1X0RA

Thioredoxin peroxidase from aeropyrum pernix k1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
244
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Crystal structure of thioredoxin peroxidase from aerobic hyperthermophilic archaeon Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 72
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 1x0rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x0rA01
3U5RE 3G9BA 2LV3A 1A2LA 2A2SA 2DC5A 1R4WA 1SJIA 1GUHA 5DCHA 2R4VA 4IELA 3HZ4A 3TCOA 3GKMA 2O87A 5KN0A 2YOIA 3I69A 4JBBA 3TKRA 1KBNA 2YWIA 1SKSB 2KHPA 3FR3A 1XBSA 2VAFA 4MZCA 3L78A 13GSA 3DXBA 3ZMLA 9GSSA 3N9JA 3S9FA 2G2QA 3FR6A 5JWOB 3DRNA 2LJRA 1GTBA 3F0IA 3EMPA 4ZBDA 2WDUA 1ZMAA 2B1LA 3NOFA 3IPZA 2EC4A 1TI3A 1XWKA 4XRAA 3W8JA 5J9CA 3GMFA 4TR0A 5ECSA 1TKDB 4G2EA 5IMZA 1GUKA 4EC0A 1RQMA 1GSDA 2O8VB 2CQ9A 2VO4A 3ME7A 4TOPA 1EOGA 1JZOA 2VIMA 2VCXA 4LMVA 2NBSA 4K0GA 4DSQA 3W8SA 1FO5A 3R2QA 3LXZA 1V2AA 1WOUA 2WCIA 2KUCA 2LQQA 1S3CA 1O85A 2YPMA 3FKFA 1K3OA 2VCZA 5A5KA 1OKTA 1X5CA 2H6ZA 4F9ZA 2F8FA 3HYPA 1SL0B 4NWYA 2DSAA 1S3AA 5CP1A 1M0UA 4JR4A 3UBLA 6GSWA 1XWCA 2H74A 3FRCA 1GSSA 4HI7A 5C00A 5CRHA 2LRTA 1SL1B 5FT3A 5LCZA 4KW6A 4JR6A 3GN3A 2NVLA 3D5JA 5J4UA 3DYRA 2FA4A 1ML6A 2AAWA 3QCPA 2L6CA 3ZYWA 2WFCA 4BA7A 2F8AA 1QMVA 3GSTA 1FAAA 2MBSA 4CHSA 3SBCA 1U88A 4TR1A 1OC8A 4POLA 1FVJA 2H76A 20GSA 2CX4A 1PMTA 5IMVA 1NHOA 2OE3A 4MJCA 3IHQA 1G6YA 1GNWA 3EE2A 1ZYQB 2PWJA 1GNEA 1YY7A 4X1UA 3KIJA 2GSQA 4Q5QA 5IO0A 3M1GA 4KDYA 3A2XA 2LJAA 5D9TA 4CW9A 1EP8A 4HUAA 4PURA 4GSNA 3L9UA 5C04A 1KNGA 4HU7A 2GQLA 4ZB9A 2B5YA 2VD1A 2C1YA 1JLWA 1PN9A 5CRWA 1GL8A 4IQ1A 2V2GA 3Q6OA 4PQHA 4ML6A 5HR3A 3CBUA 1F3BA 5CYYA 5JWQB 1ABAA 1Q4JA 1UN2A 1THOA 2RM6A 4RQXA 4ZIJA 3LEFA 1BEDA 1T1VA 2C3TA 4KCEA 2DMMA 2M72A 3TKSA 4OMVA 1YDKA 1GSEA 3PR8A 1I9DA 2CA8A 3J7Yk 1LBKA 4YQVA 6GSYA 2XPEA 4HU9A 1HYUA 2C8UA 1U3AA 4ZL8A 2GZYA 4ZB8A 4IJIA 3KXOA 1XZOA 1HNCA 2C80A 2GLRA 4IBPA 5E59A 4KA0A 5DJLA 4ID0A 3LWAA 4QL9A 3VPQA 4GSSA 3HD5A 3H8QA 3GRXA 3VK9A 1B9XC 2V6KA 3JCML 22GSA 3ZITA 3WGDA 4MJEA 2H1DA 1GLQA 3GURA 4MZWA 4N0ZA 5LD0A 5CRGA 3RPNA 3J7Yb 1IYHA 3LYPA 3ZZXA 2MZCA 4MH2A 2PPTA 4F03A 1PD21 3GX0A 3LYKA 3EYTA 1WIKA 2H75A 4PGTA 2LQOA 1PQNA 4TKYA 3KZQA 3UVTA 1MEKA 2A4VA 4ECIA 1IYIA 2QKEA 5D9VA 1SKRB 5IMFA 4JZQA 1AW9A 5CO3A 5KN1A 4BL7A 3F4TA 3LSZA 1B9YC 3ZVJA 2IPAA 4NHWA 2IIYA 2JZSA 4HDEA 4JE1A 4EO3A 1U87A 1W4VA 1BJXA 1TP9A 4WXTA 3D0ZA 2KOKA 4WETA 5JWRB 5DALB 5INYA 3F6FA 3OR5A 5IMCA 4MF6A 2RIIA 2O85A 3I9V2 3QFAC 1B4QA 3DGQA 3VWXA 1FB0A 3CTFA 5G1LA 3QD9A 4WEYA 3GYKA 2EIOA 5A4VA 1ERWA 1PKWA 2MYGA 3KTLA 2HXKA 2YNXA 2HE3A 3RPPA 4K7NA 2ZCTA 3DKSA 1JZWA 2I9HA 1PSQA 3N5OA 2VUPA 4KCAA 3TDGA 1XPVA 4L0UA 4WBRD 1K0DA 3ED3A 1YJ6A 3TJGA 2CV4A 14GSA 1F37A 3UEMA 5IOWA 4MMMA 4EKZA 4GLTA 1QUWA 3VPTA 3KD0A 1T7PB 1K0CA 4MF7A 1EZKA 4PUFC 2WS2A 1RW1A 3CSJA 1YEPA 1I5GA 3W6GA 2QSIA 3CTGA 1F9MA 4ZB6A 5D9XA 1FB6A 4O7HA 10GSA 5D8IA 1R5PA 4RI7A 18GSA 5HR0A 2IL3A 4EVMA 3D4MA 3QFBC 5G5FA 2ALBA 4KDXA 1K0MA 1UVZA 3ZRDA 1Z7PA 3M3MA 3FZAA 4HJ2A 2HZEB 2DBCA 2R3XA 5ECMB 3TKSE 4I2UA 2NTOA 3IV4A 1X9SB 1JZRA 1ST9A 3L9SA 5ELAA 1WWJA 3GUSA 3EWLA 4AGSA 1SD8A 2MBTA 3PH9A 1GWCA 3DVWA 4XIHA 3ZFBA 2FLSA 4KB3A 2CVKA 1SU9A 3SWLA 5B8AA 4K8MA 3VI5A 3GNJA 5IM9A 2EIRA 5L71A 4N0VA 5ECIB 2F3MA 4DSSB 1OAZA 5J5NA 2XBQA 2DJ0A 3CRUA 4X0XA 5DQSA 1LJRA 4PNGA 4FYUA 1B4PA 4Q5RA 3IOSA 5B7CA 4NPBA 2CVDA 3VURA 3HVXA 1SL2B 1EOHA 1FHEA 16GSA 5F06A 4ZL9A 3HJMA 1NM3A 3V1WA 5AGYA 3EU3A 2FWEA 4IKHA 1AQWA 3HY2A 1XW5A 2AV4A 2FY6A 3P8WA 2FA8A 2VD0A 3KMNA 2H0GA 2GTUA 4LL1B 3APQA 3BJ5A 4PXOA 4KAEA 2RUFA 2X99A 2IWTA 1VF2A 1J08A 2GT5A 4ZL7A 2JSYA 5DCGA 2E2MA 4WF5A 5DQYA 4G10A 5FWGA 1K0AA 3UARA 2B1KA 1SJ6A 4V2LA 1E2YA 3VWUA 3UOMA 4FYBA 4WF4A 1GH2A 2I1UA 3GSSA 1GUMA 1S3DA 3PINA 3GIXA 2C0GA 1EV4A 4AJ6A 2DJ3A 5J9BA 2LJKA 4KSOA 4IS0A 2H70A 3DEXA 2IMFA 5GSSA 3MDKA 2X8HA 5ECKB 3IBHA 3ERFA 4X43A 2CAQA 3H1NA 1TRVA 1RK4A 2K8SA 1A0FA 2OADA 1YQ1A 1BQ7A 1USBA 2N5BA 3O6TA 4MDCA 1XXUA 1GLPA 4FYCA 4ZXGA 2J9HA 1XOAA 1V40A 5AN1A 3TJKA 5GAPD 4GQFA 3QPMA 3L0HA 1Z9HA 4DSRA 4XS4B 1ZYEA 3A2VA 3L9VA 3WGXA 5CNWA 5DALA 3P90A 2OBKA 1B8XA 1R7HA 4NHZA 2XC2A 3UMAA 1EGOA 2NDOA 2FNOA 4ZILA 2JACA 3EURA 4L0WA 4L5OA 2MMNA 5EVOA 2LS5A 1SK2A 2X8CA 3DIEA 2IFQB 2MMZA 3EINA 5B8BA 2PVQA 1T8EB 2NPBA 5KEJA 1EEMA 2VL2A 2P5QA 4O92A 5AIXA 1NSWA 4K1FA 2E0QA 2CAIA 1SYRA 4G19A 4MH3A 1ZCPA 3MSZA 1ERVA 2CT6A 1A2JA 3M8NA 1KEBA 1SYXA 5KN2A 1WMJA 4TXOB 2E2GA 4OO4A 5DAKB 1EV9A 4MK3A 2P0GA 5HR2A 3LORA 4IJ3A 1MD4A 4DEJA 1F6MC 1GRXA 3AY8A 2XBIA 2E7PA 2H0HA 4ILFA 4PNFA 4KH7A 1M2BA 4BWSA 2TRCP 5A4UA 4E8EA 2YJ7A 3KH7A 2GVPA 3KCMA 4ACSA 2J23A 3GKNA 4HOJA 3MAKA 2HZEA 4P3YB 11GSA 1ERUA 1TK5B 4HJMA 4I97A 1AAZA 5H5SA 2FD3A 1FG4A 2LUSA 3P7XA 1JFUA 3QR6A 6GSTA 5ELGA 4K7IA 1VRSD 1FVKA 5CAXA 3TRXA 2CZ3A 2VL9A 1WP0A 4TW5A 1ACVA 4EE0A 4KNDA 5DDLA 2FWGA 2B5EA 2O7KA 3HJOA 2XPDA 1X9WB 1GTUA 4LLRA 4YQMA 2VCTA 4DSSA 3RHCA 3KH9A 2H73A 2H6YA 3O3TA 1U6TA 1UA5A 2V1MA 3D21A 5AISA 1R5AA 1GP1A 3ZIJA 2H01A 3VLNA 1J0FA 2YCDA 1TRWA 3DD3A 1DSBA 4ECBA 5COHA 1AQVA 1YZXA 3WGEA 4FH8A 2DIZA 3VFIA 5FHIA 3BBYA 2H6XA 2VLVA 4JEDA 1HNAA 3A2WA 2PVOC 4MP4A 1GSFA 3IR4A 1URMA 3F3RA 3KGKA 5GZZB 4BWQA 1V58A 2GQKA 3ZIVA 3E9JB 3VWVA 2GSTA 5EY6A 5ENUA 4IGJA 2JZTA 2QC7A 3KTBA 1YKCA 2YWOA 3EVIA 2C3NA 2LRCA 1OC9B 2GSSA 1NW2A 3HHVA 3US3A 2KP1A 4N30A 2O89A 5ECLB 4N11A 2JU5A 1QK8A 2YV7A 4IN0A 3KP9A 1MDKA 3A3TA 2ZUPA 2Z9SA 2ON7A 1ILOA 3WYWA 3FEUA 4F2IA 1HQOA 4OCFA 1SK1A 4J56E 4MJBA 2PMTA 4MPFA 2HNLA 3K8NA 4H86A 2L4QA 5IO2A 3ISOA 3TRPA 2BJXA 4KGIA 2HRFA 5HFIA 1GULA 2OE0A 3GKXA 2JZRA 5GSTA 1N2AA 2N5AA 2VLUA 2WGRA 3IK7A 5IIZA 5GAND 3A5WA 2LNSA 2TIRA 3C73A 3TKQA 2N5FA 1HD2A 2CX3A 2H8LA 1BX9A 1Y6EA 2OKAA 1F3AA 5AIVA 1V98A 2YJHA 3I6AA 1A23A 5JCWA 1WPIA 4XS4A 2YN1A 1W89A 4QL7A 4WBJA 4EDYA 4ECCA 2L5OA 4IQAA 8GSSA 3TRQA 1TU8A 3DWVA 2K6VA 2RLIA 2AUVA 4K2DA 3CYNA 2K9FA 4BPYA 2LSTA 3CMIA 4K6XA 2C0EA 1KTEA 3TJBA 17GSA 1VF1A 1G7OA 4POMA 2L6DA 2GS3A 4BVXA 3IAS2 5B6MA 5EPFA 5ECHB 3Q74A 2IFQA 4KUNA 1O81A 1TRSA 4Q5NA 2F9SA 1M7TA 3FR9A 5ID2B 1OC3A 2C0FA 1QFNA 1MD3A 1LU4A 2WULA 3C8EA 4EF0A 2HZFA 2D2ZA 4V1Ag 3IK9A 1XVQA 2VOCA 3F4SA 2QGVA 4V2NA 1X5DA 4TXOA 5DAKA 4YQUA 4I2TA 3TKSC 1OVNA 4E8HA 1XVWA 1JZDA 2AYTA 3ZREA 2GSRA 2YZUA 3ZVJD 1M2DA 1AXDA 5G2ZA 4J57E 1BYEA 3FK8A 2V32A 2RUEA 1ZZYA 5IPHA 1OE8A 4IP1A 1HNBA 1A8LA 2IMIA 3H93A 1XWAA 2GZZA 3RBTA 3UJ1A 1TJDA 4HZ4A 2ES7A 4MLYA 4O5RA 2R6KA 4MF5A 1OE7A 4RI6A 2JADA 3ZL5A 4XRDA 3TGZA 1SK0A 5ECOB 1OYJA 4IP6A 3IXRA 1SJZA 3G7IA 3WD6A 4F0BA 2X64A 2VM2A 2WZ9A 1T4ZA 2I81A 2CZ2A 1TTZA 1NHYA 3TOTA 2F51A 5H5RA 1K0OA 4OFTA 4POBA 4EUYA 4YAVA 2AHEA 2I3YA 3HCZA 3QDNA 5F07A 1CQHA 1G6WA 4EXJA 6GSXA 3GL3A 3GH9A 1AIUA 1C72A 1M9BA 4LA1A 1DE2A 1TDIA 2V41A 2JL4A 4POKA 1UC7A 5IMDA 2IMEA 1T3BA 3LXTA 3LG6A 1DBYA 3NZNA 3VWWA 5E4WA 1WJKA 3C71A 1XW6A 1AC1A 1XWGA 3FHKA 2ON5A 2GT6A 4RQRA 5JCUA 5F8BA 4MPGA 5EL8A 4ECJA 4N10A 1AQXA 2H1GA 1TW9A 3IC4A 5DJMA 3VI7A 4PUAA 4IVFA 2HI7A 3KEBA 3ZLPA 4IW9A 1PL2A 1OKDA 1TXXA 1THXA 2LRNA 3KP8A 4OCEA 2OE1A 1OC9A 1Z6NA 2K8VA 7GSSA 2B5XA 2H0IA 1QXHA 5HR1A 4XTSA 2MMOA 2DLXA 4I8BA 1GTAA 2M46A 1T00A 3GV1A 1VF4A 3NIVA 4EDZA 1EWXA 1VGLA 1TOFA 3FZ9A 1QGVA 4GF0A 4I5QA 1ON4A 12GSA 2K18A 5KN3A 1GSQA 1H4OA 3IE3A 6GSUA 3RHBA 1BG5A 2WJUA 2FUG2 3GFKA 2XHFA 3RAZA 2H30A 3EMXA 1PX6A 2L4CA 3FZ5A 3FYGA 3QAGA 3F8UA 5CREA 3CRTA 1Z6MA 3D6IA 4TR3A 4PQIA 1GTIA 4HEA2 2DJKA 3TJJA 4QQ7A 1K3LA 4Q5FA 5G1KA 4ZBBA 2OACA 1R26A 1PKZA 2VCVA 2YANA 1J9BA 2OJLA 1A0RP 2L5LA 1PX7A 3M9KA 5ECRB 4KX4A 1DUGA 4K0NA 2VLTA 3IAM2 3QMXA 4HS1A 3Q19A 1XWBA 2RM5A 3UIWA 3G7JA 2MMAA 5JCGA 4AJ7A 3WT1A 2ZNMA 2P31A 3FW2A 1TK8B 5HFKA 4TVEA 1EP7A 4AJ8A 1Q98A 4LMWA 1FOVA 1A8YA 1MDJA 1O7UA 2H1BA 2YZHA 3D22A 1M99A 3DMLA 2HYXA 4GRFA 3BCIA 4NAXA 1WE0A 4WKWA 1H75A 3IDVA 1TRUA 1K0NA 3ZFLA 3H4KA 4OWYA 2PERA 3ME8A 3P2AA 2G0FA 2I4AA 2IMDA 4MCUA 1X5EA 2KP2A 4I6XA 4LL4B 3Q18A 4PQ1A 1FW1A 3QAVA 1XCCA 2OA7A 4OFNA 5ID2A 3GH6A 4L5LA 1O6JA 1Z7RA 2FHEA 3HVSA 1YEXA 2DJJA 1SKWB 1E6BA 2HSYA 3F3QA 2H71A 4TR4A 1TK0B 2H72A 3F9UA 4D73B 2R2JA 2LEGA 4AF2A 3GTUB 1CQGA 3TOUA 5A4WA 1MDIA 4JU5A 3O76A 2EIQA 3FZ4A 4MA9A 5G30A 4MJAA 2KLXA 3ERWA 3PGTA 3EU4A 4XHMA 1G7EA 3LFLA 1AUCA 1ZOFA 3KM6A 3HJPA 3F4RA 2L57A 1G0TA 2IJYA 4OFMA 2FWHA 2GGTA 3WT2A 1K3YA 4V1Ap 3C1RA 2OBIA 2HFDA 5ABRA 3EC3A 3C1SA 2M80A 3KJYA 5D73A 1PL1A 1XOBA 3LQ7A 3U6VA 2L59A 3RDWA 1N8JA 1GSUA 1Z3EA 3LJRA 1K0BA 4ISDA 3CXGA 3ZMKA 4KDUA 1TI1A 4CDOA 4GTUA 3FY7A 2WB9A 1PGTA 5G5EA 3M9JA 2R37A 2C4JA 3TUEA 4XCSA 3ZTLA 2PU9C 19GSA 2TRXA 3GA4A 3TB2A 2AB6A 3E0UA 2H66A 1ZL9A 2JSZA 5HQPA 2VL3A 4EL1A 3G7YA 5J41A 2LKUA 4ZBAA 2C3QA 1JHBA 4HZ2A 4YH2A 6GSVA 3BD2A 3GL5A 2BTOT 2PUKC 3LGCA 4K7OA 4G9HA 1YKAA 2V6OA 4F0CA 4KE3A 2HLSA 1XIYA 2A2RA 2B3SA 5D93A 1PRXA 4MZBA 5F05A 1O73A 1DE1A 2C0DA 1O8WA 1GSYA 3QAWA 4YAPA 2R5GA 5DVBA 2VL2C 4XS6A 4IHUA 4ULXA 1EGRA 5J3RA 2AJQB 2REMA 4WR4A 2PN8A 2VCQA 1X0RA 2X8GA 2H1AA 1X9MB 1M2AA 4HQSA 4BVYA 3IA1A 2YWNA 3HZ8A 3L4NA 1VF3A 5IOXA 4ML1A 3E3EA 2YV9A 3GKKA 4MABA 2GQMA 4TXVA 3MNGA 5LNKe 4FIWA 5CRDA 4L8EA 4FO5A 4XS1A 3TKPA 1PA3A 2LTKA 3APOA 3TJFA 1F2EA 2PGTA 3CSIA 2BMXA 4TR1B 4O32A 2CVBA 2FGXA 1T4YA 3HXSA 4TRXA 1WRYA 2FCHA 2YP6A 5G31A 2H19A 5IMAA 1EEJA 2YWMA 3APSA 3HVVA 4NV2A 2FWFA 2DJ2A 1XFLA 4V2MA 4DVCA 1YF1A 3HKRA 3C7MA 1Y25A 5H5QA 4JRRA 4OD7A 2B6MA 4K9ZA 3F63A 1BAYA 1SD9A 4GQCA 4F82A 2LNTA 3CSHA 3H79A 1QQ2A 5F0GA 2DJ1A 1XW9A 2GDRA 3GX8A 1SENA 1MTCA 3UL3A 1B48A 4Z7XA 4GSTA 4PX1A 4NV5A 4GXZA 3UBKA 2VM1A 2WRTA 5ECPB 2PBJA 5HFGA 2DIYA 3HA9A 2HSHA 2GZPA 3DVXA 3I43A 3UAPA 4OO5A 5D96A 4NMUA 1ZGNA 3BCKA 2B7KA 1JLVA 3MWHA 2B7JA 3IRAA 5IQYA 6GSSA 3D4TA 4TN8A 3ERGA 3BOAA 4WR5A 2IMKA 5B6NA 3GHAA 4D73A 5IPGA 1V9WA 1U3IA 3GTUA 2DMLA 3UVHA 1A2MA 1Z5YE 4RUVA 4NXIA 5ECNB 4GWRA 5ECQB 1YF0A 2VCWA 4J2FA 1O8XA 3KMOA 3M0FA 1ERTA 4KSMA 2HT9A 2HRNA 3QOUA 5DBQA 5D9WA 1A24A 1V57A 1TU7A 1M9AA 2P5RA 4GCIA 4HQZA 3F6DA 2IN3A 3HDCA
