1X0RA

Thioredoxin peroxidase from aeropyrum pernix k1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
244
structure length
244
Chain Sequence
PGSIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLHAESATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable peroxiredoxin
publication title Crystal structure of thioredoxin peroxidase from aerobic hyperthermophilic archaeon Aeropyrum pernix K1
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 72
structure length 244
sequence length 244
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 1x0rA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x0rA01
3ERFA 1Z5YE 4D73A 1OVNA 3RAZA 4TR4A 4BPYA 2WCIA 3L9SA 4LMVA 19GSA 5HFGA 4K2DA 2CVBA 3CBUA 1QFNA 2HSYA 1TK5B 2C0GA 3BCKA 2FCHA 4MZWA 1I5GA 2H73A 3BOAA 2FWGA 1XXUA 4PNGA 4XCSA 2HSHA 1I9DA 4CW9A 3TKSE 2K9FA 2V6OA 5ECSA 2KLXA 1TU8A 3ZFLA 4XRAA 2HZEB 2NPBA 3F4RA 3GTUB 2H1GA 4XS1A 4PQHA 1N2AA 3N5OA 1PL1A 3TCOA 1ERUA 3KMOA 3KM6A 5JWRB 1YY7A 2DJ1A 2DIZA 2H19A 4V2LA 1DSBA 4IQ1A 2C0DA 4MK3A 2XPDA 4BWSA 6GSTA 4TOPA 1T7PB 4YAVA 1TU7A 4NMUA 3O3TA 4TN8A 1SENA 2LQQA 1JZDA 2YWMA 2CX4A 4MH3A 3DMLA 2OA7A 1OC3A 3BJ5A 1K0DA 1Z6NA 1IYHA 1PD21 1ERTA 4WEYA 4YQMA 4MLYA 2B6MA 4KDUA 2YWOA 3FRCA 4DSQA 2I81A 3IPZA 1AW9A 1R26A 4EL1A 4F2IA 3IC4A 2OE1A 4IN0A 3BD2A 4HZ2A 4OD7A 1FO5A 4G2EA 2X8HA 4XRDA 4IELA 1G7OA 1EWXA 1VF1A 5H5SA 4WR5A 2MBTA 4IJ3A 4POKA 5DJLA 1USBA 5ENUA 5CAXA 3CTGA 3VWXA 2H01A 2WFCA 3QAGA 3G7IA 3TB2A 5GAND 3MSZA 3CSHA 1TDIA 2YJ7A 3GX8A 4TR3A 3HXSA 3QR6A 4F82A 6GSVA 1MDIA 3HHVA 1FB0A 3KD0A 1CQHA 5D9VA 4N0ZA 2WS2A 2DSAA 4EVMA 1M9AA 4LA1A 1X0RA 3IHQA 3G7JA 4ILFA 3GKNA 2JZTA 2VAFA 1GTUA 3DD3A 5ABRA 4FH8A 3UEMA 4GSSA 4MF6A 1R4WA 1AXDA 3IAM2 4MF5A 5DBQA 3IAS2 2MBSA 4ECJA 1SK2A 5D93A 1AQWA 3K8NA 2DJ2A 4HI7A 1WIKA 1IYIA 4OO5A 3A2XA 4N10A 2DBCA 2A2RA 3L0HA 5JWOB 3V1WA 1XVQA 1K0NA 2YZHA 2GDRA 2FA8A 5J4UA 2AV4A 1GSSA 2PVOC 4HQZA 3KH9A 1FOVA 5D96A 3KTBA 2ALBA 4ECBA 3F0IA 4FYCA 5HFKA 1FW1A 2ZNMA 4BL7A 4NPBA 3RHBA 1VRSD 1HQOA 1R5AA 4JEDA 4BA7A 3FR9A 1OE7A 4KB3A 1GWCA 4ZXGA 2P31A 3MAKA 3UJ1A 2VM2A 2L6CA 2J23A 3TRPA 2WB9A 3D4MA 4LL4B 4ZBDA 2XHFA 4PURA 3EU4A 4GXZA 3F3RA 1SL0B 2R37A 1THOA 5F05A 4ZB8A 3RBTA 4ISDA 3VWWA 4K7OA 4I5QA 1BAYA 3ZYWA 1JLVA 2B1LA 1AIUA 4HS1A 2K6VA 1MTCA 1UVZA 2H0HA 3DXBA 3CSJA 5B6MA 5HR0A 1T00A 5KN2A 2ON7A 2B5XA 2IFQA 1K0MA 3KEBA 1A2LA 3FR6A 4MCUA 2VCWA 5IPGA 4I6XA 3TKSC 4AF2A 3W8SA 2GZZA 3GKXA 4NAXA 4IJIA 2H6XA 2PVQA 3CSIA 3D21A 2GZYA 1JZRA 3F6FA 4H86A 2EC4A 4F03A 1AQVA 3TGZA 1X9MB 2JSYA 5IMAA 1ABAA 2NTOA 4K6XA 4O92A 2IIYA 3APOA 4RI7A 2YV9A 4N11A 3LG6A 2AUVA 1O6JA 3APQA 2LRCA 2V1MA 2R6KA 4GLTA 2YWIA 4TRXA 4PXOA 4K1FA 4MF7A 1AQXA 1V9WA 5H5QA 3TKRA 4HDEA 3P90A 2JSZA 1FB6A 1ERVA 5AGYA 2G0FA 2K8VA 4TXOB 1XPVA 2H1BA 2PBJA 1PKZA 5DAKA 2H76A 5CNWA 4GWRA 2QC7A 4WBRD 1RK4A 5LD0A 4EE0A 5IMVA 4ZB6A 1M2AA 4ZL8A 2IMEA 3GNJA 4POBA 2NBSA 3A3TA 2M80A 4YQUA 2LTKA 3U6VA 3ED3A 5ECMB 4E8EA 4MABA 2YN1A 3OR5A 4EUYA 3O6TA 2B5EA 1WMJA 4ID0A 1N8JA 2WULA 2GSSA 3QFBC 2O85A 4GQFA 3HJPA 1TK0B 2A4VA 2MMAA 2DJKA 3F6DA 1K3YA 2CVDA 2K8SA 4DSRA 2AYTA 5L71A 4L8EA 2XC2A 3L78A 2VM1A 3M9KA 2Z9SA 4ZL7A 2EIQA 1O81A 3M9JA 3F4TA 1TP9A 5B7CA 3US3A 1MD4A 3P7XA 3R2QA 4KSMA 3QDNA 3VURA 1PL2A 1VF2A 1S3DA 3M0FA 1ML6A 2I1UA 4DSSA 3QAWA 2PGTA 1YF1A 3VWVA 4OFTA 5C04A 4AJ8A 1TJDA 1TTZA 1XZOA 5IPHA 1O85A 1URMA 5B8AA 1OC9A 2TRCP 5GAPD 1R7HA 1PSQA 1UN2A 2PMTA 5ELAA 1YKAA 2L5LA 5CRWA 3UVHA 2VL2A 5CRHA 5AN1A 2XPEA 2IJYA 3ZZXA 5AIXA 5C00A 4HZ4A 1YZXA 2B7JA 3Q6OA 1SYRA 5CREA 1A2JA 2F3MA 4IKHA 3ZVJD 1BEDA 4XHMA 1A8YA 3F63A 1X9SB 3GX0A 3BCIA 5D9XA 3NZNA 1F9MA 2O87A 3VI5A 1KNGA 4HU9A 1GSYA 2ZUPA 3QAVA 2DMMA 4WF4A 3GKKA 4I8BA 3H4KA 1SL1B 1B48A 1TI1A 2GLRA 4IW9A 5DQSA 2IMKA 3ZIJA 4TR1B 4WR4A 4ACSA 3VPQA 4L5LA 4F0BA 4HOJA 11GSA 1YEXA 2H6ZA 4GF0A 3HDCA 1OYJA 2LJKA 4MJBA 4WETA 1PX7A 2KP2A 4D73B 2C4JA 4X43A 2A2SA 3Q74A 2LNSA 2YANA 2G2QA 3GTUA 3FK8A 5IMDA 4KH7A 2KHPA 2JADA 3UMAA 3DWVA 2MMZA 2GGTA 2GZPA 2HZFA 2P5RA 3EINA 3WGDA 1JZWA 2P0GA 2MZCA 2I9HA 2P5QA 1J08A 3FR3A 3F9UA 5JCWA 1HNBA 5IMZA 1RW1A 4GSTA 1EZKA 1B4QA 3VI7A 2N5BA 2L5OA 2B5YA 1TKDB 4KDXA 3DVWA 3PR8A 2PERA 1YQ1A 2VLUA 5EVOA 3IXRA 5G1KA 3TUEA 2LV3A 1X5DA 3D4TA 3HVVA 5IO0A 1T4YA 3E3EA 1Q98A 3ME7A 2KOKA 1A2MA 5G5EA 3KTLA 4MZBA 5LCZA 2OBIA 3F3QA 4IQAA 5IOWA 5HR3A 6GSUA 2C8UA 2QSIA 1EP7A 3D22A 4I2TA 4TW5A 4E8HA 2YCDA 3KXOA 1C72A 1VF4A 1GTAA 1Z9HA 2IL3A 1B8XA 3GN3A 4XS6A 4Q5FA 1PGTA 4MJEA 5E59A 2VCXA 3IK9A 3ZMLA 3HCZA 5GSSA 3NIVA 3KP8A 1EEJA 3MDKA 3H93A 3IE3A 2RM6A 2VD0A 5KEJA 1Y25A 2CZ3A 2DJ3A 1ST9A 1JLWA 3IRAA 1V58A 4MJAA 3LGCA 5J41A 3GA4A 2L6DA 3ZITA 2TRXA 4CHSA 4J57E 3FEUA 3C1SA 6GSSA 2OE3A 1EGRA 1F6MC 4GCIA 4PX1A 2PU9C 2V32A 3GYKA 3E0UA 1G7EA 2E7PA 4OFMA 1DBYA 5IO2A 5J5NA 2D2ZA 3TKQA 5JWQB 1Z3EA 5EPFA 2CT6A 2H66A 2ES7A 1QQ2A 1YJ6A 5DVBA 1JFUA 3I43A 2M72A 2FWHA 2YJHA 4O5RA 2LEGA 4RQRA 1QK8A 3MNGA 2DJ0A 2C0FA 1CQGA 4IVFA 4ZIJA 2GQLA 3F8UA 1PN9A 4KGIA 3C73A 2CAQA 5DCHA 1ZCPA 1AAZA 2PWJA 2N5AA 3GIXA 5ID2B 3HKRA 2FNOA 1M2DA 2VUPA 2RLIA 5KN3A 1AUCA 3BBYA 2JU5A 3P8WA 3EYTA 4KNDA 4TKYA 1EGOA 3ZRDA 2DLXA 3ZTLA 3GSSA 1FVJA 3CRUA 5ECHB 4NXIA 2LKUA 2GS3A 1OC8A 1B4PA 3CYNA 5CRDA 4WF5A 3QMXA 1S3AA 3TOTA 1Y6EA 3WT2A 2OKAA 3CMIA 3A5WA 4QQ7A 1X5EA 4KCAA 3GURA 3ZREA 3UBLA 5J9BA 1GSDA 1YF0A 1XWGA 2IPAA 4X0XA 2QGVA 1GLPA 1G6YA 4NHZA 4KCEA 4MH2A 1TRUA 5HR1A 2LNTA 1MDJA 4Q5QA 1T8EB 4P3YB 3GUSA 5A4WA 3WD6A 4HUAA 4MA9A 5ECLB 4HEA2 3ERGA 4ECIA 2H8LA 4IBPA 1BG5A 1ZMAA 1K0AA 4J2FA 2R3XA 3C7MA 3LSZA 4PQIA 1GTBA 1TRWA 1T1VA 2IFQB 1W89A 4OWYA 4ZBAA 2RUEA 3GH6A 2X8CA 2I3YA 4KSOA 5ECRB 5DQYA 2PN8A 1GRXA 1EV4A 3UOMA 2OACA 1K0BA 6GSXA 3DYRA 5EL8A 1K0OA 1SL2B 2X99A 1NW2A 3VPTA 5ECKB 1A0RP 4AJ6A 1HNCA 3H8QA 3KP9A 1NSWA 5G31A 3MWHA 4XTSA 1F37A 3UL3A 5IOXA 2VOCA 2CQ9A 5ECQB 3TRXA 4OCFA 2AAWA 3KGKA 4ECCA 3PGTA 4N0VA 4MDCA 3GSTA 2JL4A 4EO3A 2HNLA 3TKPA 1TK8B 3DVXA 2C0EA 4JRRA 3LYPA 1LJRA 4JU5A 1DUGA 1BX9A 1SD8A 2IWTA 2OJLA 3KZQA 3EURA 1SKWB 2DIYA 2PPTA 1WP0A 1XVWA 1V98A 5HR2A 3IOSA 4JZQA 1V40A 2JACA 5DAKB 4J56E 5ECOB 1GLQA 4GTUA 4RQXA 3ERWA 2V2GA 3Q18A 5DALA 1XWCA 4FO5A 2HE3A 4EDZA 2FHEA 2VL3A 1T4ZA 3AY8A 4I2UA 2GVPA 1QXHA 3HVSA 1BYEA 3RDWA 4JR6A 4G9HA 4PQ1A 4AGSA 2OADA 4HJ2A 2XBQA 3IBHA 2GSTA 4V2MA 3DKSA 1EV9A 5HFIA 4ML6A 4TXVA 2X8GA 3W6GA 1LBKA 1U3AA 2IN3A 4OMVA 2BMXA 2KUCA 2R4VA 4V2NA 5G2ZA 4JBBA 3C8EA 12GSA 3U5RE 1EOHA 1PX6A 3QPMA 3DIEA 1E6BA 1GUHA 1F3AA 2VD1A 3TJFA 3LORA 1E2YA 4XS4B 2CX3A 1VGLA 2B7KA 3GL5A 5D9WA 4DSSB 4IP1A 13GSA 1SJZA 2OBKA 1HYUA 3EMPA 1ZL9A 4NV5A 2EIOA 1F2EA 2C1YA 1GL8A 4MMMA 4MJCA 1K0CA 5J9CA 1OC9B 2HI7A 2YWNA 3D0ZA 1SK0A 4PGTA 3ZMKA 2HXKA 2WDUA 4YAPA 16GSA 3IA1A 2O7KA 2VO4A 3G7YA 4FYBA 5D9TA 3HD5A 1THXA 1DE2A 