1TK8B

T7 dna polymerase ternary complex with 8 oxo guanosine and damp at the elongation site
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*
publication title Structural basis for the dual coding potential of 8-oxoguanosine by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1tk8B00
5IPGA 2YPMA 1G6YA 1FHEA 3GL3A 1U3AA 2C8UA 1TKDB 4OCEA 1JZRA 4MH3A 2RUFA 2V32A 5J41A 2XC2A 4POBA 1XVWA 3TGZA 4ECJA 1VGLA 1VF3A 2H66A 3FR9A 2ZCTA 1EZKA 1WMJA 2GTUA 3F9UA 3RPNA 1K0MA 2AYTA 1U87A 4MJCA 3P8WA 2CVDA 2N5AA 3L0HA 3TKSA 3LJRA 3GL5A 3I6AA 3KCMA 4OO4A 1A2JA 4MF7A 2REMA 4WKWA 2DC5A 4K6XA 3IV4A 1T3BA 1HNBA 1PQNA 2NBSA 2F9SA 2RUEA 3AY8A 5HQPA 1M2BA 3IHQA 19GSA 1X5EA 2K8SA 1JZWA 4ZB8A 1A8YA 4JR4A 5HR1A 1T4ZA 3I43A 2JZSA 5F06A 2F3MA 4NAXA 1F2EA 1KNGA 2DJKA 4GTUA 2VLTA 4XS1A 4ZILA 1XW5A 4I5QA 3QFAC 5CRWA 3IXRA 4WBJA 1XXUA 2QGVA 4FO5A 3BJ5A 4I97A 4ZBBA 4HDEA 5GAND 1SJZA 4TR3A 1QFNA 3DWVA 2TRXA 3C8EA 4PQIA 3FEUA 3TJGA 5CRGA 3BOAA 1BJXA 2EIRA 4J2FA 4NHZA 3TRXA 1GNEA 5IMFA 5J5NA 5HR3A 2YJ7A 1GSYA 3HY2A 2FNOA 5J9BA 2CVBA 1J9BA 4EDYA 4KB3A 4D73B 3GMFA 3ED3A 3M0FA 2H0IA 3CBUA 2LQQA 1XIYA 3R2QA 3ERFA 4HOJA 1K0NA 2LS5A 1AQVA 2LKUA 3GSSA 3QCPA 2FLSA 3L9VA 4ILFA 3OR5A 4KCAA 1AW9A 4FYBA 5CRHA 10GSA 2YWNA 2PVOC 2FA8A 1UA5A 3LORA 1U3IA 1H4OA 5IOXA 4KNDA 4IS0A 4GQCA 3FR6A 1YKCA 4OD7A 1KEBA 4LA1A 2LJAA 5DJMA 2LNSA 3TDGA 1FVKA 2LSTA 1Z7RA 1Z9HA 1WWJA 2YWIA 2H30A 3UEMA 1PRXA 4ID0A 3W8JA 4HI7A 4K1FA 2HNLA 4XS6A 1TK0B 1BX9A 1BG5A 1M2DA 3JCML 3F0IA 4O32A 1PX6A 3TJKA 4MZWA 1X0RA 2YV7A 3GH6A 5F07A 3QAVA 2PN8A 2HLSA 5CYYA 4F0CA 4JZQA 1XVQA 1MDIA 2DJ1A 5ECMB 1QQ2A 3GRXA 1MDJA 4BA7A 2QC7A 4ZB6A 4LMWA 18GSA 3IOSA 1TI3A 5GSTA 1SK0A 1B48A 4FYCA 1TK8B 2DMMA 1GRXA 2H71A 3E3EA 4AJ6A 1XWKA 2VCWA 3APOA 3HCZA 1TU8A 2O85A 4ML1A 4N0VA 6GSVA 1EV9A 3A3TA 2AAWA 1SK2A 2HXKA 5DALA 8GSSA 4K7NA 3VPQA 3HYPA 4XHMA 4OWYA 1XBSA 2OE1A 4YAPA 3FRCA 2VCZA 5G1KA 4HJ2A 2B7JA 4WBRD 4AF2A 3TB2A 3APQA 1TK5B 6GSUA 3UOMA 4WF5A 1J0FA 1AIUA 2X8HA 3VK9A 1XWCA 2D2ZA 1W4VA 1FW1A 1N8JA 1B9YC 2WRTA 2B3SA 2IWTA 2C4JA 2FHEA 1FAAA 4AGSA 4IKHA 1JFUA 4IELA 1N2AA 3D21A 1THXA 2DJ3A 2MBSA 2GT5A 3QOUA 4PNFA 4FYUA 2GLRA 3ZYWA 1ON4A 1K3YA 1GTBA 5EY6A 5A5KA 2VL9A 2RIIA 4EE0A 3BD2A 5B7CA 1MD3A 1KTEA 2ON5A 2JSZA 4F9ZA 1DSBA 2YCDA 3TJBA 3H4KA 1BEDA 3WGXA 1ERUA 2YZHA 5DVBA 1EOGA 2I81A 1ML6A 1K3LA 2OADA 1FOVA 3CSIA 2X8GA 3HVSA 4AJ8A 2KLXA 3EMPA 6GSTA 4ECCA 1X9WB 3KIJA 2OJLA 1ILOA 1FVJA 1Z5YE 2P31A 3A2XA 2V2GA 1SKSB 1U6TA 4POLA 1GTUA 4KW6A 4MJBA 3VI5A 2G2QA 4MZBA 2V6OA 3IAM2 7GSSA 3QR6A 1BYEA 4TKYA 4K8MA 2WB9A 1XW9A 1RK4A 5LNKe 3GSTA 5IMVA 3K8NA 2AHEA 2C1YA 1MTCA 2HZFA 3UBLA 4G19A 4F2IA 2P5RA 2CAIA 3M9KA 4Q5RA 4F0BA 1UC7A 2GT6A 3A5WA 1OE8A 1X9SB 4MPGA 3KEBA 4WR4A 2CT6A 3CRUA 3MSZA 2CQ9A 1NW2A 3DYRA 4DSQA 1GTIA 4IBPA 4LL1B 2VM1A 2C0FA 5D8IA 3RDWA 1I9DA 2WZ9A 1PKWA 3Q19A 1FB6A 2B1KA 1RW1A 4N11A 1WJKA 3D22A 3DVXA 5B6MA 3GN3A 4KUNA 2CZ2A 3F4RA 4L0UA 2IMKA 5DALB 4KSMA 3TKSC 2CAQA 3FHKA 2LNTA 1AQXA 3N9JA 2IL3A 3HD5A 1XPVA 1GWCA 3V1WA 2FUG2 2DJJA 2AJQB 3BCIA 4OFMA 5ECOB 4TN8A 1V2AA 5ECNB 3ZLPA 2BMXA 3GV1A 4L5OA 4KCEA 1R26A 1AC1A 5ID2A 4K7IA 3NIVA 4PUFC 1TJDA 3H93A 4NV2A 2R2JA 1GSFA 2KOKA 3WT2A 2H1BA 3F8UA 1HYUA 2N5FA 4MP4A 1SD9A 1TU7A 2MYGA 5J4UA 1ZZYA 3FZ4A 1PKZA 3GFKA 3GH9A 1SKWB 3SBCA 1EEJA 1B4PA 5H5QA 3TKRA 2GZYA 4EO3A 3DGQA 4G10A 3L9SA 4PNGA 2B5XA 1GLQA 3IC4A 2V1MA 1SL1B 4XS4A 1WRYA 3KGKA 1K0DA 3NZNA 3ZIJA 2VCTA 3W8SA 1T1VA 2LQOA 2K9FA 4NHWA 5CREA 4MH2A 5IM9A 2LRNA 1YZXA 3G7IA 2HRNA 1QUWA 4V2MA 1TTZA 1AAZA 2MZCA 3FYGA 3GKNA 1S3AA 3D0ZA 1X9MB 4I2UA 1IYHA 4ULXA 3W6GA 2H0HA 4ZBDA 1K0CA 2WDUA 5DJLA 4KDUA 3FR3A 3PH9A 1XCCA 5D9WA 1URMA 1YKAA 4IN0A 1YEXA 4E8HA 3KH7A 2MMAA 1CQGA 1OC3A 2EIQA 2KUCA 1QK8A 3C7MA 2PWJA 4J57E 5IMAA 2GVPA 5KN3A 3QFBC 2IIYA 5ECRB 4GWRA 5DQSA 4BWSA 5F05A 3IPZA 1WE0A 2VLUA 3GUSA 4JRRA 2GSRA 3NOFA 2B1LA 3GHAA 4HEA2 5EL8A 5DCGA 4QL7A 4FH8A 3QAWA 4XRAA 4BL7A 4V1Ap 3UARA 1ZCPA 1TXXA 4WXTA 5G1LA 2H1GA 2LTKA 1OE7A 1HNCA 1V98A 4KDYA 2WULA 1USBA 4KE3A 5FT3A 2B5EA 4EKZA 4ZXGA 3ME7A 2VO4A 3DXBA 1GSQA 1UN2A 5B8AA 1E2YA 2H72A 1VRSD 2RM5A 2IFQA 3O76A 4TW5A 2E2MA 2TIRA 1G7EA 4LMVA 5ID2B 2IMIA 3QAGA 2JU5A 2HZEA 2V6KA 2B7KA 13GSA 1T4YA 2FWGA 2XBQA 1OYJA 3HXSA 4N10A 4GSNA 5D9VA 4BWQA 5JCWA 1YF1A 3I9V2 2DSAA 4I8BA 1JZOA 3EWLA 4HZ2A 3GURA 2OBKA 5IO0A 9GSSA 1HQOA 4IJIA 2ES7A 3ZFBA 4X0XA 2WCIA 3HA9A 5AIXA 5ENUA 5HFGA 2KP1A 2OE3A 3IA1A 5FWGA 2H01A 1ZYEA 5JWRB 4F03A 1EV4A 3TOTA 4XS4B 1RQMA 2FWHA 2VUPA 4TR1A 3ZMLA 1PGTA 2J23A 3CXGA 5ECHB 5IMZA 2L4QA 3LWAA 3F6FA 4TXOA 4ISDA 2JL4A 3KMNA 4OFNA 3UAPA 2EC4A 1SK1A 4N0ZA 4HS1A 5GZZB 2B6MA 3GKXA 2GSSA 4GSSA 1G7OA 1XWAA 2GSQA 1T7PB 1OC8A 2YOIA 3KP8A 2C3NA 3DMLA 2L59A 2CZ3A 4DSSA 2MMNA 1F3BA 3F3QA 2PERA 3EMXA 1I5GA 2MMZA 1M2AA 3FKFA 4N30A 5INYA 2XPDA 3RBTA 4HJMA 3VLNA 3PGTA 1GSSA 5ECPB 4K9ZA 5ECSA 4O5RA 4O92A 2LEGA 2KHPA 2X8CA 5D73A 1WP0A 3P2AA 5EPFA 1O8WA 2GQMA 2WJUA 5KN1A 4QL9A 2IN3A 4YAVA 6GSXA 2F51A 5D96A 2H6XA 3GYKA 1ERVA 1PN9A 3UMAA 4POKA 3VWXA 3IAS2 2E2GA 1JHBA 6GSYA 3CMIA 1K0AA 3LEFA 2F8AA 1SYXA 3TKQA 3TKSE 3ZVJA 1O81A 2YJHA 4ZL7A 3M8NA 1TDIA 3G9BA 1ZYQB 3CRTA 2J9HA 3P7XA 2BTOT 5IIZA 2CA8A 3LYPA 1LJRA 2VAFA 4P3YB 2IFQB 4MJEA 5CRDA 2C0DA 2YN1A 3ZRDA 3E0UA 3P90A 2PVQA 1C72A 1ZGNA 4K0GA 1T00A 1TRUA 3KM6A 1QGVA 2HZEB 4DEJA 3A2WA 2FWFA 3DVWA 4JE1A 3KTBA 1GP1A 4IVFA 6GSWA 2V41A 1BAYA 1XWGA 4RI6A 2HSYA 2EIOA 3ZIVA 2VL2A 3FZAA 1OVNA 2VM2A 3ZL5A 3KP9A 2DJ0A 3RHCA 5DAKA 4ML6A 4K7OA 2AB6A 4GLTA 1R5PA 1B4QA 1KBNA 3KTLA 4OO5A 4F82A 4AJ7A 3L4NA 5E4WA 2DIYA 3F3RA 2IMFA 3HDCA 2H74A 1AQWA 2H19A 5ELAA 2VCQA 3VWWA 1WOUA 2YWMA 4TR1B 2LJKA 3TKPA 3MWHA 5J9CA 2JADA 2HFDA 4GQFA 4TXOB 1Z6MA 5G5EA 3DKSA 3FK8A 2LRCA 5ABRA 5JWOB 4YQVA 2FD3A 4ZL8A 1A8LA 1EEMA 3KXOA 2FGXA 5JCUA 2IPAA 4EC0A 3Q6OA 4XTSA 1VF4A 4MK3A 5IQYA 3VWUA 2RM6A 2JZRA 4FIWA 4IP6A 4Q5QA 3QDNA 2E7PA 3N5OA 1ZMAA 5GAPD 4DSSB 4TRXA 2L5LA 1F6MC 1TRVA 4Q5NA 3HVXA 3HJPA 4IQ1A 5A4VA 3WT1A 4TVEA 4OFTA 2ON7A 2HI7A 3FY7A 1TI1A 3ISOA 3WGDA 2NPBA 2HSHA 2P0GA 4GSTA 1A0RP 2GQKA 4YQUA 4XRDA 5IO2A 1Z7PA 2JSYA 5CP1A 3MDKA 1TP9A 5G30A 2ZUPA 4MDCA 3C73A 2VL3A 3G7JA 1PL1A 5KN0A 2R37A 1K0OA 5DDLA 3IK7A 4EUYA 3TUEA 2JZTA 2PBJA 1XW6A 5LD0A 3E9JB 1OC9A 1A2LA 2I9HA 3C71A 1O8XA 3O3TA 5DBQA 2WGRA 2CX3A 3ZTLA 1T8EB 5DCHA 12GSA 3LXZA 1BQ7A 2O89A 4J56E 2K8VA 2DJ2A 2MBTA 3G7YA 2LRTA 1A0FA 4XCSA 5C04A 2P5QA 3KH9A 4IGJA 5EVOA 1GULA 1XOBA 1Y6EA 2TRCP 2H1DA 3CYNA 3D5JA 2GGTA 2OACA 4POMA 2E0QA 2WS2A 3H79A 3DD3A 2HE3A 1SKRB 1UVZA 5G2ZA 2K18A 5CNWA 2VLVA 3J7Yb 2I1UA 5CAXA 1XWBA 2GSTA 1TOFA 4MF6A 2X64A 2VIMA 3FZ5A 3H1NA 3S9FA 6GSSA 2I3YA 5DAKB 2DLXA 1CQHA 4ZB9A 3TJFA 4L5LA 5LCZA 5DQYA 3DEXA 3ERWA 1GL8A 1WPIA 2OBIA 2VOCA 1U88A 4LL4B 3ZITA 2ALBA 5ECQB 2CV4A 3ZREA 4BPYA 4CHSA 1GUMA 4KA0A 3KMOA 5ECLB 3MNGA 3TJJA 4EDZA 1R4WA 3M9JA 4XIHA 4L0WA 5H5RA 1R5AA 1MEKA 2H70A 1YQ1A 4JR6A 4HU7A 5AISA 3VURA 4NXIA 3ZZXA 4YQMA 4WR5A 1GUHA 2N5BA 3KZQA 2L6CA 1SL2B 5F0GA 2YWOA 2MMOA 4DVCA 4WF4A 1PSQA 2FY6A 3RHBA 2GZPA 2IMDA 2M46A 4K0NA 5ECIB 3PR8A 4GXZA 4DSRA 4HQZA 4V1Ag 5H5SA 3IK9A 3QPMA 2H0GA 2IJYA 3CTFA 4EL1A 2R6KA 3IRAA 3DIEA 1M99A 1GLPA 1NSWA 3CTGA 5HR2A 3ZMKA 2RLIA 1M9BA 5A4UA 4HZ4A 1OKDA 1GSEA 3Q18A 3TRPA 2H8LA 2L4CA 1THOA 4MZCA 1QMVA 1VF1A 5JWQB 4IP1A 1YEPA 2PPTA 1O85A 5FHIA 3EYTA 1OC9B 1EGRA 4RQXA 5IMDA 5B8BA 1EOHA 1JZDA 3L78A 4PQHA 5D93A 4EF0A 4ZIJA 2GZZA 4MABA 1X5DA 4IJ3A 4NV5A 1ST9A 3UVTA 2OA7A 1PD21 2CX4A 3KJYA 3UIWA 5B6NA 5J3RA 3VWVA 2H76A 3EC3A 1LBKA 3H8QA 1FB0A 2PUKC 1NHYA 1Q98A 4RI7A 3LFLA 5CO3A 3O6TA 4G9HA 3IBHA 3HKRA 1SJ6A 1IYIA 3UBKA 1NM3A 2H1AA 2KP2A 1NHOA 2R4VA 1ZOFA 2O87A 1GTAA 3UL3A 3IR4A 5ECKB 2OKAA 1O7UA 2HYXA 5IPHA 3Q74A 4MA9A 3IE3A 4KAEA 1WIKA 2DMLA 3VPTA 1SYRA 1XFLA 1EWXA 1Z6NA 2B5YA 3M1GA 4HQSA 1J08A 4MPFA 2VL2C 2NVLA 16GSA 5AIVA 3A2VA 20GSA 1W89A 2VD1A 1PL2A 3QMXA 22GSA 1DE1A 3D6IA 4KX4A 5HFKA 3TCOA 4Q5FA 4EVMA 3GA4A 1F9MA 1XOAA 1HD2A 5G5FA 1PA3A 4V2NA 4I2TA 2PMTA 1X5CA 2H6YA 4MF5A 2LUSA 1PX7A 1H75A 4I6XA 4HUAA 3QD9A 1EP8A 4V2LA 1Q4JA 4ACSA 3SWLA 5AN1A 5HR0A 1M7TA 4PGTA 1AXDA 3CSHA 4IQAA 5L71A 3KD0A 2O7KA 2A2RA 3GTUA 3EU4A 4HU9A 3U6VA 2HRFA 2H73A 4BVXA 3EU3A 1V40A 3L9UA 3PINA 3UJ1A 3ZFLA 1GSDA 3CSJA 1XZOA 2H6ZA 4CW9A 1G6WA 3RAZA 3LSZA 1SL0B 1K3OA 2L5OA 2CVKA 4TOPA 5KEJA 4QQ7A 3ME8A 2XPEA 2C3TA 3EINA 3IDVA 3TRQA 1K0BA 1V9WA 4NPBA 3F4TA 3FW2A 3GIXA 4MCUA 3ERGA 4KDXA 2GDRA 3LGCA 3DRNA 4X43A 2NTOA 2Z9SA 2IMEA 2NDOA 4X1UA 2PGTA 2L57A 5HFIA 3FZ9A 1YF0A 2YNXA 3TOUA 4ZBAA 1SJIA 2QKEA 3HVVA 2F8FA 4NMUA 1TRWA 5D9TA 1V57A 1YDKA 2FWEA 1F3AA 4Z7XA 3M3MA 4GRFA 2GQLA 4JBBA 1VF2A 3U5RE 1GSUA 4EXJA 1S3CA 4GCIA 4PURA 2VCXA 1SENA 1TW9A 1G0TA 1ACVA 3GKMA 3GKKA 2C0GA 3EURA 4TXVA 1JLWA 3D4MA 3GNJA 1ERTA 5IOWA 1DUGA 2OE0A 5JCGA 1MDKA 1DBYA 2AV4A 4IHUA 2QSIA 1OAZA 4PX1A 4OCFA 4OMVA 1ERWA 2A2SA 5G31A 3RPPA 3F4SA 3HJMA 1ABAA 1E6BA 2X99A 1GH2A 5D9XA 4MJAA 1A2MA 4CDOA 1OKTA 1R7HA 2HT9A 3LYKA 3BBYA 3D4TA 3J7Yk 1M0UA 4K2DA 2XBIA 3LQ7A 2ZNMA 3GX0A 3EE2A 1JLVA 4JEDA 4E8EA 1TRSA 3BCKA 2FA4A 4H86A 2DBCA 4YH2A 4IW9A 3F63A 1A23A 4PQ1A 1QXHA 3VFIA 3WGEA 5ELGA 1Y25A 1M9AA 1FG4A 2L6DA 2A4VA 2AUVA 1SD8A 3APSA 3HJOA 3LXTA 4ZL9A 2FCHA 4RUVA 2H75A 4MLYA 2YZUA 4KH7A 3GTUB 3HHVA 2M80A 4NWYA 1LU4A 1O73A 1HNAA 4KGIA 3ZVJD 2PU9C 4ECBA 1EGOA 5F8BA 2M72A 14GSA 2LJRA 1GUKA 2LV3A 5E59A 2K6VA 2R5GA 2I4AA 2YANA 4JU5A 1FO5A 1EP7A 2WFCA 17GSA 4BVYA 5KN2A 1SU9A 4D73A 3HZ8A 2O8VB 4O7HA 1YY7A 11GSA 1DE2A 1Z3EA 2YV9A 4PUAA 4WEYA 2GS3A 5AGYA 3VI7A 1PMTA 3WYWA 2VD0A 1S3DA 2XHFA 4TR0A 1V58A 1ZL9A 5C00A 4PXOA 1GNWA 4WETA 3US3A 1A24A 3C1SA 2C3QA 2VCVA 3WD6A 2BJXA 1O6JA 5GSSA 1F37A 2R3XA 2G0FA 3LG6A 4LLRA 2DIZA 3C1RA 4GF0A 4MMMA 4G2EA 3MAKA 4KSOA 2C0EA 3HZ4A 1B9XC 1AUCA 5IMCA 2JACA 2C80A 2YP6A 3UVHA 5A4WA 1YJ6A 3I69A 4RQRA 4ECIA 3EVIA 4TR4A 3F6DA 4L8EA 1B8XA 5COHA 3GX8A 1MD4A