chains in the Genus database with same CATH superfamily
3U5RE 2HRKA 3G9BA 2LV3A 1A2LA 4YKGA 2A2SA 2DC5A 1R4WA 1SJIA 1GUHA 5DCHA 2R4VA 2QA2A 4IELA 3HZ4A 3TCOA 3GKMA 2O87A 5KN0A 2YOIA 3I69A 4JBBA 3TKRA 1KBNA 4BL7B 2YWIA 1SKSB 2KHPA 3FR3A 1XBSA 2VAFA 4MZCA 3L78A 13GSA 3DXBA 3ZMLA 4A5PA 9GSSA 3N9JA 3S9FA 2G2QA 3FR6A 5JWOB 3DRNA 2LJRA 1GTBA 3F0IA 3EMPA 4ZBDA 2WDUA 1ZMAA 2B1LA 3NOFA 3IPZA 2EC4A 1TI3A 1XWKA 4XRAA 3W8JA 5J9CA 3GMFA 4TR0A 5ECSA 1TKDB 4G2EA 5IMZA 1GUKA 4EC0A 1RQMA 1GSDA 2O8VB 2CQ9A 2VO4A 3ME7A 4TOPA 1EOGA 1JZOA 2A2PA 2VIMA 2VCXA 4LMVA 2NBSA 3MYDA 4K0GA 4DSQA 3W8SA 1FO5A 3R2QA 3LXZA 1V2AA 1WOUA 2WCIA 2KUCA 4O5QA 2LQQA 1S3CA 1O85A 2YPMA 3EPTA 3FKFA 1K3OA 2VCZA 5A5KA 1OKTA 1X5CA 2H6ZA 4F9ZA 2F8FA 3HYPA 1SL0B 4NWYA 2DSAA 1S3AA 5CP1A 1M0UA 4JR4A 3UBLA 6GSWA 1XWCA 2H74A 3FRCA 1GSSA 4HI7A 5C00A 5CRHA 2LRTA 1SL1B 5FT3A 5LCZA 4KW6A 4JR6A 3GN3A 2NVLA 3D5JA 5J4UA 3DYRA 2FA4A 1ML6A 2AAWA 3QCPA 2L6CA 3ZYWA 2WFCA 3IC8A 4BA7A 2F8AA 1QMVA 3GSTA 1FAAA 2MBSA 4CHSA 3SBCA 1U88A 4TR1A 1OC8A 4POLA 1FVJA 2H76A 20GSA 2CX4A 1PMTA 5IMVA 1NHOA 2OE3A 4MJCA 3IHQA 1G6YA 1GNWA 3EE2A 1ZYQB 2PWJA 1GNEA 1YY7A 4X1UA 3KIJA 2GSQA 4Q5QA 5IO0A 3M1GA 4KDYA 3A2XA 2LJAA 5D9TA 4CW9A 1EP8A 4HUAA 4PURA 4GSNA 3L9UA 5C04A 1KNGA 4K5SA 4HU7A 2GQLA 4ZB9A 5KOWA 1M3IA 2B5YA 2VD1A 2C1YA 1JLWA 1PN9A 5CRWA 1GL8A 4IQ1A 2V2GA 3Q6OA 4KF9A 4PQHA 4ML6A 5HR3A 3CBUA 1F3BA 5CYYA 5JWQB 1ABAA 1Q4JA 1UN2A 1THOA 2RM6A 4RQXA 4ZIJA 3LEFA 1BEDA 1T1VA 2C3TA 4KCEA 2DMMA 2M72A 3TKSA 4OMVA 1YDKA 1GSEA 3PR8A 1I9DA 2CA8A 3J7Yk 1LBKA 4YQVA 6GSYA 2XPEA 4HU9A 1HYUA 2C8UA 1U3AA 4ZL8A 2GZYA 4ZB8A 4IJIA 3KXOA 1XZOA 1HNCA 2C80A 2GLRA 4IBPA 5E59A 4KA0A 2R0PA 4ID0A 5DJLA 3LWAA 4QL9A 3VPQA 4GSSA 3HD5A 3H8QA 3GRXA 3VK9A 1B9XC 2V6KA 3JCML 22GSA 3ZITA 3WGDA 4MJEA 2H1DA 1GLQA 3GURA 4MZWA 4N0ZA 5LD0A 5CRGA 3RPNA 3J7Yb 1IYHA 3LYPA 3ZZXA 2MZCA 4MH2A 2PPTA 4F03A 1PD21 3GX0A 3LYKA 3EYTA 1WIKA 2H75A 4PGTA 2LQOA 1PQNA 4TKYA 3KZQA 3UVTA 1MEKA 2A4VA 4ECIA 1IYIA 2QKEA 5D9VA 1SKRB 5IMFA 4JZQA 1AW9A 5CO3A 5KN1A 4BL7A 3F4TA 3LSZA 1B9YC 3ZVJA 2IPAA 4NHWA 2IIYA 2JZSA 4HDEA 4JE1A 4EO3A 1U87A 1W4VA 1BJXA 1TP9A 4WXTA 3D0ZA 2KOKA 4WETA 5JWRB 5DALB 5INYA 3F6FA 3OR5A 5IMCA 4MF6A 4Z2UA 2RIIA 2O85A 3I9V2 3QFAC 1B4QA 3DGQA 3VWXA 1FB0A 3CTFA 5G1LA 3QD9A 4WEYA 3GYKA 2EIOA 5A4VA 1ERWA 1PKWA 2MYGA 3KTLA 2HXKA 2YNXA 2HE3A 3RPPA 4K7NA 2ZCTA 3DKSA 1JZWA 2I9HA 1PSQA 3N5OA 2VUPA 4KCAA 3TDGA 1XPVA 4L0UA 4WBRD 1K0DA 3ED3A 1YJ6A 3TJGA 2CV4A 14GSA 1F37A 3UEMA 5IOWA 4MMMA 4EKZA 4GLTA 1QUWA 3VPTA 3KD0A 1T7PB 1K0CA 4MF7A 1EZKA 4PUFC 2WS2A 1RW1A 3CSJA 1YEPA 1I5GA 3W6GA 2QSIA 3CTGA 1F9MA 4ZB6A 5D9XA 1FB6A 4O7HA 10GSA 5D8IA 1R5PA 4RI7A 18GSA 5HR0A 4YKFA 2IL3A 4EVMA 3D4MA 3QFBC 5G5FA 2ALBA 4KDXA 1K0MA 1UVZA 3ZRDA 1Z7PA 1XG8A 3M3MA 3FZAA 4HJ2A 2HZEB 2DBCA 2R3XA 5ECMB 3TKSE 4I2UA 2NTOA 3IV4A 1X9SB 1JZRA 1ST9A 3L9SA 5ELAA 1WWJA 3GUSA 1ZYNA 5BMUA 3EWLA 4AGSA 1SD8A 2MBTA 3PH9A 1GWCA 3DVWA 4XIHA 3ZFBA 2FLSA 4KB3A 2CVKA 1SU9A 3SWLA 5B8AA 4K8MA 3VI5A 3GNJA 5IM9A 2EIRA 5L71A 4N0VA 5ECIB 2F3MA 4DSSB 1OAZA 5J5NA 2XBQA 2DJ0A 3CRUA 4X0XA 5DQSA 1LJRA 4PNGA 4FYUA 1B4PA 4O5UA 4Q5RA 3IOSA 5B7CA 4NPBA 2CVDA 3VURA 3HVXA 1SL2B 1EOHA 1FHEA 16GSA 5F06A 4ZL9A 4PTSA 3HJMA 1NM3A 3V1WA 5AGYA 3EU3A 2FWEA 4IKHA 1AQWA 3HY2A 1XW5A 2AV4A 2FY6A 3P8WA 2FA8A 2VD0A 3KMNA 2H0GA 2GTUA 3CQFA 4LL1B 3APQA 3BJ5A 4PXOA 4KAEA 2RUFA 2X99A 2IWTA 1VF2A 1J08A 2GT5A 4ZL7A 2JSYA 5DCGA 2E2MA 4WF5A 2R0GA 5DQYA 4G10A 5FWGA 1K0AA 3UARA 2B1KA 1SJ6A 4V2LA 1E2YA 3VWUA 3UOMA 4FYBA 4WF4A 1GH2A 2I1UA 3GSSA 1GUMA 1S3DA 3PINA 5KOXA 3GIXA 2C0GA 1EV4A 4AJ6A 2DJ3A 5J9BA 2LJKA 4KSOA 4IS0A 2H70A 3DEXA 2IMFA 5GSSA 3MDKA 4G0LA 2X8HA 5ECKB 3IBHA 3ERFA 4X43A 2CAQA 3H1NA 1TRVA 1RK4A 2K8SA 1A0FA 2OADA 1YQ1A 1BQ7A 1USBA 2N5BA 3O6TA 4MDCA 1XXUA 1GLPA 4FYCA 4ZXGA 2J9HA 1XOAA 1V40A 5AN1A 3TJKA 5GAPD 4GQFA 3QPMA 3L0HA 1Z9HA 4DSRA 4XS4B 1ZYEA 3A2VA 3L9VA 4BVYB 3WGXA 4EIQA 5CNWA 5DALA 3P90A 2OBKA 1B8XA 1R7HA 4NHZA 2XC2A 3UMAA 1EGOA 2NDOA 2FNOA 4ZILA 2JACA 3EURA 4L0WA 4L5OA 2MMNA 5EVOA 4BVXB 2LS5A 3R3EA 1SK2A 2X8CA 3DIEA 2IFQB 2MMZA 3EINA 4USSA 5B8BA 2PVQA 1T8EB 2NPBA 5KEJA 1EEMA 2VL2A 2P5QA 4O92A 5AIXA 1NSWA 4K1FA 2E0QA 2CAIA 1SYRA 4G19A 4MH3A 1ZCPA 3MSZA 1ERVA 2CT6A 1A2JA 3M8NA 1KEBA 1SYXA 5KN2A 1WMJA 4TXOB 2E2GA 4OO4A 5DAKB 1EV9A 4MK3A 2P0GA 5HR2A 3LORA 4IJ3A 1MD4A 4DEJA 1F6MC 1GRXA 3AY8A 2XBIA 2E7PA 2H0HA 1PN0A 4ILFA 4PNFA 4KH7A 1M2BA 4BWSA 2TRCP 5A4UA 4E8EA 2YJ7A 3KH7A 2GVPA 3KCMA 4ACSA 2J23A 3GKNA 4HOJA 3MAKA 2HZEA 4P3YB 11GSA 1ERUA 1TK5B 4HJMA 4I97A 1AAZA 5H5SA 2FD3A 1FG4A 2LUSA 3P7XA 1JFUA 3QR6A 6GSTA 5ELGA 4K7IA 1VRSD 1FVKA 5CAXA 3TRXA 2CZ3A 3FMWA 2VL9A 1WP0A 4CY6A 4TW5A 1ACVA 4EE0A 4KNDA 5DDLA 2FWGA 2B5EA 2O7KA 3HJOA 2XPDA 1X9WB 1GTUA 4LLRA 4YQMA 2VCTA 4DSSA 3RHCA 3KH9A 2H73A 2H6YA 1ZYPA 3O3TA 1U6TA 1UA5A 2V1MA 3D21A 5AISA 1R5AA 1GP1A 3A5IA 3ZIJA 2H01A 3VLNA 1J0FA 2YCDA 1TRWA 3DD3A 1DSBA 4ECBA 5COHA 1AQVA 1YZXA 3WGEA 4FH8A 2DIZA 3VFIA 5FHIA 3BBYA 2H6XA 2VLVA 4JEDA 1HNAA 3A2WA 2PVOC 4MP4A 1GSFA 3IR4A 1URMA 2A4HA 3F3RA 3KGKA 5GZZB 4BWQA 1V58A 2GQKA 3ZIVA 3E9JB 3VWVA 2GSTA 5EY6A 5ENUA 4IGJA 2JZTA 2QC7A 3KTBA 1YKCA 2YWOA 3EVIA 2C3NA 2LRCA 1OC9B 2GSSA 1NW2A 3HHVA 3US3A 2KP1A 4N30A 2O89A 5ECLB 3IHGA 2JU5A 4N11A 1QK8A 2YV7A 4IN0A 3KP9A 1MDKA 3A3TA 2ZUPA 2Z9SA 2ON7A 1ILOA 3WYWA 3FEUA 4F2IA 1HQOA 4OCFA 1SK1A 4J56E 4MJBA 2PMTA 4MPFA 2HNLA 3K8NA 4H86A 2L4QA 5IO2A 3ISOA 3TRPA 2BJXA 4KGIA 2HRFA 5HFIA 1GULA 2OE0A 3GKXA 2JZRA 5GSTA 1N2AA 2N5AA 2VLUA 4EIPA 2WGRA 3IK7A 5IIZA 5GAND 3A5WA 2LNSA 2TIRA 3C73A 3TKQA 2N5FA 1HD2A 2CX3A 2H8LA 1BX9A 3MIXA 1Y6EA 2OKAA 1F3AA 5AIVA 1V98A 4K5RA 2YJHA 3I6AA 1A23A 5JCWA 1WPIA 4XS4A 2YN1A 1W89A 4QL7A 4WBJA 4EDYA 4ECCA 2L5OA 4IQAA 8GSSA 4Z2TA 3TRQA 1TU8A 3DWVA 2K6VA 2RLIA 2AUVA 4K2DA 4BIKA 3CYNA 2K9FA 4BPYA 2LSTA 3CMIA 4K6XA 2C0EA 1KTEA 3TJBA 17GSA 1VF1A 1G7OA 4POMA 2L6DA 2GS3A 4BVXA 3IAS2 5B6MA 5EPFA 5ECHB 3Q74A 2IFQA 4KUNA 1O81A 1TRSA 4Q5NA 2F9SA 2R0CA 1M7TA 3FR9A 5ID2B 1OC3A 2C0FA 1QFNA 1MD3A 1LU4A 2WULA 3C8EA 4EF0A 2HZFA 2D2ZA 4V1Ag 3IK9A 1XVQA 2VOCA 3F4SA 2QGVA 4V2NA 1X5DA 4TXOA 5DAKA 4YQUA 4I2TA 3TKSC 1OVNA 4E8HA 1XVWA 1JZDA 2AYTA 3ZREA 2GSRA 2YZUA 3ZVJD 1M2DA 3HVNA 1AXDA 5G2ZA 4J57E 1BYEA 3FK8A 2V32A 2RUEA 1ZZYA 5IPHA 1OE8A 4IP1A 1HNBA 1A8LA 2IMIA 3H93A 1XWAA 2GZZA 3RBTA 3UJ1A 1TJDA 4HZ4A 5BRTA 2ES7A 4MLYA 4O5RA 2R6KA 4MF5A 1OE7A 4RI6A 2JADA 3ZL5A 4XRDA 3TGZA 1SK0A 5ECOB 1OYJA 4IP6A 3IXRA 1SJZA 3G7IA 3WD6A 4F0BA 2X64A 2VM2A 2WZ9A 1T4ZA 2I81A 2CZ2A 1TTZA 1NHYA 3TOTA 2F51A 5H5RA 1K0OA 4OFTA 4POBA 4EUYA 4YAVA 2AHEA 2I3YA 3HCZA 3QDNA 5F07A 1CQHA 1G6WA 2QA1A 4EXJA 6GSXA 3GL3A 3GH9A 1AIUA 1M3JA 1C72A 1M9BA 4LA1A 1DE2A 1TDIA 2V41A 2JL4A 4POKA 1UC7A 5IMDA 2IMEA 1T3BA 3LXTA 3LG6A 1DBYA 3NZNA 3VWWA 5E4WA 1WJKA 3C71A 1XW6A 1AC1A 1XWGA 3FHKA 2ON5A 2GT6A 4RQRA 5JCUA 5F8BA 4MPGA 5EL8A 4ECJA 4N10A 1AQXA 2H1GA 1TW9A 3IC4A 5DJMA 3VI7A 4PUAA 4IVFA 2HI7A 3KEBA 3ZLPA 4IW9A 1PL2A 1OKDA 1TXXA 1THXA 2LRNA 1FOHA 3KP8A 4OCEA 2OE1A 1OC9A 1Z6NA 2K8VA 7GSSA 2B5XA 2H0IA 1QXHA 5HR1A 4Z2RA 4XTSA 2MMOA 2DLXA 4I8BA 1GTAA 2M46A 1T00A 3GV1A 1VF4A 3NIVA 4EDZA 1EWXA 1VGLA 1TOFA 3FZ9A 1PFOA 1QGVA 4GF0A 4I5QA 1ON4A 12GSA 2K18A 5KN3A 1GSQA 1H4OA 3IE3A 6GSUA 3RHBA 1BG5A 2WJUA 2FUG2 3GFKA 2XHFA 3RAZA 2H30A 3EMXA 1PX6A 2L4CA 3FZ5A 3FYGA 3QAGA 3F8UA 5CREA 3CRTA 1Z6MA 3D6IA 4TR3A 4PQIA 1GTIA 4HEA2 2DJKA 3TJJA 4QQ7A 1K3LA 4Q5FA 2HRAA 5G1KA 4ZBBA 2OACA 1R26A 1PKZA 2VCVA 2YANA 1J9BA 2OJLA 1A0RP 2L5LA 1PX7A 3M9KA 5ECRB 4KX4A 1DUGA 4K0NA 2VLTA 3IAM2 3QMXA 4HS1A 3Q19A 1XWBA 2RM5A 3UIWA 3G7JA 2MMAA 5JCGA 4AJ7A 3WT1A 2ZNMA 2P31A 3FW2A 2DKIA 1TK8B 5HFKA 4TVEA 1EP7A 4AJ8A 1Q98A 4LMWA 1FOVA 1A8YA 1MDJA 1O7UA 2H1BA 2YZHA 3D22A 1M99A 3DMLA 2HYXA 4FQUA 4GRFA 3BCIA 4NAXA 1WE0A 4WKWA 1H75A 3IDVA 1TRUA 2DKHA 1K0NA 3ZFLA 2X4AA 3H4KA 4OWYA 2PERA 3ME8A 3P2AA 2G0FA 2I4AA 2IMDA 4MCUA 1X5EA 2KP2A 4I6XA 4LL4B 3Q18A 4PQ1A 1FW1A 3QAVA 1XCCA 2OA7A 4OFNA 5ID2A 3GH6A 4L5LA 1O6JA 1Z7RA 2FHEA 3HVSA 1YEXA 2DJJA 1SKWB 1E6BA 2HSYA 3F3QA 2H71A 4TR4A 1TK0B 2H72A 3F9UA 4D73B 2R2JA 2LEGA 4AF2A 3GTUB 1CQGA 3TOUA 5A4WA 1MDIA 4JU5A 3O76A 2EIQA 3FZ4A 4MA9A 5G30A 4MJAA 2KLXA 3ERWA 3PGTA 3EU4A 4XHMA 1G7EA 3LFLA 3PPUA 1AUCA 1ZOFA 3KM6A 4CY8A 3HJPA 3F4RA 2L57A 1G0TA 2IJYA 4OFMA 2FWHA 2GGTA 3WT2A 1K3YA 4V1Ap 3C1RA 2OBIA 2HFDA 5ABRA 3EC3A 3C1SA 2M80A 3KJYA 5D73A 1PL1A 1XOBA 3LQ7A 3U6VA 2L59A 3RDWA 1N8JA 1GSUA 1Z3EA 3LJRA 1K0BA 3LW9A 4ISDA 3CXGA 3ZMKA 4KDUA 1TI1A 4CDOA 4MNNA 4GTUA 3FY7A 2WB9A 1PGTA 5G5EA 3M9JA 2R37A 2C4JA 3TUEA 4XCSA 3ZTLA 2PU9C 19GSA 2TRXA 3GA4A 3TB2A 2AB6A 