7GSSA 3CRTA 3EE2A 2LJRA 1XIYA 2ON5A 5DCGA 3FZ9A 4TR1A 1SJ6A 5GZZB 1XBSA 2H0GA 2L59A 3Q19A 1XW5A 1ZZYA 5CRGA 1XFLA 2FWFA 5COHA 4PUAA 3TKSA 4DVCA 5G30A 1HD2A 5LNKe 1TXXA 4WXTA 3KCMA 3EWLA 4KE3A 4PNFA 2C3NA 2YOIA 3F4SA 3LJRA 2HZEA 2R2JA 1ERWA 2GSRA 3A2VA 4OFNA 5CP1A 1MEKA 4Q5NA 1Z6MA 6GSYA 2BJXA 3RPPA 4ZBBA 2O8VB 2VLVA 3WGEA 2RM5A 4KUNA 5J3RA 1YKCA 2R5GA 1SU9A 4XIHA 2HLSA 4CDOA 1XCCA 2RIIA 3H1NA 3FW2A 3UIWA 1U3IA 2VIMA 3UVTA 4OO4A 1XWAA 1HNAA 3D6IA 2E0QA 3APSA 5AIVA 2H1AA 4F9ZA 4OCEA 2GSQA 2AHEA 1ZYQB 2GT6A 2DJJA 1G0TA 14GSA 5B8BA 3DGQA 5FHIA 5F8BA 4K0NA 1GTIA 2LRTA 3VLNA 1UC7A 5FWGA 2IMIA 4K0GA 2CAIA 1F3BA 1QGVA 3KH7A 3HYPA 3GRXA 2F9SA 1SD9A 1WE0A 1UA5A 3TJBA 1X9WB 2LRNA 1NM3A 4Z7XA 4KX4A 3M3MA 4WBJA 4K9ZA 2N5FA 1EOGA 1Z7RA 1WWJA 5G1LA 2L57A 2BTOT 3ZLPA 3HZ4A 2CVKA 2CV4A 4KAEA 2GQKA 4POMA 4YH2A 2H1DA 2E2MA 3C1RA 3I69A 3ISOA 4HU7A 3ME8A 2LS5A 3JCML 5D8IA 1AC1A 2QKEA 4NHWA 3KJYA 4YQVA 1J0FA 1JZOA 3LWAA 3N9JA 1A0FA 5F07A 3TJKA 1KEBA 3FKFA 4K8MA 2FLSA 1A8LA 2X64A 3O76A 4MP4A 5IIZA 2MYGA 5IQYA 4LL1B 5D73A 2HYXA 3IDVA 2VCQA 3CXGA 2J9HA 1U6TA 2HFDA 2LUSA 2O89A 1GNWA 2H6YA 17GSA 1XWKA 3GKMA 1OE8A 3TJJA 10GSA 2B1KA 1U88A 1GSUA 2VCTA 5EY6A 5CO3A 4N30A 4HQSA 3LXTA 1XW6A 2VCVA 3SBCA 3I6AA 5ID2A 1WJKA 5KN0A 3PINA 1A23A 4EC0A 2V41A 4AJ7A 1T3BA 3EU3A 1K3OA 2DMLA 5ECNB 3HJMA 3HA9A 1X5CA 2K18A 3S9FA 1GSEA 2YNXA 2V6KA 3TOUA 2MMOA 4EDYA 4DEJA 4BWQA 1O8XA 1W4VA 4QL7A 5IMFA 4HJMA 1PA3A 3L9VA 1BJXA 1GP1A 3FZ4A 3VFIA 3IR4A 4Q5RA 3EMXA 4K7IA 3HZ8A 1GSFA 5FT3A 1M2BA 3TDGA 5INYA 3HY2A 1GH2A 2IMFA 4EXJA 2VLTA 1ILOA 3G9BA 1R5PA 2VL9A 2VL2C 4F0CA 2FGXA 1O7UA 3LEFA 2DC5A 3RHCA 3UAPA 1G6WA 3QD9A 2FWEA 4WKWA 1FVKA 1GNEA 1OAZA 2EIRA 2GQMA 1TRSA 2REMA 5CYYA 4RUVA 3ZL5A 2F51A 3ZFBA 3L4NA 2WZ9A 2L4QA 5F0GA 5G5FA 1FG4A 3CTFA 2NDOA 4BVXA 3I9V2 1XWBA 4O7HA 2YP6A 1GUMA 2HRFA 3GHAA 1J9BA 4GRFA 3VWUA 3KMNA 1M99A 1YEPA 4KW6A 2H74A 3M8NA 1TRVA 4MPGA 1QUWA 3HJOA 4EKZA 1OKTA 1XW9A 3WT1A 1LU4A 2OE0A 1A24A 1JHBA 4ZILA 5GSTA 4L0WA 9GSSA 5ECPB 2IMDA 5DJMA 3J7Yk 2C80A 1O73A 2JZSA 4I97A 4G19A 1SYXA 2WJUA 1M0UA 5A5KA 1O8WA 4NV2A 1GULA 2AB6A 3EC3A 3GMFA 1VF3A 2ZCTA 1PRXA 4IGJA 1MDKA 3TRQA 1KTEA 4FYUA 4V1Ap 22GSA 4TXOA 5JCUA 4RI6A 1M7TA 1PQNA 1NHOA 4BVYA 4GQCA 1PKWA 3ZIVA 1XOAA 5ECIB 4PUFC 4V1Ag 3DEXA 1YDKA 4POLA 3D5JA 2H71A 1Z7PA 1WOUA 3IK7A 2NVLA 5ELGA 2H70A 4IHUA 5A4VA 3FZAA 3KIJA 3LFLA 4KA0A 8GSSA 4ZL9A 1KBNA 2E2GA 1MD3A 1ZYEA 5F06A 3RPNA 1ZOFA 3A2WA 3EVIA 3J7Yb 1GUKA 5A4UA 4EF0A 2YZUA 2LSTA 5AISA 1TI3A 2C3TA 1SK1A 2RUFA 2XBIA 4TR0A 2HT9A 3H79A 5DDLA 3LQ7A 1FAAA 3FZ5A 4X1UA 2CZ2A 2M46A 4JE1A 2FA4A 2L4CA 4GSNA 1ZGNA 2AJQB 1TW9A 1FHEA 1GSQA 1WPIA 18GSA 5JCGA 3LYKA 5HQPA 4G10A 2GT5A 3ZVJA 5DALB 2WGRA 1S3CA 3WYWA 20GSA 2HRNA 3TJGA 1SKRB 5H5RA 3FY7A 2YPMA 1U87A 2KP1A 1H4OA 1K3LA 4O32A 1BQ7A 4IS0A 5KN1A 2F8FA 3WGXA 1EEMA 4ULXA 4KDYA 3P2AA 2F8AA 2I4AA 3GL3A 2FUG2 3PH9A 1DE1A 3QCPA 2FY6A 1OKDA 3FYGA 2LQOA 3GV1A 1B9XC 3UBKA 3M1GA 4LMWA 4MPFA 4L0UA 1SKSB 2VCZA 1Q4JA 3DRNA 2H30A 4XS4A 2H0IA 5IMCA 2GTUA 1PMTA 5B6NA 1TOFA 1RQMA 3QFAC 4JR4A 3FHKA 3L9UA 1SJIA 2H75A 2H72A 1EP8A 4LLRA 1V2AA 4IP6A 2WRTA 4NWYA 2MMNA 4L5OA 2PUKC 1B9YC 3IV4A 2CA8A 2LJAA 3HVXA 4ML1A 6GSWA 1XOBA 4K7NA 1V57A 2C3QA 4MZCA 1H75A 2B3SA 3UARA 4TVEA 3W8JA 3C71A 1NHYA 3E9JB 1M9BA 3LXZA 1ON4A 3SWLA 2FD3A 2JZRA 2TIRA 3VK9A 5IM9A 3GH9A 4QL9A 4FIWA 3GFKA 3QOUA 1WRYA 2YV7A 5E4WA 1ACVA 3NOFA 4ZB9A 1QMVA