chains in the Genus database with same CATH superfamily
5IPGA 2YPMA 3CQFA 1G6YA 1FHEA 3GL3A 1U3AA 2C8UA 1TKDB 4OCEA 1JZRA 4MH3A 2RUFA 2V32A 5J41A 2XC2A 4POBA 1XVWA 3TGZA 4ECJA 1VGLA 1VF3A 2H66A 3FR9A 2ZCTA 1EZKA 1WMJA 2GTUA 3F9UA 3RPNA 1K0MA 2AYTA 1U87A 4MJCA 3P8WA 2CVDA 2N5AA 3L0HA 3TKSA 3LJRA 3GL5A 3I6AA 3KCMA 4OO4A 1A2JA 4MF7A 2REMA 4WKWA 2DC5A 4K6XA 3IV4A 1T3BA 1HNBA 1PQNA 2NBSA 2F9SA 2RUEA 3AY8A 5HQPA 1M2BA 3IHQA 19GSA 1X5EA 2K8SA 1JZWA 4ZB8A 1A8YA 4JR4A 5HR1A 1T4ZA 3I43A 4CY8A 2JZSA 5F06A 2F3MA 4NAXA 1F2EA 1KNGA 2DJKA 4GTUA 2VLTA 4XS1A 4ZILA 1XW5A 4I5QA 3QFAC 5CRWA 3IXRA 4WBJA 1XXUA 2QGVA 4FO5A 3BJ5A 4I97A 4ZBBA 4HDEA 5GAND 1SJZA 4TR3A 1QFNA 3DWVA 4YKFA 2TRXA 3C8EA 4PQIA 3FEUA 3TJGA 5CRGA 3BOAA 1BJXA 2EIRA 2QA1A 4J2FA 4NHZA 3TRXA 1GNEA 5IMFA 5J5NA 5HR3A 2YJ7A 1GSYA 3HY2A 2FNOA 5J9BA 5BRTA 2CVBA 1J9BA 4EDYA 4KB3A 4BVYB 4D73B 3GMFA 3ED3A 1XG8A 3M0FA 2H0IA 3CBUA 2LQQA 1XIYA 3R2QA 3ERFA 4HOJA 1K0NA 2LS5A 1AQVA 2LKUA 3GSSA 3QCPA 2FLSA 3L9VA 4ILFA 3OR5A 4KCAA 1AW9A 4FYBA 5CRHA 10GSA 2YWNA 2PVOC 2FA8A 1UA5A 3LORA 1U3IA 1H4OA 5IOXA 4KNDA 4IS0A 4GQCA 3FR6A 1YKCA 4OD7A 1KEBA 4LA1A 2LJAA 5DJMA 2LNSA 3TDGA 1FVKA 2LSTA 1Z7RA 1Z9HA 1WWJA 2YWIA 2H30A 3UEMA 1PRXA 4ID0A 3W8JA 4HI7A 4K1FA 2HNLA 4XS6A 1TK0B 1BX9A 1BG5A 1M2DA 1FOHA 3JCML 3F0IA 4O32A 1PX6A 3TJKA 4MZWA 1X0RA 2YV7A 3GH6A 5F07A 3QAVA 2PN8A 2HLSA 5CYYA 4F0CA 4JZQA 4Z2RA 1XVQA 1MDIA 2DJ1A 5ECMB 1QQ2A 3GRXA 1MDJA 3LW9A 4BA7A 2QC7A 4ZB6A 4LMWA 18GSA 3IOSA 1TI3A 5GSTA 1SK0A 1B48A 4FYCA 1TK8B 2DMMA 1GRXA 2H71A 3E3EA 4AJ6A 1XWKA 2VCWA 3APOA 3HCZA 1TU8A 2O85A 4ML1A 4N0VA 6GSVA 1EV9A 3A3TA 2AAWA 1SK2A 2HXKA 5DALA 8GSSA 4K7NA 3VPQA 3HYPA 4XHMA 4OWYA 1XBSA 2OE1A 4YAPA 3FRCA 2VCZA 5G1KA 4HJ2A 2B7JA 4WBRD 4AF2A 3TB2A 3APQA 1TK5B 6GSUA 3UOMA 4WF5A 1J0FA 1AIUA 2X8HA 3VK9A 1XWCA 2D2ZA 1W4VA 1FW1A 1N8JA 1B9YC 2WRTA 2B3SA 2IWTA 2C4JA 2FHEA 1FAAA 4AGSA 4IKHA 1JFUA 4IELA 1N2AA 3D21A 1THXA 2DJ3A 2MBSA 2GT5A 3QOUA 4PNFA 4FYUA 2GLRA 3ZYWA 1ON4A 1K3YA 1GTBA 5EY6A 5A5KA 2VL9A 2RIIA 4EE0A 3BD2A 5B7CA 1MD3A 1KTEA 2ON5A 2JSZA 4F9ZA 1DSBA 1PFOA 2YCDA 3TJBA 3H4KA 1BEDA 3WGXA 1ERUA 2YZHA 5DVBA 3HVNA 1EOGA 2I81A 1ML6A 1K3LA 2OADA 1FOVA 3CSIA 2X8GA 3HVSA 2UZ8A 4AJ8A 2KLXA 3EMPA 6GSTA 4ECCA 1X9WB 3KIJA 5BMUA 2OJLA 1ILOA 1FVJA 1Z5YE 2P31A 3A2XA 2V2GA 1SKSB 1U6TA 4POLA 1GTUA 4KW6A 4MJBA 3VI5A 2G2QA 4MZBA 2V6OA 3IAM2 7GSSA 3QR6A 1BYEA 4TKYA 4K8MA 2WB9A 1XW9A 1RK4A 5LNKe 3GSTA 5IMVA 3K8NA 2AHEA 2C1YA 1MTCA 2HZFA 3UBLA 4G19A 4F2IA 2P5RA 2CAIA 3M9KA 4Q5RA 4F0BA 1UC7A 2GT6A 3A5WA 1OE8A 1X9SB 4MPGA 3KEBA 4WR4A 2CT6A 3CRUA 3MSZA 2CQ9A 1NW2A 3DYRA 4DSQA 1GTIA 4IBPA 4LL1B 2VM1A 2C0FA 5D8IA 3IHGA 3RDWA 1I9DA 2WZ9A 1PKWA 3Q19A 1FB6A 2B1KA 1RW1A 4N11A 1WJKA 3D22A 3DVXA 5B6MA 3GN3A 4KUNA 2CZ2A 3F4RA 4L0UA 1ZYPA 2IMKA 5DALB 4KSMA 3TKSC 2CAQA 3FHKA 4A5PA 2LNTA 1AQXA 3N9JA 2IL3A 3HD5A 1XPVA 1GWCA 3V1WA 2FUG2 2DJJA 2AJQB 3BCIA 4OFMA 5ECOB 4TN8A 1V2AA 5ECNB 3ZLPA 2BMXA 3GV1A 4L5OA 4KCEA 1R26A 1AC1A 5ID2A 4K7IA 4BIKA 3NIVA 4PUFC 1TJDA 3H93A 4NV2A 2R2JA 1GSFA 4KF9A 4YKGA 2KOKA 3WT2A 2H1BA 3F8UA 1HYUA 2N5FA 4MP4A 1SD9A 1TU7A 2MYGA 5J4UA 1ZZYA 3FZ4A 1PKZA 3GFKA 3GH9A 1SKWB 3SBCA 1EEJA 1B4PA 5H5QA 3TKRA 2GZYA 4EO3A 3DGQA 4G10A 3L9SA 4PNGA 2B5XA 1GLQA 3IC4A 2V1MA 1SL1B 4XS4A 2A4HA 1WRYA 3KGKA 1K0DA 3NZNA 3ZIJA 2VCTA 3W8SA 1T1VA 2LQOA 2K9FA 4NHWA 5CREA 1PN0A 4MH2A 5IM9A 2LRNA 1YZXA 3G7IA 2HRNA 1QUWA 4V2MA 1TTZA 4G0LA 1AAZA 2MZCA 3FYGA 1S3RA 3GKNA 1S3AA 3D0ZA 1X9MB 4I2UA 1IYHA 4ULXA 3W6GA 2H0HA 4ZBDA 1K0CA 2WDUA 5DJLA 4KDUA 3FR3A 3PH9A 1XCCA 5D9WA 1URMA 1YKAA 4IN0A 1YEXA 4E8HA 3KH7A 2MMAA 1CQGA 1OC3A 2EIQA 2KUCA 1QK8A 3C7MA 2PWJA 4J57E 5IMAA 2GVPA 5KN3A 3QFBC 3FMWA 2IIYA 5ECRB 4GWRA 5DQSA 4BWSA 5F05A 3IPZA 1WE0A 2VLUA 3GUSA 4JRRA 2GSRA 3NOFA 2B1LA 3GHAA 4HEA2 5EL8A 5DCGA 4QL7A 4FH8A 2HSMA 2HRKA 3QAWA 4XRAA 4BL7A 4V1Ap 3UARA 1ZCPA 1TXXA 4WXTA 5G1LA 2H1GA 2LTKA 1OE7A 1HNCA 1V98A 4KDYA 2WULA 1USBA 4KE3A 5FT3A 2B5EA 4EKZA 4ZXGA 3ME7A 2VO4A 3DXBA 1GSQA 1UN2A 5B8AA 1E2YA 2H72A 1VRSD 2RM5A 2IFQA 3O76A 4TW5A 2E2MA 2TIRA 1G7EA 3A5IA 4LMVA 5ID2B 2IMIA 3QAGA 2JU5A 2HZEA 2V6KA 2B7KA 13GSA 1T4YA 2FWGA 2XBQA 1OYJA 3HXSA 4N10A 4GSNA 5D9VA 4BWQA 5JCWA 4G0KA 1YF1A 3I9V2 2DSAA 4I8BA 1JZOA 3EWLA 4HZ2A 3GURA 2OBKA 5IO0A 9GSSA 1HQOA 4IJIA 2ES7A 3ZFBA 4X0XA 2WCIA 3HA9A 5AIXA 5ENUA 5HFGA 2KP1A 2OE3A 3IA1A 5FWGA 2H01A 1ZYEA 5JWRB 4F03A 1EV4A 3TOTA 4XS4B 1RQMA 2FWHA 2VUPA 3IC8A 4TR1A 3ZMLA 1PGTA 2J23A 3CXGA 5ECHB 1ZYNA 2R0PA 5IMZA 5KOWA 2L4QA 3LWAA 3F6FA 4TXOA 4ISDA 2JL4A 3KMNA 4OFNA 3UAPA 2EC4A 1SK1A 4N0ZA 4HS1A 5GZZB 2B6MA 3GKXA 2GSSA 4GSSA 1G7OA 1XWAA 2GSQA 1T7PB 1OC8A 2YOIA 3KP8A 2A2PA 2C3NA 4EIQA 3DMLA 2L59A 2CZ3A 4DSSA 2MMNA 1F3BA 3F3QA 2PERA 3EMXA 1I5GA 2MMZA 1M2AA 3FKFA 4N30A 5INYA 2XPDA 3RBTA 4HJMA 3VLNA 3PGTA 1GSSA 5ECPB 4K9ZA 5ECSA 4O5RA 4O92A 2LEGA 2KHPA 2X8CA 5D73A 1WP0A 3P2AA 5EPFA 1O8WA 4MNNA 4X4JA 2GQMA 2WJUA 5KN1A 4QL9A 2IN3A 4YAVA 6GSXA 2F51A 4K5SA 5D96A 2H6XA 3GYKA 1ERVA 1PN9A 3UMAA 4POKA 3VWXA 3IAS2 2E2GA 1JHBA 6GSYA 4BL7B 3CMIA 1K0AA 3LEFA 2F8AA 1SYXA 3TKQA 3TKSE 3ZVJA 1O81A 2YJHA 3MYDA 4ZL7A 3M8NA 1TDIA 3G9BA 1ZYQB 3CRTA 2J9HA 3P7XA 2BTOT 5IIZA 2CA8A 3LYPA 1LJRA 2HRAA 2VAFA 4P3YB 2IFQB 4MJEA 5CRDA 2C0DA 2YN1A 3ZRDA 3E0UA 3P90A 2PVQA 1C72A 1ZGNA 4K0GA 1T00A 1TRUA 3KM6A 4O5UA 1QGVA 2HZEB 4DEJA 3A2WA 2FWFA 3DVWA 4JE1A 3KTBA 1GP1A 4IVFA 6GSWA 2V41A 1BAYA 1XWGA 4RI6A 2HSYA 2EIOA 3ZIVA 2VL2A 3FZAA 1OVNA 2VM2A 3ZL5A 3KP9A 2DJ0A 3RHCA 5DAKA 4ML6A 4K7OA 2AB6A 4GLTA 1R5PA 1B4QA 1KBNA 3KTLA 4OO5A 4F82A 4AJ7A 3L4NA 5E4WA 2DIYA 2X4AA 3F3RA 2IMFA 3HDCA 2H74A 1AQWA 2H19A 5ELAA 2VCQA 3VWWA 1WOUA 2YWMA 4TR1B 2LJKA 3TKPA 3MWHA 5J9CA 2JADA 2HFDA 4GQFA 4TXOB 5KOXA 1Z6MA 5G5EA 3DKSA 3FK8A 2LRCA 5ABRA 5JWOB 4YQVA 2FD3A 4ZL8A 1A8LA 1EEMA 3KXOA 2FGXA 5JCUA 2IPAA 4EC0A 3Q6OA 4XTSA 1VF4A 4MK3A 5IQYA 3VWUA 2RM6A 2JZRA 4FIWA 4IP6A 4Q5QA 3QDNA 2E7PA 3N5OA 1ZMAA 5GAPD 4DSSB 4TRXA 2L5LA 1F6MC 1TRVA 4Q5NA 3HVXA 3HJPA 4IQ1A 5A4VA 3WT1A 4TVEA 4OFTA 2ON7A 2HI7A 3FY7A 1TI1A 3ISOA 3WGDA 2NPBA 2HSHA 2P0GA 4GSTA 1A0RP 2GQKA 4YQUA 4XRDA 5IO2A 1Z7PA 2JSYA 5CP1A 3MDKA 1TP9A 5G30A 2ZUPA 4MDCA 3C73A 2VL3A 3G7JA 1PL1A 5KN0A 2R37A 1K0OA 5DDLA 3IK7A 4CY6A 4EUYA 3TUEA 2JZTA 2PBJA 1XW6A 5LD0A 3E9JB 1OC9A 1A2LA 2I9HA 3C71A 1O8XA 3O3TA 5DBQA 2WGRA 2CX3A 3ZTLA 1T8EB 5DCHA 12GSA 3LXZA 1BQ7A 2O89A 4J56E 2K8VA 2DJ2A 2MBTA 3G7YA 2LRTA 1A0FA 4XCSA 5C04A 2P5QA 3KH9A 4IGJA 5EVOA 1GULA 1XOBA 1Y6EA 2TRCP 2H1DA 3CYNA 1M3JA 3D5JA 2GGTA 2OACA 4POMA 2E0QA 2WS2A 3H79A 3DD3A 2HE3A 4PTSA 1SKRB 1UVZA 5G2ZA 2K18A 5CNWA 2VLVA 3J7Yb 2I1UA 5CAXA 2DKHA 1XWBA 2GSTA 1TOFA 4MF6A 2X64A 2VIMA 3FZ5A 4Z2UA 3H1NA 3S9FA 6GSSA 2I3YA 5DAKB 2DLXA 1CQHA 4ZB9A 3TJFA 4L5LA 5LCZA 5DQYA 3DEXA 3ERWA 1GL8A 1WPIA 2OBIA 2VOCA 1U88A 4LL4B 3ZITA 2ALBA 3PPUA 5ECQB 2CV4A 3ZREA 4BPYA 4CHSA 1GUMA 4KA0A 3KMOA 5ECLB 3MNGA 3TJJA 4EDZA 1R4WA 3M9JA 4XIHA 4L0WA 5H5RA 2QA2A 1R5AA 1MEKA 2H70A 1YQ1A 4JR6A 4HU7A 5AISA 3VURA 4NXIA 3ZZXA 4YQMA 4WR5A 1GUHA 2N5BA 3KZQA 2L6CA 1SL2B 5F0GA 2YWOA 2MMOA 2R0GA 4DVCA 4WF4A 1PSQA 2FY6A 3RHBA 2GZPA 2IMDA 2M46A 4K0NA 5ECIB 3PR8A 4GXZA 4DSRA 4HQZA 4V1Ag 5H5SA 3IK9A 3QPMA 2H0GA 2IJYA 3CTFA 4EL1A 2R6KA 3IRAA 3DIEA 1M99A 1GLPA 1NSWA 3CTGA 5HR2A 3ZMKA 2RLIA 1M9BA 5A4UA 4HZ4A 1OKDA 1GSEA 3Q18A 3TRPA 2H8LA 2L4CA 1THOA 4MZCA 1QMVA 1VF1A 5JWQB 4IP1A 1YEPA 2PPTA 1O85A 5FHIA 3EYTA 1OC9B 1EGRA 4RQXA 5IMDA 5B8BA 1EOHA 1JZDA 3L78A 4PQHA 5D93A 4EF0A 4ZIJA 2GZZA 4MABA 1X5DA 4IJ3A 4NV5A 1ST9A 3UVTA 2OA7A 1PD21 2CX4A 3KJYA 3UIWA 5B6NA 5J3RA 3VWVA 2H76A 3EC3A 4FQUA 1LBKA 3H8QA 1FB0A 2PUKC 1NHYA 1Q98A 4RI7A 3LFLA 5CO3A 3O6TA 4G9HA 3IBHA 3HKRA 1SJ6A 1IYIA 3UBKA 1NM3A 2H1AA 2KP2A 1NHOA 2R4VA 1ZOFA 2O87A 1GTAA 3UL3A 3IR4A 5ECKB 2OKAA 1O7UA 2HYXA 4USSA 5IPHA 3Q74A 4MA9A 3IE3A 4KAEA 1WIKA 2DMLA 3VPTA 1SYRA 1XFLA 1EWXA 1Z6NA 2B5YA 3M1GA 4HQSA 1J08A 4MPFA 2VL2C 2NVLA 16GSA 5AIVA 3A2VA 20GSA 1W89A 2VD1A 3EPTA 1PL2A 3QMXA 22GSA 1DE1A 3D6IA 4KX4A 5HFKA 3TCOA 4G0IA 4Q5FA 4EVMA 4O5QA 3GA4A 1F9MA 1XOAA 1HD2A 5G5FA 1PA3A 4V2NA 4I2TA 2PMTA 1X5CA 2H6YA 4MF5A 2LUSA 1PX7A 1H75A 4I6XA 4HUAA 3QD9A 1EP8A 4V2LA 1Q4JA 4ACSA 3SWLA 5AN1A 5HR0A 1M7TA 4PGTA 1AXDA 3CSHA 4IQAA 5L71A 3KD0A 2O7KA 2A2RA 3GTUA 2DKIA 3EU4A 4HU9A 3U6VA 2HRFA 4Z2TA 2H73A 4BVXA 3EU3A 1V40A 3L9UA 3PINA 3UJ1A 3ZFLA 1GSDA 3CSJA 1XZOA 2H6ZA 4CW9A 1G6WA 3RAZA 3LSZA 1SL0B 1K3OA 2L5OA 2CVKA 4TOPA 5KEJA 4QQ7A 3ME8A 2XPEA 2C3TA 3EINA 3IDVA 3TRQA 1K0BA 1V9WA 4NPBA 3F4TA 3FW2A 3GIXA 4MCUA 3ERGA 4KDXA 2GDRA 3LGCA 1M3IA 3DRNA 4X43A 2NTOA 2Z9SA 2IMEA 2NDOA 4X1UA 2PGTA 2L57A 4K2XA 3FZ9A 1YF0A 5HFIA 2YNXA 3TOUA 4ZBAA 1SJIA 2QKEA 3HVVA 2F8FA 4NMUA 1TRWA 5D9TA 1V57A 1YDKA 2FWEA 1F3AA 4Z7XA 3M3MA 4GRFA 2GQLA 4JBBA 1VF2A 3U5RE 1GSUA 4EXJA 1S3CA 4GCIA 4PURA 2VCXA 1SENA 1TW9A 1G0TA 1ACVA 3GKMA 3GKKA 2C0GA 3EURA 4TXVA 1JLWA 3D4MA 3GNJA 1ERTA 5IOWA 1DUGA 2X49A 2OE0A 5JCGA 1MDKA 1DBYA 2AV4A 4IHUA 2QSIA 1OAZA 4PX1A 4OCFA 4OMVA 1ERWA 2A2SA 5G31A 3RPPA 3F4SA 3HJMA 1ABAA 1E6BA 2X99A 1GH2A 5D9XA 4MJAA 1A2MA 4CDOA 1OKTA 1R7HA 2HT9A 3LYKA 3BBYA 3D4TA 3J7Yk 1M0UA 4K2DA 2XBIA 3LQ7A 2ZNMA 3GX0A 3EE2A 1JLVA 4JEDA 4E8EA 1TRSA 3BCKA 2FA4A 4H86A 2DBCA 4YH2A 4IW9A 3F63A 1A23A 4PQ1A 1QXHA 3VFIA 3WGEA 5ELGA 1Y25A 1M9AA 1FG4A 2L6DA 2A4VA 2AUVA 1SD8A 3APSA 3HJOA 3LXTA 4ZL9A 2FCHA 4RUVA 2R0CA 2H75A 4MLYA 2YZUA 4KH7A 3GTUB 3HHVA 2M80A 4NWYA 1LU4A 1O73A 1HNAA 4KGIA 3ZVJD 2PU9C 4ECBA 1EGOA 4BVXB 3MIXA 3R3EA 5F8BA 2M72A 14GSA 2LJRA 1GUKA 2LV3A 5E59A 2K6VA 2R5GA 2I4AA 2YANA 4JU5A 1FO5A 1EP7A 2WFCA 17GSA 4BVYA 5KN2A 1SU9A 4D73A 3HZ8A 2O8VB 4O7HA 1YY7A 11GSA 1DE2A 1Z3EA 2YV9A 4PUAA 4WEYA 2GS3A 5AGYA 3VI7A 1PMTA 3WYWA 2VD0A 1S3DA 4EIPA 2XHFA 4TR0A 1V58A 1ZL9A 5C00A 4PXOA 1GNWA 4WETA 3US3A 1A24A 3C1SA 2C3QA 2VCVA 3WD6A 4HSCX 2BJXA 4K5RA 1O6JA 5GSSA 1F37A 2R3XA 2G0FA 3LG6A 4LLRA 2DIZA 3C1RA 4GF0A 4MMMA 4G2EA 3MAKA 4KSOA 2C0EA 3HZ4A 1B9XC 1AUCA 5IMCA 2JACA 2C80A 2YP6A 3UVHA 5A4WA 1YJ6A 3I69A 4RQRA 4ECIA 3EVIA 4TR4A 4ICYA 3F6DA 4L8EA 1B8XA 5COHA 3GX8A 1MD4A