1S3RA 3E0UA 2H66A 1ZL9A 2JSZA 5HQPA 2VL3A 4EL1A 3G7YA 5J41A 2LKUA 4ZBAA 2C3QA 1JHBA 4HZ2A 4YH2A 6GSVA 3BD2A 3GL5A 2BTOT 2PUKC 3LGCA 4K7OA 4G9HA 1YKAA 2V6OA 4F0CA 4KE3A 2UZ8A 2HLSA 1XIYA 2A2RA 2B3SA 5D93A 1PRXA 4MZBA 5F05A 1O73A 1DE1A 2C0DA 1O8WA 1GSYA 3QAWA 4YAPA 2R5GA 5DVBA 2VL2C 4XS6A 4IHUA 4ULXA 1EGRA 5J3RA 2AJQB 2REMA 4WR4A 2PN8A 2VCQA 2X49A 1X0RA 2X8GA 2H1AA 1X9MB 4G0IA 1M2AA 4HQSA 4BVYA 3IA1A 2YWNA 3HZ8A 3L4NA 1VF3A 2HSMA 5IOXA 4ML1A 3E3EA 2YV9A 3GKKA 4MABA 2GQMA 4TXVA 3MNGA 5LNKe 4FIWA 5CRDA 4L8EA 4FO5A 4XS1A 3TKPA 1PA3A 2LTKA 3APOA 3TJFA 1F2EA 2PGTA 3CSIA 2BMXA 4TR1B 4O32A 2CVBA 2FGXA 1T4YA 3HXSA 4TRXA 1WRYA 2FCHA 2YP6A 5G31A 2H19A 5IMAA 1EEJA 2YWMA 3APSA 3HVVA 4ICYA 4NV2A 2FWFA 2DJ2A 1XFLA 4V2MA 4DVCA 4HSCX 1YF1A 3HKRA 3C7MA 1Y25A 5H5QA 4JRRA 4OD7A 2B6MA 4K9ZA 3F63A 1BAYA 1SD9A 4GQCA 4F82A 2LNTA 3CSHA 3H79A 1QQ2A 5F0GA 2DJ1A 1XW9A 2GDRA 3GX8A 1SENA 1MTCA 3UL3A 1B48A 4Z7XA 4X4JA 4GSTA 4PX1A 4K2XA 4NV5A 4GXZA 3UBKA 2VM1A 2WRTA 5ECPB 2PBJA 5HFGA 2DIYA 3HA9A 2HSHA 2GZPA 3DVXA 3I43A 3UAPA 4OO5A 5D96A 4NMUA 1ZGNA 3BCKA 2B7KA 1JLVA 3MWHA 2B7JA 3IRAA 5IQYA 6GSSA 3D4TA 4TN8A 3ERGA 3BOAA 4WR5A 2IMKA 5B6NA 3GHAA 4D73A 5IPGA 1V9WA 1U3IA 3GTUA 2DMLA 3UVHA 1A2MA 1Z5YE 4RUVA 4NXIA 5ECNB 4GWRA 5ECQB 1YF0A 2VCWA 4J2FA 1O8XA 3KMOA 3M0FA 1ERTA 4KSMA 2HT9A 2HRNA 4G0KA 3QOUA 5DBQA 5D9WA 1A24A 1V57A 1TU7A 1M9AA 2P5RA 4GCIA 4HQZA 3F6DA 2IN3A 3HDCA
chains in the Genus database with same CATH topology
3U5RE 2HRKA 3G9BA 2LV3A 1A2LA 4YKGA 2A2SA 2DC5A 1R4WA 1SJIA 1GUHA 5DCHA 2R4VA 2QA2A 4IELA 3HZ4A 3TCOA 3GKMA 2O87A 5KN0A 2YOIA 3I69A 4JBBA 3TKRA 1KBNA 4BL7B 2YWIA 1SKSB 2KHPA 3FR3A 1XBSA 2VAFA 4MZCA 3L78A 13GSA 3DXBA 3ZMLA 4A5PA 9GSSA 3N9JA 3S9FA 2G2QA 3FR6A 5JWOB 3DRNA 2LJRA 1GTBA 3F0IA 3EMPA 4ZBDA 2WDUA 1ZMAA 2B1LA 3NOFA 3IPZA 2EC4A 1TI3A 1XWKA 4XRAA 3W8JA 5J9CA 3GMFA 4TR0A 5ECSA 1TKDB 4G2EA 5IMZA 1GUKA 4EC0A 1RQMA 1GSDA 2O8VB 2CQ9A 2VO4A 3ME7A 4TOPA 1EOGA 1JZOA 2A2PA 2VIMA 2VCXA 4LMVA 2NBSA 3MYDA 4K0GA 4DSQA 3W8SA 1FO5A 3R2QA 3LXZA 1V2AA 1WOUA 2WCIA 2KUCA 4O5QA 2LQQA 1S3CA 1O85A 2YPMA 3EPTA 3FKFA 1K3OA 2VCZA 5A5KA 1OKTA 1X5CA 2H6ZA 4F9ZA 2F8FA 3HYPA 1SL0B 4NWYA 2DSAA 1S3AA 5CP1A 1M0UA 4JR4A 3UBLA 6GSWA 1XWCA 2H74A 3FRCA 1GSSA 4HI7A 5C00A 5CRHA 2LRTA 1SL1B 5FT3A 5LCZA 4KW6A 4JR6A 3GN3A 2NVLA 3D5JA 5J4UA 3DYRA 2FA4A 1ML6A 2AAWA 3QCPA 2L6CA 3ZYWA 2WFCA 3IC8A 4BA7A 2F8AA 1QMVA 3GSTA 1FAAA 2MBSA 4CHSA 3SBCA 1U88A 4TR1A 1OC8A 4POLA 1FVJA 2H76A 20GSA 2CX4A 1PMTA 5IMVA 1NHOA 2OE3A 4MJCA 3IHQA 1G6YA 1GNWA 3EE2A 1ZYQB 2PWJA 1GNEA 1YY7A 4X1UA 3KIJA 2GSQA 4Q5QA 5IO0A 3M1GA 4KDYA 3A2XA 2LJAA 5D9TA 4CW9A 1EP8A 4HUAA 4PURA 4GSNA 3L9UA 5C04A 1KNGA 4K5SA 4HU7A 2GQLA 4ZB9A 5KOWA 2B5YA 2VD1A 2C1YA 1JLWA 1PN9A 5CRWA 1GL8A 4IQ1A 2V2GA 3Q6OA 4KF9A 4PQHA 4ML6A 5HR3A 3CBUA 1F3BA 5CYYA 5JWQB 1ABAA 1Q4JA 1UN2A 1THOA 2RM6A 4RQXA 4ZIJA 3LEFA 1BEDA 1T1VA 2C3TA 4KCEA 2DMMA 2M72A 3TKSA 4OMVA 1YDKA 1GSEA 3PR8A 1I9DA 2CA8A 3J7Yk 1LBKA 4YQVA 6GSYA 2XPEA 4HU9A 1HYUA 2C8UA 1U3AA 4ZL8A 2GZYA 4ZB8A 4IJIA 3KXOA 1XZOA 1HNCA 2C80A 2GLRA 4IBPA 5E59A 4KA0A 2R0PA 4ID0A 5DJLA 3LWAA 4QL9A 3VPQA 4GSSA 3HD5A 3H8QA 3GRXA 3VK9A 1B9XC 2V6KA 3JCML 22GSA 3ZITA 3WGDA 4MJEA 2H1DA 1GLQA 3GURA 4MZWA 4N0ZA 5LD0A 5CRGA 3RPNA 3J7Yb 1IYHA 3LYPA 3ZZXA 2MZCA 4MH2A 2PPTA 4F03A 1PD21 3GX0A 3LYKA 3EYTA 1WIKA 2H75A 4PGTA 2LQOA 1PQNA 4TKYA 3KZQA 3UVTA 1MEKA 2A4VA 4ECIA 1IYIA 2QKEA 5D9VA 1SKRB 5IMFA 4JZQA 1AW9A 5CO3A 5KN1A 4BL7A 3F4TA 3LSZA 1B9YC 3ZVJA 2IPAA 4NHWA 2IIYA 2JZSA 4HDEA 4JE1A 4EO3A 1U87A 1W4VA 1BJXA 1TP9A 4WXTA 3D0ZA 2KOKA 4WETA 5JWRB 5DALB 5INYA 3F6FA 3OR5A 5IMCA 4MF6A 4Z2UA 2RIIA 2O85A 3I9V2 3QFAC 1B4QA 3DGQA 3VWXA 1FB0A 3CTFA 5G1LA 3QD9A 4WEYA 3GYKA 2EIOA 5A4VA 1ERWA 1PKWA 2MYGA 3KTLA 2HXKA 2YNXA 2HE3A 3RPPA 4K7NA 2ZCTA 3DKSA 1JZWA 2I9HA 1PSQA 3N5OA 2VUPA 4KCAA 3TDGA 1XPVA 4L0UA 4WBRD 1K0DA 3ED3A 1YJ6A 3TJGA 2CV4A 14GSA 1F37A 3UEMA 5IOWA 4MMMA 4EKZA 4GLTA 1QUWA 3VPTA 3KD0A 1T7PB 1K0CA 4MF7A 1EZKA 4PUFC 2WS2A 1RW1A 3CSJA 1YEPA 1I5GA 3W6GA 2QSIA 3CTGA 1F9MA 4ZB6A 5D9XA 1FB6A 4O7HA 10GSA 5D8IA 1R5PA 4RI7A 18GSA 5HR0A 4YKFA 2IL3A 4EVMA 3D4MA 3QFBC 5G5FA 2ALBA 4KDXA 1K0MA 1UVZA 3ZRDA 1Z7PA 3M3MA 3FZAA 4HJ2A 2HZEB 2DBCA 2R3XA 5ECMB 3TKSE 4I2UA 2NTOA 3IV4A 1X9SB 1JZRA 1ST9A 3L9SA 5ELAA 1WWJA 3GUSA 1ZYNA 5BMUA 3EWLA 4AGSA 1SD8A 2MBTA 3PH9A 1GWCA 3DVWA 4XIHA 3ZFBA 2FLSA 4KB3A 2CVKA 1SU9A 3SWLA 5B8AA 4K8MA 3VI5A 3GNJA 5IM9A 2EIRA 5L71A 4N0VA 5ECIB 2F3MA 4DSSB 1OAZA 5J5NA 2XBQA 2DJ0A 3CRUA 4X0XA 5DQSA 1LJRA 4PNGA 4FYUA 1B4PA 4O5UA 4Q5RA 3IOSA 5B7CA 4NPBA 2CVDA 3VURA 3HVXA 1SL2B 1EOHA 1FHEA 16GSA 5F06A 4ZL9A 4PTSA 3HJMA 1NM3A 3V1WA 5AGYA 3EU3A 2FWEA 4IKHA 1AQWA 3HY2A 1XW5A 2AV4A 2FY6A 3P8WA 2FA8A 2VD0A 3KMNA 2H0GA 2GTUA 4LL1B 3APQA 3BJ5A 4PXOA 4KAEA 2RUFA 2X99A 2IWTA 1VF2A 1J08A 2GT5A 4ZL7A 2JSYA 5DCGA 2E2MA 4WF5A 2R0GA 5DQYA 4G10A 5FWGA 1K0AA 3UARA 2B1KA 1SJ6A 4V2LA 1E2YA 3VWUA 3UOMA 4FYBA 4WF4A 1GH2A 2I1UA 3GSSA 1GUMA 1S3DA 3PINA 5KOXA 3GIXA 2C0GA 1EV4A 4AJ6A 2DJ3A 5J9BA 2LJKA 4KSOA 4IS0A 2H70A 3DEXA 2IMFA 5GSSA 3MDKA 4G0LA 2X8HA 5ECKB 3IBHA 3ERFA 4X43A 2CAQA 3H1NA 1TRVA 1RK4A 2K8SA 1A0FA 2OADA 1YQ1A 1BQ7A 1USBA 2N5BA 3O6TA 4MDCA 1XXUA 1GLPA 4FYCA 4ZXGA 2J9HA 1XOAA 1V40A 5AN1A 3TJKA 5GAPD 4GQFA 3QPMA 3L0HA 1Z9HA 4DSRA 4XS4B 1ZYEA 3A2VA 3L9VA 4BVYB 3WGXA 4EIQA 5CNWA 5DALA 3P90A 2OBKA 1B8XA 1R7HA 4NHZA 2XC2A 3UMAA 1EGOA 2NDOA 2FNOA 4ZILA 2JACA 3EURA 4L0WA 4L5OA 2MMNA 5EVOA 4BVXB 2LS5A 3R3EA 1SK2A 2X8CA 3DIEA 2IFQB 2MMZA 3EINA 4USSA 5B8BA 2PVQA 1T8EB 2NPBA 5KEJA 1EEMA 2VL2A 2P5QA 4O92A 5AIXA 1NSWA 4K1FA 2E0QA 2CAIA 1SYRA 4G19A 4MH3A 1ZCPA 3MSZA 1ERVA 2CT6A 1A2JA 3M8NA 1KEBA 1SYXA 5KN2A 1WMJA 4TXOB 2E2GA 4OO4A 5DAKB 1EV9A 4MK3A 2P0GA 5HR2A 3LORA 4IJ3A 1MD4A 4DEJA 1F6MC 1GRXA 3AY8A 2XBIA 2E7PA 2H0HA 1PN0A 4ILFA 4PNFA 4KH7A 1M2BA 4BWSA 2TRCP 5A4UA 4E8EA 2YJ7A 3KH7A 2GVPA 3KCMA 4ACSA 2J23A 3GKNA 4HOJA 3MAKA 2HZEA 4P3YB 11GSA 1ERUA 1TK5B 4HJMA 4I97A 1AAZA 5H5SA 2FD3A 1FG4A 2LUSA 3P7XA 1JFUA 3QR6A 6GSTA 5ELGA 4K7IA 1VRSD 1FVKA 5CAXA 3TRXA 2CZ3A 3FMWA 2VL9A 1WP0A 4CY6A 4TW5A 1ACVA 4EE0A 4KNDA 5DDLA 2FWGA 2B5EA 2O7KA 3HJOA 2XPDA 1X9WB 1GTUA 4LLRA 4YQMA 2VCTA 4DSSA 3RHCA 3KH9A 2H73A 2H6YA 1ZYPA 3O3TA 1U6TA 1UA5A 2V1MA 3D21A 5AISA 1R5AA 1GP1A 3A5IA 3ZIJA 2H01A 3VLNA 1J0FA 2YCDA 1TRWA 3DD3A 1DSBA 4ECBA 5COHA 1AQVA 1YZXA 3WGEA 4FH8A 2DIZA 3VFIA 5FHIA 3BBYA 2H6XA 2VLVA 4JEDA 1HNAA 3A2WA 2PVOC 4MP4A 1GSFA 3IR4A 1URMA 2A4HA 3F3RA 3KGKA 5GZZB 4BWQA 1V58A 2GQKA 3ZIVA 3E9JB 3VWVA 2GSTA 5EY6A 5ENUA 4IGJA 2JZTA 2QC7A 3KTBA 1YKCA 2YWOA 3EVIA 2C3NA 2LRCA 1OC9B 2GSSA 1NW2A 3HHVA 3US3A 2KP1A 4N30A 2O89A 5ECLB 3IHGA 2JU5A 4N11A 1QK8A 2YV7A 4IN0A 3KP9A 1MDKA 3A3TA 2ZUPA 2Z9SA 2ON7A 1ILOA 3WYWA 3FEUA 4F2IA 1HQOA 4OCFA 1SK1A 4J56E 4MJBA 2PMTA 4MPFA 2HNLA 3K8NA 4H86A 2L4QA 5IO2A 3ISOA 3TRPA 2BJXA 4KGIA 2HRFA 5HFIA 1GULA 2OE0A 3GKXA 2JZRA 5GSTA 1N2AA 2N5AA 2VLUA 4EIPA 2WGRA 3IK7A 5IIZA 5GAND 3A5WA 2LNSA 2TIRA 3C73A 3TKQA 2N5FA 1HD2A 2CX3A 2H8LA 1BX9A 3MIXA 1Y6EA 2OKAA 1F3AA 5AIVA 1V98A 4K5RA 2YJHA 3I6AA 1A23A 5JCWA 1WPIA 4XS4A 2YN1A 1W89A 4QL7A 4WBJA 4EDYA 4ECCA 2L5OA 4IQAA 8GSSA 4Z2TA 3TRQA 1TU8A 3DWVA 2K6VA 2RLIA 2AUVA 4K2DA 3CYNA 2K9FA 4BPYA 2LSTA 3CMIA 4K6XA 2C0EA 1KTEA 3TJBA 17GSA 1VF1A 1G7OA 4POMA 2L6DA 2GS3A 4BVXA 3IAS2 5B6MA 5EPFA 5ECHB 3Q74A 2IFQA 4KUNA 1O81A 1TRSA 4Q5NA 2F9SA 2R0CA 1M7TA 3FR9A 5ID2B 1OC3A 2C0FA 1QFNA 1MD3A 1LU4A 2WULA 3C8EA 4EF0A 2HZFA 2D2ZA 4V1Ag 3IK9A 1XVQA 2VOCA 3F4SA 2QGVA 4V2NA 1X5DA 4TXOA 5DAKA 4YQUA 4I2TA 3TKSC 1OVNA 4E8HA 1XVWA 1JZDA 2AYTA 3ZREA 2GSRA 2YZUA 3ZVJD 1M2DA 1AXDA 5G2ZA 4J57E 1BYEA 3FK8A 2V32A 2RUEA 1ZZYA 5IPHA 1OE8A 4IP1A 1HNBA 1A8LA 2IMIA 3H93A 1XWAA 2GZZA 3RBTA 3UJ1A 1TJDA 4HZ4A 5BRTA 2ES7A 4MLYA 4O5RA 2R6KA 4MF5A 1OE7A 4RI6A 2JADA 3ZL5A 4XRDA 3TGZA 1SK0A 5ECOB 1OYJA 4IP6A 3IXRA 1SJZA 3G7IA 3WD6A 4F0BA 2X64A 2VM2A 2WZ9A 1T4ZA 2I81A 2CZ2A 1TTZA 1NHYA 3TOTA 2F51A 5H5RA 1K0OA 4OFTA 4POBA 4EUYA 4YAVA 2AHEA 2I3YA 3HCZA 3QDNA 5F07A 1CQHA 1G6WA 2QA1A 4EXJA 6GSXA 3GL3A 3GH9A 1AIUA 1C72A 1M9BA 4LA1A 1DE2A 1TDIA 2V41A 2JL4A 4POKA 1UC7A 5IMDA 2IMEA 1T3BA 3LXTA 3LG6A 1DBYA 3NZNA 3VWWA 5E4WA 1WJKA 3C71A 1XW6A 1AC1A 1XWGA 3FHKA 2ON5A 2GT6A 4RQRA 5JCUA 5F8BA 4MPGA 5EL8A 4ECJA 4N10A 1AQXA 2H1GA 1TW9A 3IC4A 5DJMA 3VI7A 4PUAA 4IVFA 2HI7A 3KEBA 3ZLPA 4IW9A 1PL2A 1OKDA 1TXXA 1THXA 2LRNA 1FOHA 3KP8A 4OCEA 2OE1A 1OC9A 1Z6NA 2K8VA 7GSSA 2B5XA 2H0IA 1QXHA 5HR1A 4Z2RA 4XTSA 2MMOA 2DLXA 4I8BA 1GTAA 2M46A 1T00A 3GV1A 1VF4A 3NIVA 4EDZA 1EWXA 1VGLA 1TOFA 3FZ9A 1QGVA 4GF0A 4I5QA 1ON4A 12GSA 2K18A 5KN3A 1GSQA 1H4OA 3IE3A 6GSUA 3RHBA 1BG5A 2WJUA 2FUG2 3GFKA 2XHFA 3RAZA 2H30A 3EMXA 1PX6A 2L4CA 3FZ5A 3FYGA 3QAGA 3F8UA 5CREA 3CRTA 1Z6MA 3D6IA 4TR3A 4PQIA 1GTIA 4HEA2 2DJKA 3TJJA 4QQ7A 1K3LA 4Q5FA 2HRAA 5G1KA 4ZBBA 2OACA 1R26A 1PKZA 2VCVA 2YANA 1J9BA 2OJLA 1A0RP 2L5LA 1PX7A 3M9KA 5ECRB 4KX4A 1DUGA 4K0NA 2VLTA 3IAM2 3QMXA 4HS1A 3Q19A 1XWBA 2RM5A 3UIWA 3G7JA 2MMAA 5JCGA 4AJ7A 3WT1A 2ZNMA 2P31A 3FW2A 2DKIA 1TK8B 5HFKA 4TVEA 1EP7A 4AJ8A 1Q98A 4LMWA 1FOVA 1A8YA 1MDJA 1O7UA 2H1BA 2YZHA 3D22A 1M99A 3DMLA 2HYXA 4FQUA 4GRFA 3BCIA 4NAXA 1WE0A 4WKWA 1H75A 3IDVA 1TRUA 2DKHA 1K0NA 3ZFLA 2X4AA 3H4KA 4OWYA 2PERA 3ME8A 3P2AA 2G0FA 2I4AA 2IMDA 4MCUA 1X5EA 2KP2A 4I6XA 4LL4B 