chains in the Genus database with same CATH superfamily
3ERFA 1Z5YE 4D73A 1OVNA 3RAZA 4TR4A 4BPYA 2WCIA 3L9SA 4LMVA 19GSA 5HFGA 4K2DA 2CVBA 3CBUA 1QFNA 2HSYA 1TK5B 2C0GA 3BCKA 2FCHA 4MZWA 1I5GA 2H73A 3BOAA 2FWGA 1XXUA 4PNGA 4XCSA 2HSHA 1I9DA 4CW9A 3TKSE 2K9FA 2V6OA 5ECSA 2KLXA 4O5QA 1TU8A 3ZFLA 4XRAA 2HZEB 2NPBA 3F4RA 3GTUB 2H1GA 4XS1A 4PQHA 1N2AA 3N5OA 1PL1A 3TCOA 1ERUA 3KMOA 3KM6A 5JWRB 4MNNA 1YY7A 2DJ1A 2DIZA 2H19A 4V2LA 1DSBA 4IQ1A 2C0DA 4MK3A 4K5RA 2XPDA 4BWSA 6GSTA 4TOPA 1T7PB 4YAVA 1TU7A 4NMUA 3O3TA 4TN8A 1SENA 2LQQA 1JZDA 2YWMA 2CX4A 4MH3A 4G0IA 3DMLA 2OA7A 1OC3A 3BJ5A 1K0DA 1Z6NA 1IYHA 1PD21 1ERTA 4WEYA 4YQMA 4MLYA 2B6MA 4KDUA 2YWOA 3FRCA 4DSQA 2I81A 3IPZA 2A4HA 1AW9A 1R26A 4EL1A 4F2IA 3IC4A 2OE1A 4IN0A 3BD2A 4HZ2A 4OD7A 1FO5A 4G2EA 4YKFA 2X8HA 4XRDA 4IELA 1G7OA 1EWXA 1VF1A 5H5SA 4WR5A 2MBTA 4IJ3A 4POKA 5DJLA 1USBA 5ENUA 5CAXA 3CTGA 3VWXA 2HSMA 2H01A 2WFCA 3QAGA 3G7IA 3TB2A 5GAND 3MSZA 3CSHA 1TDIA 2YJ7A 3GX8A 4TR3A 3HXSA 3PPUA 3QR6A 4F82A 6GSVA 1MDIA 3HHVA 1FB0A 3KD0A 1CQHA 5D9VA 4N0ZA 2WS2A 2DSAA 4EVMA 1M9AA 4LA1A 1X0RA 3IHQA 3G7JA 4ILFA 3GKNA 2JZTA 2R0PA 2VAFA 1GTUA 3DD3A 5ABRA 4FH8A 3UEMA 4GSSA 4MF6A 1R4WA 1AXDA 3IAM2 4MF5A 5DBQA 1M3IA 3IAS2 2MBSA 4ECJA 1SK2A 5D93A 1AQWA 3K8NA 2DJ2A 4HI7A 1WIKA 1IYIA 4OO5A 3A2XA 2QA2A 4N10A 2DBCA 2A2RA 3L0HA 5JWOB 3V1WA 1XVQA 1K0NA 2YZHA 2GDRA 2FA8A 5J4UA 4Z2RA 2AV4A 1GSSA 2PVOC 4HQZA 3KH9A 1FOVA 5D96A 3KTBA 2ALBA 4ECBA 3F0IA 4FYCA 5HFKA 1FW1A 2ZNMA 4BL7A 4NPBA 3RHBA 1VRSD 1HQOA 1R5AA 4JEDA 4BA7A 3FR9A 1OE7A 4KB3A 1GWCA 4ZXGA 2P31A 3MAKA 3UJ1A 2VM2A 2L6CA 2J23A 3TRPA 2WB9A 3D4MA 4LL4B 4ZBDA 2XHFA 4PURA 3EU4A 4GXZA 2DKIA 3F3RA 1SL0B 2R37A 1THOA 5F05A 4ZB8A 3RBTA 4ISDA 3VWWA 4K7OA 4I5QA 1BAYA 3ZYWA 1JLVA 2B1LA 1AIUA 4HS1A 2K6VA 1MTCA 1UVZA 2H0HA 3DXBA 3CSJA 5B6MA 4FQUA 5HR0A 1T00A 5KN2A 2ON7A 2B5XA 2IFQA 1K0MA 3KEBA 1A2LA 3FR6A 4MCUA 2VCWA 4BVXB 5IPGA 4I6XA 3TKSC 4AF2A 3W8SA 2GZZA 3GKXA 4NAXA 4IJIA 2H6XA 2PVQA 3CSIA 3D21A 2GZYA 1JZRA 4CY6A 3F6FA 4H86A 2EC4A 4F03A 1AQVA 3TGZA 1X9MB 2JSYA 5IMAA 1ABAA 2NTOA 4K6XA 4O92A 2IIYA 3APOA 4RI7A 2YV9A 4N11A 3LG6A 2AUVA 1O6JA 3APQA 2LRCA 2V1MA 2R6KA 4GLTA 2YWIA 4TRXA 4PXOA 4K1FA 4ICYA 4MF7A 1AQXA 1V9WA 5H5QA 3TKRA 4HDEA 3P90A 2JSZA 1FB6A 1ERVA 5AGYA 2G0FA 2K8VA 3FMWA 4TXOB 1XPVA 2H1BA 1M3JA 4BVYB 2PBJA 1PKZA 5DAKA 2DKHA 2H76A 5CNWA 4GWRA 2QC7A 4WBRD 1RK4A 5LD0A 4EE0A 5IMVA 4ZB6A 1M2AA 4ZL8A 2IMEA 3GNJA 4POBA 2NBSA 3A3TA 2M80A 4YQUA 2LTKA 3U6VA 3ED3A 5ECMB 4E8EA 4MABA 2YN1A 3OR5A 4EUYA 3O6TA 2B5EA 1WMJA 4ID0A 1N8JA 2WULA 2GSSA 3QFBC 2O85A 4GQFA 3HJPA 1TK0B 5KOXA 2A4VA 2MMAA 2DJKA 3F6DA 1K3YA 2CVDA 2K8SA 4DSRA 2AYTA 1ZYNA 5L71A 3CQFA 4L8EA 2XC2A 3L78A 2VM1A 3M9KA 2Z9SA 4ZL7A 2EIQA 1O81A 5BMUA 3M9JA 3F4TA 1TP9A 5B7CA 3US3A 1MD4A 3P7XA 3R2QA 4KSMA 3QDNA 3VURA 1PL2A 1VF2A 1S3DA 3M0FA 1ML6A 2I1UA 4DSSA 3QAWA 2PGTA 1YF1A 3VWVA 4OFTA 5C04A 4AJ8A 1TJDA 1TTZA 1XZOA 5IPHA 1O85A 1URMA 5B8AA 1OC9A 2TRCP 5GAPD 1R7HA 1PSQA 1UN2A 2PMTA 5ELAA 1YKAA 2L5LA 5CRWA 3UVHA 2VL2A 5CRHA 5AN1A 5KOWA 2XPEA 2IJYA 3ZZXA 5AIXA 5C00A 4HZ4A 1YZXA 2B7JA 3Q6OA 1SYRA 5CREA 1A2JA 2F3MA 4IKHA 3ZVJD 4K2XA 1BEDA 4XHMA 1A8YA 3F63A 1X9SB 3GX0A 3BCIA 5D9XA 3NZNA 1F9MA 2O87A 3VI5A 1KNGA 4HU9A 1GSYA 2ZUPA 3QAVA 2DMMA 4WF4A 3GKKA 2A2PA 4I8BA 3H4KA 1SL1B 1B48A 1TI1A 