chains in the Genus database with same CATH topology
5IPGA 2YPMA 1G6YA 1FHEA 3GL3A 1U3AA 2C8UA 1TKDB 4OCEA 1JZRA 4MH3A 2RUFA 2V32A 5J41A 2XC2A 4POBA 1XVWA 3TGZA 4ECJA 1VGLA 1VF3A 2H66A 3FR9A 2ZCTA 1EZKA 1WMJA 2GTUA 3F9UA 3RPNA 1K0MA 2AYTA 1U87A 4MJCA 3P8WA 2CVDA 2N5AA 3L0HA 3TKSA 3LJRA 3GL5A 3I6AA 3KCMA 4OO4A 1A2JA 4MF7A 2REMA 4WKWA 2DC5A 4K6XA 3IV4A 1T3BA 1HNBA 1PQNA 2NBSA 2F9SA 2RUEA 3AY8A 5HQPA 1M2BA 3IHQA 19GSA 1X5EA 2K8SA 1JZWA 4ZB8A 1A8YA 4JR4A 5HR1A 1T4ZA 3I43A 4CY8A 2JZSA 5F06A 2F3MA 4NAXA 1F2EA 1KNGA 2DJKA 4GTUA 2VLTA 4XS1A 4ZILA 1XW5A 4I5QA 3QFAC 5CRWA 3IXRA 4WBJA 1XXUA 2QGVA 4FO5A 3BJ5A 4I97A 4ZBBA 4HDEA 5GAND 1SJZA 4TR3A 1QFNA 3DWVA 4YKFA 2TRXA 3C8EA 4PQIA 3FEUA 3TJGA 5CRGA 3BOAA 1BJXA 2EIRA 2QA1A 4J2FA 4NHZA 3TRXA 1GNEA 5IMFA 5J5NA 5HR3A 2YJ7A 1GSYA 3HY2A 2FNOA 5J9BA 5BRTA 2CVBA 1J9BA 4EDYA 4KB3A 4BVYB 4D73B 3GMFA 3ED3A 3M0FA 2H0IA 3CBUA 2LQQA 1XIYA 3R2QA 3ERFA 4HOJA 1K0NA 2LS5A 1AQVA 2LKUA 3GSSA 3QCPA 2FLSA 3L9VA 4ILFA 3OR5A 4KCAA 1AW9A 4FYBA 5CRHA 10GSA 2YWNA 2PVOC 2FA8A 1UA5A 3LORA 1U3IA 1H4OA 5IOXA 4KNDA 4IS0A 4GQCA 3FR6A 1YKCA 4OD7A 1KEBA 4LA1A 2LJAA 5DJMA 2LNSA 3TDGA 1FVKA 2LSTA 1Z7RA 1Z9HA 1WWJA 2YWIA 2H30A 3UEMA 1PRXA 4ID0A 3W8JA 4HI7A 4K1FA 2HNLA 4XS6A 1TK0B 1BX9A 1BG5A 1M2DA 1FOHA 3JCML 3F0IA 4O32A 1PX6A 3TJKA 4MZWA 1X0RA 2YV7A 3GH6A 5F07A 3QAVA 2PN8A 2HLSA 5CYYA 4F0CA 4JZQA 4Z2RA 1XVQA 1MDIA 2DJ1A 5ECMB 1QQ2A 3GRXA 1MDJA 3LW9A 4BA7A 2QC7A 4ZB6A 4LMWA 18GSA 3IOSA 1TI3A 5GSTA 1SK0A 1B48A 4FYCA 1TK8B 2DMMA 1GRXA 2H71A 3E3EA 4AJ6A 1XWKA 2VCWA 3APOA 3HCZA 1TU8A 2O85A 4ML1A 4N0VA 6GSVA 1EV9A 3A3TA 2AAWA 1SK2A 2HXKA 5DALA 8GSSA 4K7NA 3VPQA 3HYPA 4XHMA 4OWYA 1XBSA 2OE1A 4YAPA 3FRCA 2VCZA 5G1KA 4HJ2A 2B7JA 4WBRD 4AF2A 3TB2A 3APQA 1TK5B 6GSUA 3UOMA 4WF5A 1J0FA 1AIUA 2X8HA 3VK9A 1XWCA 2D2ZA 1W4VA 1FW1A 1N8JA 1B9YC 2WRTA 2B3SA 2IWTA 2C4JA 2FHEA 1FAAA 4AGSA 4IKHA 1JFUA 4IELA 1N2AA 3D21A 1THXA 2DJ3A 2MBSA 2GT5A 3QOUA 4PNFA 4FYUA 2GLRA 3ZYWA 1ON4A 1K3YA 1GTBA 5EY6A 5A5KA 2VL9A 2RIIA 4EE0A 3BD2A 5B7CA 1MD3A 1KTEA 2ON5A 2JSZA 4F9ZA 1DSBA 2YCDA 3TJBA 3H4KA 1BEDA 3WGXA 1ERUA 2YZHA 5DVBA 1EOGA 2I81A 1ML6A 1K3LA 2OADA 1FOVA 3CSIA 2X8GA 3HVSA 2UZ8A 4AJ8A 2KLXA 3EMPA 6GSTA 4ECCA 1X9WB 3KIJA 5BMUA 2OJLA 1ILOA 1FVJA 1Z5YE 2P31A 3A2XA 2V2GA 1SKSB 1U6TA 4POLA 1GTUA 4KW6A 4MJBA 3VI5A 2G2QA 4MZBA 2V6OA 3IAM2 7GSSA 3QR6A 1BYEA 4TKYA 4K8MA 2WB9A 1XW9A 1RK4A 5LNKe 3GSTA 5IMVA 3K8NA 2AHEA 2C1YA 1MTCA 2HZFA 3UBLA 4G19A 4F2IA 2P5RA 2CAIA 3M9KA 4Q5RA 4F0BA 1UC7A 2GT6A 3A5WA 1OE8A 1X9SB 4MPGA 3KEBA 4WR4A 2CT6A 3CRUA 3MSZA 2CQ9A 1NW2A 3DYRA 4DSQA 1GTIA 4IBPA 4LL1B 2VM1A 2C0FA 5D8IA 3IHGA 3RDWA 1I9DA 2WZ9A 1PKWA 3Q19A 1FB6A 2B1KA 1RW1A 4N11A 1WJKA 3D22A 3DVXA 5B6MA 3GN3A 4KUNA 2CZ2A 3F4RA 4L0UA 1ZYPA 2IMKA 5DALB 4KSMA 3TKSC 2CAQA 3FHKA 4A5PA 2LNTA 1AQXA 3N9JA 2IL3A 3HD5A 1XPVA 1GWCA 3V1WA 2FUG2 2DJJA 2AJQB 3BCIA 4OFMA 5ECOB 4TN8A 1V2AA 5ECNB 3ZLPA 2BMXA 3GV1A 4L5OA 4KCEA 1R26A 1AC1A 5ID2A 4K7IA 3NIVA 4PUFC 1TJDA 3H93A 4NV2A 2R2JA 1GSFA 4KF9A 4YKGA 2KOKA 3WT2A 2H1BA 3F8UA 1HYUA 2N5FA 4MP4A 1SD9A 1TU7A 2MYGA 5J4UA 1ZZYA 3FZ4A 1PKZA 3GFKA 3GH9A 1SKWB 3SBCA 1EEJA 1B4PA 5H5QA 3TKRA 2GZYA 4EO3A 3DGQA 4G10A 3L9SA 4PNGA 2B5XA 1GLQA 3IC4A 2V1MA 1SL1B 4XS4A 2A4HA 1WRYA 3KGKA 1K0DA 3NZNA 3ZIJA 2VCTA 3W8SA 1T1VA 2LQOA 2K9FA 4NHWA 5CREA 1PN0A 4MH2A 5IM9A 2LRNA 1YZXA 3G7IA 2HRNA 1QUWA 4V2MA 1TTZA 4G0LA 1AAZA 2MZCA 3FYGA 3GKNA 1S3AA 3D0ZA 1X9MB 4I2UA 1IYHA 4ULXA 3W6GA 2H0HA 4ZBDA 1K0CA 2WDUA 5DJLA 4KDUA 3FR3A 3PH9A 1XCCA 5D9WA 1URMA 1YKAA 4IN0A 1YEXA 4E8HA 3KH7A 2MMAA 1CQGA 1OC3A 2EIQA 2KUCA 1QK8A 3C7MA 2PWJA 4J57E 5IMAA 2GVPA 5KN3A 3QFBC 3FMWA 2IIYA 5ECRB 4GWRA 5DQSA 4BWSA 5F05A 3IPZA 1WE0A 2VLUA 3GUSA 4JRRA 2GSRA 3NOFA 2B1LA 3GHAA 4HEA2 5EL8A 5DCGA 4QL7A 4FH8A 2HSMA 2HRKA 3QAWA 4XRAA 4BL7A 4V1Ap 3UARA 1ZCPA 1TXXA 4WXTA 5G1LA 2H1GA 2LTKA 1OE7A 1HNCA 1V98A 4KDYA 2WULA 1USBA 4KE3A 5FT3A 2B5EA 4EKZA 4ZXGA 3ME7A 2VO4A 3DXBA 1GSQA 1UN2A 5B8AA 1E2YA 2H72A 1VRSD 2RM5A 2IFQA 3O76A 4TW5A 2E2MA 2TIRA 1G7EA 3A5IA 4LMVA 5ID2B 2IMIA 3QAGA 2JU5A 2HZEA 2V6KA 2B7KA 13GSA 1T4YA 2FWGA 2XBQA 1OYJA 3HXSA 4N10A 4GSNA 5D9VA 4BWQA 5JCWA 4G0KA 1YF1A 3I9V2 2DSAA 4I8BA 1JZOA 3EWLA 4HZ2A 3GURA 2OBKA 5IO0A 9GSSA 1HQOA 4IJIA 2ES7A 3ZFBA 4X0XA 2WCIA 3HA9A 5AIXA 5ENUA 5HFGA 2KP1A 2OE3A 3IA1A 5FWGA 2H01A 1ZYEA 5JWRB 4F03A 1EV4A 3TOTA 4XS4B 1RQMA 2FWHA 2VUPA 3IC8A 4TR1A 3ZMLA 1PGTA 2J23A 3CXGA 5ECHB 1ZYNA 2R0PA 5IMZA 5KOWA 2L4QA 3LWAA 3F6FA 4TXOA 4ISDA 2JL4A 3KMNA 4OFNA 3UAPA 2EC4A 1SK1A 4N0ZA 4HS1A 5GZZB 2B6MA 3GKXA 2GSSA 4GSSA 1G7OA 1XWAA 2GSQA 1T7PB 1OC8A 2YOIA 3KP8A 2A2PA 2C3NA 4EIQA 3DMLA 2L59A 2CZ3A 4DSSA 2MMNA 1F3BA 3F3QA 2PERA 3EMXA 1I5GA 2MMZA 1M2AA 3FKFA 4N30A 5INYA 2XPDA 3RBTA 4HJMA 3VLNA 3PGTA 1GSSA 5ECPB 4K9ZA 5ECSA 4O5RA 4O92A 2LEGA 2KHPA 2X8CA 5D73A 1WP0A 3P2AA 5EPFA 1O8WA 4MNNA 4X4JA 2GQMA 2WJUA 5KN1A 4QL9A 2IN3A 4YAVA 6GSXA 2F51A 4K5SA 5D96A 2H6XA 3GYKA 1ERVA 1PN9A 3UMAA 4POKA 3VWXA 3IAS2 2E2GA 1JHBA 6GSYA 4BL7B 3CMIA 1K0AA 3LEFA 2F8AA 1SYXA 3TKQA 3TKSE 3ZVJA 1O81A 2YJHA 3MYDA 4ZL7A 3M8NA 1TDIA 3G9BA 1ZYQB 3CRTA 2J9HA 3P7XA 2BTOT 5IIZA 2CA8A 3LYPA 1LJRA 2HRAA 2VAFA 4P3YB 2IFQB 4MJEA 5CRDA 2C0DA 2YN1A 3ZRDA 3E0UA 3P90A 2PVQA 1C72A 1ZGNA 4K0GA 1T00A 1TRUA 3KM6A 4O5UA 1QGVA 2HZEB 4DEJA 3A2WA 2FWFA 3DVWA 4JE1A 3KTBA 1GP1A 4IVFA 6GSWA 2V41A 1BAYA 1XWGA 4RI6A 2HSYA 2EIOA 3ZIVA 2VL2A 3FZAA 1OVNA 2VM2A 3ZL5A 3KP9A 2DJ0A 3RHCA 5DAKA 4ML6A 4K7OA 2AB6A 4GLTA 1R5PA 1B4QA 1KBNA 3KTLA 4OO5A 4F82A 4AJ7A 3L4NA 5E4WA 2DIYA 2X4AA 3F3RA 2IMFA 3HDCA 2H74A 1AQWA 2H19A 5ELAA 2VCQA 3VWWA 1WOUA 2YWMA 4TR1B 2LJKA 3TKPA 3MWHA 5J9CA 2JADA 2HFDA 4GQFA 4TXOB 5KOXA 1Z6MA 5G5EA 3DKSA 3FK8A 2LRCA 5ABRA 5JWOB 4YQVA 2FD3A 4ZL8A 1A8LA 1EEMA 3KXOA 2FGXA 5JCUA 2IPAA 4EC0A 3Q6OA 4XTSA 1VF4A 4MK3A 5IQYA 3VWUA 2RM6A 2JZRA 4FIWA 4IP6A 4Q5QA 3QDNA 2E7PA 3N5OA 1ZMAA 5GAPD 4DSSB 4TRXA 2L5LA 1F6MC 1TRVA 4Q5NA 3HVXA 3HJPA 4IQ1A 5A4VA 3WT1A 4TVEA 4OFTA 2ON7A 2HI7A 3FY7A 1TI1A 3ISOA 3WGDA 2NPBA 2HSHA 2P0GA 4GSTA 1A0RP 2GQKA 4YQUA 4XRDA 5IO2A 1Z7PA 2JSYA 5CP1A 3MDKA 1TP9A 5G30A 2ZUPA 4MDCA 3C73A 2VL3A 3G7JA 1PL1A 5KN0A 2R37A 1K0OA 5DDLA 3IK7A 4CY6A 4EUYA 3TUEA 2JZTA 2PBJA 1XW6A 5LD0A 3E9JB 1OC9A 1A2LA 2I9HA 3C71A 1O8XA 3O3TA 5DBQA 2WGRA 2CX3A 3ZTLA 1T8EB 5DCHA 12GSA 3LXZA 1BQ7A 2O89A 4J56E 2K8VA 2DJ2A 2MBTA 3G7YA 2LRTA 1A0FA 4XCSA 5C04A 2P5QA 3KH9A 4IGJA 5EVOA 1GULA 1XOBA 1Y6EA 2TRCP 2H1DA 3CYNA 3D5JA 2GGTA 2OACA 4POMA 2E0QA 2WS2A 3H79A 3DD3A 2HE3A 4PTSA 1SKRB 1UVZA 5G2ZA 2K18A 5CNWA 2VLVA 3J7Yb 2I1UA 5CAXA 2DKHA 1XWBA 2GSTA 1TOFA 4MF6A 2X64A 2VIMA 3FZ5A 4Z2UA 3H1NA 3S9FA 6GSSA 2I3YA 5DAKB 2DLXA 1CQHA 4ZB9A 3TJFA 4L5LA 5LCZA 5DQYA 3DEXA 3ERWA 1GL8A 1WPIA 2OBIA 2VOCA 1U88A 4LL4B 3ZITA 2ALBA 3PPUA 5ECQB 2CV4A 3ZREA 4BPYA 4CHSA 1GUMA 4KA0A 3KMOA 5ECLB 3MNGA 3TJJA 4EDZA 1R4WA 3M9JA 4XIHA 4L0WA 5H5RA 2QA2A 1R5AA 1MEKA 2H70A 1YQ1A 4JR6A 4HU7A 5AISA 3VURA 4NXIA 3ZZXA 4YQMA 4WR5A 1GUHA 2N5BA 3KZQA 2L6CA 1SL2B 5F0GA 2YWOA 2MMOA 2R0GA 4DVCA 4WF4A 1PSQA 2FY6A 3RHBA 2GZPA 2IMDA 2M46A 4K0NA 5ECIB 3PR8A 4GXZA 4DSRA 4HQZA 4V1Ag 5H5SA 3IK9A 3QPMA 2H0GA 2IJYA 3CTFA 4EL1A 2R6KA 3IRAA 3DIEA 1M99A 1GLPA 1NSWA 3CTGA 5HR2A 3ZMKA 2RLIA 1M9BA 5A4UA 4HZ4A 1OKDA 1GSEA 3Q18A 3TRPA 2H8LA 2L4CA 1THOA 4MZCA 1QMVA 1VF1A 5JWQB 4IP1A 1YEPA 2PPTA 1O85A 5FHIA 3EYTA 1OC9B 1EGRA 4RQXA 5IMDA 5B8BA 1EOHA 1JZDA 3L78A 4PQHA 5D93A 4EF0A 4ZIJA 2GZZA 4MABA 1X5DA 4IJ3A 4NV5A 1ST9A 3UVTA 2OA7A 1PD21 2CX4A 3KJYA 3UIWA 5B6NA 5J3RA 3VWVA 2H76A 3EC3A 4FQUA 1LBKA 3H8QA 1FB0A 2PUKC 1NHYA 1Q98A 4RI7A 3LFLA 5CO3A 3O6TA 4G9HA 3IBHA 3HKRA 1SJ6A 1IYIA 3UBKA 1NM3A 2H1AA 2KP2A 1NHOA 2R4VA 1ZOFA 2O87A 1GTAA 3UL3A 3IR4A 5ECKB 2OKAA 1O7UA 2HYXA 4USSA 5IPHA 3Q74A 4MA9A 3IE3A 4KAEA 1WIKA 2DMLA 3VPTA 1SYRA 1XFLA 1EWXA 1Z6NA 2B5YA 3M1GA 4HQSA 1J08A 4MPFA 2VL2C 2NVLA 16GSA 5AIVA 3A2VA 20GSA 1W89A 2VD1A 3EPTA 1PL2A 3QMXA 22GSA 1DE1A 3D6IA 4KX4A 5HFKA 3TCOA 4G0IA 