3Q18A 4PQ1A 1FW1A 3QAVA 1XCCA 2OA7A 4OFNA 5ID2A 3GH6A 4L5LA 1O6JA 1Z7RA 2FHEA 3HVSA 1YEXA 2DJJA 1SKWB 1E6BA 2HSYA 3F3QA 2H71A 4TR4A 1TK0B 2H72A 3F9UA 4D73B 2R2JA 2LEGA 4AF2A 3GTUB 1CQGA 3TOUA 5A4WA 1MDIA 4JU5A 3O76A 2EIQA 3FZ4A 4MA9A 5G30A 4MJAA 2KLXA 3ERWA 3PGTA 3EU4A 4XHMA 1G7EA 3LFLA 3PPUA 1AUCA 1ZOFA 3KM6A 4CY8A 3HJPA 3F4RA 2L57A 1G0TA 2IJYA 4OFMA 2FWHA 2GGTA 3WT2A 1K3YA 4V1Ap 3C1RA 2OBIA 2HFDA 5ABRA 3EC3A 3C1SA 2M80A 3KJYA 5D73A 1PL1A 1XOBA 3LQ7A 3U6VA 2L59A 3RDWA 1N8JA 1GSUA 1Z3EA 3LJRA 1K0BA 3LW9A 4ISDA 3CXGA 3ZMKA 4KDUA 1TI1A 4CDOA 4MNNA 4GTUA 3FY7A 2WB9A 1PGTA 5G5EA 3M9JA 2R37A 2C4JA 3TUEA 4XCSA 3ZTLA 2PU9C 19GSA 2TRXA 3GA4A 3TB2A 2AB6A 3E0UA 2H66A 1ZL9A 2JSZA 5HQPA 2VL3A 4EL1A 3G7YA 5J41A 2LKUA 4ZBAA 2C3QA 1JHBA 4HZ2A 4YH2A 6GSVA 3BD2A 3GL5A 2BTOT 2PUKC 3LGCA 4K7OA 4G9HA 1YKAA 2V6OA 4F0CA 4KE3A 2UZ8A 2HLSA 1XIYA 2A2RA 2B3SA 5D93A 1PRXA 4MZBA 5F05A 1O73A 1DE1A 2C0DA 1O8WA 1GSYA 3QAWA 4YAPA 2R5GA 5DVBA 2VL2C 4XS6A 4IHUA 4ULXA 1EGRA 5J3RA 2AJQB 2REMA 4WR4A 2PN8A 2VCQA 2X49A 1X0RA 2X8GA 2H1AA 1X9MB 4G0IA 1M2AA 4HQSA 4BVYA 3IA1A 2YWNA 3HZ8A 3L4NA 1VF3A 2HSMA 5IOXA 4ML1A 3E3EA 2YV9A 3GKKA 4MABA 2GQMA 4TXVA 3MNGA 5LNKe 4FIWA 5CRDA 4L8EA 4FO5A 4XS1A 3TKPA 1PA3A 2LTKA 3APOA 3TJFA 1F2EA 2PGTA 3CSIA 2BMXA 4TR1B 4O32A 2CVBA 2FGXA 1T4YA 3HXSA 4TRXA 1WRYA 2FCHA 2YP6A 5G31A 2H19A 5IMAA 1EEJA 2YWMA 3APSA 3HVVA 4ICYA 4NV2A 2FWFA 2DJ2A 1XFLA 4V2MA 4DVCA 1YF1A 3HKRA 3C7MA 1Y25A 5H5QA 4JRRA 4OD7A 2B6MA 4K9ZA 3F63A 1BAYA 1SD9A 4GQCA 4F82A 2LNTA 3CSHA 3H79A 1QQ2A 5F0GA 2DJ1A 1XW9A 2GDRA 3GX8A 1SENA 1MTCA 3UL3A 1B48A 4Z7XA 4X4JA 4GSTA 4PX1A 4K2XA 4NV5A 4GXZA 3UBKA 2VM1A 2WRTA 5ECPB 2PBJA 5HFGA 2DIYA 3HA9A 2HSHA 2GZPA 3DVXA 3I43A 3UAPA 4OO5A 5D96A 4NMUA 1ZGNA 3BCKA 2B7KA 1JLVA 3MWHA 2B7JA 3IRAA 5IQYA 6GSSA 3D4TA 4TN8A 3ERGA 3BOAA 4WR5A 2IMKA 5B6NA 3GHAA 4D73A 5IPGA 1V9WA 1U3IA 3GTUA 2DMLA 3UVHA 1A2MA 1Z5YE 4RUVA 4NXIA 5ECNB 4GWRA 5ECQB 1YF0A 2VCWA 4J2FA 1O8XA 3KMOA 3M0FA 1ERTA 4KSMA 2HT9A 2HRNA 4G0KA 3QOUA 5DBQA 5D9WA 1A24A 1V57A 1TU7A 1M9AA 2P5RA 4GCIA 4HQZA 3F6DA 2IN3A 3HDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5R E;  3G9B A;  2LV3 A;  1A2L A;  2A2S A;  2DC5 A;  1R4W A;  1SJI A;  1GUH A;  5DCH A;  2R4V A;  4IEL A;  3HZ4 A;  3TCO A;  3GKM A;  2O87 A;  5KN0 A;  2YOI A;  3I69 A;  4JBB A;  3TKR A;  1KBN A;  2YWI A;  1SKS B;  2KHP A;  3FR3 A;  1XBS A;  2VAF A;  4MZC A;  3L78 A;  13GS A;  3DXB A;  3ZML A;  9GSS A;  3N9J A;  3S9F A;  2G2Q A;  3FR6 A;  5JWO B;  3DRN A;  2LJR A;  1GTB A;  3F0I A;  3EMP A;  4ZBD A;  2WDU A;  1ZMA A;  2B1L A;  3NOF A;  3IPZ A;  2EC4 A;  1TI3 A;  1XWK A;  4XRA A;  3W8J A;  5J9C A;  3GMF A;  4TR0 A;  5ECS A;  1TKD B;  4G2E A;  5IMZ A;  1GUK A;  4EC0 A;  1RQM A;  1GSD A;  2O8V B;  2CQ9 A;  2VO4 A;  3ME7 A;  4TOP A;  1EOG A;  1JZO A;  2VIM A;  2VCX A;  4LMV A;  2NBS A;  4K0G A;  4DSQ A;  3W8S A;  1FO5 A;  3R2Q A;  3LXZ A;  1V2A A;  1WOU A;  2WCI A;  2KUC A;  2LQQ A;  1S3C A;  1O85 A;  2YPM A;  3FKF A;  1K3O A;  2VCZ A;  5A5K A;  1OKT A;  1X5C A;  2H6Z A;  4F9Z A;  2F8F A;  3HYP A;  1SL0 B;  4NWY A;  2DSA A;  1S3A A;  5CP1 A;  1M0U A;  4JR4 A;  3UBL A;  6GSW A;  1XWC A;  2H74 A;  3FRC A;  1GSS A;  4HI7 A;  5C00 A;  5CRH A;  2LRT A;  1SL1 B;  5FT3 A;  5LCZ A;  4KW6 A;  4JR6 A;  3GN3 A;  2NVL A;  3D5J A;  5J4U A;  3DYR A;  2FA4 A;  1ML6 A;  2AAW A;  3QCP A;  2L6C A;  3ZYW A;  2WFC A;  4BA7 A;  2F8A A;  1QMV A;  3GST A;  1FAA A;  2MBS A;  4CHS A;  3SBC A;  1U88 A;  4TR1 A;  1OC8 A;  4POL A;  1FVJ A;  2H76 A;  20GS A;  2CX4 A;  1PMT A;  5IMV A;  1NHO A;  2OE3 A;  4MJC A;  3IHQ A;  1G6Y A;  1GNW A;  3EE2 A;  1ZYQ B;  2PWJ A;  1GNE A;  1YY7 A;  4X1U A;  3KIJ A;  2GSQ A;  4Q5Q A;  5IO0 A;  3M1G A;  4KDY A;  3A2X A;  2LJA A;  5D9T A;  4CW9 A;  1EP8 A;  4HUA A;  4PUR A;  4GSN A;  3L9U A;  5C04 A;  1KNG A;  4HU7 A;  2GQL A;  4ZB9 A;  2B5Y A;  2VD1 A;  2C1Y A;  1JLW A;  1PN9 A;  5CRW A;  1GL8 A;  4IQ1 A;  2V2G A;  3Q6O A;  4PQH A;  4ML6 A;  5HR3 A;  3CBU A;  1F3B A;  5CYY A;  5JWQ B;  1ABA A;  1Q4J A;  1UN2 A;  1THO A;  2RM6 A;  4RQX A;  4ZIJ A;  3LEF A;  1BED A;  1T1V A;  2C3T A;  4KCE A;  2DMM A;  2M72 A;  3TKS A;  4OMV A;  1YDK A;  1GSE A;  3PR8 A;  1I9D A;  2CA8 A;  3J7Y k;  1LBK A;  4YQV A;  6GSY A;  2XPE A;  4HU9 A;  1HYU A;  2C8U A;  1U3A A;  4ZL8 A;  2GZY A;  4ZB8 A;  4IJI A;  3KXO A;  1XZO A;  1HNC A;  2C80 A;  2GLR A;  4IBP A;  5E59 A;  4KA0 A;  5DJL A;  4ID0 A;  3LWA A;  4QL9 A;  3VPQ A;  4GSS A;  3HD5 A;  3H8Q A;  3GRX A;  3VK9 A;  1B9X C;  2V6K A;  3JCM L;  22GS A;  3ZIT A;  3WGD A;  4MJE A;  2H1D A;  1GLQ A;  3GUR A;  4MZW A;  4N0Z A;  5LD0 A;  5CRG A;  3RPN A;  3J7Y b;  1IYH A;  3LYP A;  3ZZX A;  2MZC A;  4MH2 A;  2PPT A;  4F03 A;  1PD2 1;  3GX0 A;  3LYK A;  3EYT A;  1WIK A;  2H75 A;  4PGT A;  2LQO A;  1PQN A;  4TKY A;  3KZQ A;  3UVT A;  1MEK A;  2A4V A;  4ECI A;  1IYI A;  2QKE A;  5D9V A;  1SKR B;  5IMF A;  4JZQ A;  1AW9 A;  5CO3 A;  5KN1 A;  4BL7 A;  3F4T A;  3LSZ A;  1B9Y C;  3ZVJ A;  2IPA A;  4NHW A;  2IIY A;  2JZS A;  4HDE A;  4JE1 A;  4EO3 A;  1U87 A;  1W4V A;  1BJX A;  1TP9 A;  4WXT A;  3D0Z A;  2KOK A;  4WET A;  5JWR B;  5DAL B;  5INY A;  3F6F A;  3OR5 A;  5IMC A;  4MF6 A;  2RII A;  2O85 A;  3I9V 2;  3QFA C;  1B4Q A;  3DGQ A;  3VWX A;  1FB0 A;  3CTF A;  5G1L A;  3QD9 A;  4WEY A;  3GYK A;  2EIO A;  5A4V A;  1ERW A;  1PKW A;  2MYG A;  3KTL A;  2HXK A;  2YNX A;  2HE3 A;  3RPP A;  4K7N A;  2ZCT A;  3DKS A;  1JZW A;  2I9H A;  1PSQ A;  3N5O A;  2VUP A;  4KCA A;  3TDG A;  1XPV A;  4L0U A;  4WBR D;  1K0D A;  3ED3 A;  1YJ6 A;  3TJG A;  2CV4 A;  14GS A;  1F37 A;  3UEM A;  5IOW A;  4MMM A;  4EKZ A;  4GLT A;  1QUW A;  3VPT A;  3KD0 A;  1T7P B;  1K0C A;  4MF7 A;  1EZK A;  4PUF C;  2WS2 A;  1RW1 A;  3CSJ A;  1YEP A;  1I5G A;  3W6G A;  2QSI A;  3CTG A;  1F9M A;  4ZB6 A;  5D9X A;  1FB6 A;  4O7H A;  10GS A;  5D8I A;  1R5P A;  4RI7 A;  18GS A;  5HR0 A;  2IL3 A;  4EVM A;  3D4M A;  3QFB C;  5G5F A;  2ALB A;  4KDX A;  1K0M A;  1UVZ A;  3ZRD A;  1Z7P A;  3M3M A;  3FZA A;  4HJ2 A;  2HZE B;  2DBC A;  2R3X A;  5ECM B;  3TKS E;  4I2U A;  2NTO A;  3IV4 A;  1X9S B;  1JZR A;  1ST9 A;  3L9S A;  5ELA A;  1WWJ A;  3GUS A;  3EWL A;  4AGS A;  1SD8 A;  2MBT A;  3PH9 A;  1GWC A;  3DVW A;  4XIH A;  3ZFB A;  2FLS A;  4KB3 A;  2CVK A;  1SU9 A;  3SWL A;  5B8A A;  4K8M A;  3VI5 A;  3GNJ A;  5IM9 A;  2EIR A;  5L71 A;  4N0V A;  5ECI B;  2F3M A;  4DSS B;  1OAZ A;  5J5N A;  2XBQ A;  2DJ0 A;  3CRU A;  4X0X A;  5DQS A;  1LJR A;  4PNG A;  4FYU A;  1B4P A;  4Q5R A;  3IOS A;  5B7C A;  4NPB A;  2CVD A;  3VUR A;  3HVX A;  1SL2 B;  1EOH A;  1FHE A;  16GS A;  5F06 A;  4ZL9 A;  3HJM A;  1NM3 A;  3V1W A;  5AGY A;  3EU3 A;  2FWE A;  4IKH A;  1AQW A;  3HY2 A;  1XW5 A;  2AV4 A;  2FY6 A;  3P8W A;  2FA8 A;  2VD0 A;  3KMN A;  2H0G A;  2GTU A;  4LL1 B;  3APQ A;  3BJ5 A;  4PXO A;  4KAE A;  2RUF A;  2X99 A;  2IWT A;  1VF2 A;  1J08 A;  2GT5 A;  4ZL7 A;  2JSY A;  5DCG A;  2E2M A;  4WF5 A;  5DQY A;  4G10 A;  5FWG A;  1K0A A;  3UAR A;  2B1K A;  1SJ6 A;  4V2L A;  1E2Y A;  3VWU A;  3UOM A;  4FYB A;  4WF4 A;  1GH2 A;  2I1U A;  3GSS A;  1GUM A;  1S3D A;  3PIN A;  3GIX A;  2C0G A;  1EV4 A;  4AJ6 A;  2DJ3 A;  5J9B A;  2LJK A;  4KSO A;  4IS0 A;  2H70 A;  3DEX A;  2IMF A;  5GSS A;  3MDK A;  2X8H A;  5ECK B;  3IBH A;  3ERF A;  4X43 A;  2CAQ A;  3H1N A;  1TRV A;  1RK4 A;  2K8S A;  1A0F A;  2OAD A;  1YQ1 A;  1BQ7 A;  1USB A;  2N5B A;  3O6T A;  4MDC A;  1XXU A;  1GLP A;  4FYC A;  4ZXG A;  2J9H A;  1XOA A;  1V40 A;  5AN1 A;  3TJK A;  5GAP D;  4GQF A;  3QPM A;  3L0H A;  1Z9H A;  4DSR A;  4XS4 B;  1ZYE A;  3A2V A;  3L9V A;  3WGX A;  5CNW A;  5DAL A;  3P90 A;  2OBK A;  1B8X A;  1R7H A;  4NHZ A;  2XC2 A;  3UMA A;  1EGO A;  2NDO A;  2FNO A;  4ZIL A;  2JAC A;  3EUR A;  4L0W A;  4L5O A;  2MMN A;  5EVO A;  2LS5 A;  1SK2 A;  2X8C A;  3DIE A;  2IFQ B;  2MMZ A;  3EIN A;  5B8B A;  2PVQ A;  1T8E B;  2NPB A;  5KEJ A;  1EEM A;  2VL2 A;  2P5Q A;  4O92 A;  5AIX A;  1NSW A;  4K1F A;  2E0Q A;  2CAI A;  1SYR A;  4G19 A;  4MH3 A;  1ZCP A;  3MSZ A;  1ERV A;  2CT6 A;  1A2J A;  3M8N A;  1KEB A;  1SYX A;  5KN2 A;  1WMJ A;  4TXO B;  2E2G A;  4OO4 A;  5DAK B;  1EV9 A;  4MK3 A;  2P0G A;  5HR2 A;  3LOR A;  4IJ3 A;  1MD4 A;  4DEJ A;  1F6M C;  1GRX A;  3AY8 A;  2XBI A;  2E7P A;  2H0H A;  4ILF A;  4PNF A;  4KH7 A;  1M2B A;  4BWS A;  2TRC P;  5A4U A;  4E8E A;  2YJ7 A;  3KH7 A;  2GVP A;  3KCM A;  4ACS A;  2J23 A;  3GKN A;  4HOJ A;  3MAK A;  2HZE A;  4P3Y B;  11GS A;  1ERU A;  1TK5 B;  4HJM A;  4I97 A;  1AAZ A;  5H5S A;  2FD3 A;  1FG4 A;  2LUS A;  3P7X A;  1JFU A;  3QR6 A;  6GST A;  5ELG A;  4K7I A;  1VRS D;  1FVK A;  5CAX A;  3TRX A;  2CZ3 A;  2VL9 A;  1WP0 A;  4TW5 A;  1ACV A;  4EE0 A;  4KND A;  5DDL A;  2FWG A;  2B5E A;  2O7K A;  3HJO A;  2XPD A;  1X9W B;  1GTU A;  4LLR A;  4YQM A;  2VCT A;  4DSS A;  3RHC A;  3KH9 A;  2H73 A;  2H6Y A;  3O3T A;  1U6T A;  1UA5 A;  2V1M A;  3D21 A;  5AIS A;  1R5A A;  1GP1 A;  3ZIJ A;  2H01 A;  3VLN A;  1J0F A;  2YCD A;  1TRW A;  3DD3 A;  1DSB A;  4ECB A;  5COH A;  1AQV A;  1YZX A;  3WGE A;  4FH8 A;  2DIZ A;  3VFI A;  5FHI A;  3BBY A;  2H6X A;  2VLV A;  4JED A;  1HNA A;  3A2W A;  2PVO C;  4MP4 A;  1GSF