A;  4L5O A;  5ENU A;  5ABR A;  3TKP A;  3V1W A;  3GH6 A;  2KP2 A;  3GIX A;  3GN3 A;  1UC7 A;  3ERG A;  4GF0 A;  3IXR A;  4NV2 A;  1F3B A;  5IOX A;  4F9Z A;  4Q5R A;  8GSS A;  3HCZ A;  1YKC A;  4BL7 B;  4PUR A;  3D5J A;  4MA9 A;  3LFL A;  1VF2 A;  4MCU A;  4G10 A;  3UAR A;  3I6A A;  3LYK A;  4OMV A;  4IJ3 A;  7GSS A;  3GL5 A;  4TR4 A;  2H75 A;  1T3B A;  2ES7 A;  1GTI A;  4PX1 A;  1OYJ A;  3EMX A;  4I5Q A;  2VL3 A;  2HNL A;  1V9W A;  2ALB A;  4ZBA A;  2WRT A;  2JZS A;  1B8X A;  3TJK A;  1TK5 B;  5ECP B;  2AAW A;  5ECQ B;  3ERW A;  5KEJ A;  1DBY A;  1O7U A;  4POM A;  3A5W A;  3TKR A;  3HXS A;  4ZL7 A;  5D96 A;  5BRT A;  5D9W A;  1OC3 A;  2O87 A;  4BWS A;  1A0R P;  2IMD A;  3IRA A;  4CDO A;  3PGT A;  1MTC A;  2CT6 A;  4WBJ A;  3ISO A;  3L9U A;  4TW5 A;  5ECO B;  5HR2 A;  5E59 A;  3KP9 A;  4IVF A;  1TXX A;  4X4J A;  4MJC A;  2IFQ B;  4F0B A;  4BVY B;  2V6K A;  3IBH A;  2VOC A;  3R2Q A;  3I43 A;  3TOT A;  5J41 A;  5J9B A;  4MH3 A;  4ZIL A;  1WPI A;  2F8A A;  2H1D A;  4TR1 B;  4GXZ A;  1X0R A;  1VF1 A;  4NMU A;  3QFB C;  5G5F A;  2YWM A;  1K0B A;  5ECK B;  5ECS A;  3O76 A;  2BTO T;  3DVX A;  4YKF A;  1NM3 A;  1FVK A;  2MBS A;  1GUM A;  2LUS A;  2KOK A;  4ILF A;  3L78 A;  1B4P A;  3CRT A;  3M1G A;  3DRN A;  3ZL5 A;  5CRE A;  3DKS A;  2FWG A;  2JZR A;  3W6G A;  4KUN A;  1OE8 A;  2J9H A;  2A2S A;  2YAN A;  1XWC A;  1HNA A;  3M8N A;  3HA9 A;  2VCT A;  1NHY A;  17GS A;  1Z3E A;  3KZQ A;  3JCM L;  3P8W A;  3GX0 A;  2O7K A;  4LMV A;  2FLS A;  2OE3 A;  3APQ A;  2CA8 A;  5DBQ A;  1R5P A;  2XPD A;  4PUF C;  2CVD A;  2R2J A;  2FGX A;  4USS A;  5LCZ A;  2C8U A;  3CTF A;  5G2Z A;  3LSZ A;  2NDO A;  4TXO B;  1PRX A;  2X8G A;  2CAI A;  1TK8 B;  1T4Y A;  4G0L A;  2YPM A;  5JWO B;  4JR4 A;  1AC1 A;  2DMM A;  4POB A;  4V1A g;  2LV3 A;  2VM1 A;  4WKW A;  4P3Y B;  3RPP A;  4GWR A;  3DGQ A;  3FR6 A;  4YQV A;  2F8F A;  4BWQ A;  2G0F A;  3A2V A;  5IO2 A;  5DCG A;  3VWW A;  2CV4 A;  3TJJ A;  2DJK A;  5G30 A;  2WGR A;  5AN1 A;  3O3T A;  5CYY A;  3LOR A;  5H5R A;  1GLQ A;  1VGL A;  1HQO A;  2IMI A;  3EWL A;  2O8V B;  4I6X A;  2CVK A;  4CW9 A;  5D9X A;  3FZA A;  1ERV A;  1FB6 A;  1GTA A;  1MDK A;  1ZYP A;  3TGZ A;  1J9B A;  5D73 A;  2M72 A;  4XCS A;  5A5K A;  2WJU A;  3RAZ A;  4MJB A;  2H1G A;  5IMZ A;  3DD3 A;  3E0U A;  3DVW A;  3FY7 A;  4HJM A;  4A5P A;  3S9F A;  2HRA A;  4D73 A;  2FNO A;  1K3L A;  1F9M A;  2KHP A;  2DJ2 A;  1YZX A;  5JWQ B;  4YAV A;  2H0G A;  4ZBB A;  2HRK A;  4G9H A;  1K3O A;  2R37 A;  3ED3 A;  4QL9 A;  2P0G A;  3CXG A;  4HI7 A;  1T4Z A;  2LTK A;  1SL2 B;  2CX3 A;  4MH2 A;  1PN9 A;  1ZOF A;  2WZ9 A;  1WJK A;  2PMT A;  4ZL9 A;  4PUA A;  4O32 A;  3DWV A;  19GS A;  2M80 A;  4NPB A;  3R3E A;  1BQ7 A;  3D4M A;  3FHK A;  10GS A;  4RQR A;  1PKW A;  5GSS A;  2HRF A;  1SEN A;  4X43 A;  1UA5 A;  4BVY A;  4OWY A;  5HFG A;  1ZGN A;  2CX4 A;  3F6D A;  4HS1 A;  5CP1 A;  2JZT A;  3BCI A;  1ZZY A;  2PBJ A;  3NIV A;  2IMF A;  2IJY A;  4YKG A;  2LJK A;  1OC8 A;  2FWF A;  3VLN A;  3EE2 A;  3MYD A;  1M9B A;  3K8N A;  4XS4 A;  4ZB6 A;  3HVV A;  4JZQ A;  5ECH B;  4L8E A;  2D2Z A;  4OO4 A;  1TI1 A;  5A4V A;  1JZW A;  3KH9 A;  4GQC A;  3FZ9 A;  1T00 A;  2N5B A;  4ZB9 A;  5GZZ B;  3GX8 A;  5CO3 A;  1K0M A;  1GSD A;  4O92 A;  1T8E B;  3F4T A;  2EIQ A;  4NV5 A;  4CHS A;  2RLI A;  4FYB A;  1YF1 A;  3D22 A;  2GGT A;  1X9M B;  4TVE A;  1SU9 A;  5EVO A;  3FYG A;  2H76 A;  1U87 A;  1HNC A;  2MMZ A;  4HJ2 A;  3I9V 2;  1K3Y A;  1CQH A;  1KEB A;  2K8V A;  3FR9 A;  1K0N A;  1XW5 A;  4IQ1 A;  1XVQ A;  1THO A;  4N0Z A;  4EDY A;  4EXJ A;  4J2F A;  1SL1 B;  2L57 A;  2DIZ A;  4Q5F A;  4OD7 A;  2V6O A;  3KJY A;  2ON7 A;  1XW6 A;  3FKF A;  3NZN A;  4X0X A;  1RW1 A;  2R0G A;  5IMD A;  1Y25 A;  5INY A;  3F3Q A;  3EUR A;  2IMK A;  4GTU A;  5B8B A;  1GUL A;  1ZCP A;  4CY6 A;  3WGD A;  4KX4 A;  2V1M A;  2H01 A;  4G0K A;  1WRY A;  3FW2 A;  1VRS D;  3GHA A;  5AIX A;  1CQG A;  1K0C A;  4IHU A;  3UIW A;  2H8L A;  2A2P A;  5FWG A;  4FIW A;  2C1Y A;  3ZIT A;  3VK9 A;  3WT2 A;  2LQO A;  1EP8 A;  1O8X A;  2WDU A;  3ZRE A;  1V2A A;  5KOW