4Q5FA 4EVMA 4O5QA 3GA4A 1F9MA 1XOAA 1HD2A 5G5FA 1PA3A 4V2NA 4I2TA 2PMTA 1X5CA 2H6YA 4MF5A 2LUSA 1PX7A 1H75A 4I6XA 4HUAA 3QD9A 1EP8A 4V2LA 1Q4JA 4ACSA 3SWLA 5AN1A 5HR0A 1M7TA 4PGTA 1AXDA 3CSHA 4IQAA 5L71A 3KD0A 2O7KA 2A2RA 3GTUA 2DKIA 3EU4A 4HU9A 3U6VA 2HRFA 4Z2TA 2H73A 4BVXA 3EU3A 1V40A 3L9UA 3PINA 3UJ1A 3ZFLA 1GSDA 3CSJA 1XZOA 2H6ZA 4CW9A 1G6WA 3RAZA 3LSZA 1SL0B 1K3OA 2L5OA 2CVKA 4TOPA 5KEJA 4QQ7A 3ME8A 2XPEA 2C3TA 3EINA 3IDVA 3TRQA 1K0BA 1V9WA 4NPBA 3F4TA 3FW2A 3GIXA 4MCUA 3ERGA 4KDXA 2GDRA 3LGCA 3DRNA 4X43A 2NTOA 2Z9SA 2IMEA 2NDOA 4X1UA 2PGTA 2L57A 4K2XA 3FZ9A 1YF0A 5HFIA 2YNXA 3TOUA 4ZBAA 1SJIA 2QKEA 3HVVA 2F8FA 4NMUA 1TRWA 5D9TA 1V57A 1YDKA 2FWEA 1F3AA 4Z7XA 3M3MA 4GRFA 2GQLA 4JBBA 1VF2A 3U5RE 1GSUA 4EXJA 1S3CA 4GCIA 4PURA 2VCXA 1SENA 1TW9A 1G0TA 1ACVA 3GKMA 3GKKA 2C0GA 3EURA 4TXVA 1JLWA 3D4MA 3GNJA 1ERTA 5IOWA 1DUGA 2X49A 2OE0A 5JCGA 1MDKA 1DBYA 2AV4A 4IHUA 2QSIA 1OAZA 4PX1A 4OCFA 4OMVA 1ERWA 2A2SA 5G31A 3RPPA 3F4SA 3HJMA 1ABAA 1E6BA 2X99A 1GH2A 5D9XA 4MJAA 1A2MA 4CDOA 1OKTA 1R7HA 2HT9A 3LYKA 3BBYA 3D4TA 3J7Yk 1M0UA 4K2DA 2XBIA 3LQ7A 2ZNMA 3GX0A 3EE2A 1JLVA 4JEDA 4E8EA 1TRSA 3BCKA 2FA4A 4H86A 2DBCA 4YH2A 4IW9A 3F63A 1A23A 4PQ1A 1QXHA 3VFIA 3WGEA 5ELGA 1Y25A 1M9AA 1FG4A 2L6DA 2A4VA 2AUVA 1SD8A 3APSA 3HJOA 3LXTA 4ZL9A 2FCHA 4RUVA 2R0CA 2H75A 4MLYA 2YZUA 4KH7A 3GTUB 3HHVA 2M80A 4NWYA 1LU4A 1O73A 1HNAA 4KGIA 3ZVJD 2PU9C 4ECBA 1EGOA 4BVXB 3MIXA 3R3EA 5F8BA 2M72A 14GSA 2LJRA 1GUKA 2LV3A 5E59A 2K6VA 2R5GA 2I4AA 2YANA 4JU5A 1FO5A 1EP7A 2WFCA 17GSA 4BVYA 5KN2A 1SU9A 4D73A 3HZ8A 2O8VB 4O7HA 1YY7A 11GSA 1DE2A 1Z3EA 2YV9A 4PUAA 4WEYA 2GS3A 5AGYA 3VI7A 1PMTA 3WYWA 2VD0A 1S3DA 4EIPA 2XHFA 4TR0A 1V58A 1ZL9A 5C00A 4PXOA 1GNWA 4WETA 3US3A 1A24A 3C1SA 2C3QA 2VCVA 3WD6A 2BJXA 4K5RA 1O6JA 5GSSA 1F37A 2R3XA 2G0FA 3LG6A 4LLRA 2DIZA 3C1RA 4GF0A 4MMMA 4G2EA 3MAKA 4KSOA 2C0EA 3HZ4A 1B9XC 1AUCA 5IMCA 2JACA 2C80A 2YP6A 3UVHA 5A4WA 1YJ6A 3I69A 4RQRA 4ECIA 3EVIA 4TR4A 4ICYA 3F6DA 4L8EA 1B8XA 5COHA 3GX8A 1MD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IPG A;  2YPM A;  1G6Y A;  1FHE A;  3GL3 A;  1U3A A;  2C8U A;  1TKD B;  4OCE A;  1JZR A;  4MH3 A;  2RUF A;  2V32 A;  5J41 A;  2XC2 A;  4POB A;  1XVW A;  3TGZ A;  4ECJ A;  1VGL A;  1VF3 A;  2H66 A;  3FR9 A;  2ZCT A;  1EZK A;  1WMJ A;  2GTU A;  3F9U A;  3RPN A;  1K0M A;  2AYT A;  1U87 A;  4MJC A;  3P8W A;  2CVD A;  2N5A A;  3L0H A;  3TKS A;  3LJR A;  3GL5 A;  3I6A A;  3KCM A;  4OO4 A;  1A2J A;  4MF7 A;  2REM A;  4WKW A;  2DC5 A;  4K6X A;  3IV4 A;  1T3B A;  1HNB A;  1PQN A;  2NBS A;  2F9S A;  2RUE A;  3AY8 A;  5HQP A;  1M2B A;  3IHQ A;  19GS A;  1X5E A;  2K8S A;  1JZW A;  4ZB8 A;  1A8Y A;  4JR4 A;  5HR1 A;  1T4Z A;  3I43 A;  2JZS A;  5F06 A;  2F3M A;  4NAX A;  1F2E A;  1KNG A;  2DJK A;  4GTU A;  2VLT A;  4XS1 A;  4ZIL A;  1XW5 A;  4I5Q A;  3QFA C;  5CRW A;  3IXR A;  4WBJ A;  1XXU A;  2QGV A;  4FO5 A;  3BJ5 A;  4I97 A;  4ZBB A;  4HDE A;  5GAN D;  1SJZ A;  4TR3 A;  1QFN A;  3DWV A;  2TRX A;  3C8E A;  4PQI A;  3FEU A;  3TJG A;  5CRG A;  3BOA A;  1BJX A;  2EIR A;  4J2F A;  4NHZ A;  3TRX A;  1GNE A;  5IMF A;  5J5N A;  5HR3 A;  2YJ7 A;  1GSY A;  3HY2 A;  2FNO A;  5J9B A;  2CVB A;  1J9B A;  4EDY A;  4KB3 A;  4D73 B;  3GMF A;  3ED3 A;  3M0F A;  2H0I A;  3CBU A;  2LQQ A;  1XIY A;  3R2Q A;  3ERF A;  4HOJ A;  1K0N A;  2LS5 A;  1AQV A;  2LKU A;  3GSS A;  3QCP A;  2FLS A;  3L9V A;  4ILF A;  3OR5 A;  4KCA A;  1AW9 A;  4FYB A;  5CRH A;  10GS A;  2YWN A;  2PVO C;  2FA8 A;  1UA5 A;  3LOR A;  1U3I A;  1H4O A;  5IOX A;  4KND A;  4IS0 A;  4GQC A;  3FR6 A;  1YKC A;  4OD7 A;  1KEB A;  4LA1 A;  2LJA A;  5DJM A;  2LNS A;  3TDG A;  1FVK A;  2LST A;  1Z7R A;  1Z9H A;  1WWJ A;  2YWI A;  2H30 A;  3UEM A;  1PRX A;  4ID0 A;  3W8J A;  4HI7 A;  4K1F A;  2HNL A;  4XS6 A;  1TK0 B;  1BX9 A;  1BG5 A;  1M2D A;  3JCM L;  3F0I A;  4O32 A;  1PX6 A;  3TJK A;  4MZW A;  1X0R A;  2YV7 A;  3GH6 A;  5F07 A;  3QAV A;  2PN8 A;  2HLS A;  5CYY A;  4F0C A;  4JZQ A;  1XVQ A;  1MDI A;  2DJ1 A;  5ECM B;  1QQ2 A;  3GRX A;  1MDJ A;  4BA7 A;  2QC7 A;  4ZB6 A;  4LMW A;  18GS A;  3IOS A;  1TI3 A;  5GST A;  1SK0 A;  1B48 A;  4FYC A;  1TK8 B;  2DMM A;  1GRX A;  2H71 A;  3E3E A;  4AJ6 A;  1XWK A;  2VCW A;  3APO A;  3HCZ A;  1TU8 A;  2O85 A;  4ML1 A;  4N0V A;  6GSV A;  1EV9 A;  3A3T A;  2AAW A;  1SK2 A;  2HXK A;  5DAL A;  8GSS A;  4K7N A;  3VPQ A;  3HYP A;  4XHM A;  4OWY A;  1XBS A;  2OE1 A;  4YAP A;  3FRC A;  2VCZ A;  5G1K A;  4HJ2 A;  2B7J A;  4WBR D;  4AF2 A;  3TB2 A;  3APQ A;  1TK5 B;  6GSU A;  3UOM A;  4WF5 A;  1J0F A;  1AIU A;  2X8H A;  3VK9 A;  1XWC A;  2D2Z A;  1W4V A;  1FW1 A;  1N8J A;  1B9Y C;  2WRT A;  2B3S A;  2IWT A;  2C4J A;  2FHE A;  1FAA A;  4AGS A;  4IKH A;  1JFU A;  4IEL A;  1N2A A;  3D21 A;  1THX A;  2DJ3 A;  2MBS A;  2GT5 A;  3QOU A;  4PNF A;  4FYU A;  2GLR A;  3ZYW A;  1ON4 A;  1K3Y A;  1GTB A;  5EY6 A;  5A5K A;  2VL9 A;  2RII A;  4EE0 A;  3BD2 A;  5B7C A;  1MD3 A;  1KTE A;  2ON5 A;  2JSZ A;  4F9Z A;  1DSB A;  2YCD A;  3TJB A;  3H4K A;  1BED A;  3WGX A;  1ERU A;  2YZH A;  5DVB A;  1EOG A;  2I81 A;  1ML6 A;  1K3L A;  2OAD A;  1FOV A;  3CSI A;  2X8G A;  3HVS A;  4AJ8 A;  2KLX A;  3EMP A;  6GST A;  4ECC A;  1X9W B;  3KIJ A;  2OJL A;  1ILO A;  1FVJ A;  1Z5Y E;  2P31 A;  3A2X A;  2V2G A;  1SKS B;  1U6T A;  4POL A;  1GTU A;  4KW6 A;  4MJB A;  3VI5 A;  2G2Q A;  4MZB A;  2V6O A;  3IAM 2;  7GSS A;  3QR6 A;  1BYE A;  4TKY A;  4K8M A;  2WB9 A;  1XW9 A;  1RK4 A;  5LNK e;  3GST A;  5IMV A;  3K8N A;  2AHE A;  2C1Y A;  1MTC A;  2HZF A;  3UBL A;  4G19 A;  4F2I A;  2P5R A;  2CAI A;  3M9K A;  4Q5R A;  4F0B A;  1UC7 A;  2GT6 A;  3A5W A;  1OE8 A;  1X9S B;  4MPG A;  3KEB A;  4WR4 A;  2CT6 A;  3CRU A;  3MSZ A;  2CQ9 A;  1NW2 A;  3DYR A;  4DSQ A;  1GTI A;  4IBP A;  4LL1 B;  2VM1 A;  2C0F A;  5D8I A;  3RDW A;  1I9D A;  2WZ9 A;  1PKW A;  3Q19 A;  1FB6 A;  2B1K A;  1RW1 A;  4N11 A;  1WJK A;  3D22 A;  3DVX A;  5B6M A;  3GN3 A;  4KUN A;  2CZ2 A;  3F4R A;  4L0U A;  2IMK A;  5DAL B;  4KSM A;  3TKS C;  2CAQ A;  3FHK A;  2LNT A;  1AQX A;  3N9J A;  2IL3 A;  3HD5 A;  1XPV A;  1GWC A;  3V1W A;  2FUG 2;  2DJJ A;  2AJQ B;  3BCI A;  4OFM A;  5ECO B;  4TN8 A;  1V2A A;  5ECN B;  3ZLP A;  2BMX A;  3GV1 A;  4L5O A;  4KCE A;  1R26 A;  1AC1 A;  5ID2 A;  4K7I A;  3NIV A;  4PUF C;  1TJD A;  3H93 A;  4NV2 A;  2R2J A;  1GSF A;  2KOK A;  3WT2 A;  2H1B A;  3F8U A;  1HYU A;  2N5F A;  4MP4 A;  1SD9 A;  1TU7 A;  2MYG A;  5J4U A;  1ZZY A;  3FZ4 A;  1PKZ A;  3GFK A;  3GH9 A;  1SKW B;  3SBC A;  1EEJ A;  1B4P A;  5H5Q A;  3TKR A;  2GZY A;  4EO3 A;  3DGQ A;  4G10 A;  3L9S A;  4PNG A;  2B5X A;  1GLQ A;  3IC4 A;  2V1M A;  1SL1 B;  4XS4 A;  1WRY A;  3KGK A;  1K0D A;  3NZN A;  3ZIJ A;  2VCT A;  3W8S A;  1T1V A;  2LQO A;  2K9F A;  4NHW A;  5CRE A;  4MH2 A;  5IM9 A;  2LRN A;  1YZX A;  3G7I A;  2HRN A;  1QUW A;  4V2M A;  1TTZ A;  1AAZ A;  2MZC A;  3FYG A;  3GKN A;  1S3A A;  3D0Z A;  1X9M B;  4I2U A;  1IYH A;  4ULX A;  3W6G A;  2H0H A;  4ZBD A;  1K0C A;  2WDU A;  5DJL A;  4KDU A;  3FR3 A;  3PH9 A;  1XCC A;  5D9W A;  1URM A;  1YKA A;  4IN0 A;  1YEX A;  4E8H A;  3KH7 A;  2MMA A;  1CQG A;  1OC3 A;  2EIQ A;  2KUC A;  1QK8 A;  3C7M A;  2PWJ A;  4J57 E;  5IMA A;  2GVP A;  5KN3 A;  3QFB C;  2IIY A;  5ECR B;  4GWR A;  5DQS A;  4BWS A;  5F05 A;  3IPZ A;  1WE0 A;  2VLU A;  3GUS A;  4JRR A;  2GSR A;  3NOF A;  2B1L A;  3GHA A;  4HEA 2;  5EL8 A;  5DCG A;  4QL7 A;  4FH8 A;  3QAW A;  4XRA A;  4BL7 A;  4V1A p;  3UAR A;  1ZCP A;  1TXX A;  4WXT A;  5G1L A;  2H1G A;  2LTK A;  1OE7 A;  1HNC A;  1V98 A;  4KDY A;  2WUL A;  1USB A;  4KE3 A;  5FT3 A;  2B5E A;  4EKZ A;  4ZXG A;  3ME7 A;  2VO4 A;  3DXB A;  1GSQ A;  1UN2 A;  5B8A A;  1E2Y A;  2H72 A;  1VRS D;  2RM5 A;  2IFQ A;  3O76 A;  4TW5 A;  2E2M A;  2TIR A;  1G7E A;  4LMV A;  5ID2 B;  2IMI A;  3QAG A;  2JU5 A;  2HZE A;  2V6K A;  2B7K A;  13GS A;  1T4Y A;  2FWG A;  2XBQ A;  1OYJ A;  3HXS A;  4N10 A;  4GSN A;  5D9V A;  4BWQ A;  5JCW A;  1YF1 A;  3I9V 2;  2DSA A;  4I8B A;  1JZO A;  3EWL A;  4HZ2 A;  3GUR A;  2OBK A;  5IO0 A;  9GSS A;  1HQO A;  4IJI A;  2ES7 A;  3ZFB A;  4X0X A;  2WCI A;  3HA9 A;  5AIX A;  5ENU A;  5HFG A;  2KP1 A;  2OE3 A;  3IA1 A;  5FWG A;  2H01 A;  1ZYE A;  5JWR B;  4F03 A;  1EV4 A;  3TOT A;  4XS4 B;  1RQM A;  2FWH A;  2VUP A;  4TR1 A;  3ZML A;  1PGT A;  2J23 A;  3CXG A;  5ECH B;  5IMZ A;  2L4Q A;  3LWA A;  3F6F A;  4TXO A;  4ISD A;  2JL4 A;  3KMN A;  4OFN A;  3UAP A;  2EC4 A;  1SK1 A;  4N0Z A;  4HS1 A;  5GZZ B;  2B6M A;  3GKX A;  2GSS A;  4GSS A;  1G7O A;  1XWA A;  2GSQ A;  1T7P B;  1OC8 A;  2YOI A;  3KP8 A;  2C3N A;  3DML A;  2L59 A;  2CZ3 A;  4DSS A;  2MMN A;  1F3B A;  3F3Q A;  2PER A;  3EMX A;  1I5G A;  2MMZ A;  1M2A A;  3FKF A;  4N30 A;  5INY A;  2XPD A;  3RBT A;  4HJM A;  3VLN A;  3PGT A;  1GSS A;  5ECP B;  4K9Z A;  5ECS A;  4O5R A;  4O92 A;  2LEG A;  2KHP A;  2X8C A;  5D73 A;  1WP0 A;  3P2A A;  5EPF A;  1O8W A;  2GQM A;  2WJU A;  5KN1 A;  4QL9 A;  2IN3 A;  4YAV A;  6GSX A;  2F51 A;  5D96 A;  2H6X A;  3GYK A;  1ERV A;  1PN9 A;  3UMA A;  4POK A;  3VWX A;  3IAS 2;  2E2G A;  1JHB A;  6GSY A;  3CMI A;  1K0A A;  3LEF A;  2F8A A;  1SYX A;  3TKQ A;  3TKS E;  3ZVJ A;  1O81 