A;  3IR4 A;  1URM A;  3F3R A;  3KGK A;  5GZZ B;  4BWQ A;  1V58 A;  2GQK A;  3ZIV A;  3E9J B;  3VWV A;  2GST A;  5EY6 A;  5ENU A;  4IGJ A;  2JZT A;  2QC7 A;  3KTB A;  1YKC A;  2YWO A;  3EVI A;  2C3N A;  2LRC A;  1OC9 B;  2GSS A;  1NW2 A;  3HHV A;  3US3 A;  2KP1 A;  4N30 A;  2O89 A;  5ECL B;  4N11 A;  2JU5 A;  1QK8 A;  2YV7 A;  4IN0 A;  3KP9 A;  1MDK A;  3A3T A;  2ZUP A;  2Z9S A;  2ON7 A;  1ILO A;  3WYW A;  3FEU A;  4F2I A;  1HQO A;  4OCF A;  1SK1 A;  4J56 E;  4MJB A;  2PMT A;  4MPF A;  2HNL A;  3K8N A;  4H86 A;  2L4Q A;  5IO2 A;  3ISO A;  3TRP A;  2BJX A;  4KGI A;  2HRF A;  5HFI A;  1GUL A;  2OE0 A;  3GKX A;  2JZR A;  5GST A;  1N2A A;  2N5A A;  2VLU A;  2WGR A;  3IK7 A;  5IIZ A;  5GAN D;  3A5W A;  2LNS A;  2TIR A;  3C73 A;  3TKQ A;  2N5F A;  1HD2 A;  2CX3 A;  2H8L A;  1BX9 A;  1Y6E A;  2OKA A;  1F3A A;  5AIV A;  1V98 A;  2YJH A;  3I6A A;  1A23 A;  5JCW A;  1WPI A;  4XS4 A;  2YN1 A;  1W89 A;  4QL7 A;  4WBJ A;  4EDY A;  4ECC A;  2L5O A;  4IQA A;  8GSS A;  3TRQ A;  1TU8 A;  3DWV A;  2K6V A;  2RLI A;  2AUV A;  4K2D A;  3CYN A;  2K9F A;  4BPY A;  2LST A;  3CMI A;  4K6X A;  2C0E A;  1KTE A;  3TJB A;  17GS A;  1VF1 A;  1G7O A;  4POM A;  2L6D A;  2GS3 A;  4BVX A;  3IAS 2;  5B6M A;  5EPF A;  5ECH B;  3Q74 A;  2IFQ A;  4KUN A;  1O81 A;  1TRS A;  4Q5N A;  2F9S A;  1M7T A;  3FR9 A;  5ID2 B;  1OC3 A;  2C0F A;  1QFN A;  1MD3 A;  1LU4 A;  2WUL A;  3C8E A;  4EF0 A;  2HZF A;  2D2Z A;  4V1A g;  3IK9 A;  1XVQ A;  2VOC A;  3F4S A;  2QGV A;  4V2N A;  1X5D A;  4TXO A;  5DAK A;  4YQU A;  4I2T A;  3TKS C;  1OVN A;  4E8H A;  1XVW A;  1JZD A;  2AYT A;  3ZRE A;  2GSR A;  2YZU A;  3ZVJ D;  1M2D A;  1AXD A;  5G2Z A;  4J57 E;  1BYE A;  3FK8 A;  2V32 A;  2RUE A;  1ZZY A;  5IPH A;  1OE8 A;  4IP1 A;  1HNB A;  1A8L A;  2IMI A;  3H93 A;  1XWA A;  2GZZ A;  3RBT A;  3UJ1 A;  1TJD A;  4HZ4 A;  2ES7 A;  4MLY A;  4O5R A;  2R6K A;  4MF5 A;  1OE7 A;  4RI6 A;  2JAD A;  3ZL5 A;  4XRD A;  3TGZ A;  1SK0 A;  5ECO B;  1OYJ A;  4IP6 A;  3IXR A;  1SJZ A;  3G7I A;  3WD6 A;  4F0B A;  2X64 A;  2VM2 A;  2WZ9 A;  1T4Z A;  2I81 A;  2CZ2 A;  1TTZ A;  1NHY A;  3TOT A;  2F51 A;  5H5R A;  1K0O A;  4OFT A;  4POB A;  4EUY A;  4YAV A;  2AHE A;  2I3Y A;  3HCZ A;  3QDN A;  5F07 A;  1CQH A;  1G6W A;  4EXJ A;  6GSX A;  3GL3 A;  3GH9 A;  1AIU A;  1C72 A;  1M9B A;  4LA1 A;  1DE2 A;  1TDI A;  2V41 A;  2JL4 A;  4POK A;  1UC7 A;  5IMD A;  2IME A;  1T3B A;  3LXT A;  3LG6 A;  1DBY A;  3NZN A;  3VWW A;  5E4W A;  1WJK A;  3C71 A;  1XW6 A;  1AC1 A;  1XWG A;  3FHK A;  2ON5 A;  2GT6 A;  4RQR A;  5JCU A;  5F8B A;  4MPG A;  5EL8 A;  4ECJ A;  4N10 A;  1AQX A;  2H1G A;  1TW9 A;  3IC4 A;  5DJM A;  3VI7 A;  4PUA A;  4IVF A;  2HI7 A;  3KEB A;  3ZLP A;  4IW9 A;  1PL2 A;  1OKD A;  1TXX A;  1THX A;  2LRN A;  3KP8 A;  4OCE A;  2OE1 A;  1OC9 A;  1Z6N A;  2K8V A;  7GSS A;  2B5X A;  2H0I A;  1QXH A;  5HR1 A;  4XTS A;  2MMO A;  2DLX A;  4I8B A;  1GTA A;  2M46 A;  1T00 A;  3GV1 A;  1VF4 A;  3NIV A;  4EDZ A;  1EWX A;  1VGL A;  1TOF A;  3FZ9 A;  1QGV A;  4GF0 A;  4I5Q A;  1ON4 A;  12GS A;  2K18 A;  5KN3 A;  1GSQ A;  1H4O A;  3IE3 A;  6GSU A;  3RHB A;  1BG5 A;  2WJU A;  2FUG 2;  3GFK A;  2XHF A;  3RAZ A;  2H30 A;  3EMX A;  1PX6 A;  2L4C A;  3FZ5 A;  3FYG A;  3QAG A;  3F8U A;  5CRE A;  3CRT A;  1Z6M A;  3D6I A;  4TR3 A;  4PQI A;  1GTI A;  4HEA 2;  2DJK A;  3TJJ A;  4QQ7 A;  1K3L A;  4Q5F A;  5G1K A;  4ZBB A;  2OAC A;  1R26 A;  1PKZ A;  2VCV A;  2YAN A;  1J9B A;  2OJL A;  1A0R P;  2L5L A;  1PX7 A;  3M9K A;  5ECR B;  4KX4 A;  1DUG A;  4K0N A;  2VLT A;  3IAM 2;  3QMX A;  4HS1 A;  3Q19 A;  1XWB A;  2RM5 A;  3UIW A;  3G7J A;  2MMA A;  5JCG A;  4AJ7 A;  3WT1 A;  2ZNM A;  2P31 A;  3FW2 A;  1TK8 B;  5HFK A;  4TVE A;  1EP7 A;  4AJ8 A;  1Q98 A;  4LMW A;  1FOV A;  1A8Y A;  1MDJ A;  1O7U A;  2H1B A;  2YZH A;  3D22 A;  1M99 A;  3DML A;  2HYX A;  4GRF A;  3BCI A;  4NAX A;  1WE0 A;  4WKW A;  1H75 A;  3IDV A;  1TRU A;  1K0N A;  3ZFL A;  3H4K A;  4OWY A;  2PER A;  3ME8 A;  3P2A A;  2G0F A;  2I4A A;  2IMD A;  4MCU A;  1X5E A;  2KP2 A;  4I6X A;  4LL4 B;  3Q18 A;  4PQ1 A;  1FW1 A;  3QAV A;  1XCC A;  2OA7 A;  4OFN A;  5ID2 A;  3GH6 A;  4L5L A;  1O6J A;  1Z7R A;  2FHE A;  3HVS A;  1YEX A;  2DJJ A;  1SKW B;  1E6B A;  2HSY A;  3F3Q A;  2H71 A;  4TR4 A;  1TK0 B;  2H72 A;  3F9U A;  4D73 B;  2R2J A;  2LEG A;  4AF2 A;  3GTU B;  1CQG A;  3TOU A;  5A4W A;  1MDI A;  4JU5 A;  3O76 A;  2EIQ A;  3FZ4 A;  4MA9 A;  5G30 A;  4MJA A;  2KLX A;  3ERW A;  3PGT A;  3EU4 A;  4XHM A;  1G7E A;  3LFL A;  1AUC A;  1ZOF A;  3KM6 A;  3HJP A;  3F4R A;  2L57 A;  1G0T A;  2IJY A;  4OFM A;  2FWH A;  2GGT A;  3WT2 A;  1K3Y A;  4V1A p;  3C1R A;  2OBI A;  2HFD A;  5ABR A;  3EC3 A;  3C1S A;  2M80 A;  3KJY A;  5D73 A;  1PL1 A;  1XOB A;  3LQ7 A;  3U6V A;  2L59 A;  3RDW A;  1N8J A;  1GSU A;  1Z3E A;  3LJR A;  1K0B A;  4ISD A;  3CXG A;  3ZMK A;  4KDU A;  1TI1 A;  4CDO A;  4GTU A;  3FY7 A;  2WB9 A;  1PGT A;  5G5E A;  3M9J A;  2R37 A;  2C4J A;  3TUE A;  4XCS A;  3ZTL A;  2PU9 C;  19GS A;  2TRX A;  3GA4 A;  3TB2 A;  2AB6 A;  3E0U A;  2H66 A;  1ZL9 A;  2JSZ A;  5HQP A;  2VL3 A;  4EL1 A;  3G7Y A;  5J41 A;  2LKU A;  4ZBA A;  2C3Q A;  1JHB A;  4HZ2 A;  4YH2 A;  6GSV A;  3BD2 A;  3GL5 A;  2BTO T;  2PUK C;  3LGC A;  4K7O A;  4G9H A;  1YKA A;  2V6O A;  4F0C A;  4KE3 A;  2HLS A;  1XIY A;  2A2R A;  2B3S A;  5D93 A;  1PRX A;  4MZB A;  5F05 A;  1O73 A;  1DE1 A;  2C0D A;  1O8W A;  1GSY A;  3QAW A;  4YAP A;  2R5G A;  5DVB A;  2VL2 C;  4XS6 A;  4IHU A;  4ULX A;  1EGR A;  5J3R A;  2AJQ B;  2REM A;  4WR4 A;  2PN8 A;  2VCQ A;  1X0R A;  2X8G A;  2H1A A;  1X9M B;  1M2A A;  4HQS A;  4BVY A;  3IA1 A;  2YWN A;  3HZ8 A;  3L4N A;  1VF3 A;  5IOX A;  4ML1 A;  3E3E A;  2YV9 A;  3GKK A;  4MAB A;  2GQM A;  4TXV A;  3MNG A;  5LNK e;  4FIW A;  5CRD A;  4L8E A;  4FO5 A;  4XS1 A;  3TKP A;  1PA3 A;  2LTK A;  3APO A;  3TJF A;  1F2E A;  2PGT A;  3CSI A;  2BMX A;  4TR1 B;  4O32 A;  2CVB A;  2FGX A;  1T4Y A;  3HXS A;  4TRX A;  1WRY A;  2FCH A;  2YP6 A;  5G31 A;  2H19 A;  5IMA A;  1EEJ A;  2YWM A;  3APS A;  3HVV A;  4NV2 A;  2FWF A;  2DJ2 A;  1XFL A;  4V2M A;  4DVC A;  1YF1 A;  3HKR A;  3C7M A;  1Y25 A;  5H5Q A;  4JRR A;  4OD7 A;  2B6M A;  4K9Z A;  3F63 A;  1BAY A;  1SD9 A;  4GQC A;  4F82 A;  2LNT A;  3CSH A;  3H79 A;  1QQ2 A;  5F0G A;  2DJ1 A;  1XW9 A;  2GDR A;  3GX8 A;  1SEN A;  1MTC A;  3UL3 A;  1B48 A;  4Z7X A;  4GST A;  4PX1 A;  4NV5 A;  4GXZ A;  3UBK A;  2VM1 A;  2WRT A;  5ECP B;  2PBJ A;  5HFG A;  2DIY A;  3HA9 A;  2HSH A;  2GZP A;  3DVX A;  3I43 A;  3UAP A;  4OO5 A;  5D96 A;  4NMU A;  1ZGN A;  3BCK A;  2B7K A;  1JLV A;  3MWH A;  2B7J A;  3IRA A;  5IQY A;  6GSS A;  3D4T A;  4TN8 A;  3ERG A;  3BOA A;  4WR5 A;  2IMK A;  5B6N A;  3GHA A;  4D73 A;  5IPG A;  1V9W A;  1U3I A;  3GTU A;  2DML A;  3UVH A;  1A2M A;  1Z5Y E;  4RUV A;  4NXI A;  5ECN B;  4GWR A;  5ECQ B;  1YF0 A;  2VCW A;  4J2F A;  1O8X A;  3KMO A;  3M0F A;  1ERT A;  4KSM A;  2HT9 A;  2HRN A;  3QOU A;  5DBQ A;  5D9W A;  1A24 A;  1V57 A;  1TU7 A;  1M9A A;  2P5R A;  4GCI A;  4HQZ A;  3F6D A;  2IN3 A;  3HDC A; 
#chains in the Genus database with same CATH topology
 3U5R E;  2HRK A;  3G9B A;  2LV3 A;  1A2L A;  4YKG A;  2A2S A;  2DC5 A;  1R4W A;  1SJI A;  1GUH A;  5DCH A;  2R4V A;  2QA2 A;  4IEL A;  3HZ4 A;  3TCO A;  3GKM A;  2O87 A;  5KN0 A;  2YOI A;  3I69 A;  4JBB A;  3TKR A;  1KBN A;  4BL7 B;  2YWI A;  1SKS B;  2KHP A;  3FR3 A;  1XBS A;  2VAF A;  4MZC A;  3L78 A;  13GS A;  3DXB A;  3ZML A;  4A5P A;  9GSS A;  3N9J A;  3S9F A;  2G2Q A;  3FR6 A;  5JWO B;  3DRN A;  2LJR A;  1GTB A;  3F0I A;  3EMP A;  4ZBD A;  2WDU A;  1ZMA A;  2B1L A;  3NOF A;  3IPZ A;  2EC4 A;  1TI3 A;  1XWK A;  4XRA A;  3W8J A;  5J9C A;  3GMF A;  4TR0 A;  5ECS A;  1TKD B;  4G2E A;  5IMZ A;  1GUK A;  4EC0 A;  1RQM A;  1GSD A;  2O8V B;  2CQ9 A;  2VO4 A;  3ME7 A;  4TOP A;  1EOG A;  1JZO A;  2A2P A;  2VIM A;  2VCX A;  4LMV A;  2NBS A;  3MYD A;  4K0G A;  4DSQ A;  3W8S A;  1FO5 A;  3R2Q A;  3LXZ A;  1V2A A;  1WOU A;  2WCI A;  2KUC A;  4O5Q A;  2LQQ A;  1S3C A;  1O85 A;  2YPM A;  3EPT A;  3FKF A;  1K3O A;  2VCZ A;  5A5K A;  1OKT A;  1X5C A;  2H6Z A;  4F9Z A;  2F8F A;  3HYP A;  1SL0 B;  4NWY A;  2DSA A;  1S3A A;  5CP1 A;  1M0U A;  4JR4 A;  3UBL A;  6GSW A;  1XWC A;  2H74 A;  3FRC A;  1GSS A;  4HI7 A;  5C00 A;  5CRH A;  2LRT A;  1SL1 B;  5FT3 A;  5LCZ A;  4KW6 A;  4JR6 A;  3GN3 A;  2NVL A;  3D5J A;  5J4U A;  3DYR A;  2FA4 A;  1ML6 A;  2AAW A;  3QCP A;  2L6C A;  3ZYW A;  2WFC A;  3IC8 A;  4BA7 A;  2F8A A;  1QMV A;  3GST A;  1FAA A;  2MBS A;  4CHS A;  3SBC A;  1U88 A;  4TR1 A;  1OC8 A;  4POL A;  1FVJ A;  2H76 A;  20GS A;  2CX4 A;  1PMT A;  5IMV A;  1NHO A;  2OE3 A;  4MJC A;  3IHQ A;  1G6Y A;  1GNW A;  3EE2 A;  1ZYQ B;  2PWJ A;  1GNE A;  1YY7 A;  4X1U A;  3KIJ A;  2GSQ A;  4Q5Q A;  5IO0 A;  3M1G A;  4KDY A;  3A2X A;  2LJA A;  5D9T A;  4CW9 A;  1EP8 A;  4HUA A;  4PUR A;  4GSN A;  3L9U A;  5C04 A;  1KNG A;  4K5S A;  4HU7 A;  2GQL A;  4ZB9 A;  5KOW A;  1M3I A;  2B5Y A;  2VD1 A;  2C1Y A;  1JLW A;  1PN9 A;  5CRW A;  1GL8 A;  4IQ1 A;  2V2G A;  3Q6O A;  4KF9 A;  4PQH A;  4ML6 A;  5HR3 A;  3CBU A;  1F3B A;  5CYY A;  5JWQ B;  1ABA A;  1Q4J A;  1UN2 