A;  1GTU A;  3U5R E;  4TN8 A;  2C0F A;  4RUV A;  2VLU A;  4ECC A;  5B7C A;  1G6W A;  4IGJ A;  3FRC A;  3GMF A;  4BVX A;  4IKH A;  2GT6 A;  3C71 A;  4GLT A;  2WCI A;  5DQY A;  3F63 A;  5GAP D;  2OKA A;  2H72 A;  4K0G A;  2VLV A;  1E2Y A;  2H0H A;  2VD1 A;  3PIN A;  3ZRD A;  4EO3 A;  2HZF A;  1GUK A;  3HY2 A;  3DIE A;  1XPV A;  1HNB A;  4KDY A;  1TTZ A;  3QCP A;  1J08 A;  1TRW A;  3APO A;  4K2X A;  4EDZ A;  1JHB A;  1X5D A;  4K7I A;  2GDR A;  4FYC A;  3WGE A;  3ME8 A;  2LNT A;  2JSY A;  3UOM A;  11GS A;  5J9C A;  1SD8 A;  1IYI A;  2C0E A;  3KD0 A;  5ECL B;  4F03 A;  3C73 A;  1ERU A;  2VM2 A;  1OAZ A;  4G2E A;  3LJR A;  4GST A;  1S3C A;  1RQM A;  2B6M A;  3VFI A;  3GTU B;  2G2Q A;  4YAP A;  5IMC A;  6GSW A;  1SK2 A;  1F3A A;  4XRA A;  3CSJ A;  2N5F A;  1R7H A;  3I69 A;  1M99 A;  4KDU A;  2DJ3 A;  1AIU A;  4J56 E;  2MMN A;  5F05 A;  4K5S A;  2FA4 A;  4WET A;  4CY8 A;  3H93 A;  4ECI A;  3H8Q A;  3IV4 A;  3A5I A;  3TDG A;  3LXZ A;  4HQZ A;  1G0T A;  2C0G A;  4TR3 A;  4PQI A;  1WOU A;  3QDN A;  2LNS A;  3TOU A;  1QK8 A;  1M9A A;  1Q4J A;  2MMO A;  2PPT A;  3IR4 A;  2QKE A;  2FD3 A;  3VI5 A;  5D9V A;  1U6T A;  1O73 A;  1QXH A;  1MD4 A;  4MK3 A;  4PQH A;  2YNX A;  1YKA A;  1LU4 A;  4KE3 A;  4LL1 B;  1ML6 A;  6GSS A;  2HFD A;  2QA2 A;  3CSI A;  1K0D A;  5DVB A;  1GP1 A;  3ZYW A;  4ID0 A;  2EC4 A;  3VUR A;  3J7Y k;  3MSZ A;  4TXV A;  2FWE A;  3EYT A;  1AQV A;  1MEK A;  2R3X A;  5IM9 A;  4KW6 A;  1K0O A;  1BYE A;  4EF0 A;  4EE0 A;  5DDL A;  3Q19 A;  2R6K A;  3TRX A;  3CBU A;  3VWV A;  4Q5N A;  1EP7 A;  2LEG A;  1TP9 A;  2DIY A;  3GRX A;  2GSR A;  4XHM A;  4J57 E;  1SK1 A;  3EPT A;  3D0Z A;  3GST A;  2XBQ A;  1PD2 1;  3VI7 A;  9GSS A;  1GSE A;  1TI3 A;  2HLS A;  2OJL A;  4AJ6 A;  1T1V A;  4F2I A;  2RII A;  2MMA A;  3UVH A;  4L5L A;  4WF5 A;  4EIQ A;  1GTB A;  2F51 A;  2F3M A;  2YZU A;  5ID2 A;  1AW9 A;  1R4W A;  3H79 A;  5DJM A;  2CZ2 A;  1A2M A;  5ELG A;  5DAL A;  2PWJ A;  3P7X A;  1A23 A;  4GSN A;  2GQL A;  6GSV A;  3PH9 A;  4OFN A;  4KCE A;  3N5O