A;  2YJH A;  4ZL7 A;  3M8N A;  1TDI A;  3G9B A;  1ZYQ B;  3CRT A;  2J9H A;  3P7X A;  2BTO T;  5IIZ A;  2CA8 A;  3LYP A;  1LJR A;  2VAF A;  4P3Y B;  2IFQ B;  4MJE A;  5CRD A;  2C0D A;  2YN1 A;  3ZRD A;  3E0U A;  3P90 A;  2PVQ A;  1C72 A;  1ZGN A;  4K0G A;  1T00 A;  1TRU A;  3KM6 A;  1QGV A;  2HZE B;  4DEJ A;  3A2W A;  2FWF A;  3DVW A;  4JE1 A;  3KTB A;  1GP1 A;  4IVF A;  6GSW A;  2V41 A;  1BAY A;  1XWG A;  4RI6 A;  2HSY A;  2EIO A;  3ZIV A;  2VL2 A;  3FZA A;  1OVN A;  2VM2 A;  3ZL5 A;  3KP9 A;  2DJ0 A;  3RHC A;  5DAK A;  4ML6 A;  4K7O A;  2AB6 A;  4GLT A;  1R5P A;  1B4Q A;  1KBN A;  3KTL A;  4OO5 A;  4F82 A;  4AJ7 A;  3L4N A;  5E4W A;  2DIY A;  3F3R A;  2IMF A;  3HDC A;  2H74 A;  1AQW A;  2H19 A;  5ELA A;  2VCQ A;  3VWW A;  1WOU A;  2YWM A;  4TR1 B;  2LJK A;  3TKP A;  3MWH A;  5J9C A;  2JAD A;  2HFD A;  4GQF A;  4TXO B;  1Z6M A;  5G5E A;  3DKS A;  3FK8 A;  2LRC A;  5ABR A;  5JWO B;  4YQV A;  2FD3 A;  4ZL8 A;  1A8L A;  1EEM A;  3KXO A;  2FGX A;  5JCU A;  2IPA A;  4EC0 A;  3Q6O A;  4XTS A;  1VF4 A;  4MK3 A;  5IQY A;  3VWU A;  2RM6 A;  2JZR A;  4FIW A;  4IP6 A;  4Q5Q A;  3QDN A;  2E7P A;  3N5O A;  1ZMA A;  5GAP D;  4DSS B;  4TRX A;  2L5L A;  1F6M C;  1TRV A;  4Q5N A;  3HVX A;  3HJP A;  4IQ1 A;  5A4V A;  3WT1 A;  4TVE A;  4OFT A;  2ON7 A;  2HI7 A;  3FY7 A;  1TI1 A;  3ISO A;  3WGD A;  2NPB A;  2HSH A;  2P0G A;  4GST A;  1A0R P;  2GQK A;  4YQU A;  4XRD A;  5IO2 A;  1Z7P A;  2JSY A;  5CP1 A;  3MDK A;  1TP9 A;  5G30 A;  2ZUP A;  4MDC A;  3C73 A;  2VL3 A;  3G7J A;  1PL1 A;  5KN0 A;  2R37 A;  1K0O A;  5DDL A;  3IK7 A;  4EUY A;  3TUE A;  2JZT A;  2PBJ A;  1XW6 A;  5LD0 A;  3E9J B;  1OC9 A;  1A2L A;  2I9H A;  3C71 A;  1O8X A;  3O3T A;  5DBQ A;  2WGR A;  2CX3 A;  3ZTL A;  1T8E B;  5DCH A;  12GS A;  3LXZ A;  1BQ7 A;  2O89 A;  4J56 E;  2K8V A;  2DJ2 A;  2MBT A;  3G7Y A;  2LRT A;  1A0F A;  4XCS A;  5C04 A;  2P5Q A;  3KH9 A;  4IGJ A;  5EVO A;  1GUL A;  1XOB A;  1Y6E A;  2TRC P;  2H1D A;  3CYN A;  3D5J A;  2GGT A;  2OAC A;  4POM A;  2E0Q A;  2WS2 A;  3H79 A;  3DD3 A;  2HE3 A;  1SKR B;  1UVZ A;  5G2Z A;  2K18 A;  5CNW A;  2VLV A;  3J7Y b;  2I1U A;  5CAX A;  1XWB A;  2GST A;  1TOF A;  4MF6 A;  2X64 A;  2VIM A;  3FZ5 A;  3H1N A;  3S9F A;  6GSS A;  2I3Y A;  5DAK B;  2DLX A;  1CQH A;  4ZB9 A;  3TJF A;  4L5L A;  5LCZ A;  5DQY A;  3DEX A;  3ERW A;  1GL8 A;  1WPI A;  2OBI A;  2VOC A;  1U88 A;  4LL4 B;  3ZIT A;  2ALB A;  5ECQ B;  2CV4 A;  3ZRE A;  4BPY A;  4CHS A;  1GUM A;  4KA0 A;  3KMO A;  5ECL B;  3MNG A;  3TJJ A;  4EDZ A;  1R4W A;  3M9J A;  4XIH A;  4L0W A;  5H5R A;  1R5A A;  1MEK A;  2H70 A;  1YQ1 A;  4JR6 A;  4HU7 A;  5AIS A;  3VUR A;  4NXI A;  3ZZX A;  4YQM A;  4WR5 A;  1GUH A;  2N5B A;  3KZQ A;  2L6C A;  1SL2 B;  5F0G A;  2YWO A;  2MMO A;  4DVC A;  4WF4 A;  1PSQ A;  2FY6 A;  3RHB A;  2GZP A;  2IMD A;  2M46 A;  4K0N A;  5ECI B;  3PR8 A;  4GXZ A;  4DSR A;  4HQZ A;  4V1A g;  5H5S A;  3IK9 A;  3QPM A;  2H0G A;  2IJY A;  3CTF A;  4EL1 A;  2R6K A;  3IRA A;  3DIE A;  1M99 A;  1GLP A;  1NSW A;  3CTG A;  5HR2 A;  3ZMK A;  2RLI A;  1M9B A;  5A4U A;  4HZ4 A;  1OKD A;  1GSE A;  3Q18 A;  3TRP A;  2H8L A;  2L4C A;  1THO A;  4MZC A;  1QMV A;  1VF1 A;  5JWQ B;  4IP1 A;  1YEP A;  2PPT A;  1O85 A;  5FHI A;  3EYT A;  1OC9 B;  1EGR A;  4RQX A;  5IMD A;  5B8B A;  1EOH A;  1JZD A;  3L78 A;  4PQH A;  5D93 A;  4EF0 A;  4ZIJ A;  2GZZ A;  4MAB A;  1X5D A;  4IJ3 A;  4NV5 A;  1ST9 A;  3UVT A;  2OA7 A;  1PD2 1;  2CX4 A;  3KJY A;  3UIW A;  5B6N A;  5J3R A;  3VWV A;  2H76 A;  3EC3 A;  1LBK A;  3H8Q A;  1FB0 A;  2PUK C;  1NHY A;  1Q98 A;  4RI7 A;  3LFL A;  5CO3 A;  3O6T A;  4G9H A;  3IBH A;  3HKR A;  1SJ6 A;  1IYI A;  3UBK A;  1NM3 A;  2H1A A;  2KP2 A;  1NHO A;  2R4V A;  1ZOF A;  2O87 A;  1GTA A;  3UL3 A;  3IR4 A;  5ECK B;  2OKA A;  1O7U A;  2HYX A;  5IPH A;  3Q74 A;  4MA9 A;  3IE3 A;  4KAE A;  1WIK A;  2DML A;  3VPT A;  1SYR A;  1XFL A;  1EWX A;  1Z6N A;  2B5Y A;  3M1G A;  4HQS A;  1J08 A;  4MPF A;  2VL2 C;  2NVL A;  16GS A;  5AIV A;  3A2V A;  20GS A;  1W89 A;  2VD1 A;  1PL2 A;  3QMX A;  22GS A;  1DE1 A;  3D6I A;  4KX4 A;  5HFK A;  3TCO A;  4Q5F A;  4EVM A;  3GA4 A;  1F9M A;  1XOA A;  1HD2 A;  5G5F A;  1PA3 A;  4V2N A;  4I2T A;  2PMT A;  1X5C A;  2H6Y A;  4MF5 A;  2LUS A;  1PX7 A;  1H75 A;  4I6X A;  4HUA A;  3QD9 A;  1EP8 A;  4V2L A;  1Q4J A;  4ACS A;  3SWL A;  5AN1 A;  5HR0 A;  1M7T A;  4PGT A;  1AXD A;  3CSH A;  4IQA A;  5L71 A;  3KD0 A;  2O7K A;  2A2R A;  3GTU A;  3EU4 A;  4HU9 A;  3U6V A;  2HRF A;  2H73 A;  4BVX A;  3EU3 A;  1V40 A;  3L9U A;  3PIN A;  3UJ1 A;  3ZFL A;  1GSD A;  3CSJ A;  1XZO A;  2H6Z A;  4CW9 A;  1G6W A;  3RAZ A;  3LSZ A;  1SL0 B;  1K3O A;  2L5O A;  2CVK A;  4TOP A;  5KEJ A;  4QQ7 A;  3ME8 A;  2XPE A;  2C3T A;  3EIN A;  3IDV A;  3TRQ A;  1K0B A;  1V9W A;  4NPB A;  3F4T A;  3FW2 A;  3GIX A;  4MCU A;  3ERG A;  4KDX A;  2GDR A;  3LGC A;  3DRN A;  4X43 A;  2NTO A;  2Z9S A;  2IME A;  2NDO A;  4X1U A;  2PGT A;  2L57 A;  5HFI A;  3FZ9 A;  1YF0 A;  2YNX A;  3TOU A;  4ZBA A;  1SJI A;  2QKE A;  3HVV A;  2F8F A;  4NMU A;  1TRW A;  5D9T A;  1V57 A;  1YDK A;  2FWE A;  1F3A A;  4Z7X A;  3M3M A;  4GRF A;  2GQL A;  4JBB A;  1VF2 A;  3U5R E;  1GSU A;  4EXJ A;  1S3C A;  4GCI A;  4PUR A;  2VCX A;  1SEN A;  1TW9 A;  1G0T A;  1ACV A;  3GKM A;  3GKK A;  2C0G A;  3EUR A;  4TXV A;  1JLW A;  3D4M A;  3GNJ A;  1ERT A;  5IOW A;  1DUG A;  2OE0 A;  5JCG A;  1MDK A;  1DBY A;  2AV4 A;  4IHU A;  2QSI A;  1OAZ A;  4PX1 A;  4OCF A;  4OMV A;  1ERW A;  2A2S A;  5G31 A;  3RPP A;  3F4S A;  3HJM A;  1ABA A;  1E6B A;  2X99 A;  1GH2 A;  5D9X A;  4MJA A;  1A2M A;  4CDO A;  1OKT A;  1R7H A;  2HT9 A;  3LYK A;  3BBY A;  3D4T A;  3J7Y k;  1M0U A;  4K2D A;  2XBI A;  3LQ7 A;  2ZNM A;  3GX0 A;  3EE2 A;  1JLV A;  4JED A;  4E8E A;  1TRS A;  3BCK A;  2FA4 A;  4H86 A;  2DBC A;  4YH2 A;  4IW9 A;  3F63 A;  1A23 A;  4PQ1 A;  1QXH A;  3VFI A;  3WGE A;  5ELG A;  1Y25 A;  1M9A A;  1FG4 A;  2L6D A;  2A4V A;  2AUV A;  1SD8 A;  3APS A;  3HJO A;  3LXT A;  4ZL9 A;  2FCH A;  4RUV A;  2H75 A;  4MLY A;  2YZU A;  4KH7 A;  3GTU B;  3HHV A;  2M80 A;  4NWY A;  1LU4 A;  1O73 A;  1HNA A;  4KGI A;  3ZVJ D;  2PU9 C;  4ECB A;  1EGO A;  5F8B A;  2M72 A;  14GS A;  2LJR A;  1GUK A;  2LV3 A;  5E59 A;  2K6V A;  2R5G A;  2I4A A;  2YAN A;  4JU5 A;  1FO5 A;  1EP7 A;  2WFC A;  17GS A;  4BVY A;  5KN2 A;  1SU9 A;  4D73 A;  3HZ8 A;  2O8V B;  4O7H A;  1YY7 A;  11GS A;  1DE2 A;  1Z3E A;  2YV9 A;  4PUA A;  4WEY A;  2GS3 A;  5AGY A;  3VI7 A;  1PMT A;  3WYW A;  2VD0 A;  1S3D A;  2XHF A;  4TR0 A;  1V58 A;  1ZL9 A;  5C00 A;  4PXO A;  1GNW A;  4WET A;  3US3 A;  1A24 A;  3C1S A;  2C3Q A;  2VCV A;  3WD6 A;  2BJX A;  1O6J A;  5GSS A;  1F37 A;  2R3X A;  2G0F A;  3LG6 A;  4LLR A;  2DIZ A;  3C1R A;  4GF0 A;  4MMM A;  4G2E A;  3MAK A;  4KSO A;  2C0E A;  3HZ4 A;  1B9X C;  1AUC A;  5IMC A;  2JAC A;  2C80 A;  2YP6 A;  3UVH A;  5A4W A;  1YJ6 A;  3I69 A;  4RQR A;  4ECI A;  3EVI A;  4TR4 A;  3F6D A;  4L8E A;  1B8X A;  5COH A;  3GX8 A;  1MD4 A; 
#chains in the Genus database with same CATH topology
 5IPG A;  2YPM A;  3CQF A;  1G6Y A;  1FHE A;  3GL3 A;  1U3A A;  2C8U A;  1TKD B;  4OCE A;  1JZR A;  4MH3 A;  2RUF A;  2V32 A;  5J41 A;  2XC2 A;  4POB A;  1XVW A;  3TGZ A;  4ECJ A;  1VGL A;  1VF3 A;  2H66 A;  3FR9 A;  2ZCT A;  1EZK A;  1WMJ A;  2GTU A;  3F9U A;  3RPN A;  1K0M A;  2AYT A;  1U87 A;  4MJC A;  3P8W A;  2CVD A;  2N5A A;  3L0H A;  3TKS A;  3LJR A;  3GL5 A;  3I6A A;  3KCM A;  4OO4 A;  1A2J A;  4MF7 A;  2REM A;  4WKW A;  2DC5 A;  4K6X A;  3IV4 A;  1T3B A;  1HNB A;  1PQN A;  2NBS A;  2F9S A;  2RUE A;  3AY8 A;  5HQP A;  1M2B A;  3IHQ A;  19GS A;  1X5E A;  2K8S A;  1JZW A;  4ZB8 A;  1A8Y A;  4JR4 A;  5HR1 A;  1T4Z A;  3I43 A;  4CY8 A;  2JZS A;  5F06 A;  2F3M A;  4NAX A;  1F2E A;  1KNG A;  2DJK A;  4GTU A;  2VLT A;  4XS1 A;  4ZIL A;  1XW5 A;  4I5Q A;  3QFA C;  5CRW A;  3IXR A;  4WBJ A;  1XXU A;  2QGV A;  4FO5 A;  3BJ5 A;  4I97 A;  4ZBB A;  4HDE A;  5GAN D;  1SJZ A;  4TR3 A;  1QFN A;  3DWV A;  4YKF A;  2TRX A;  3C8E A;  4PQI A;  3FEU A;  3TJG A;  5CRG A;  3BOA A;  1BJX A;  2EIR A;  2QA1 A;  4J2F A;  4NHZ A;  3TRX A;  1GNE A;  5IMF A;  5J5N A;  5HR3 A;  2YJ7 A;  1GSY A;  3HY2 A;  2FNO A;  5J9B A;  5BRT A;  2CVB A;  1J9B A;  4EDY A;  4KB3 A;  4BVY B;  4D73 B;  3GMF A;  3ED3 A;  1XG8 A;  3M0F A;  2H0I A;  3CBU A;  2LQQ A;  1XIY A;  3R2Q A;  3ERF A;  4HOJ A;  1K0N A;  2LS5 A;  1AQV A;  2LKU A;  3GSS A;  3QCP A;  2FLS A;  3L9V A;  4ILF A;  3OR5 A;  4KCA A;  1AW9 A;  4FYB A;  5CRH A;  10GS A;  2YWN A;  2PVO C;  2FA8 A;  1UA5 A;  3LOR A;  1U3I A;  1H4O A;  5IOX A;  4KND A;  4IS0 A;  4GQC A;  3FR6 A;  1YKC A;  4OD7 A;  1KEB A;  4LA1 A;  2LJA A;  5DJM A;  2LNS A;  3TDG A;  1FVK A;  2LST A;  1Z7R A;  1Z9H A;  1WWJ A;  2YWI A;  2H30 A;  3UEM A;  1PRX A;  4ID0 A;  3W8J A;  4HI7 A;  4K1F A;  2HNL A;  4XS6 A;  1TK0 B;  1BX9 A;  1BG5 A;  1M2D A;  1FOH A;  3JCM L;  3F0I A;  4O32 A;  1PX6 A;  3TJK A;  4MZW A;  1X0R A;  2YV7 A;  3GH6 A;  5F07 A;  3QAV A;  2PN8 A;  2HLS A;  5CYY A;  4F0C A;  4JZQ A;  4Z2R A;  1XVQ A;  1MDI A;  2DJ1 A;  5ECM B;  1QQ2 A;  3GRX A;  1MDJ A;  3LW9 A;  4BA7 A;  2QC7 