A;  1THO A;  2RM6 A;  4RQX A;  4ZIJ A;  3LEF A;  1BED A;  1T1V A;  2C3T A;  4KCE A;  2DMM A;  2M72 A;  3TKS A;  4OMV A;  1YDK A;  1GSE A;  3PR8 A;  1I9D A;  2CA8 A;  3J7Y k;  1LBK A;  4YQV A;  6GSY A;  2XPE A;  4HU9 A;  1HYU A;  2C8U A;  1U3A A;  4ZL8 A;  2GZY A;  4ZB8 A;  4IJI A;  3KXO A;  1XZO A;  1HNC A;  2C80 A;  2GLR A;  4IBP A;  5E59 A;  4KA0 A;  2R0P A;  4ID0 A;  5DJL A;  3LWA A;  4QL9 A;  3VPQ A;  4GSS A;  3HD5 A;  3H8Q A;  3GRX A;  3VK9 A;  1B9X C;  2V6K A;  3JCM L;  22GS A;  3ZIT A;  3WGD A;  4MJE A;  2H1D A;  1GLQ A;  3GUR A;  4MZW A;  4N0Z A;  5LD0 A;  5CRG A;  3RPN A;  3J7Y b;  1IYH A;  3LYP A;  3ZZX A;  2MZC A;  4MH2 A;  2PPT A;  4F03 A;  1PD2 1;  3GX0 A;  3LYK A;  3EYT A;  1WIK A;  2H75 A;  4PGT A;  2LQO A;  1PQN A;  4TKY A;  3KZQ A;  3UVT A;  1MEK A;  2A4V A;  4ECI A;  1IYI A;  2QKE A;  5D9V A;  1SKR B;  5IMF A;  4JZQ A;  1AW9 A;  5CO3 A;  5KN1 A;  4BL7 A;  3F4T A;  3LSZ A;  1B9Y C;  3ZVJ A;  2IPA A;  4NHW A;  2IIY A;  2JZS A;  4HDE A;  4JE1 A;  4EO3 A;  1U87 A;  1W4V A;  1BJX A;  1TP9 A;  4WXT A;  3D0Z A;  2KOK A;  4WET A;  5JWR B;  5DAL B;  5INY A;  3F6F A;  3OR5 A;  5IMC A;  4MF6 A;  4Z2U A;  2RII A;  2O85 A;  3I9V 2;  3QFA C;  1B4Q A;  3DGQ A;  3VWX A;  1FB0 A;  3CTF A;  5G1L A;  3QD9 A;  4WEY A;  3GYK A;  2EIO A;  5A4V A;  1ERW A;  1PKW A;  2MYG A;  3KTL A;  2HXK A;  2YNX A;  2HE3 A;  3RPP A;  4K7N A;  2ZCT A;  3DKS A;  1JZW A;  2I9H A;  1PSQ A;  3N5O A;  2VUP A;  4KCA A;  3TDG A;  1XPV A;  4L0U A;  4WBR D;  1K0D A;  3ED3 A;  1YJ6 A;  3TJG A;  2CV4 A;  14GS A;  1F37 A;  3UEM A;  5IOW A;  4MMM A;  4EKZ A;  4GLT A;  1QUW A;  3VPT A;  3KD0 A;  1T7P B;  1K0C A;  4MF7 A;  1EZK A;  4PUF C;  2WS2 A;  1RW1 A;  3CSJ A;  1YEP A;  1I5G A;  3W6G A;  2QSI A;  3CTG A;  1F9M A;  4ZB6 A;  5D9X A;  1FB6 A;  4O7H A;  10GS A;  5D8I A;  1R5P A;  4RI7 A;  18GS A;  5HR0 A;  4YKF A;  2IL3 A;  4EVM A;  3D4M A;  3QFB C;  5G5F A;  2ALB A;  4KDX A;  1K0M A;  1UVZ A;  3ZRD A;  1Z7P A;  1XG8 A;  3M3M A;  3FZA A;  4HJ2 A;  2HZE B;  2DBC A;  2R3X A;  5ECM B;  3TKS E;  4I2U A;  2NTO A;  3IV4 A;  1X9S B;  1JZR A;  1ST9 A;  3L9S A;  5ELA A;  1WWJ A;  3GUS A;  1ZYN A;  5BMU A;  3EWL A;  4AGS A;  1SD8 A;  2MBT A;  3PH9 A;  1GWC A;  3DVW A;  4XIH A;  3ZFB A;  2FLS A;  4KB3 A;  2CVK A;  1SU9 A;  3SWL A;  5B8A A;  4K8M A;  3VI5 A;  3GNJ A;  5IM9 A;  2EIR A;  5L71 A;  4N0V A;  5ECI B;  2F3M A;  4DSS B;  1OAZ A;  5J5N A;  2XBQ A;  2DJ0 A;  3CRU A;  4X0X A;  5DQS A;  1LJR A;  4PNG A;  4FYU A;  1B4P A;  4O5U A;  4Q5R A;  3IOS A;  5B7C A;  4NPB A;  2CVD A;  3VUR A;  3HVX A;  1SL2 B;  1EOH A;  1FHE A;  16GS A;  5F06 A;  4ZL9 A;  4PTS A;  3HJM A;  1NM3 A;  3V1W A;  5AGY A;  3EU3 A;  2FWE A;  4IKH A;  1AQW A;  3HY2 A;  1XW5 A;  2AV4 A;  2FY6 A;  3P8W A;  2FA8 A;  2VD0 A;  3KMN A;  2H0G A;  2GTU A;  3CQF A;  4LL1 B;  3APQ A;  3BJ5 A;  4PXO A;  4KAE A;  2RUF A;  2X99 A;  2IWT A;  1VF2 A;  1J08 A;  2GT5 A;  4ZL7 A;  2JSY A;  5DCG A;  2E2M A;  4WF5 A;  2R0G A;  5DQY A;  4G10 A;  5FWG A;  1K0A A;  3UAR A;  2B1K A;  1SJ6 A;  4V2L A;  1E2Y A;  3VWU A;  3UOM A;  4FYB A;  4WF4 A;  1GH2 A;  2I1U A;  3GSS A;  1GUM A;  1S3D A;  3PIN A;  5KOX A;  3GIX A;  2C0G A;  1EV4 A;  4AJ6 A;  2DJ3 A;  5J9B A;  2LJK A;  4KSO A;  4IS0 A;  2H70 A;  3DEX A;  2IMF A;  5GSS A;  3MDK A;  4G0L A;  2X8H A;  5ECK B;  3IBH A;  3ERF A;  4X43 A;  2CAQ A;  3H1N A;  1TRV A;  1RK4 A;  2K8S A;  1A0F A;  2OAD A;  1YQ1 A;  1BQ7 A;  1USB A;  2N5B A;  3O6T A;  4MDC A;  1XXU A;  1GLP A;  4FYC A;  4ZXG A;  2J9H A;  1XOA A;  1V40 A;  5AN1 A;  3TJK A;  5GAP D;  4GQF A;  3QPM A;  3L0H A;  1Z9H A;  4DSR A;  4XS4 B;  1ZYE A;  3A2V A;  3L9V A;  4BVY B;  3WGX A;  4EIQ A;  5CNW A;  5DAL A;  3P90 A;  2OBK A;  1B8X A;  1R7H A;  4NHZ A;  2XC2 A;  3UMA A;  1EGO A;  2NDO A;  2FNO A;  4ZIL A;  2JAC A;  3EUR A;  4L0W A;  4L5O A;  2MMN A;  5EVO A;  4BVX B;  2LS5 A;  3R3E A;  1SK2 A;  2X8C A;  3DIE A;  2IFQ B;  2MMZ A;  3EIN A;  4USS A;  5B8B A;  2PVQ A;  1T8E B;  2NPB A;  5KEJ A;  1EEM A;  2VL2 A;  2P5Q A;  4O92 A;  5AIX A;  1NSW A;  4K1F A;  2E0Q A;  2CAI A;  1SYR A;  4G19 A;  4MH3 A;  1ZCP A;  3MSZ A;  1ERV A;  2CT6 A;  1A2J A;  3M8N A;  1KEB A;  1SYX A;  5KN2 A;  1WMJ A;  4TXO B;  2E2G A;  4OO4 A;  5DAK B;  1EV9 A;  4MK3 A;  2P0G A;  5HR2 A;  3LOR A;  4IJ3 A;  1MD4 A;  4DEJ A;  1F6M C;  1GRX A;  3AY8 A;  2XBI A;  2E7P A;  2H0H A;  1PN0 A;  4ILF A;  4PNF A;  4KH7 A;  1M2B A;  4BWS A;  2TRC P;  5A4U A;  4E8E A;  2YJ7 A;  3KH7 A;  2GVP A;  3KCM A;  4ACS A;  2J23 A;  3GKN A;  4HOJ A;  3MAK A;  2HZE A;  4P3Y B;  11GS A;  1ERU A;  1TK5 B;  4HJM A;  4I97 A;  1AAZ A;  5H5S A;  2FD3 A;  1FG4 A;  2LUS A;  3P7X A;  1JFU A;  3QR6 A;  6GST A;  5ELG A;  4K7I A;  1VRS D;  1FVK A;  5CAX A;  3TRX A;  2CZ3 A;  3FMW A;  2VL9 A;  1WP0 A;  4CY6 A;  4TW5 A;  1ACV A;  4EE0 A;  4KND A;  5DDL A;  2FWG A;  2B5E A;  2O7K A;  3HJO A;  2XPD A;  1X9W B;  1GTU A;  4LLR A;  4YQM A;  2VCT A;  4DSS A;  3RHC A;  3KH9 A;  2H73 A;  2H6Y A;  1ZYP A;  3O3T A;  1U6T A;  1UA5 A;  2V1M A;  3D21 A;  5AIS A;  1R5A A;  1GP1 A;  3A5I A;  3ZIJ A;  2H01 A;  3VLN A;  1J0F A;  2YCD A;  1TRW A;  3DD3 A;  1DSB A;  4ECB A;  5COH A;  1AQV A;  1YZX A;  3WGE A;  4FH8 A;  2DIZ A;  3VFI A;  5FHI A;  3BBY A;  2H6X A;  2VLV A;  4JED A;  1HNA A;  3A2W A;  2PVO C;  4MP4 A;  1GSF A;  3IR4 A;  1URM A;  2A4H A;  3F3R A;  3KGK A;  5GZZ B;  4BWQ A;  1V58 A;  2GQK A;  3ZIV A;  3E9J B;  3VWV A;  2GST A;  5EY6 A;  5ENU A;  4IGJ A;  2JZT A;  2QC7 A;  3KTB A;  1YKC A;  2YWO A;  3EVI A;  2C3N A;  2LRC A;  1OC9 B;  2GSS A;  1NW2 A;  3HHV A;  3US3 A;  2KP1 A;  4N30 A;  2O89 A;  5ECL B;  3IHG A;  2JU5 A;  4N11 A;  1QK8 A;  2YV7 A;  4IN0 A;  3KP9 A;  1MDK A;  3A3T A;  2ZUP A;  2Z9S A;  2ON7 A;  1ILO A;  3WYW A;  3FEU A;  4F2I A;  1HQO A;  4OCF A;  1SK1 A;  4J56 E;  4MJB A;  2PMT A;  4MPF A;  2HNL A;  3K8N A;  4H86 A;  2L4Q A;  5IO2 A;  3ISO A;  3TRP A;  2BJX A;  4KGI A;  2HRF A;  5HFI A;  1GUL A;  2OE0 A;  3GKX A;  2JZR A;  5GST A;  1N2A A;  2N5A A;  2VLU A;  4EIP A;  2WGR A;  3IK7 A;  5IIZ A;  5GAN D;  3A5W A;  2LNS A;  2TIR A;  3C73 A;  3TKQ A;  2N5F A;  1HD2 A;  2CX3 A;  2H8L A;  1BX9 A;  3MIX A;  1Y6E A;  2OKA A;  1F3A A;  5AIV A;  1V98 A;  4K5R A;  2YJH A;  3I6A A;  1A23 A;  5JCW A;  1WPI A;  4XS4 A;  2YN1 A;  1W89 A;  4QL7 A;  4WBJ A;  4EDY A;  4ECC A;  2L5O A;  4IQA A;  8GSS A;  4Z2T A;  3TRQ A;  1TU8 A;  3DWV A;  2K6V A;  2RLI A;  2AUV A;  4K2D A;  4BIK A;  3CYN A;  2K9F A;  4BPY A;  2LST A;  3CMI A;  4K6X A;  2C0E A;  1KTE A;  3TJB A;  17GS A;  1VF1 A;  1G7O A;  4POM A;  2L6D A;  2GS3 A;  4BVX A;  3IAS 2;  5B6M A;  5EPF A;  5ECH B;  3Q74 A;  2IFQ A;  4KUN A;  1O81 A;  1TRS A;  4Q5N A;  2F9S A;  2R0C A;  1M7T A;  3FR9 A;  5ID2 B;  1OC3 A;  2C0F A;  1QFN A;  1MD3 A;  1LU4 A;  2WUL A;  3C8E A;  4EF0 A;  2HZF A;  2D2Z A;  4V1A g;  3IK9 A;  1XVQ A;  2VOC A;  3F4S A;  2QGV A;  4V2N A;  1X5D A;  4TXO A;  5DAK A;  4YQU A;  4I2T A;  3TKS C;  1OVN A;  4E8H A;  1XVW A;  1JZD A;  2AYT A;  3ZRE A;  2GSR A;  2YZU A;  3ZVJ D;  1M2D A;  3HVN A;  1AXD A;  5G2Z A;  4J57 E;  1BYE A;  3FK8 A;  2V32 A;  2RUE A;  1ZZY A;  5IPH A;  1OE8 A;  4IP1 A;  1HNB A;  1A8L A;  2IMI A;  3H93 A;  1XWA A;  2GZZ A;  3RBT A;  3UJ1 A;  1TJD A;  4HZ4 A;  5BRT A;  2ES7 A;  4MLY A;  4O5R A;  2R6K A;  4MF5 A;  1OE7 A;  4RI6 A;  2JAD A;  3ZL5 A;  4XRD A;  3TGZ A;  1SK0 A;  5ECO B;  1OYJ A;  4IP6 A;  3IXR A;  1SJZ A;  3G7I A;  3WD6 A;  4F0B A;  2X64 A;  2VM2 A;  2WZ9 A;  1T4Z A;  2I81 A;  2CZ2 A;  1TTZ A;  1NHY A;  3TOT A;  2F51 A;  5H5R A;  1K0O A;  4OFT A;  4POB A;  4EUY A;  4YAV A;  2AHE A;  2I3Y A;  3HCZ A;  3QDN A;  5F07 A;  1CQH A;  1G6W A;  2QA1 A;  4EXJ A;  6GSX A;  3GL3 A;  3GH9 A;  1AIU A;  1M3J A;  1C72 A;  1M9B A;  4LA1 A;  1DE2 A;  1TDI A;  2V41 A;  2JL4 A;  4POK A;  1UC7 A;  5IMD A;  2IME A;  1T3B A;  3LXT A;  3LG6 A;  1DBY A;  3NZN A;  3VWW A;  5E4W A;  1WJK A;  3C71 A;  1XW6 A;  1AC1 A;  1XWG A;  3FHK A;  2ON5 A;  2GT6 A;  4RQR A;  5JCU A;  5F8B A;  4MPG A;  5EL8 A;  4ECJ A;  4N10 A;  1AQX A;  2H1G A;  1TW9 A;  3IC4 A;  5DJM A;  3VI7 A;  4PUA A;  4IVF A;  2HI7 A;  3KEB A;  3ZLP A;  4IW9 A;  1PL2 A;  1OKD A;  1TXX A;  1THX A;  2LRN A;  1FOH A;  3KP8 A;  4OCE A;  2OE1 A;  1OC9 A;  1Z6N A;  2K8V A;  7GSS A;  2B5X A;  2H0I A;  1QXH A;  5HR1 A;  4Z2R A;  4XTS A;  2MMO A;  2DLX A;  4I8B A;  1GTA A;  2M46 A;  1T00 A;  3GV1 A;  1VF4 A;  3NIV A;  4EDZ A;  1EWX A;  1VGL A;  1TOF A;  3FZ9 A;  1PFO A;  1QGV A;  4GF0 A;  4I5Q A;  1ON4 A;  12GS A;  2K18 A;  5KN3 A;  1GSQ A;  1H4O A;  3IE3 A;  6GSU A;  3RHB A;  1BG5 A;  2WJU A;  2FUG 2;  3GFK A;  2XHF A;  3RAZ A;  2H30 A;  3EMX A;  1PX6 A;  2L4C A;  3FZ5 A;  3FYG A;  3QAG A;  3F8U A;  5CRE A;  3CRT A;  1Z6M A;  3D6I A;  4TR3 A;  4PQI A;  1GTI A;  4HEA 2;  2DJK A;  3TJJ A;  4QQ7 A;  1K3L A;  4Q5F A;  2HRA A;  5G1K A;  4ZBB A;  2OAC A;  1R26 A;  1PKZ A;  2VCV A;  2YAN A;  1J9B A;  2OJL A;  1A0R P;  2L5L A;  1PX7 A;  3M9K A;  5ECR B;  4KX4 A;  1DUG A;  4K0N A;  2VLT A;  3IAM 2;  3QMX A;  4HS1 A;  3Q19 A;  1XWB A;  2RM5 A;  3UIW A;  3G7J A;  2MMA A;  5JCG A;  4AJ7 A;  3WT1 A;  2ZNM A;  2P31 A;  3FW2 