2GLRA 4IW9A 5DQSA 3EPTA 2IMKA 3ZIJA 4TR1B 4WR4A 4ACSA 3VPQA 4L5LA 4F0BA 4HOJA 11GSA 1YEXA 4Z2UA 2H6ZA 4GF0A 3HDCA 1OYJA 2LJKA 4MJBA 4WETA 1PX7A 2KP2A 4D73B 2C4JA 4X43A 2A2SA 3Q74A 2LNSA 2YANA 2G2QA 3GTUA 3FK8A 5IMDA 4KH7A 2KHPA 2JADA 3UMAA 3DWVA 2MMZA 2GGTA 2GZPA 2HZFA 2P5RA 3EINA 3WGDA 1JZWA 2P0GA 2MZCA 2I9HA 2P5QA 1J08A 3FR3A 3F9UA 5JCWA 1HNBA 5IMZA 1RW1A 4GSTA 4PTSA 1EZKA 1B4QA 4X4JA 3VI7A 2N5BA 2L5OA 2B5YA 1TKDB 4KDXA 3DVWA 3PR8A 2PERA 1YQ1A 2VLUA 5EVOA 3IXRA 5G1KA 3TUEA 2LV3A 1X5DA 3D4TA 3HVVA 5IO0A 1T4YA 3E3EA 1Q98A 3ME7A 2KOKA 1A2MA 5G5EA 3KTLA 4MZBA 5LCZA 2OBIA 3F3QA 4IQAA 5IOWA 5HR3A 6GSUA 2C8UA 2QSIA 1EP7A 3D22A 4I2TA 4TW5A 4E8HA 2YCDA 3KXOA 1C72A 1VF4A 1GTAA 1Z9HA 2IL3A 1B8XA 3GN3A 4XS6A 4Q5FA 1PGTA 4MJEA 5E59A 2VCXA 3IK9A 4EIQA 3ZMLA 3HCZA 5GSSA 3NIVA 3KP8A 1EEJA 3MDKA 3H93A 3IE3A 2RM6A 2VD0A 5KEJA 1Y25A 2CZ3A 2DJ3A 1ST9A 1JLWA 3IRAA 1V58A 4MJAA 3LGCA 3MIXA 3GA4A 5J41A 2L6DA 3ZITA 2TRXA 4CHSA 4J57E 3FEUA 3C1SA 6GSSA 2OE3A 1EGRA 1F6MC 4GCIA 4PX1A 2V32A 2PU9C 3GYKA 3E0UA 1G7EA 2E7PA 4OFMA 1DBYA 5IO2A 5J5NA 2D2ZA 3TKQA 5JWQB 1Z3EA 5EPFA 2CT6A 2H66A 2ES7A 1QQ2A 1YJ6A 5DVBA 1JFUA 3I43A 2M72A 2FWHA 2YJHA 4O5RA 2LEGA 4RQRA 1QK8A 3MNGA 2DJ0A 2C0FA 1CQGA 4IVFA 4ZIJA 4G0LA 2GQLA 3F8UA 1PN9A 4KGIA 3C73A 4A5PA 2CAQA 5DCHA 1ZCPA 1AAZA 2PWJA 2N5AA 3GIXA 5ID2B 3HKRA 2FNOA 4G0KA 1M2DA 2VUPA 2RLIA 5KN3A 1AUCA 3BBYA 2JU5A 3P8WA 3EYTA 4KNDA 4TKYA 1EGOA 3ZRDA 2DLXA 3ZTLA 3GSSA 1FVJA 3CRUA 5ECHB 2R0GA 4NXIA 2LKUA 2GS3A 1OC8A 1B4PA 3CYNA 5CRDA 4WF5A 4BL7B 3QMXA 1S3AA 3TOTA 1Y6EA 3WT2A 2OKAA 3CMIA 3A5WA 4QQ7A 1X5EA 4KCAA 3GURA 3ZREA 3UBLA 5J9BA 1GSDA 1YF0A 1XWGA 2IPAA 4X0XA 2QGVA 1GLPA 1G6YA 4NHZA 4KCEA 4MH2A 1TRUA 5HR1A 2LNTA 1MDJA 4Q5QA 1T8EB 4P3YB 3GUSA 5A4WA 3WD6A 4HUAA 3HVNA 4MA9A 5ECLB 4HEA2 3ERGA 4ECIA 2H8LA 4IBPA 1BG5A 1ZMAA 2HRAA 3IC8A 1K0AA 4J2FA 2R3XA 3C7MA 3LSZA 4PQIA 1GTBA 1TRWA 1T1VA 2IFQB 1W89A 4OWYA 4ZBAA 1XG8A 2RUEA 3GH6A 2X8CA 2I3YA 4KSOA 5ECRB 5DQYA 2PN8A 1GRXA 1EV4A 3UOMA 2OACA 1K0BA 6GSXA 3DYRA 2HRKA 5EL8A 1K0OA 1SL2B 4O5UA 2X99A 1NW2A 3VPTA 5ECKB 1A0RP 4AJ6A 1HNCA 3H8QA 3KP9A 4EIPA 1NSWA 5G31A 3MWHA 4XTSA 1F37A 3UL3A 5IOXA 2VOCA 2CQ9A 5ECQB 3TRXA 4OCFA 2AAWA 3KGKA 4ECCA 3PGTA 4N0VA 4MDCA 3GSTA 2JL4A 4EO3A 2HNLA 3TKPA 1TK8B 3DVXA 2C0EA 4JRRA 3LYPA 1LJRA 4JU5A 1DUGA 1BX9A 1SD8A 2IWTA 2OJLA 3KZQA 3EURA 1SKWB 2DIYA 2PPTA 1WP0A 1XVWA 1V98A 5HR2A 3IOSA 4JZQA 1V40A 2JACA 5DAKB 4J56E 5ECOB 1GLQA 4GTUA 4RQXA 3ERWA 2V2GA 3Q18A 5DALA 1XWCA 4FO5A 2HE3A 4EDZA 2FHEA 2VL3A 1T4ZA 3AY8A 4I2UA 2GVPA 1QXHA 3HVSA 1BYEA 3RDWA 4JR6A 4G9HA 4PQ1A 4AGSA 2OADA 4HJ2A 2XBQA 3IBHA 2GSTA 4V2MA 3DKSA 1EV9A 5HFIA 4ML6A 4YKGA 2QA1A 4TXVA 3W6GA 2X8GA 1LBKA 1U3AA 2IN3A 4OMVA 2BMXA 2KUCA 2R4VA 4V2NA 5G2ZA 4JBBA 3C8EA 12GSA 3U5RE 2X49A 1EOHA 1PX6A 3QPMA 3DIEA 1E6BA 1GUHA 1F3AA 2VD1A 5BRTA 3TJFA 3LORA 1E2YA 4XS4B 2CX3A 1VGLA 2B7KA 3GL5A 5D9WA 4DSSB 4IP1A 13GSA 1SJZA 2OBKA 1HYUA 3EMPA 2UZ8A 1ZL9A 4NV5A 2EIOA 4BIKA 1F2EA 2C1YA 1GL8A 4MMMA 4MJCA 1K0CA 5J9CA 1OC9B 2HI7A 2YWNA 4K5SA 3D0ZA 1SK0A 4PGTA 3ZMKA 2HXKA 2WDUA 4YAPA 16GSA 3IA1A 1ZYPA 2O7KA 2VO4A 3G7YA 4FYBA 5D9TA 3HD5A 1THXA 1DE2A 7GSSA 3CRTA 3EE2A 2LJRA 1XIYA 2ON5A 4Z2TA 5DCGA 3FZ9A 4TR1A 1SJ6A 5GZZB 1XBSA 2H0GA 2L59A 3Q19A 1XW5A 1ZZYA 5CRGA 1XFLA 2FWFA 5COHA 4PUAA 3TKSA 4DVCA 5G30A 1HD2A 4KF9A 5LNKe 1TXXA 4USSA 4WXTA 3KCMA 