A;  4ZB6 A;  4LMW A;  18GS A;  3IOS A;  1TI3 A;  5GST A;  1SK0 A;  1B48 A;  4FYC A;  1TK8 B;  2DMM A;  1GRX A;  2H71 A;  3E3E A;  4AJ6 A;  1XWK A;  2VCW A;  3APO A;  3HCZ A;  1TU8 A;  2O85 A;  4ML1 A;  4N0V A;  6GSV A;  1EV9 A;  3A3T A;  2AAW A;  1SK2 A;  2HXK A;  5DAL A;  8GSS A;  4K7N A;  3VPQ A;  3HYP A;  4XHM A;  4OWY A;  1XBS A;  2OE1 A;  4YAP A;  3FRC A;  2VCZ A;  5G1K A;  4HJ2 A;  2B7J A;  4WBR D;  4AF2 A;  3TB2 A;  3APQ A;  1TK5 B;  6GSU A;  3UOM A;  4WF5 A;  1J0F A;  1AIU A;  2X8H A;  3VK9 A;  1XWC A;  2D2Z A;  1W4V A;  1FW1 A;  1N8J A;  1B9Y C;  2WRT A;  2B3S A;  2IWT A;  2C4J A;  2FHE A;  1FAA A;  4AGS A;  4IKH A;  1JFU A;  4IEL A;  1N2A A;  3D21 A;  1THX A;  2DJ3 A;  2MBS A;  2GT5 A;  3QOU A;  4PNF A;  4FYU A;  2GLR A;  3ZYW A;  1ON4 A;  1K3Y A;  1GTB A;  5EY6 A;  5A5K A;  2VL9 A;  2RII A;  4EE0 A;  3BD2 A;  5B7C A;  1MD3 A;  1KTE A;  2ON5 A;  2JSZ A;  4F9Z A;  1DSB A;  1PFO A;  2YCD A;  3TJB A;  3H4K A;  1BED A;  3WGX A;  1ERU A;  2YZH A;  5DVB A;  3HVN A;  1EOG A;  2I81 A;  1ML6 A;  1K3L A;  2OAD A;  1FOV A;  3CSI A;  2X8G A;  3HVS A;  2UZ8 A;  4AJ8 A;  2KLX A;  3EMP A;  6GST A;  4ECC A;  1X9W B;  3KIJ A;  5BMU A;  2OJL A;  1ILO A;  1FVJ A;  1Z5Y E;  2P31 A;  3A2X A;  2V2G A;  1SKS B;  1U6T A;  4POL A;  1GTU A;  4KW6 A;  4MJB A;  3VI5 A;  2G2Q A;  4MZB A;  2V6O A;  3IAM 2;  7GSS A;  3QR6 A;  1BYE A;  4TKY A;  4K8M A;  2WB9 A;  1XW9 A;  1RK4 A;  5LNK e;  3GST A;  5IMV A;  3K8N A;  2AHE A;  2C1Y A;  1MTC A;  2HZF A;  3UBL A;  4G19 A;  4F2I A;  2P5R A;  2CAI A;  3M9K A;  4Q5R A;  4F0B A;  1UC7 A;  2GT6 A;  3A5W A;  1OE8 A;  1X9S B;  4MPG A;  3KEB A;  4WR4 A;  2CT6 A;  3CRU A;  3MSZ A;  2CQ9 A;  1NW2 A;  3DYR A;  4DSQ A;  1GTI A;  4IBP A;  4LL1 B;  2VM1 A;  2C0F A;  5D8I A;  3IHG A;  3RDW A;  1I9D A;  2WZ9 A;  1PKW A;  3Q19 A;  1FB6 A;  2B1K A;  1RW1 A;  4N11 A;  1WJK A;  3D22 A;  3DVX A;  5B6M A;  3GN3 A;  4KUN A;  2CZ2 A;  3F4R A;  4L0U A;  1ZYP A;  2IMK A;  5DAL B;  4KSM A;  3TKS C;  2CAQ A;  3FHK A;  4A5P A;  2LNT A;  1AQX A;  3N9J A;  2IL3 A;  3HD5 A;  1XPV A;  1GWC A;  3V1W A;  2FUG 2;  2DJJ A;  2AJQ B;  3BCI A;  4OFM A;  5ECO B;  4TN8 A;  1V2A A;  5ECN B;  3ZLP A;  2BMX A;  3GV1 A;  4L5O A;  4KCE A;  1R26 A;  1AC1 A;  5ID2 A;  4K7I A;  4BIK A;  3NIV A;  4PUF C;  1TJD A;  3H93 A;  4NV2 A;  2R2J A;  1GSF A;  4KF9 A;  4YKG A;  2KOK A;  3WT2 A;  2H1B A;  3F8U A;  1HYU A;  2N5F A;  4MP4 A;  1SD9 A;  1TU7 A;  2MYG A;  5J4U A;  1ZZY A;  3FZ4 A;  1PKZ A;  3GFK A;  3GH9 A;  1SKW B;  3SBC A;  1EEJ A;  1B4P A;  5H5Q A;  3TKR A;  2GZY A;  4EO3 A;  3DGQ A;  4G10 A;  3L9S A;  4PNG A;  2B5X A;  1GLQ A;  3IC4 A;  2V1M A;  1SL1 B;  4XS4 A;  2A4H A;  1WRY A;  3KGK A;  1K0D A;  3NZN A;  3ZIJ A;  2VCT A;  3W8S A;  1T1V A;  2LQO A;  2K9F A;  4NHW A;  5CRE A;  1PN0 A;  4MH2 A;  5IM9 A;  2LRN A;  1YZX A;  3G7I A;  2HRN A;  1QUW A;  4V2M A;  1TTZ A;  4G0L A;  1AAZ A;  2MZC A;  3FYG A;  1S3R A;  3GKN A;  1S3A A;  3D0Z A;  1X9M B;  4I2U A;  1IYH A;  4ULX A;  3W6G A;  2H0H A;  4ZBD A;  1K0C A;  2WDU A;  5DJL A;  4KDU A;  3FR3 A;  3PH9 A;  1XCC A;  5D9W A;  1URM A;  1YKA A;  4IN0 A;  1YEX A;  4E8H A;  3KH7 A;  2MMA A;  1CQG A;  1OC3 A;  2EIQ A;  2KUC A;  1QK8 A;  3C7M A;  2PWJ A;  4J57 E;  5IMA A;  2GVP A;  5KN3 A;  3QFB C;  3FMW A;  2IIY A;  5ECR B;  4GWR A;  5DQS A;  4BWS A;  5F05 A;  3IPZ A;  1WE0 A;  2VLU A;  3GUS A;  4JRR A;  2GSR A;  3NOF A;  2B1L A;  3GHA A;  4HEA 2;  5EL8 A;  5DCG A;  4QL7 A;  4FH8 A;  2HSM A;  2HRK A;  3QAW A;  4XRA A;  4BL7 A;  4V1A p;  3UAR A;  1ZCP A;  1TXX A;  4WXT A;  5G1L A;  2H1G A;  2LTK A;  1OE7 A;  1HNC A;  1V98 A;  4KDY A;  2WUL A;  1USB A;  4KE3 A;  5FT3 A;  2B5E A;  4EKZ A;  4ZXG A;  3ME7 A;  2VO4 A;  3DXB A;  1GSQ A;  1UN2 A;  5B8A A;  1E2Y A;  2H72 A;  1VRS D;  2RM5 A;  2IFQ A;  3O76 A;  4TW5 A;  2E2M A;  2TIR A;  1G7E A;  3A5I A;  4LMV A;  5ID2 B;  2IMI A;  3QAG A;  2JU5 A;  2HZE A;  2V6K A;  2B7K A;  13GS A;  1T4Y A;  2FWG A;  2XBQ A;  1OYJ A;  3HXS A;  4N10 A;  4GSN A;  5D9V A;  4BWQ A;  5JCW A;  4G0K A;  1YF1 A;  3I9V 2;  2DSA A;  4I8B A;  1JZO A;  3EWL A;  4HZ2 A;  3GUR A;  2OBK A;  5IO0 A;  9GSS A;  1HQO A;  4IJI A;  2ES7 A;  3ZFB A;  4X0X A;  2WCI A;  3HA9 A;  5AIX A;  5ENU A;  5HFG A;  2KP1 A;  2OE3 A;  3IA1 A;  5FWG A;  2H01 A;  1ZYE A;  5JWR B;  4F03 A;  1EV4 A;  3TOT A;  4XS4 B;  1RQM A;  2FWH A;  2VUP A;  3IC8 A;  4TR1 A;  3ZML A;  1PGT A;  2J23 A;  3CXG A;  5ECH B;  1ZYN A;  2R0P A;  5IMZ A;  5KOW A;  2L4Q A;  3LWA A;  3F6F A;  4TXO A;  4ISD A;  2JL4 A;  3KMN A;  4OFN A;  3UAP A;  2EC4 A;  1SK1 A;  4N0Z A;  4HS1 A;  5GZZ B;  2B6M A;  3GKX A;  2GSS A;  4GSS A;  1G7O A;  1XWA A;  2GSQ A;  1T7P B;  1OC8 A;  2YOI A;  3KP8 A;  2A2P A;  2C3N A;  4EIQ A;  3DML A;  2L59 A;  2CZ3 A;  4DSS A;  2MMN A;  1F3B A;  3F3Q A;  2PER A;  3EMX A;  1I5G A;  2MMZ A;  1M2A A;  3FKF A;  4N30 A;  5INY A;  2XPD A;  3RBT A;  4HJM A;  3VLN A;  3PGT A;  1GSS A;  5ECP B;  4K9Z A;  5ECS A;  4O5R A;  4O92 A;  2LEG A;  2KHP A;  2X8C A;  5D73 A;  1WP0 A;  3P2A A;  5EPF A;  1O8W A;  4MNN A;  4X4J A;  2GQM A;  2WJU A;  5KN1 A;  4QL9 A;  2IN3 A;  4YAV A;  6GSX A;  2F51 A;  4K5S A;  5D96 A;  2H6X A;  3GYK A;  1ERV A;  1PN9 A;  3UMA A;  4POK A;  3VWX A;  3IAS 2;  2E2G A;  1JHB A;  6GSY A;  4BL7 B;  3CMI A;  1K0A A;  3LEF A;  2F8A A;  1SYX A;  3TKQ A;  3TKS E;  3ZVJ A;  1O81 A;  2YJH A;  3MYD A;  4ZL7 A;  3M8N A;  1TDI A;  3G9B A;  1ZYQ B;  3CRT A;  2J9H A;  3P7X A;  2BTO T;  5IIZ A;  2CA8 A;  3LYP A;  1LJR A;  2HRA A;  2VAF A;  4P3Y B;  2IFQ B;  4MJE A;  5CRD A;  2C0D A;  2YN1 A;  3ZRD A;  3E0U A;  3P90 A;  2PVQ A;  1C72 A;  1ZGN A;  4K0G A;  1T00 A;  1TRU A;  3KM6 A;  4O5U A;  1QGV A;  2HZE B;  4DEJ A;  3A2W A;  2FWF A;  3DVW A;  4JE1 A;  3KTB A;  1GP1 A;  4IVF A;  6GSW A;  2V41 A;  1BAY A;  1XWG A;  4RI6 A;  2HSY A;  2EIO A;  3ZIV A;  2VL2 A;  3FZA A;  1OVN A;  2VM2 A;  3ZL5 A;  3KP9 A;  2DJ0 A;  3RHC A;  5DAK A;  4ML6 A;  4K7O A;  2AB6 A;  4GLT A;  1R5P A;  1B4Q A;  1KBN A;  3KTL A;  4OO5 A;  4F82 A;  4AJ7 A;  3L4N A;  5E4W A;  2DIY A;  2X4A A;  3F3R A;  2IMF A;  3HDC A;  2H74 A;  1AQW A;  2H19 A;  5ELA A;  2VCQ A;  3VWW A;  1WOU A;  2YWM A;  4TR1 B;  2LJK A;  3TKP A;  3MWH A;  5J9C A;  2JAD A;  2HFD A;  4GQF A;  4TXO B;  5KOX A;  1Z6M A;  5G5E A;  3DKS A;  3FK8 A;  2LRC A;  5ABR A;  5JWO B;  4YQV A;  2FD3 A;  4ZL8 A;  1A8L A;  1EEM A;  3KXO A;  2FGX A;  5JCU A;  2IPA A;  4EC0 A;  3Q6O A;  4XTS A;  1VF4 A;  4MK3 A;  5IQY A;  3VWU A;  2RM6 A;  2JZR A;  4FIW A;  4IP6 A;  4Q5Q A;  3QDN A;  2E7P A;  3N5O A;  1ZMA A;  5GAP D;  4DSS B;  4TRX A;  2L5L A;  1F6M C;  1TRV A;  4Q5N A;  3HVX A;  3HJP A;  4IQ1 A;  5A4V A;  3WT1 A;  4TVE A;  4OFT A;  2ON7 A;  2HI7 A;  3FY7 A;  1TI1 A;  3ISO A;  3WGD A;  2NPB A;  2HSH A;  2P0G A;  4GST A;  1A0R P;  2GQK A;  4YQU A;  4XRD A;  5IO2 A;  1Z7P A;  2JSY A;  5CP1 A;  3MDK A;  1TP9 A;  5G30 A;  2ZUP A;  4MDC A;  3C73 A;  2VL3 A;  3G7J A;  1PL1 A;  5KN0 A;  2R37 A;  1K0O A;  5DDL A;  3IK7 A;  4CY6 A;  4EUY A;  3TUE A;  2JZT A;  2PBJ A;  1XW6 A;  5LD0 A;  3E9J B;  1OC9 A;  1A2L A;  2I9H A;  3C71 A;  1O8X A;  3O3T A;  5DBQ A;  2WGR A;  2CX3 A;  3ZTL A;  1T8E B;  5DCH A;  12GS A;  3LXZ A;  1BQ7 A;  2O89 A;  4J56 E;  2K8V A;  2DJ2 A;  2MBT A;  3G7Y A;  2LRT A;  1A0F A;  4XCS A;  5C04 A;  2P5Q A;  3KH9 A;  4IGJ A;  5EVO A;  1GUL A;  1XOB A;  1Y6E A;  2TRC P;  2H1D A;  3CYN A;  1M3J A;  3D5J A;  2GGT A;  2OAC A;  4POM A;  2E0Q A;  2WS2 A;  3H79 A;  3DD3 A;  2HE3 A;  4PTS A;  1SKR B;  1UVZ A;  5G2Z A;  2K18 A;  5CNW A;  2VLV A;  3J7Y b;  2I1U A;  5CAX A;  2DKH A;  1XWB A;  2GST A;  1TOF A;  4MF6 A;  2X64 A;  2VIM A;  3FZ5 A;  4Z2U A;  3H1N A;  3S9F A;  6GSS A;  2I3Y A;  5DAK B;  2DLX A;  1CQH A;  4ZB9 A;  3TJF A;  4L5L A;  5LCZ A;  5DQY A;  3DEX A;  3ERW A;  1GL8 A;  1WPI A;  2OBI A;  2VOC A;  1U88 A;  4LL4 B;  3ZIT A;  2ALB A;  3PPU A;  5ECQ B;  2CV4 A;  3ZRE A;  4BPY A;  4CHS A;  1GUM A;  4KA0 A;  3KMO A;  5ECL B;  3MNG A;  3TJJ A;  4EDZ A;  1R4W A;  3M9J A;  4XIH A;  4L0W A;  5H5R A;  2QA2 A;  1R5A A;  1MEK A;  2H70 A;  1YQ1 A;  4JR6 A;  4HU7 A;  5AIS A;  3VUR A;  4NXI A;  3ZZX A;  4YQM A;  4WR5 A;  1GUH A;  2N5B A;  3KZQ A;  2L6C A;  1SL2 B;  5F0G A;  2YWO A;  2MMO A;  2R0G A;  4DVC A;  4WF4 A;  1PSQ A;  2FY6 A;  3RHB A;  2GZP A;  2IMD A;  2M46 A;  4K0N A;  5ECI B;  3PR8 A;  4GXZ A;  4DSR A;  4HQZ A;  4V1A g;  5H5S A;  3IK9 A;  3QPM A;  2H0G A;  2IJY A;  3CTF A;  4EL1 A;  2R6K A;  3IRA A;  3DIE A;  1M99 A;  1GLP A;  1NSW A;  3CTG A;  5HR2 A;  3ZMK A;  2RLI A;  1M9B A;  5A4U A;  4HZ4 A;  1OKD A;  1GSE A;  3Q18 A;  3TRP A;  2H8L A;  2L4C A;  1THO A;  4MZC A;  1QMV A;  1VF1 A;  5JWQ B;  4IP1 A;  1YEP A;  2PPT A;  1O85 A;  5FHI A;  3EYT A;  1OC9 B;  1EGR A;  4RQX A;  5IMD A;  5B8B A;  1EOH A;  1JZD A;  3L78 A;  4PQH A;  5D93 A;  4EF0 A;  4ZIJ A;  2GZZ A;  4MAB A;  1X5D A;  4IJ3 A;  4NV5 A;  1ST9 A;  3UVT A;  2OA7 A;  1PD2 1;  2CX4 A;  3KJY A;  3UIW A;  5B6N A;  5J3R A;  3VWV A;  2H76 A;  3EC3 A;  4FQU A;  1LBK A;  3H8Q A;  1FB0 A;  2PUK C;  1NHY A;  1Q98 A;  4RI7 A;  3LFL A;  5CO3 A;  3O6T A;  4G9H A;  3IBH A;  