A;  2DKI A;  1TK8 B;  5HFK A;  4TVE A;  1EP7 A;  4AJ8 A;  1Q98 A;  4LMW A;  1FOV A;  1A8Y A;  1MDJ A;  1O7U A;  2H1B A;  2YZH A;  3D22 A;  1M99 A;  3DML A;  2HYX A;  4FQU A;  4GRF A;  3BCI A;  4NAX A;  1WE0 A;  4WKW A;  1H75 A;  3IDV A;  1TRU A;  2DKH A;  1K0N A;  3ZFL A;  2X4A A;  3H4K A;  4OWY A;  2PER A;  3ME8 A;  3P2A A;  2G0F A;  2I4A A;  2IMD A;  4MCU A;  1X5E A;  2KP2 A;  4I6X A;  4LL4 B;  3Q18 A;  4PQ1 A;  1FW1 A;  3QAV A;  1XCC A;  2OA7 A;  4OFN A;  5ID2 A;  3GH6 A;  4L5L A;  1O6J A;  1Z7R A;  2FHE A;  3HVS A;  1YEX A;  2DJJ A;  1SKW B;  1E6B A;  2HSY A;  3F3Q A;  2H71 A;  4TR4 A;  1TK0 B;  2H72 A;  3F9U A;  4D73 B;  2R2J A;  2LEG A;  4AF2 A;  3GTU B;  1CQG A;  3TOU A;  5A4W A;  1MDI A;  4JU5 A;  3O76 A;  2EIQ A;  3FZ4 A;  4MA9 A;  5G30 A;  4MJA A;  2KLX A;  3ERW A;  3PGT A;  3EU4 A;  4XHM A;  1G7E A;  3LFL A;  3PPU A;  1AUC A;  1ZOF A;  3KM6 A;  4CY8 A;  3HJP A;  3F4R A;  2L57 A;  1G0T A;  2IJY A;  4OFM A;  2FWH A;  2GGT A;  3WT2 A;  1K3Y A;  4V1A p;  3C1R A;  2OBI A;  2HFD A;  5ABR A;  3EC3 A;  3C1S A;  2M80 A;  3KJY A;  5D73 A;  1PL1 A;  1XOB A;  3LQ7 A;  3U6V A;  2L59 A;  3RDW A;  1N8J A;  1GSU A;  1Z3E A;  3LJR A;  1K0B A;  3LW9 A;  4ISD A;  3CXG A;  3ZMK A;  4KDU A;  1TI1 A;  4CDO A;  4MNN A;  4GTU A;  3FY7 A;  2WB9 A;  1PGT A;  5G5E A;  3M9J A;  2R37 A;  2C4J A;  3TUE A;  4XCS A;  3ZTL A;  2PU9 C;  19GS A;  2TRX A;  3GA4 A;  3TB2 A;  2AB6 A;  1S3R A;  3E0U A;  2H66 A;  1ZL9 A;  2JSZ A;  5HQP A;  2VL3 A;  4EL1 A;  3G7Y A;  5J41 A;  2LKU A;  4ZBA A;  2C3Q A;  1JHB A;  4HZ2 A;  4YH2 A;  6GSV A;  3BD2 A;  3GL5 A;  2BTO T;  2PUK C;  3LGC A;  4K7O A;  4G9H A;  1YKA A;  2V6O A;  4F0C A;  4KE3 A;  2UZ8 A;  2HLS A;  1XIY A;  2A2R A;  2B3S A;  5D93 A;  1PRX A;  4MZB A;  5F05 A;  1O73 A;  1DE1 A;  2C0D A;  1O8W A;  1GSY A;  3QAW A;  4YAP A;  2R5G A;  5DVB A;  2VL2 C;  4XS6 A;  4IHU A;  4ULX A;  1EGR A;  5J3R A;  2AJQ B;  2REM A;  4WR4 A;  2PN8 A;  2VCQ A;  2X49 A;  1X0R A;  2X8G A;  2H1A A;  1X9M B;  4G0I A;  1M2A A;  4HQS A;  4BVY A;  3IA1 A;  2YWN A;  3HZ8 A;  3L4N A;  1VF3 A;  2HSM A;  5IOX A;  4ML1 A;  3E3E A;  2YV9 A;  3GKK A;  4MAB A;  2GQM A;  4TXV A;  3MNG A;  5LNK e;  4FIW A;  5CRD A;  4L8E A;  4FO5 A;  4XS1 A;  3TKP A;  1PA3 A;  2LTK A;  3APO A;  3TJF A;  1F2E A;  2PGT A;  3CSI A;  2BMX A;  4TR1 B;  4O32 A;  2CVB A;  2FGX A;  1T4Y A;  3HXS A;  4TRX A;  1WRY A;  2FCH A;  2YP6 A;  5G31 A;  2H19 A;  5IMA A;  1EEJ A;  2YWM A;  3APS A;  3HVV A;  4ICY A;  4NV2 A;  2FWF A;  2DJ2 A;  1XFL A;  4V2M A;  4DVC A;  4HSC X;  1YF1 A;  3HKR A;  3C7M A;  1Y25 A;  5H5Q A;  4JRR A;  4OD7 A;  2B6M A;  4K9Z A;  3F63 A;  1BAY A;  1SD9 A;  4GQC A;  4F82 A;  2LNT A;  3CSH A;  3H79 A;  1QQ2 A;  5F0G A;  2DJ1 A;  1XW9 A;  2GDR A;  3GX8 A;  1SEN A;  1MTC A;  3UL3 A;  1B48 A;  4Z7X A;  4X4J A;  4GST A;  4PX1 A;  4K2X A;  4NV5 A;  4GXZ A;  3UBK A;  2VM1 A;  2WRT A;  5ECP B;  2PBJ A;  5HFG A;  2DIY A;  3HA9 A;  2HSH A;  2GZP A;  3DVX A;  3I43 A;  3UAP A;  4OO5 A;  5D96 A;  4NMU A;  1ZGN A;  3BCK A;  2B7K A;  1JLV A;  3MWH A;  2B7J A;  3IRA A;  5IQY A;  6GSS A;  3D4T A;  4TN8 A;  3ERG A;  3BOA A;  4WR5 A;  2IMK A;  5B6N A;  3GHA A;  4D73 A;  5IPG A;  1V9W A;  1U3I A;  3GTU A;  2DML A;  3UVH A;  1A2M A;  1Z5Y E;  4RUV A;  4NXI A;  5ECN B;  4GWR A;  5ECQ B;  1YF0 A;  2VCW A;  4J2F A;  1O8X A;  3KMO A;  3M0F A;  1ERT A;  4KSM A;  2HT9 A;  2HRN A;  4G0K A;  3QOU A;  5DBQ A;  5D9W A;  1A24 A;  1V57 A;  1TU7 A;  1M9A A;  2P5R A;  4GCI A;  4HQZ A;  3F6D A;  2IN3 A;  3HDC A; 
#chains in the Genus database with same CATH homology
 3U5R E;  2HRK A;  3G9B A;  2LV3 A;  1A2L A;  4YKG A;  2A2S A;  2DC5 A;  1R4W A;  1SJI A;  1GUH A;  5DCH A;  2R4V A;  2QA2 A;  4IEL A;  3HZ4 A;  3TCO A;  3GKM A;  2O87 A;  5KN0 A;  2YOI A;  3I69 A;  4JBB A;  3TKR A;  1KBN A;  4BL7 B;  2YWI A;  1SKS B;  2KHP A;  3FR3 A;  1XBS A;  2VAF A;  4MZC A;  3L78 A;  13GS A;  3DXB A;  3ZML A;  4A5P A;  9GSS A;  3N9J A;  3S9F A;  2G2Q A;  3FR6 A;  5JWO B;  3DRN A;  2LJR A;  1GTB A;  3F0I A;  3EMP A;  4ZBD A;  2WDU A;  1ZMA A;  2B1L A;  3NOF A;  3IPZ A;  2EC4 A;  1TI3 A;  1XWK A;  4XRA A;  3W8J A;  5J9C A;  3GMF A;  4TR0 A;  5ECS A;  1TKD B;  4G2E A;  5IMZ A;  1GUK A;  4EC0 A;  1RQM A;  1GSD A;  2O8V B;  2CQ9 A;  2VO4 A;  3ME7 A;  4TOP A;  1EOG A;  1JZO A;  2A2P A;  2VIM A;  2VCX A;  4LMV A;  2NBS A;  3MYD A;  4K0G A;  4DSQ A;  3W8S A;  1FO5 A;  3R2Q A;  3LXZ A;  1V2A A;  1WOU A;  2WCI A;  2KUC A;  4O5Q A;  2LQQ A;  1S3C A;  1O85 A;  2YPM A;  3EPT A;  3FKF A;  1K3O A;  2VCZ A;  5A5K A;  1OKT A;  1X5C A;  2H6Z A;  4F9Z A;  2F8F A;  3HYP A;  1SL0 B;  4NWY A;  2DSA A;  1S3A A;  5CP1 A;  1M0U A;  4JR4 A;  3UBL A;  6GSW A;  1XWC A;  2H74 A;  3FRC A;  1GSS A;  4HI7 A;  5C00 A;  5CRH A;  2LRT A;  1SL1 B;  5FT3 A;  5LCZ A;  4KW6 A;  4JR6 A;  3GN3 A;  2NVL A;  3D5J A;  5J4U A;  3DYR A;  2FA4 A;  1ML6 A;  2AAW A;  3QCP A;  2L6C A;  3ZYW A;  2WFC A;  3IC8 A;  4BA7 A;  2F8A A;  1QMV A;  3GST A;  1FAA A;  2MBS A;  4CHS A;  3SBC A;  1U88 A;  4TR1 A;  1OC8 A;  4POL A;  1FVJ A;  2H76 A;  20GS A;  2CX4 A;  1PMT A;  5IMV A;  1NHO A;  2OE3 A;  4MJC A;  3IHQ A;  1G6Y A;  1GNW A;  3EE2 A;  1ZYQ B;  2PWJ A;  1GNE A;  1YY7 A;  4X1U A;  3KIJ A;  2GSQ A;  4Q5Q A;  5IO0 A;  3M1G A;  4KDY A;  3A2X A;  2LJA A;  5D9T A;  4CW9 A;  1EP8 A;  4HUA A;  4PUR A;  4GSN A;  3L9U A;  5C04 A;  1KNG A;  4K5S A;  4HU7 A;  2GQL A;  4ZB9 A;  5KOW A;  2B5Y A;  2VD1 A;  2C1Y A;  1JLW A;  1PN9 A;  5CRW A;  1GL8 A;  4IQ1 A;  2V2G A;  3Q6O A;  4KF9 A;  4PQH A;  4ML6 A;  5HR3 A;  3CBU A;  1F3B A;  5CYY A;  5JWQ B;  1ABA A;  1Q4J A;  1UN2 A;  1THO A;  2RM6 A;  4RQX A;  4ZIJ A;  3LEF A;  1BED A;  1T1V A;  2C3T A;  4KCE A;  2DMM A;  2M72 A;  3TKS A;  4OMV A;  1YDK A;  1GSE A;  3PR8 A;  1I9D A;  2CA8 A;  3J7Y k;  1LBK A;  4YQV A;  6GSY A;  2XPE A;  4HU9 A;  1HYU A;  2C8U A;  1U3A A;  4ZL8 A;  2GZY A;  4ZB8 A;  4IJI A;  3KXO A;  1XZO A;  1HNC A;  2C80 A;  2GLR A;  4IBP A;  5E59 A;  4KA0 A;  2R0P A;  4ID0 A;  5DJL A;  3LWA A;  4QL9 A;  3VPQ A;  4GSS A;  3HD5 A;  3H8Q A;  3GRX A;  3VK9 A;  1B9X C;  2V6K A;  3JCM L;  22GS A;  3ZIT A;  3WGD A;  4MJE A;  2H1D A;  1GLQ A;  3GUR A;  4MZW A;  4N0Z A;  5LD0 A;  5CRG A;  3RPN A;  3J7Y b;  1IYH A;  3LYP A;  3ZZX A;  2MZC A;  4MH2 A;  2PPT A;  4F03 A;  1PD2 1;  3GX0 A;  3LYK A;  3EYT A;  1WIK A;  2H75 A;  4PGT A;  2LQO A;  1PQN A;  4TKY A;  3KZQ A;  3UVT A;  1MEK A;  2A4V A;  4ECI A;  1IYI A;  2QKE A;  5D9V A;  1SKR B;  5IMF A;  4JZQ A;  1AW9 A;  5CO3 A;  5KN1 A;  4BL7 A;  3F4T A;  3LSZ A;  1B9Y C;  3ZVJ A;  2IPA A;  4NHW A;  2IIY A;  2JZS A;  4HDE A;  4JE1 A;  4EO3 A;  1U87 A;  1W4V A;  1BJX A;  1TP9 A;  4WXT A;  3D0Z A;  2KOK A;  4WET A;  5JWR B;  5DAL B;  5INY A;  3F6F A;  3OR5 A;  5IMC A;  4MF6 A;  4Z2U A;  2RII A;  2O85 A;  3I9V 2;  3QFA C;  1B4Q A;  3DGQ A;  3VWX A;  1FB0 A;  3CTF A;  5G1L A;  3QD9 A;  4WEY A;  3GYK A;  2EIO A;  5A4V A;  1ERW A;  1PKW A;  2MYG A;  3KTL A;  2HXK A;  2YNX A;  2HE3 A;  3RPP A;  4K7N A;  2ZCT A;  3DKS A;  1JZW A;  2I9H A;  1PSQ A;  3N5O A;  2VUP A;  4KCA A;  3TDG A;  1XPV A;  4L0U A;  4WBR D;  1K0D A;  3ED3 A;  1YJ6 A;  3TJG A;  2CV4 A;  14GS A;  1F37 A;  3UEM A;  5IOW A;  4MMM A;  4EKZ A;  4GLT A;  1QUW A;  3VPT A;  3KD0 A;  1T7P B;  1K0C A;  4MF7 A;  1EZK A;  4PUF C;  2WS2 A;  1RW1 A;  3CSJ A;  1YEP A;  1I5G A;  3W6G A;  2QSI A;  3CTG A;  1F9M A;  4ZB6 A;  5D9X A;  1FB6 A;  4O7H A;  10GS A;  5D8I A;  1R5P A;  4RI7 A;  18GS A;  5HR0 A;  4YKF A;  2IL3 A;  4EVM A;  3D4M A;  3QFB C;  5G5F A;  2ALB A;  4KDX A;  1K0M A;  1UVZ A;  3ZRD A;  1Z7P A;  3M3M A;  3FZA A;  4HJ2 A;  2HZE B;  2DBC A;  2R3X A;  5ECM B;  3TKS E;  4I2U A;  2NTO A;  3IV4 A;  1X9S B;  1JZR A;  1ST9 A;  3L9S A;  5ELA A;  1WWJ A;  3GUS A;  1ZYN A;  5BMU A;  3EWL A;  4AGS A;  1SD8 A;  2MBT A;  3PH9 A;  1GWC A;  3DVW A;  4XIH A;  3ZFB A;  2FLS A;  4KB3 A;  2CVK A;  1SU9 A;  3SWL A;  5B8A A;  4K8M A;  3VI5 A;  3GNJ A;  5IM9 A;  2EIR A;  5L71 A;  4N0V A;  5ECI B;  2F3M A;  4DSS B;  1OAZ A;  5J5N A;  2XBQ A;  2DJ0 A;  3CRU A;  4X0X A;  5DQS A;  1LJR A;  4PNG A;  4FYU A;  1B4P A;  4O5U A;  4Q5R A;  3IOS A;  5B7C A;  4NPB A;  2CVD A;  3VUR A;  3HVX A;  1SL2 B;  1EOH A;  1FHE A;  16GS A;  5F06 A;  4ZL9 A;  4PTS A;  3HJM A;  1NM3 A;  3V1W A;  5AGY A;  3EU3 A;  2FWE A;  4IKH A;  1AQW A;  3HY2 A;  1XW5 A;  2AV4 A;  2FY6 A;  3P8W A;  2FA8 A;  2VD0 A;  3KMN A;  2H0G A;  2GTU A;  4LL1 B;  3APQ A;  3BJ5 A;  4PXO A;  4KAE A;  2RUF A;  2X99 A;  2IWT A;  1VF2 A;  1J08 A;  2GT5 A;  4ZL7 A;  2JSY A;  5DCG A;  2E2M A;  4WF5 A;  2R0G A;  5DQY A;  4G10 A;  5FWG A;  1K0A A;  3UAR A;  2B1K A;  1SJ6 A;  4V2L A;  1E2Y A;  3VWU A;  3UOM A;  4FYB A;  4WF4 A;  1GH2 A;  2I1U A;  3GSS A;  1GUM A;  1S3D A;  3PIN A;  5KOX A;  3GIX A;  2C0G A;  1EV4 A;  4AJ6 A;  2DJ3 A;  5J9B A;  2LJK A;  4KSO A;  4IS0 A;  2H70 A;  3DEX A;  2IMF A;  5GSS A;  3MDK A;  4G0L A;  2X8H A;  5ECK B;  3IBH A;  3ERF A;  4X43 A;  2CAQ A;  3H1N A;  1TRV A;  1RK4 A;  2K8S A;  1A0F A;  2OAD A;  1YQ1 A;  1BQ7 A;  1USB A;  2N5B A;  3O6T A;  4MDC A;  1XXU A;  1GLP A;  4FYC A;  4ZXG A;  2J9H A;  1XOA