3EWLA 4KE3A 4PNFA 2C3NA 2YOIA 3F4SA 3LJRA 2HZEA 2R2JA 1ERWA 2GSRA 3A2VA 4OFNA 5CP1A 1MEKA 4Q5NA 1Z6MA 6GSYA 2BJXA 3RPPA 4ZBBA 2O8VB 2VLVA 3WGEA 2RM5A 4KUNA 5J3RA 1YKCA 2R5GA 1SU9A 4XIHA 2HLSA 4CDOA 1XCCA 2RIIA 3H1NA 3FW2A 3UIWA 1U3IA 2VIMA 3UVTA 1S3RA 4OO4A 1XWAA 1HNAA 3D6IA 2E0QA 3APSA 5AIVA 2H1AA 4F9ZA 4OCEA 2GSQA 2AHEA 1ZYQB 2GT6A 2DJJA 1G0TA 14GSA 5B8BA 3DGQA 5FHIA 5F8BA 4K0NA 1GTIA 2LRTA 3VLNA 1UC7A 5FWGA 2IMIA 4K0GA 2CAIA 1F3BA 1QGVA 3KH7A 3HYPA 3GRXA 2F9SA 1SD9A 1WE0A 1UA5A 3TJBA 1X9WB 2LRNA 1NM3A 4Z7XA 4KX4A 3M3MA 4WBJA 4K9ZA 2N5FA 1EOGA 1Z7RA 1WWJA 5G1LA 2L57A 2BTOT 3ZLPA 3HZ4A 2CVKA 2CV4A 4KAEA 1FOHA 2GQKA 4POMA 4YH2A 2H1DA 2E2MA 3C1RA 3I69A 3ISOA 4HU7A 3ME8A 2LS5A 3JCML 5D8IA 1AC1A 2QKEA 4NHWA 3KJYA 4YQVA 1J0FA 1JZOA 3LWAA 3N9JA 1A0FA 5F07A 3TJKA 1KEBA 3FKFA 4K8MA 2FLSA 1A8LA 2X64A 3O76A 4MP4A 5IIZA 2MYGA 5IQYA 4LL1B 5D73A 3R3EA 2HYXA 3IDVA 2VCQA 3CXGA 2J9HA 1U6TA 2HFDA 2LUSA 2O89A 1GNWA 2H6YA 17GSA 1XWKA 3GKMA 1OE8A 3TJJA 10GSA 2B1KA 1U88A 1GSUA 2VCTA 5EY6A 5CO3A 4N30A 4HQSA 3LXTA 1XW6A 2VCVA 3SBCA 3I6AA 5ID2A 1WJKA 5KN0A 3PINA 1A23A 4EC0A 2V41A 4AJ7A 1T3BA 3EU3A 1K3OA 2DMLA 5ECNB 3HJMA 3HA9A 1X5CA 2K18A 3S9FA 1GSEA 2YNXA 2V6KA 3TOUA 2MMOA 4EDYA 4DEJA 4BWQA 1O8XA 1W4VA 4QL7A 5IMFA 4HJMA 1PA3A 3L9VA 1BJXA 1GP1A 3FZ4A 3VFIA 3IR4A 4Q5RA 3EMXA 4K7IA 3HZ8A 1GSFA 5FT3A 1M2BA 3TDGA 5INYA 3HY2A 1GH2A 2IMFA 4EXJA 2VLTA 1ILOA 3G9BA 1R5PA 2VL9A 2VL2C 4F0CA 2FGXA 1O7UA 3LEFA 2DC5A 3RHCA 3UAPA 1G6WA 3QD9A 2FWEA 4WKWA 1FVKA 1GNEA 1OAZA 2EIRA 2GQMA 1TRSA 2REMA 5CYYA 4RUVA 3ZL5A 2F51A 3ZFBA 3L4NA 2WZ9A 2L4QA 5F0GA 5G5FA 1FG4A 3CTFA 2NDOA 4BVXA 3I9V2 1XWBA 4O7HA 2YP6A 1GUMA 2HRFA 3GHAA 1J9BA 4GRFA 3VWUA 3KMNA 1M99A 1YEPA 4KW6A 2H74A 3M8NA 1TRVA 4MPGA 1QUWA 3HJOA 4EKZA 1OKTA 1XW9A 3WT1A 1LU4A 2OE0A 1A24A 1JHBA 4ZILA 5GSTA 1PFOA 4L0WA 9GSSA 5ECPB 2IMDA 5DJMA 3J7Yk 2C80A 1O73A 2JZSA 4I97A 4G19A 1SYXA 2WJUA 1M0UA 5A5KA 1O8WA 4NV2A 1GULA 2AB6A 3EC3A 3GMFA 1VF3A 2ZCTA 1PRXA 4IGJA 3A5IA 1MDKA 3TRQA 1KTEA 4FYUA 4V1Ap 22GSA 4TXOA 5JCUA 4RI6A 1M7TA 1PQNA 1NHOA 4BVYA 4GQCA 1PKWA 3ZIVA 1XOAA 5ECIB 4PUFC 3IHGA 4V1Ag 3DEXA 1YDKA 4POLA 3D5JA 2R0CA 2H71A 1Z7PA 1WOUA 3IK7A 2NVLA 5ELGA 2H70A 2X4AA 4IHUA 5A4VA 3FZAA 3KIJA 3LFLA 4KA0A 8GSSA 4ZL9A 1KBNA 2E2GA 1MD3A 1ZYEA 5F06A 3RPNA 1ZOFA 3A2WA 3EVIA 3J7Yb 1GUKA 5A4UA 4EF0A 2YZUA 2LSTA 5AISA 1PN0A 1TI3A 2C3TA 1SK1A 2RUFA 2XBIA 4TR0A 2HT9A 3H79A 5DDLA 3LQ7A 1FAAA 3FZ5A 4X1UA 2CZ2A 2M46A 4JE1A 2FA4A 2L4CA 4GSNA 1ZGNA 2AJQB 1TW9A 1FHEA 3LW9A 1GSQA 1WPIA 18GSA 5JCGA 3LYKA 5HQPA 4G10A 2GT5A 3ZVJA 5DALB 2WGRA 1S3CA 3WYWA 20GSA 2HRNA 3TJGA 1SKRB 5H5RA 3FY7A 2YPMA 1U87A 2KP1A 4HSCX 1H4OA 1K3LA 4O32A 1BQ7A 4IS0A 5KN1A 2F8FA 3WGXA 1EEMA 4ULXA 4KDYA 3P2AA 2F8AA 2I4AA 3GL3A 2FUG2 3PH9A 1DE1A 3QCPA 2FY6A 1OKDA 3FYGA 2LQOA 3GV1A 1B9XC 3MYDA 3UBKA 3M1GA 4LMWA 4MPFA 4L0UA 1SKSB 2VCZA 1Q4JA 3DRNA 2H30A 4XS4A 2H0IA 5IMCA 2GTUA 1PMTA 5B6NA 1TOFA 1RQMA 3QFAC 4JR4A 3FHKA 3L9UA 1SJIA 2H75A 2H72A 1EP8A 4LLRA 1V2AA 4IP6A 2WRTA 4NWYA 2MMNA 4L5OA 2PUKC 1B9YC 3IV4A 2CA8A 2LJAA 3HVXA 4ML1A 6GSWA 1XOBA 4K7NA 1V57A 2C3QA 4MZCA 1H75A 2B3SA 3UARA 4TVEA 3W8JA 3C71A 1NHYA 3E9JB 1M9BA 3LXZA 1ON4A 4CY8A 3SWLA 2FD3A 2JZRA 2TIRA 3VK9A 5IM9A 3GH9A 4QL9A 4FIWA 3GFKA 3QOUA 1WRYA 2YV7A 5E4WA 1ACVA 3NOFA 4ZB9A 1QMVA
chains in the Genus database with same CATH topology