3HKR A;  1SJ6 A;  1IYI A;  3UBK A;  1NM3 A;  2H1A A;  2KP2 A;  1NHO A;  2R4V A;  1ZOF A;  2O87 A;  1GTA A;  3UL3 A;  3IR4 A;  5ECK B;  2OKA A;  1O7U A;  2HYX A;  4USS A;  5IPH A;  3Q74 A;  4MA9 A;  3IE3 A;  4KAE A;  1WIK A;  2DML A;  3VPT A;  1SYR A;  1XFL A;  1EWX A;  1Z6N A;  2B5Y A;  3M1G A;  4HQS A;  1J08 A;  4MPF A;  2VL2 C;  2NVL A;  16GS A;  5AIV A;  3A2V A;  20GS A;  1W89 A;  2VD1 A;  3EPT A;  1PL2 A;  3QMX A;  22GS A;  1DE1 A;  3D6I A;  4KX4 A;  5HFK A;  3TCO A;  4G0I A;  4Q5F A;  4EVM A;  4O5Q A;  3GA4 A;  1F9M A;  1XOA A;  1HD2 A;  5G5F A;  1PA3 A;  4V2N A;  4I2T A;  2PMT A;  1X5C A;  2H6Y A;  4MF5 A;  2LUS A;  1PX7 A;  1H75 A;  4I6X A;  4HUA A;  3QD9 A;  1EP8 A;  4V2L A;  1Q4J A;  4ACS A;  3SWL A;  5AN1 A;  5HR0 A;  1M7T A;  4PGT A;  1AXD A;  3CSH A;  4IQA A;  5L71 A;  3KD0 A;  2O7K A;  2A2R A;  3GTU A;  2DKI A;  3EU4 A;  4HU9 A;  3U6V A;  2HRF A;  4Z2T A;  2H73 A;  4BVX A;  3EU3 A;  1V40 A;  3L9U A;  3PIN A;  3UJ1 A;  3ZFL A;  1GSD A;  3CSJ A;  1XZO A;  2H6Z A;  4CW9 A;  1G6W A;  3RAZ A;  3LSZ A;  1SL0 B;  1K3O A;  2L5O A;  2CVK A;  4TOP A;  5KEJ A;  4QQ7 A;  3ME8 A;  2XPE A;  2C3T A;  3EIN A;  3IDV A;  3TRQ A;  1K0B A;  1V9W A;  4NPB A;  3F4T A;  3FW2 A;  3GIX A;  4MCU A;  3ERG A;  4KDX A;  2GDR A;  3LGC A;  1M3I A;  3DRN A;  4X43 A;  2NTO A;  2Z9S A;  2IME A;  2NDO A;  4X1U A;  2PGT A;  2L57 A;  4K2X A;  3FZ9 A;  1YF0 A;  5HFI A;  2YNX A;  3TOU A;  4ZBA A;  1SJI A;  2QKE A;  3HVV A;  2F8F A;  4NMU A;  1TRW A;  5D9T A;  1V57 A;  1YDK A;  2FWE A;  1F3A A;  4Z7X A;  3M3M A;  4GRF A;  2GQL A;  4JBB A;  1VF2 A;  3U5R E;  1GSU A;  4EXJ A;  1S3C A;  4GCI A;  4PUR A;  2VCX A;  1SEN A;  1TW9 A;  1G0T A;  1ACV A;  3GKM A;  3GKK A;  2C0G A;  3EUR A;  4TXV A;  1JLW A;  3D4M A;  3GNJ A;  1ERT A;  5IOW A;  1DUG A;  2X49 A;  2OE0 A;  5JCG A;  1MDK A;  1DBY A;  2AV4 A;  4IHU A;  2QSI A;  1OAZ A;  4PX1 A;  4OCF A;  4OMV A;  1ERW A;  2A2S A;  5G31 A;  3RPP A;  3F4S A;  3HJM A;  1ABA A;  1E6B A;  2X99 A;  1GH2 A;  5D9X A;  4MJA A;  1A2M A;  4CDO A;  1OKT A;  1R7H A;  2HT9 A;  3LYK A;  3BBY A;  3D4T A;  3J7Y k;  1M0U A;  4K2D A;  2XBI A;  3LQ7 A;  2ZNM A;  3GX0 A;  3EE2 A;  1JLV A;  4JED A;  4E8E A;  1TRS A;  3BCK A;  2FA4 A;  4H86 A;  2DBC A;  4YH2 A;  4IW9 A;  3F63 A;  1A23 A;  4PQ1 A;  1QXH A;  3VFI A;  3WGE A;  5ELG A;  1Y25 A;  1M9A A;  1FG4 A;  2L6D A;  2A4V A;  2AUV A;  1SD8 A;  3APS A;  3HJO A;  3LXT A;  4ZL9 A;  2FCH A;  4RUV A;  2R0C A;  2H75 A;  4MLY A;  2YZU A;  4KH7 A;  3GTU B;  3HHV A;  2M80 A;  4NWY A;  1LU4 A;  1O73 A;  1HNA A;  4KGI A;  3ZVJ D;  2PU9 C;  4ECB A;  1EGO A;  4BVX B;  3MIX A;  3R3E A;  5F8B A;  2M72 A;  14GS A;  2LJR A;  1GUK A;  2LV3 A;  5E59 A;  2K6V A;  2R5G A;  2I4A A;  2YAN A;  4JU5 A;  1FO5 A;  1EP7 A;  2WFC A;  17GS A;  4BVY A;  5KN2 A;  1SU9 A;  4D73 A;  3HZ8 A;  2O8V B;  4O7H A;  1YY7 A;  11GS A;  1DE2 A;  1Z3E A;  2YV9 A;  4PUA A;  4WEY A;  2GS3 A;  5AGY A;  3VI7 A;  1PMT A;  3WYW A;  2VD0 A;  1S3D A;  4EIP A;  2XHF A;  4TR0 A;  1V58 A;  1ZL9 A;  5C00 A;  4PXO A;  1GNW A;  4WET A;  3US3 A;  1A24 A;  3C1S A;  2C3Q A;  2VCV A;  3WD6 A;  4HSC X;  2BJX A;  4K5R A;  1O6J A;  5GSS A;  1F37 A;  2R3X A;  2G0F A;  3LG6 A;  4LLR A;  2DIZ A;  3C1R A;  4GF0 A;  4MMM A;  4G2E A;  3MAK A;  4KSO A;  2C0E A;  3HZ4 A;  1B9X C;  1AUC A;  5IMC A;  2JAC A;  2C80 A;  2YP6 A;  3UVH A;  5A4W A;  1YJ6 A;  3I69 A;  4RQR A;  4ECI A;  3EVI A;  4TR4 A;  4ICY A;  3F6D A;  4L8E A;  1B8X A;  5COH A;  3GX8 A;  1MD4 A; 
#chains in the Genus database with same CATH homology
 5IPG A;  2YPM A;  1G6Y A;  1FHE A;  3GL3 A;  1U3A A;  2C8U A;  1TKD B;  4OCE A;  1JZR A;  4MH3 A;  2RUF A;  2V32 A;  5J41 A;  2XC2 A;  4POB A;  1XVW A;  3TGZ A;  4ECJ A;  1VGL A;  1VF3 A;  2H66 A;  3FR9 A;  2ZCT A;  1EZK A;  1WMJ A;  2GTU A;  3F9U A;  3RPN A;  1K0M A;  2AYT A;  1U87 A;  4MJC A;  3P8W A;  2CVD A;  2N5A A;  3L0H A;  3TKS A;  3LJR A;  3GL5 A;  3I6A A;  3KCM A;  4OO4 A;  1A2J A;  4MF7 A;  2REM A;  4WKW A;  2DC5 A;  4K6X A;  3IV4 A;  1T3B A;  1HNB A;  1PQN A;  2NBS A;  2F9S A;  2RUE A;  3AY8 A;  5HQP A;  1M2B A;  3IHQ A;  19GS A;  1X5E A;  2K8S A;  1JZW A;  4ZB8 A;  1A8Y A;  4JR4 A;  5HR1 A;  1T4Z A;  3I43 A;  4CY8 A;  2JZS A;  5F06 A;  2F3M A;  4NAX A;  1F2E A;  1KNG A;  2DJK A;  4GTU A;  2VLT A;  4XS1 A;  4ZIL A;  1XW5 A;  4I5Q A;  3QFA C;  5CRW A;  3IXR A;  4WBJ A;  1XXU A;  2QGV A;  4FO5 A;  3BJ5 A;  4I97 A;  4ZBB A;  4HDE A;  5GAN D;  1SJZ A;  4TR3 A;  1QFN A;  3DWV A;  4YKF A;  2TRX A;  3C8E A;  4PQI A;  3FEU A;  3TJG A;  5CRG A;  3BOA A;  1BJX A;  2EIR A;  2QA1 A;  4J2F A;  4NHZ A;  3TRX A;  1GNE A;  5IMF A;  5J5N A;  5HR3 A;  2YJ7 A;  1GSY A;  3HY2 A;  2FNO A;  5J9B A;  5BRT A;  2CVB A;  1J9B A;  4EDY A;  4KB3 A;  4BVY B;  4D73 B;  3GMF A;  3ED3 A;  3M0F A;  2H0I A;  3CBU A;  2LQQ A;  1XIY A;  3R2Q A;  3ERF A;  4HOJ A;  1K0N A;  2LS5 A;  1AQV A;  2LKU A;  3GSS A;  3QCP A;  2FLS A;  3L9V A;  4ILF A;  3OR5 A;  4KCA A;  1AW9 A;  4FYB A;  5CRH A;  10GS A;  2YWN A;  2PVO C;  2FA8 A;  1UA5 A;  3LOR A;  1U3I A;  1H4O A;  5IOX A;  4KND A;  4IS0 A;  4GQC A;  3FR6 A;  1YKC A;  4OD7 A;  1KEB A;  4LA1 A;  2LJA A;  5DJM A;  2LNS A;  3TDG A;  1FVK A;  2LST A;  1Z7R A;  1Z9H A;  1WWJ A;  2YWI A;  2H30 A;  3UEM A;  1PRX A;  4ID0 A;  3W8J A;  4HI7 A;  4K1F A;  2HNL A;  4XS6 A;  1TK0 B;  1BX9 A;  1BG5 A;  1M2D A;  1FOH A;  3JCM L;  3F0I A;  4O32 A;  1PX6 A;  3TJK A;  4MZW A;  1X0R A;  2YV7 A;  3GH6 A;  5F07 A;  3QAV A;  2PN8 A;  2HLS A;  5CYY A;  4F0C A;  4JZQ A;  4Z2R A;  1XVQ A;  1MDI A;  2DJ1 A;  5ECM B;  1QQ2 A;  3GRX A;  1MDJ A;  3LW9 A;  4BA7 A;  2QC7 A;  4ZB6 A;  4LMW A;  18GS A;  3IOS A;  1TI3 A;  5GST A;  1SK0 A;  1B48 A;  4FYC A;  1TK8 B;  2DMM A;  1GRX A;  2H71 A;  3E3E A;  4AJ6 A;  1XWK A;  2VCW A;  3APO A;  3HCZ A;  1TU8 A;  2O85 A;  4ML1 A;  4N0V A;  6GSV A;  1EV9 A;  3A3T A;  2AAW A;  1SK2 A;  2HXK A;  5DAL A;  8GSS A;  4K7N A;  3VPQ A;  3HYP A;  4XHM A;  4OWY A;  1XBS A;  2OE1 A;  4YAP A;  3FRC A;  2VCZ A;  5G1K A;  4HJ2 A;  2B7J A;  4WBR D;  4AF2 A;  3TB2 A;  3APQ A;  1TK5 B;  6GSU A;  3UOM A;  4WF5 A;  1J0F A;  1AIU A;  2X8H A;  3VK9 A;  1XWC A;  2D2Z A;  1W4V A;  1FW1 A;  1N8J A;  1B9Y C;  2WRT A;  2B3S A;  2IWT A;  2C4J A;  2FHE A;  1FAA A;  4AGS A;  4IKH A;  1JFU A;  4IEL A;  1N2A A;  3D21 A;  1THX A;  2DJ3 A;  2MBS A;  2GT5 A;  3QOU A;  4PNF A;  4FYU A;  2GLR A;  3ZYW A;  1ON4 A;  1K3Y A;  1GTB A;  5EY6 A;  5A5K A;  2VL9 A;  2RII A;  4EE0 A;  3BD2 A;  5B7C A;  1MD3 A;  1KTE A;  2ON5 A;  2JSZ A;  4F9Z A;  1DSB A;  2YCD A;  3TJB A;  3H4K A;  1BED A;  3WGX A;  1ERU A;  2YZH A;  5DVB A;  1EOG A;  2I81 A;  1ML6 A;  1K3L A;  2OAD A;  1FOV A;  3CSI A;  2X8G A;  3HVS A;  2UZ8 A;  4AJ8 A;  2KLX A;  3EMP A;  6GST A;  4ECC A;  1X9W B;  3KIJ A;  5BMU A;  2OJL A;  1ILO A;  1FVJ A;  1Z5Y E;  2P31 A;  3A2X A;  2V2G A;  1SKS B;  1U6T A;  4POL A;  1GTU A;  4KW6 A;  4MJB A;  3VI5 A;  2G2Q A;  4MZB A;  2V6O A;  3IAM 2;  7GSS A;  3QR6 A;  1BYE A;  4TKY A;  4K8M A;  2WB9 A;  1XW9 A;  1RK4 A;  5LNK e;  3GST A;  5IMV A;  3K8N A;  2AHE A;  2C1Y A;  1MTC A;  2HZF A;  3UBL A;  4G19 A;  4F2I A;  2P5R A;  2CAI A;  3M9K A;  4Q5R A;  4F0B A;  1UC7 A;  2GT6 A;  3A5W A;  1OE8 A;  1X9S B;  4MPG A;  3KEB A;  4WR4 A;  2CT6 A;  3CRU A;  3MSZ A;  2CQ9 A;  1NW2 A;  3DYR A;  4DSQ A;  1GTI A;  4IBP A;  4LL1 B;  2VM1 A;  2C0F A;  5D8I A;  3IHG A;  3RDW A;  1I9D A;  2WZ9 A;  1PKW A;  3Q19 A;  1FB6 A;  2B1K A;  1RW1 A;  4N11 A;  1WJK A;  3D22 A;  3DVX A;  5B6M A;  3GN3 A;  4KUN A;  2CZ2 A;  3F4R A;  4L0U A;  1ZYP A;  2IMK A;  5DAL B;  4KSM A;  3TKS C;  2CAQ A;  3FHK A;  4A5P A;  2LNT A;  1AQX A;  3N9J A;  2IL3 A;  3HD5 A;  1XPV A;  1GWC A;  3V1W A;  2FUG 2;  2DJJ A;  2AJQ B;  3BCI A;  4OFM A;  5ECO B;  4TN8 A;  1V2A A;  5ECN B;  3ZLP A;  2BMX A;  3GV1 A;  4L5O A;  4KCE A;  1R26 A;  1AC1 A;  5ID2 A;  4K7I A;  3NIV A;  4PUF C;  1TJD A;  3H93 A;  4NV2 A;  2R2J A;  1GSF A;  4KF9 A;  4YKG A;  2KOK A;  3WT2 A;  2H1B A;  3F8U A;  1HYU A;  2N5F A;  4MP4 A;  1SD9 A;  1TU7 A;  2MYG A;  5J4U A;  1ZZY A;  3FZ4 A;  1PKZ A;  3GFK A;  3GH9 A;  1SKW B;  3SBC A;  1EEJ A;  1B4P A;  5H5Q A;  3TKR A;  2GZY A;  4EO3 A;  3DGQ A;  4G10 A;  3L9S A;  4PNG A;  2B5X A;  1GLQ A;  3IC4 A;  2V1M A;  1SL1 B;  4XS4 A;  2A4H A;  1WRY A;  3KGK A;  1K0D A;  3NZN A;  3ZIJ A;  2VCT A;  3W8S A;  1T1V A;  2LQO A;  2K9F A;  4NHW A;  5CRE A;  1PN0 A;  4MH2 A;  5IM9 A;  2LRN A;  1YZX A;  3G7I A;  2HRN A;  1QUW A;  4V2M A;  1TTZ A;  4G0L A;  1AAZ A;  2MZC A;  3FYG A;  3GKN A;  1S3A A;  3D0Z A;  1X9M B;  4I2U A;  1IYH A;  4ULX A;  3W6G A;  2H0H A;  4ZBD A;  1K0C A;  2WDU A;  5DJL A;  4KDU A;  3FR3 A;  3PH9 A;  1XCC A;  5D9W A;  1URM A;  1YKA A;  4IN0 A;  1YEX A;  4E8H A;  3KH7 A;  2MMA A;  1CQG A;  1OC3 A;  2EIQ A;  2KUC A;  1QK8 A;  3C7M A;  2PWJ A;  4J57 E;  5IMA A;  2GVP A;  5KN3 A;  3QFB C;  3FMW A;  2IIY A;  5ECR B;  4GWR A;  5DQS A;  4BWS A;  5F05 A;  3IPZ A;  1WE0 A;  2VLU A;  3GUS A;  4JRR A;  2GSR A;  3NOF A;  2B1L A;  3GHA A;  4HEA 2;  5EL8 A;  5DCG A;  4QL7 A;  4FH8 A;  2HSM A;  2HRK A;  3QAW A;  4XRA A;  4BL7 A;  