A;  1V40 A;  5AN1 A;  3TJK A;  5GAP D;  4GQF A;  3QPM A;  3L0H A;  1Z9H A;  4DSR A;  4XS4 B;  1ZYE A;  3A2V A;  3L9V A;  4BVY B;  3WGX A;  4EIQ A;  5CNW A;  5DAL A;  3P90 A;  2OBK A;  1B8X A;  1R7H A;  4NHZ A;  2XC2 A;  3UMA A;  1EGO A;  2NDO A;  2FNO A;  4ZIL A;  2JAC A;  3EUR A;  4L0W A;  4L5O A;  2MMN A;  5EVO A;  4BVX B;  2LS5 A;  3R3E A;  1SK2 A;  2X8C A;  3DIE A;  2IFQ B;  2MMZ A;  3EIN A;  4USS A;  5B8B A;  2PVQ A;  1T8E B;  2NPB A;  5KEJ A;  1EEM A;  2VL2 A;  2P5Q A;  4O92 A;  5AIX A;  1NSW A;  4K1F A;  2E0Q A;  2CAI A;  1SYR A;  4G19 A;  4MH3 A;  1ZCP A;  3MSZ A;  1ERV A;  2CT6 A;  1A2J A;  3M8N A;  1KEB A;  1SYX A;  5KN2 A;  1WMJ A;  4TXO B;  2E2G A;  4OO4 A;  5DAK B;  1EV9 A;  4MK3 A;  2P0G A;  5HR2 A;  3LOR A;  4IJ3 A;  1MD4 A;  4DEJ A;  1F6M C;  1GRX A;  3AY8 A;  2XBI A;  2E7P A;  2H0H A;  1PN0 A;  4ILF A;  4PNF A;  4KH7 A;  1M2B A;  4BWS A;  2TRC P;  5A4U A;  4E8E A;  2YJ7 A;  3KH7 A;  2GVP A;  3KCM A;  4ACS A;  2J23 A;  3GKN A;  4HOJ A;  3MAK A;  2HZE A;  4P3Y B;  11GS A;  1ERU A;  1TK5 B;  4HJM A;  4I97 A;  1AAZ A;  5H5S A;  2FD3 A;  1FG4 A;  2LUS A;  3P7X A;  1JFU A;  3QR6 A;  6GST A;  5ELG A;  4K7I A;  1VRS D;  1FVK A;  5CAX A;  3TRX A;  2CZ3 A;  3FMW A;  2VL9 A;  1WP0 A;  4CY6 A;  4TW5 A;  1ACV A;  4EE0 A;  4KND A;  5DDL A;  2FWG A;  2B5E A;  2O7K A;  3HJO A;  2XPD A;  1X9W B;  1GTU A;  4LLR A;  4YQM A;  2VCT A;  4DSS A;  3RHC A;  3KH9 A;  2H73 A;  2H6Y A;  1ZYP A;  3O3T A;  1U6T A;  1UA5 A;  2V1M A;  3D21 A;  5AIS A;  1R5A A;  1GP1 A;  3A5I A;  3ZIJ A;  2H01 A;  3VLN A;  1J0F A;  2YCD A;  1TRW A;  3DD3 A;  1DSB A;  4ECB A;  5COH A;  1AQV A;  1YZX A;  3WGE A;  4FH8 A;  2DIZ A;  3VFI A;  5FHI A;  3BBY A;  2H6X A;  2VLV A;  4JED A;  1HNA A;  3A2W A;  2PVO C;  4MP4 A;  1GSF A;  3IR4 A;  1URM A;  2A4H A;  3F3R A;  3KGK A;  5GZZ B;  4BWQ A;  1V58 A;  2GQK A;  3ZIV A;  3E9J B;  3VWV A;  2GST A;  5EY6 A;  5ENU A;  4IGJ A;  2JZT A;  2QC7 A;  3KTB A;  1YKC A;  2YWO A;  3EVI A;  2C3N A;  2LRC A;  1OC9 B;  2GSS A;  1NW2 A;  3HHV A;  3US3 A;  2KP1 A;  4N30 A;  2O89 A;  5ECL B;  3IHG A;  2JU5 A;  4N11 A;  1QK8 A;  2YV7 A;  4IN0 A;  3KP9 A;  1MDK A;  3A3T A;  2ZUP A;  2Z9S A;  2ON7 A;  1ILO A;  3WYW A;  3FEU A;  4F2I A;  1HQO A;  4OCF A;  1SK1 A;  4J56 E;  4MJB A;  2PMT A;  4MPF A;  2HNL A;  3K8N A;  4H86 A;  2L4Q A;  5IO2 A;  3ISO A;  3TRP A;  2BJX A;  4KGI A;  2HRF A;  5HFI A;  1GUL A;  2OE0 A;  3GKX A;  2JZR A;  5GST A;  1N2A A;  2N5A A;  2VLU A;  4EIP A;  2WGR A;  3IK7 A;  5IIZ A;  5GAN D;  3A5W A;  2LNS A;  2TIR A;  3C73 A;  3TKQ A;  2N5F A;  1HD2 A;  2CX3 A;  2H8L A;  1BX9 A;  3MIX A;  1Y6E A;  2OKA A;  1F3A A;  5AIV A;  1V98 A;  4K5R A;  2YJH A;  3I6A A;  1A23 A;  5JCW A;  1WPI A;  4XS4 A;  2YN1 A;  1W89 A;  4QL7 A;  4WBJ A;  4EDY A;  4ECC A;  2L5O A;  4IQA A;  8GSS A;  4Z2T A;  3TRQ A;  1TU8 A;  3DWV A;  2K6V A;  2RLI A;  2AUV A;  4K2D A;  3CYN A;  2K9F A;  4BPY A;  2LST A;  3CMI A;  4K6X A;  2C0E A;  1KTE A;  3TJB A;  17GS A;  1VF1 A;  1G7O A;  4POM A;  2L6D A;  2GS3 A;  4BVX A;  3IAS 2;  5B6M A;  5EPF A;  5ECH B;  3Q74 A;  2IFQ A;  4KUN A;  1O81 A;  1TRS A;  4Q5N A;  2F9S A;  2R0C A;  1M7T A;  3FR9 A;  5ID2 B;  1OC3 A;  2C0F A;  1QFN A;  1MD3 A;  1LU4 A;  2WUL A;  3C8E A;  4EF0 A;  2HZF A;  2D2Z A;  4V1A g;  3IK9 A;  1XVQ A;  2VOC A;  3F4S A;  2QGV A;  4V2N A;  1X5D A;  4TXO A;  5DAK A;  4YQU A;  4I2T A;  3TKS C;  1OVN A;  4E8H A;  1XVW A;  1JZD A;  2AYT A;  3ZRE A;  2GSR A;  2YZU A;  3ZVJ D;  1M2D A;  1AXD A;  5G2Z A;  4J57 E;  1BYE A;  3FK8 A;  2V32 A;  2RUE A;  1ZZY A;  5IPH A;  1OE8 A;  4IP1 A;  1HNB A;  1A8L A;  2IMI A;  3H93 A;  1XWA A;  2GZZ A;  3RBT A;  3UJ1 A;  1TJD A;  4HZ4 A;  5BRT A;  2ES7 A;  4MLY A;  4O5R A;  2R6K A;  4MF5 A;  1OE7 A;  4RI6 A;  2JAD A;  3ZL5 A;  4XRD A;  3TGZ A;  1SK0 A;  5ECO B;  1OYJ A;  4IP6 A;  3IXR A;  1SJZ A;  3G7I A;  3WD6 A;  4F0B A;  2X64 A;  2VM2 A;  2WZ9 A;  1T4Z A;  2I81 A;  2CZ2 A;  1TTZ A;  1NHY A;  3TOT A;  2F51 A;  5H5R A;  1K0O A;  4OFT A;  4POB A;  4EUY A;  4YAV A;  2AHE A;  2I3Y A;  3HCZ A;  3QDN A;  5F07 A;  1CQH A;  1G6W A;  2QA1 A;  4EXJ A;  6GSX A;  3GL3 A;  3GH9 A;  1AIU A;  1C72 A;  1M9B A;  4LA1 A;  1DE2 A;  1TDI A;  2V41 A;  2JL4 A;  4POK A;  1UC7 A;  5IMD A;  2IME A;  1T3B A;  3LXT A;  3LG6 A;  1DBY A;  3NZN A;  3VWW A;  5E4W A;  1WJK A;  3C71 A;  1XW6 A;  1AC1 A;  1XWG A;  3FHK A;  2ON5 A;  2GT6 A;  4RQR A;  5JCU A;  5F8B A;  4MPG A;  5EL8 A;  4ECJ A;  4N10 A;  1AQX A;  2H1G A;  1TW9 A;  3IC4 A;  5DJM A;  3VI7 A;  4PUA A;  4IVF A;  2HI7 A;  3KEB A;  3ZLP A;  4IW9 A;  1PL2 A;  1OKD A;  1TXX A;  1THX A;  2LRN A;  1FOH A;  3KP8 A;  4OCE A;  2OE1 A;  1OC9 A;  1Z6N A;  2K8V A;  7GSS A;  2B5X A;  2H0I A;  1QXH A;  5HR1 A;  4Z2R A;  4XTS A;  2MMO A;  2DLX A;  4I8B A;  1GTA A;  2M46 A;  1T00 A;  3GV1 A;  1VF4 A;  3NIV A;  4EDZ A;  1EWX A;  1VGL A;  1TOF A;  3FZ9 A;  1QGV A;  4GF0 A;  4I5Q A;  1ON4 A;  12GS A;  2K18 A;  5KN3 A;  1GSQ A;  1H4O A;  3IE3 A;  6GSU A;  3RHB A;  1BG5 A;  2WJU A;  2FUG 2;  3GFK A;  2XHF A;  3RAZ A;  2H30 A;  3EMX A;  1PX6 A;  2L4C A;  3FZ5 A;  3FYG A;  3QAG A;  3F8U A;  5CRE A;  3CRT A;  1Z6M A;  3D6I A;  4TR3 A;  4PQI A;  1GTI A;  4HEA 2;  2DJK A;  3TJJ A;  4QQ7 A;  1K3L A;  4Q5F A;  2HRA A;  5G1K A;  4ZBB A;  2OAC A;  1R26 A;  1PKZ A;  2VCV A;  2YAN A;  1J9B A;  2OJL A;  1A0R P;  2L5L A;  1PX7 A;  3M9K A;  5ECR B;  4KX4 A;  1DUG A;  4K0N A;  2VLT A;  3IAM 2;  3QMX A;  4HS1 A;  3Q19 A;  1XWB A;  2RM5 A;  3UIW A;  3G7J A;  2MMA A;  5JCG A;  4AJ7 A;  3WT1 A;  2ZNM A;  2P31 A;  3FW2 A;  2DKI A;  1TK8 B;  5HFK A;  4TVE A;  1EP7 A;  4AJ8 A;  1Q98 A;  4LMW A;  1FOV A;  1A8Y A;  1MDJ A;  1O7U A;  2H1B A;  2YZH A;  3D22 A;  1M99 A;  3DML A;  2HYX A;  4FQU A;  4GRF A;  3BCI A;  4NAX A;  1WE0 A;  4WKW A;  1H75 A;  3IDV A;  1TRU A;  2DKH A;  1K0N A;  3ZFL A;  2X4A A;  3H4K A;  4OWY A;  2PER A;  3ME8 A;  3P2A A;  2G0F A;  2I4A A;  2IMD A;  4MCU A;  1X5E A;  2KP2 A;  4I6X A;  4LL4 B;  3Q18 A;  4PQ1 A;  1FW1 A;  3QAV A;  1XCC A;  2OA7 A;  4OFN A;  5ID2 A;  3GH6 A;  4L5L A;  1O6J A;  1Z7R A;  2FHE A;  3HVS A;  1YEX A;  2DJJ A;  1SKW B;  1E6B A;  2HSY A;  3F3Q A;  2H71 A;  4TR4 A;  1TK0 B;  2H72 A;  3F9U A;  4D73 B;  2R2J A;  2LEG A;  4AF2 A;  3GTU B;  1CQG A;  3TOU A;  5A4W A;  1MDI A;  4JU5 A;  3O76 A;  2EIQ A;  3FZ4 A;  4MA9 A;  5G30 A;  4MJA A;  2KLX A;  3ERW A;  3PGT A;  3EU4 A;  4XHM A;  1G7E A;  3LFL A;  3PPU A;  1AUC A;  1ZOF A;  3KM6 A;  4CY8 A;  3HJP A;  3F4R A;  2L57 A;  1G0T A;  2IJY A;  4OFM A;  2FWH A;  2GGT A;  3WT2 A;  1K3Y A;  4V1A p;  3C1R A;  2OBI A;  2HFD A;  5ABR A;  3EC3 A;  3C1S A;  2M80 A;  3KJY A;  5D73 A;  1PL1 A;  1XOB A;  3LQ7 A;  3U6V A;  2L59 A;  3RDW A;  1N8J A;  1GSU A;  1Z3E A;  3LJR A;  1K0B A;  3LW9 A;  4ISD A;  3CXG A;  3ZMK A;  4KDU A;  1TI1 A;  4CDO A;  4MNN A;  4GTU A;  3FY7 A;  2WB9 A;  1PGT A;  5G5E A;  3M9J A;  2R37 A;  2C4J A;  3TUE A;  4XCS A;  3ZTL A;  2PU9 C;  19GS A;  2TRX A;  3GA4 A;  3TB2 A;  2AB6 A;  3E0U A;  2H66 A;  1ZL9 A;  2JSZ A;  5HQP A;  2VL3 A;  4EL1 A;  3G7Y A;  5J41 A;  2LKU A;  4ZBA A;  2C3Q A;  1JHB A;  4HZ2 A;  4YH2 A;  6GSV A;  3BD2 A;  3GL5 A;  2BTO T;  2PUK C;  3LGC A;  4K7O A;  4G9H A;  1YKA A;  2V6O A;  4F0C A;  4KE3 A;  2UZ8 A;  2HLS A;  1XIY A;  2A2R A;  2B3S A;  5D93 A;  1PRX A;  4MZB A;  5F05 A;  1O73 A;  1DE1 A;  2C0D A;  1O8W A;  1GSY A;  3QAW A;  4YAP A;  2R5G A;  5DVB A;  2VL2 C;  4XS6 A;  4IHU A;  4ULX A;  1EGR A;  5J3R A;  2AJQ B;  2REM A;  4WR4 A;  2PN8 A;  2VCQ A;  2X49 A;  1X0R A;  2X8G A;  2H1A A;  1X9M B;  4G0I A;  1M2A A;  4HQS A;  4BVY A;  3IA1 A;  2YWN A;  3HZ8 A;  3L4N A;  1VF3 A;  2HSM A;  5IOX A;  4ML1 A;  3E3E A;  2YV9 A;  3GKK A;  4MAB A;  2GQM A;  4TXV A;  3MNG A;  5LNK e;  4FIW A;  5CRD A;  4L8E A;  4FO5 A;  4XS1 A;  3TKP A;  1PA3 A;  2LTK A;  3APO A;  3TJF A;  1F2E A;  2PGT A;  3CSI A;  2BMX A;  4TR1 B;  4O32 A;  2CVB A;  2FGX A;  1T4Y A;  3HXS A;  4TRX A;  1WRY A;  2FCH A;  2YP6 A;  5G31 A;  2H19 A;  5IMA A;  1EEJ A;  2YWM A;  3APS A;  3HVV A;  4ICY A;  4NV2 A;  2FWF A;  2DJ2 A;  1XFL A;  4V2M A;  4DVC A;  1YF1 A;  3HKR A;  3C7M A;  1Y25 A;  5H5Q A;  4JRR A;  4OD7 A;  2B6M A;  4K9Z A;  3F63 A;  1BAY A;  1SD9 A;  4GQC A;  4F82 A;  2LNT A;  3CSH A;  3H79 A;  1QQ2 A;  5F0G A;  2DJ1 A;  1XW9 A;  2GDR A;  3GX8 A;  1SEN A;  1MTC A;  3UL3 A;  1B48 A;  4Z7X A;  4X4J A;  4GST A;  4PX1 A;  4K2X A;  4NV5 A;  4GXZ A;  3UBK A;  2VM1 A;  2WRT A;  5ECP B;  2PBJ A;  5HFG A;  2DIY A;  3HA9 A;  2HSH A;  2GZP A;  3DVX A;  3I43 A;  3UAP A;  4OO5 A;  5D96 A;  4NMU A;  1ZGN A;  3BCK A;  2B7K A;  1JLV A;  3MWH A;  2B7J A;  3IRA A;  5IQY A;  6GSS A;  3D4T A;  4TN8 A;  3ERG A;  3BOA A;  4WR5 A;  2IMK A;  5B6N A;  3GHA A;  4D73 A;  5IPG A;  1V9W A;  1U3I A;  3GTU A;  2DML A;  3UVH A;  1A2M A;  1Z5Y E;  4RUV A;  4NXI A;  5ECN B;  4GWR A;  5ECQ B;  1YF0 A;  2VCW A;  4J2F A;  1O8X A;  3KMO A;  3M0F A;  1ERT A;  4KSM A;  2HT9 A;  2HRN A;  4G0K A;  3QOU A;  5DBQ A;  5D9W A;  1A24 A;  1V57 A;  1TU7 A;  1M9A A;  2P5R A;  4GCI A;  4HQZ A;  3F6D A;  2IN3 A;  3HDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...