A;  2PGT A;  2WUL A;  2QGV A;  1XWA A;  3CTG A;  3HKR A;  1N2A A;  1XWK A;  2C3Q A;  4RQX A;  5A4W A;  5L71 A;  1S3D A;  4DSS B;  5AGY A;  1OC9 B;  5J3R A;  2M46 A;  3FR3 A;  2HZE B;  1C72 A;  3PPU A;  3IA1 A;  2V41 A;  1EZK A;  3FK8 A;  2YZH A;  2VD0 A;  4NXI A;  4YQM A;  1BAY A;  3HHV A;  4POL A;  1DE1 A;  1SYR A;  2CZ3 A;  2C3N A;  5JCU A;  3W8J A;  1YEX A;  1A2L A;  5JCW A;  4HU9 A;  2QC7 A;  4ML6 A;  2K6V A;  4AF2 A;  1BJX A;  1K0A A;  3TJF A;  2VAF A;  3O6T A;  3KH7 A;  4V2M A;  3GKM A;  3N9J A;  5AIV A;  3EU3 A;  4JED A;  1JZR A;  2ON5 A;  2VL2 C;  4FH8 A;  3EIN A;  1XWB A;  5JWR B;  2YJH A;  2YWN A;  4N11 A;  4BL7 A;  3GTU A;  5G5E A;  1JZD A;  3D21 A;  1GH2 A;  3G7I A;  1JLV A;  5LD0 A;  3UMA A;  3TKS C;  1GSS A;  2WS2 A;  2L4Q A;  4E8H A;  3HD5 A;  2P5R A;  2R5G A;  3M3M A;  2B5E A;  4MDC A;  1PQN A;  4MNN A;  4BA7 A;  6GSX A;  2YN1 A;  3Q74 A;  5IQY A;  2GS3 A;  5KOX A;  2FUG 2;  4KND A;  3GUR A;  5DAK B;  2HT9 A;  4K1F A;  3WD6 A;  4OO5 A;  3KCM A;  2HE3 A;  2GVP A;  5HR1 A;  3IAS 2;  12GS A;  2AYT A;  5DJL A;  3UL3 A;  1PL1 A;  3CRU A;  2B3S A;  4YH2 A;  1IYH A;  2DLX A;  2K18 A;  3QOU A;  3KXO A;  3E3E A;  1J0F A;  4XIH A;  2NVL A;  3PR8 A;  1WE0 A;  1KBN A;  2B5X A;  4WF4 A;  4ULX A;  4OFT A;  2OE0 A;  1GSF A;  4ZXG A;  1HYU A;  2RM6 A;  2Z9S A;  5HFI A;  2R0C A;  2KLX A;  1EWX A;  4PGT A;  2FA8 A;  1B9Y C;  2YJ7 A;  1X9W B;  2IFQ A;  1F6M C;  1TKD B;  3RBT A;  4HUA A;  3QAG A;  1FO5 A;  2DJ0 A;  2R0P A;  4PNF A;  2XBI A;  1B48 A;  2XPE A;  4MLY A;  5CRG A;  2YV9 A;  1ZYQ B;  1ABA A;  2VCQ A;  5HFK A;  4MP4 A;  4KGI A;  2TRC P;  4TR1 A;  2IWT A;  5ELA A;  4HZ2 A;  5J5N A;  1OKD A;  5IO0 A;  4IJI A;  3ZVJ D;  4I8B A;  1XOA A;  2JSZ A;  3TJB A;  3KEB A;  2NTO A;  4JBB A;  1F2E A;  1THX A;  2DJ1 A;  5IMA A;  4XTS A;  3QAW A;  1Z7P A;  3ME7 A;  2H73 A;  3TKS E;  4LL4 B;  4XS1 A;  4N30 A;  1FOV A;  1BX9 A;  2B1K A;  3IK7 A;  1SL0 B;  3KGK A;  5F06 A;  2NPB A;  2L4C A;  2L6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...