3ERFA 1Z5YE 4D73A 1OVNA 3RAZA 4TR4A 4BPYA 2WCIA 3L9SA 4LMVA 19GSA 5HFGA 4K2DA 2CVBA 3CBUA 1QFNA 2HSYA 1TK5B 2C0GA 3BCKA 2FCHA 4MZWA 1I5GA 2H73A 3BOAA 2FWGA 1XXUA 4PNGA 4XCSA 2HSHA 1I9DA 4CW9A 3TKSE 2K9FA 2V6OA 5ECSA 2KLXA 4O5QA 1TU8A 3ZFLA 4XRAA 2HZEB 2NPBA 3F4RA 3GTUB 2H1GA 4XS1A 4PQHA 1N2AA 3N5OA 1PL1A 3TCOA 1ERUA 3KMOA 3KM6A 5JWRB 4MNNA 1YY7A 2DJ1A 2DIZA 2H19A 4V2LA 1DSBA 4IQ1A 2C0DA 4MK3A 4K5RA 2XPDA 4BWSA 6GSTA 4TOPA 1T7PB 4YAVA 1TU7A 4NMUA 3O3TA 4TN8A 1SENA 2LQQA 1JZDA 2YWMA 2CX4A 4MH3A 4G0IA 3DMLA 2OA7A 1OC3A 3BJ5A 1K0DA 1Z6NA 1IYHA 1PD21 1ERTA 4WEYA 4YQMA 4MLYA 2B6MA 4KDUA 2YWOA 3FRCA 4DSQA 2I81A 3IPZA 2A4HA 1AW9A 1R26A 4EL1A 4F2IA 3IC4A 2OE1A 4IN0A 3BD2A 4HZ2A 4OD7A 1FO5A 4G2EA 4YKFA 2X8HA 4XRDA 4IELA 1G7OA 1EWXA 1VF1A 5H5SA 4WR5A 2MBTA 4IJ3A 4POKA 5DJLA 1USBA 5ENUA 5CAXA 3CTGA 3VWXA 2HSMA 2H01A 2WFCA 3QAGA 3G7IA 3TB2A 5GAND 3MSZA 3CSHA 1TDIA 2YJ7A 3GX8A 4TR3A 3HXSA 3PPUA 3QR6A 4F82A 6GSVA 1MDIA 3HHVA 1FB0A 3KD0A 1CQHA 5D9VA 4N0ZA 2WS2A 2DSAA 4EVMA 1M9AA 4LA1A 1X0RA 3IHQA 3G7JA 4ILFA 3GKNA 2JZTA 2R0PA 2VAFA 1GTUA 3DD3A 5ABRA 4FH8A 3UEMA 4GSSA 4MF6A 1R4WA 1AXDA 3IAM2 4MF5A 5DBQA 3IAS2 2MBSA 4ECJA 1SK2A 5D93A 1AQWA 3K8NA 2DJ2A 4HI7A 1WIKA 1IYIA 4OO5A 3A2XA 2QA2A 4N10A 2DBCA 2A2RA 3L0HA 5JWOB 3V1WA 1XVQA 1K0NA 2YZHA 2GDRA 2FA8A 5J4UA 4Z2RA 2AV4A 1GSSA 2PVOC 4HQZA 3KH9A 1FOVA 5D96A 3KTBA 2ALBA 4ECBA 3F0IA 4FYCA 5HFKA 1FW1A 2ZNMA 4BL7A 4NPBA 3RHBA 1VRSD 1HQOA 1R5AA 4JEDA 4BA7A 3FR9A 1OE7A 4KB3A 1GWCA 4ZXGA 2P31A 3MAKA 3UJ1A 2VM2A 2L6CA 2J23A 3TRPA 2WB9A 3D4MA 4LL4B 4ZBDA 2XHFA 4PURA 3EU4A 4GXZA 2DKIA 3F3RA 1SL0B 2R37A 1THOA 5F05A 4ZB8A 3RBTA 4ISDA 3VWWA 4K7OA 4I5QA 1BAYA 3ZYWA 1JLVA 2B1LA 1AIUA 4HS1A 2K6VA 1MTCA 1UVZA 2H0HA 3DXBA 3CSJA 5B6MA 4FQUA 5HR0A 1T00A 5KN2A 2ON7A 2B5XA 2IFQA 1K0MA 3KEBA 1A2LA 3FR6A 4MCUA 2VCWA 4BVXB 5IPGA 4I6XA 3TKSC 4AF2A 3W8SA 2GZZA 3GKXA 4NAXA 4IJIA 2H6XA 2PVQA 3CSIA 3D21A 2GZYA 1JZRA 4CY6A 3F6FA 4H86A 2EC4A 4F03A 1AQVA 3TGZA 1X9MB 2JSYA 5IMAA 1ABAA 2NTOA 4K6XA 4O92A 2IIYA 3APOA 4RI7A 2YV9A 4N11A 3LG6A 2AUVA 1O6JA 3APQA 2LRCA 2V1MA 2R6KA 4GLTA 2YWIA 4TRXA 4PXOA 4K1FA 4ICYA 4MF7A 1AQXA 1V9WA 5H5QA 3TKRA 4HDEA 3P90A 2JSZA 1FB6A 1ERVA 5AGYA 2G0FA 2K8VA 3FMWA 4TXOB 1XPVA 2H1BA 4BVYB 2PBJA 1PKZA 5DAKA 2DKHA 2H76A 5CNWA 4GWRA 2QC7A 4WBRD 1RK4A 5LD0A 4EE0A 5IMVA 4ZB6A 1M2AA 4ZL8A 2IMEA 3GNJA 4POBA 2NBSA 3A3TA 2M80A 4YQUA 2LTKA 3U6VA 3ED3A 5ECMB 4E8EA 4MABA 2YN1A 3OR5A 4EUYA 3O6TA 2B5EA 1WMJA 4ID0A 1N8JA 2WULA 2GSSA 3QFBC 2O85A 4GQFA 3HJPA 1TK0B 5KOXA 2A4VA 2MMAA 2DJKA 3F6DA 1K3YA 2CVDA 2K8SA 4DSRA 2AYTA 1ZYNA 5L71A 4L8EA 2XC2A 3L78A 2VM1A 3M9KA 2Z9SA 4ZL7A 2EIQA 1O81A 5BMUA 3M9JA 3F4TA 1TP9A 5B7CA 3US3A 1MD4A 3P7XA 3R2QA 4KSMA 3QDNA 3VURA 1PL2A 1VF2A 1S3DA 3M0FA 1ML6A 2I1UA 4DSSA 3QAWA 2PGTA 1YF1A 3VWVA 4OFTA 5C04A 4AJ8A 1TJDA 1TTZA 1XZOA 5IPHA 1O85A 1URMA 5B8AA 1OC9A 2TRCP 5GAPD 1R7HA 1PSQA 1UN2A 2PMTA 5ELAA 1YKAA 2L5LA 5CRWA 3UVHA 2VL2A 5CRHA 5AN1A 5KOWA 2XPEA 2IJYA 3ZZXA 5AIXA 5C00A 4HZ4A 1YZXA 2B7JA 3Q6OA 1SYRA 5CREA 1A2JA 2F3MA 4IKHA 3ZVJD 4K2XA 1BEDA 4XHMA 1A8YA 3F63A 1X9SB 3GX0A 3BCIA 5D9XA 3NZNA 1F9MA 2O87A 3VI5A 1KNGA 4HU9A 1GSYA 2ZUPA 3QAVA 2DMMA 4WF4A 3GKKA 2A2PA 4I8BA 3H4KA 1SL1B 1B48A 1TI1A 2GLRA 4IW9A 5DQSA 3EPTA 2IMKA 3ZIJA 4TR1B 4WR4A 4ACSA 3VPQA 4L5LA 4F0BA 4HOJA 11GSA 1YEXA 4Z2UA 2H6ZA 4GF0A 3HDCA 1OYJA 