4V1A p;  3UAR A;  1ZCP A;  1TXX A;  4WXT A;  5G1L A;  2H1G A;  2LTK A;  1OE7 A;  1HNC A;  1V98 A;  4KDY A;  2WUL A;  1USB A;  4KE3 A;  5FT3 A;  2B5E A;  4EKZ A;  4ZXG A;  3ME7 A;  2VO4 A;  3DXB A;  1GSQ A;  1UN2 A;  5B8A A;  1E2Y A;  2H72 A;  1VRS D;  2RM5 A;  2IFQ A;  3O76 A;  4TW5 A;  2E2M A;  2TIR A;  1G7E A;  3A5I A;  4LMV A;  5ID2 B;  2IMI A;  3QAG A;  2JU5 A;  2HZE A;  2V6K A;  2B7K A;  13GS A;  1T4Y A;  2FWG A;  2XBQ A;  1OYJ A;  3HXS A;  4N10 A;  4GSN A;  5D9V A;  4BWQ A;  5JCW A;  4G0K A;  1YF1 A;  3I9V 2;  2DSA A;  4I8B A;  1JZO A;  3EWL A;  4HZ2 A;  3GUR A;  2OBK A;  5IO0 A;  9GSS A;  1HQO A;  4IJI A;  2ES7 A;  3ZFB A;  4X0X A;  2WCI A;  3HA9 A;  5AIX A;  5ENU A;  5HFG A;  2KP1 A;  2OE3 A;  3IA1 A;  5FWG A;  2H01 A;  1ZYE A;  5JWR B;  4F03 A;  1EV4 A;  3TOT A;  4XS4 B;  1RQM A;  2FWH A;  2VUP A;  3IC8 A;  4TR1 A;  3ZML A;  1PGT A;  2J23 A;  3CXG A;  5ECH B;  1ZYN A;  2R0P A;  5IMZ A;  5KOW A;  2L4Q A;  3LWA A;  3F6F A;  4TXO A;  4ISD A;  2JL4 A;  3KMN A;  4OFN A;  3UAP A;  2EC4 A;  1SK1 A;  4N0Z A;  4HS1 A;  5GZZ B;  2B6M A;  3GKX A;  2GSS A;  4GSS A;  1G7O A;  1XWA A;  2GSQ A;  1T7P B;  1OC8 A;  2YOI A;  3KP8 A;  2A2P A;  2C3N A;  4EIQ A;  3DML A;  2L59 A;  2CZ3 A;  4DSS A;  2MMN A;  1F3B A;  3F3Q A;  2PER A;  3EMX A;  1I5G A;  2MMZ A;  1M2A A;  3FKF A;  4N30 A;  5INY A;  2XPD A;  3RBT A;  4HJM A;  3VLN A;  3PGT A;  1GSS A;  5ECP B;  4K9Z A;  5ECS A;  4O5R A;  4O92 A;  2LEG A;  2KHP A;  2X8C A;  5D73 A;  1WP0 A;  3P2A A;  5EPF A;  1O8W A;  4MNN A;  4X4J A;  2GQM A;  2WJU A;  5KN1 A;  4QL9 A;  2IN3 A;  4YAV A;  6GSX A;  2F51 A;  4K5S A;  5D96 A;  2H6X A;  3GYK A;  1ERV A;  1PN9 A;  3UMA A;  4POK A;  3VWX A;  3IAS 2;  2E2G A;  1JHB A;  6GSY A;  4BL7 B;  3CMI A;  1K0A A;  3LEF A;  2F8A A;  1SYX A;  3TKQ A;  3TKS E;  3ZVJ A;  1O81 A;  2YJH A;  3MYD A;  4ZL7 A;  3M8N A;  1TDI A;  3G9B A;  1ZYQ B;  3CRT A;  2J9H A;  3P7X A;  2BTO T;  5IIZ A;  2CA8 A;  3LYP A;  1LJR A;  2HRA A;  2VAF A;  4P3Y B;  2IFQ B;  4MJE A;  5CRD A;  2C0D A;  2YN1 A;  3ZRD A;  3E0U A;  3P90 A;  2PVQ A;  1C72 A;  1ZGN A;  4K0G A;  1T00 A;  1TRU A;  3KM6 A;  4O5U A;  1QGV A;  2HZE B;  4DEJ A;  3A2W A;  2FWF A;  3DVW A;  4JE1 A;  3KTB A;  1GP1 A;  4IVF A;  6GSW A;  2V41 A;  1BAY A;  1XWG A;  4RI6 A;  2HSY A;  2EIO A;  3ZIV A;  2VL2 A;  3FZA A;  1OVN A;  2VM2 A;  3ZL5 A;  3KP9 A;  2DJ0 A;  3RHC A;  5DAK A;  4ML6 A;  4K7O A;  2AB6 A;  4GLT A;  1R5P A;  1B4Q A;  1KBN A;  3KTL A;  4OO5 A;  4F82 A;  4AJ7 A;  3L4N A;  5E4W A;  2DIY A;  2X4A A;  3F3R A;  2IMF A;  3HDC A;  2H74 A;  1AQW A;  2H19 A;  5ELA A;  2VCQ A;  3VWW A;  1WOU A;  2YWM A;  4TR1 B;  2LJK A;  3TKP A;  3MWH A;  5J9C A;  2JAD A;  2HFD A;  4GQF A;  4TXO B;  5KOX A;  1Z6M A;  5G5E A;  3DKS A;  3FK8 A;  2LRC A;  5ABR A;  5JWO B;  4YQV A;  2FD3 A;  4ZL8 A;  1A8L A;  1EEM A;  3KXO A;  2FGX A;  5JCU A;  2IPA A;  4EC0 A;  3Q6O A;  4XTS A;  1VF4 A;  4MK3 A;  5IQY A;  3VWU A;  2RM6 A;  2JZR A;  4FIW A;  4IP6 A;  4Q5Q A;  3QDN A;  2E7P A;  3N5O A;  1ZMA A;  5GAP D;  4DSS B;  4TRX A;  2L5L A;  1F6M C;  1TRV A;  4Q5N A;  3HVX A;  3HJP A;  4IQ1 A;  5A4V A;  3WT1 A;  4TVE A;  4OFT A;  2ON7 A;  2HI7 A;  3FY7 A;  1TI1 A;  3ISO A;  3WGD A;  2NPB A;  2HSH A;  2P0G A;  4GST A;  1A0R P;  2GQK A;  4YQU A;  4XRD A;  5IO2 A;  1Z7P A;  2JSY A;  5CP1 A;  3MDK A;  1TP9 A;  5G30 A;  2ZUP A;  4MDC A;  3C73 A;  2VL3 A;  3G7J A;  1PL1 A;  5KN0 A;  2R37 A;  1K0O A;  5DDL A;  3IK7 A;  4CY6 A;  4EUY A;  3TUE A;  2JZT A;  2PBJ A;  1XW6 A;  5LD0 A;  3E9J B;  1OC9 A;  1A2L A;  2I9H A;  3C71 A;  1O8X A;  3O3T A;  5DBQ A;  2WGR A;  2CX3 A;  3ZTL A;  1T8E B;  5DCH A;  12GS A;  3LXZ A;  1BQ7 A;  2O89 A;  4J56 E;  2K8V A;  2DJ2 A;  2MBT A;  3G7Y A;  2LRT A;  1A0F A;  4XCS A;  5C04 A;  2P5Q A;  3KH9 A;  4IGJ A;  5EVO A;  1GUL A;  1XOB A;  1Y6E A;  2TRC P;  2H1D A;  3CYN A;  3D5J A;  2GGT A;  2OAC A;  4POM A;  2E0Q A;  2WS2 A;  3H79 A;  3DD3 A;  2HE3 A;  4PTS A;  1SKR B;  1UVZ A;  5G2Z A;  2K18 A;  5CNW A;  2VLV A;  3J7Y b;  2I1U A;  5CAX A;  2DKH A;  1XWB A;  2GST A;  1TOF A;  4MF6 A;  2X64 A;  2VIM A;  3FZ5 A;  4Z2U A;  3H1N A;  3S9F A;  6GSS A;  2I3Y A;  5DAK B;  2DLX A;  1CQH A;  4ZB9 A;  3TJF A;  4L5L A;  5LCZ A;  5DQY A;  3DEX A;  3ERW A;  1GL8 A;  1WPI A;  2OBI A;  2VOC A;  1U88 A;  4LL4 B;  3ZIT A;  2ALB A;  3PPU A;  5ECQ B;  2CV4 A;  3ZRE A;  4BPY A;  4CHS A;  1GUM A;  4KA0 A;  3KMO A;  5ECL B;  3MNG A;  3TJJ A;  4EDZ A;  1R4W A;  3M9J A;  4XIH A;  4L0W A;  5H5R A;  2QA2 A;  1R5A A;  1MEK A;  2H70 A;  1YQ1 A;  4JR6 A;  4HU7 A;  5AIS A;  3VUR A;  4NXI A;  3ZZX A;  4YQM A;  4WR5 A;  1GUH A;  2N5B A;  3KZQ A;  2L6C A;  1SL2 B;  5F0G A;  2YWO A;  2MMO A;  2R0G A;  4DVC A;  4WF4 A;  1PSQ A;  2FY6 A;  3RHB A;  2GZP A;  2IMD A;  2M46 A;  4K0N A;  5ECI B;  3PR8 A;  4GXZ A;  4DSR A;  4HQZ A;  4V1A g;  5H5S A;  3IK9 A;  3QPM A;  2H0G A;  2IJY A;  3CTF A;  4EL1 A;  2R6K A;  3IRA A;  3DIE A;  1M99 A;  1GLP A;  1NSW A;  3CTG A;  5HR2 A;  3ZMK A;  2RLI A;  1M9B A;  5A4U A;  4HZ4 A;  1OKD A;  1GSE A;  3Q18 A;  3TRP A;  2H8L A;  2L4C A;  1THO A;  4MZC A;  1QMV A;  1VF1 A;  5JWQ B;  4IP1 A;  1YEP A;  2PPT A;  1O85 A;  5FHI A;  3EYT A;  1OC9 B;  1EGR A;  4RQX A;  5IMD A;  5B8B A;  1EOH A;  1JZD A;  3L78 A;  4PQH A;  5D93 A;  4EF0 A;  4ZIJ A;  2GZZ A;  4MAB A;  1X5D A;  4IJ3 A;  4NV5 A;  1ST9 A;  3UVT A;  2OA7 A;  1PD2 1;  2CX4 A;  3KJY A;  3UIW A;  5B6N A;  5J3R A;  3VWV A;  2H76 A;  3EC3 A;  4FQU A;  1LBK A;  3H8Q A;  1FB0 A;  2PUK C;  1NHY A;  1Q98 A;  4RI7 A;  3LFL A;  5CO3 A;  3O6T A;  4G9H A;  3IBH A;  3HKR A;  1SJ6 A;  1IYI A;  3UBK A;  1NM3 A;  2H1A A;  2KP2 A;  1NHO A;  2R4V A;  1ZOF A;  2O87 A;  1GTA A;  3UL3 A;  3IR4 A;  5ECK B;  2OKA A;  1O7U A;  2HYX A;  4USS A;  5IPH A;  3Q74 A;  4MA9 A;  3IE3 A;  4KAE A;  1WIK A;  2DML A;  3VPT A;  1SYR A;  1XFL A;  1EWX A;  1Z6N A;  2B5Y A;  3M1G A;  4HQS A;  1J08 A;  4MPF A;  2VL2 C;  2NVL A;  16GS A;  5AIV A;  3A2V A;  20GS A;  1W89 A;  2VD1 A;  3EPT A;  1PL2 A;  3QMX A;  22GS A;  1DE1 A;  3D6I A;  4KX4 A;  5HFK A;  3TCO A;  4G0I A;  4Q5F A;  4EVM A;  4O5Q A;  3GA4 A;  1F9M A;  1XOA A;  1HD2 A;  5G5F A;  1PA3 A;  4V2N A;  4I2T A;  2PMT A;  1X5C A;  2H6Y A;  4MF5 A;  2LUS A;  1PX7 A;  1H75 A;  4I6X A;  4HUA A;  3QD9 A;  1EP8 A;  4V2L A;  1Q4J A;  4ACS A;  3SWL A;  5AN1 A;  5HR0 A;  1M7T A;  4PGT A;  1AXD A;  3CSH A;  4IQA A;  5L71 A;  3KD0 A;  2O7K A;  2A2R A;  3GTU A;  2DKI A;  3EU4 A;  4HU9 A;  3U6V A;  2HRF A;  4Z2T A;  2H73 A;  4BVX A;  3EU3 A;  1V40 A;  3L9U A;  3PIN A;  3UJ1 A;  3ZFL A;  1GSD A;  3CSJ A;  1XZO A;  2H6Z A;  4CW9 A;  1G6W A;  3RAZ A;  3LSZ A;  1SL0 B;  1K3O A;  2L5O A;  2CVK A;  4TOP A;  5KEJ A;  4QQ7 A;  3ME8 A;  2XPE A;  2C3T A;  3EIN A;  3IDV A;  3TRQ A;  1K0B A;  1V9W A;  4NPB A;  3F4T A;  3FW2 A;  3GIX A;  4MCU A;  3ERG A;  4KDX A;  2GDR A;  3LGC A;  3DRN A;  4X43 A;  2NTO A;  2Z9S A;  2IME A;  2NDO A;  4X1U A;  2PGT A;  2L57 A;  4K2X A;  3FZ9 A;  1YF0 A;  5HFI A;  2YNX A;  3TOU A;  4ZBA A;  1SJI A;  2QKE A;  3HVV A;  2F8F A;  4NMU A;  1TRW A;  5D9T A;  1V57 A;  1YDK A;  2FWE A;  1F3A A;  4Z7X A;  3M3M A;  4GRF A;  2GQL A;  4JBB A;  1VF2 A;  3U5R E;  1GSU A;  4EXJ A;  1S3C A;  4GCI A;  4PUR A;  2VCX A;  1SEN A;  1TW9 A;  1G0T A;  1ACV A;  3GKM A;  3GKK A;  2C0G A;  3EUR A;  4TXV A;  1JLW A;  3D4M A;  3GNJ A;  1ERT A;  5IOW A;  1DUG A;  2X49 A;  2OE0 A;  5JCG A;  1MDK A;  1DBY A;  2AV4 A;  4IHU A;  2QSI A;  1OAZ A;  4PX1 A;  4OCF A;  4OMV A;  1ERW A;  2A2S A;  5G31 A;  3RPP A;  3F4S A;  3HJM A;  1ABA A;  1E6B A;  2X99 A;  1GH2 A;  5D9X A;  4MJA A;  1A2M A;  4CDO A;  1OKT A;  1R7H A;  2HT9 A;  3LYK A;  3BBY A;  3D4T A;  3J7Y k;  1M0U A;  4K2D A;  2XBI A;  3LQ7 A;  2ZNM A;  3GX0 A;  3EE2 A;  1JLV A;  4JED A;  4E8E A;  1TRS A;  3BCK A;  2FA4 A;  4H86 A;  2DBC A;  4YH2 A;  4IW9 A;  3F63 A;  1A23 A;  4PQ1 A;  1QXH A;  3VFI A;  3WGE A;  5ELG A;  1Y25 A;  1M9A A;  1FG4 A;  2L6D A;  2A4V A;  2AUV A;  1SD8 A;  3APS A;  3HJO A;  3LXT A;  4ZL9 A;  2FCH A;  4RUV A;  2R0C A;  2H75 A;  4MLY A;  2YZU A;  4KH7 A;  3GTU B;  3HHV A;  2M80 A;  4NWY A;  1LU4 A;  1O73 A;  1HNA A;  4KGI A;  3ZVJ D;  2PU9 C;  4ECB A;  1EGO A;  4BVX B;  3MIX A;  3R3E A;  5F8B A;  2M72 A;  14GS A;  2LJR A;  1GUK A;  2LV3 A;  5E59 A;  2K6V A;  2R5G A;  2I4A A;  2YAN A;  4JU5 A;  1FO5 A;  1EP7 A;  2WFC A;  17GS A;  4BVY A;  5KN2 A;  1SU9 A;  4D73 A;  3HZ8 A;  2O8V B;  4O7H A;  1YY7 A;  11GS A;  1DE2 A;  1Z3E A;  2YV9 A;  4PUA A;  4WEY A;  2GS3 A;  5AGY A;  3VI7 A;  1PMT A;  3WYW A;  2VD0 A;  1S3D A;  4EIP A;  2XHF A;  4TR0 A;  1V58 A;  1ZL9 A;  5C00 A;  4PXO A;  1GNW A;  4WET A;  3US3 A;  1A24 A;  3C1S A;  2C3Q A;  2VCV A;  3WD6 A;  2BJX A;  4K5R A;  1O6J A;  5GSS A;  1F37 A;  2R3X A;  2G0F A;  3LG6 A;  4LLR A;  2DIZ A;  3C1R A;  4GF0 A;  4MMM A;  4G2E A;  3MAK A;  4KSO A;  2C0E A;  3HZ4 A;  1B9X C;  1AUC A;  5IMC A;  2JAC A;  2C80 A;  2YP6 A;  3UVH A;  5A4W A;  1YJ6 A;  3I69 A;  4RQR A;  4ECI A;  3EVI A;  4TR4 A;  4ICY A;  3F6D A;  4L8E A;  1B8X A;  5COH A;  3GX8 A;  1MD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...