2LJKA 4MJBA 4WETA 1PX7A 2KP2A 4D73B 2C4JA 4X43A 2A2SA 3Q74A 2LNSA 2YANA 2G2QA 3GTUA 3FK8A 5IMDA 4KH7A 2KHPA 2JADA 3UMAA 3DWVA 2MMZA 2GGTA 2GZPA 2HZFA 2P5RA 3EINA 3WGDA 1JZWA 2P0GA 2MZCA 2I9HA 2P5QA 1J08A 3FR3A 3F9UA 5JCWA 1HNBA 5IMZA 1RW1A 4GSTA 4PTSA 1EZKA 1B4QA 4X4JA 3VI7A 2N5BA 2L5OA 2B5YA 1TKDB 4KDXA 3DVWA 3PR8A 2PERA 1YQ1A 2VLUA 5EVOA 3IXRA 5G1KA 3TUEA 2LV3A 1X5DA 3D4TA 3HVVA 5IO0A 1T4YA 3E3EA 1Q98A 3ME7A 2KOKA 1A2MA 5G5EA 3KTLA 4MZBA 5LCZA 2OBIA 3F3QA 4IQAA 5IOWA 5HR3A 6GSUA 2C8UA 2QSIA 1EP7A 3D22A 4I2TA 4TW5A 4E8HA 2YCDA 3KXOA 1C72A 1VF4A 1GTAA 1Z9HA 2IL3A 1B8XA 3GN3A 4XS6A 4Q5FA 1PGTA 4MJEA 5E59A 2VCXA 3IK9A 4EIQA 3ZMLA 3HCZA 5GSSA 3NIVA 3KP8A 1EEJA 3MDKA 3H93A 3IE3A 2RM6A 2VD0A 5KEJA 1Y25A 2CZ3A 2DJ3A 1ST9A 1JLWA 3IRAA 1V58A 4MJAA 3LGCA 3MIXA 3GA4A 5J41A 2L6DA 3ZITA 2TRXA 4CHSA 4J57E 3FEUA 3C1SA 6GSSA 2OE3A 1EGRA 1F6MC 4GCIA 4PX1A 2PU9C 2V32A 3GYKA 3E0UA 1G7EA 2E7PA 4OFMA 1DBYA 5IO2A 5J5NA 2D2ZA 3TKQA 5JWQB 1Z3EA 5EPFA 2CT6A 2H66A 2ES7A 1QQ2A 1YJ6A 5DVBA 1JFUA 3I43A 2M72A 2FWHA 2YJHA 4O5RA 2LEGA 4RQRA 1QK8A 3MNGA 2DJ0A 2C0FA 1CQGA 4IVFA 4ZIJA 4G0LA 2GQLA 3F8UA 1PN9A 4KGIA 3C73A 4A5PA 2CAQA 5DCHA 1ZCPA 1AAZA 2PWJA 2N5AA 3GIXA 5ID2B 3HKRA 2FNOA 4G0KA 1M2DA 2VUPA 2RLIA 5KN3A 1AUCA 3BBYA 2JU5A 3P8WA 3EYTA 4KNDA 4TKYA 1EGOA 3ZRDA 2DLXA 3ZTLA 3GSSA 1FVJA 3CRUA 5ECHB 2R0GA 4NXIA 2LKUA 2GS3A 1OC8A 1B4PA 3CYNA 5CRDA 4WF5A 4BL7B 3QMXA 1S3AA 3TOTA 1Y6EA 3WT2A 2OKAA 3CMIA 3A5WA 4QQ7A 1X5EA 4KCAA 3GURA 3ZREA 3UBLA 5J9BA 1GSDA 1YF0A 1XWGA 2IPAA 4X0XA 2QGVA 1GLPA 1G6YA 4NHZA 4KCEA 4MH2A 1TRUA 5HR1A 2LNTA 1MDJA 4Q5QA 1T8EB 4P3YB 3GUSA 5A4WA 3WD6A 4HUAA 4MA9A 5ECLB 4HEA2 3ERGA 4ECIA 2H8LA 4IBPA 1BG5A 1ZMAA 2HRAA 3IC8A 1K0AA 4J2FA 2R3XA 3C7MA 3LSZA 4PQIA 1GTBA 1TRWA 1T1VA 2IFQB 1W89A 4OWYA 4ZBAA 2RUEA 3GH6A 2X8CA 2I3YA 4KSOA 5ECRB 5DQYA 2PN8A 1GRXA 1EV4A 3UOMA 2OACA 1K0BA 6GSXA 3DYRA 2HRKA 5EL8A 1K0OA 1SL2B 4O5UA 2X99A 1NW2A 3VPTA 5ECKB 1A0RP 4AJ6A 1HNCA 3H8QA 3KP9A 4EIPA 1NSWA 5G31A 3MWHA 4XTSA 1F37A 3UL3A 5IOXA 2VOCA 2CQ9A 5ECQB 3TRXA 4OCFA 2AAWA 3KGKA 4ECCA 3PGTA 4N0VA 4MDCA 3GSTA 2JL4A 4EO3A 2HNLA 3TKPA 1TK8B 3DVXA 2C0EA 4JRRA 3LYPA 1LJRA 4JU5A 1DUGA 1BX9A 1SD8A 2IWTA 2OJLA 3KZQA 3EURA 1SKWB 2DIYA 2PPTA 1WP0A 1XVWA 1V98A 5HR2A 3IOSA 4JZQA 1V40A 2JACA 5DAKB 4J56E 5ECOB 1GLQA 4GTUA 4RQXA 3ERWA 2V2GA 3Q18A 5DALA 1XWCA 4FO5A 2HE3A 4EDZA 2FHEA 2VL3A 1T4ZA 3AY8A 4I2UA 2GVPA 1QXHA 3HVSA 1BYEA 3RDWA 4JR6A 4G9HA 4PQ1A 4AGSA 2OADA 4HJ2A 2XBQA 3IBHA 2GSTA 4V2MA 3DKSA 1EV9A 5HFIA 4ML6A 4YKGA 2QA1A 4TXVA 2X8GA 3W6GA 1LBKA 1U3AA 2IN3A 4OMVA 2BMXA 2KUCA 2R4VA 4V2NA 5G2ZA 4JBBA 3C8EA 12GSA 3U5RE 2X49A 1EOHA 1PX6A 3QPMA 3DIEA 1E6BA 1GUHA 1F3AA 2VD1A 5BRTA 3TJFA 3LORA 1E2YA 4XS4B 2CX3A 1VGLA 2B7KA 3GL5A 5D9WA 4DSSB 4IP1A 13GSA 1SJZA 2OBKA 1HYUA 3EMPA 2UZ8A 1ZL9A 4NV5A 2EIOA 1F2EA 2C1YA 1GL8A 4MMMA 4MJCA 1K0CA 5J9CA 1OC9B 2HI7A 2YWNA 4K5SA 3D0ZA 1SK0A 4PGTA 3ZMKA 2HXKA 2WDUA 4YAPA 16GSA 3IA1A 1ZYPA 2O7KA 2VO4A 3G7YA 4FYBA 5D9TA 3HD5A 1THXA 1DE2A 7GSSA 3CRTA 3EE2A 2LJRA 1XIYA 2ON5A 4Z2TA 5DCGA 3FZ9A 4TR1A 1SJ6A 5GZZB 1XBSA 2H0GA 2L59A 3Q19A 1XW5A 1ZZYA 5CRGA 1XFLA 2FWFA 5COHA 4PUAA 3TKSA 4DVCA 5G30A 1HD2A 4KF9A 5LNKe 1TXXA 4USSA 4WXTA 3KCMA 3EWLA 4KE3A 4PNFA 2C3NA 2YOIA 3F4SA 3LJRA 2HZEA 2R2JA 1ERWA 2GSRA 3A2VA 4OFNA 5CP1A 1MEKA 4Q5NA 1Z6MA 6GSYA 2BJXA 3RPPA 4ZBBA 2O8VB 2VLVA 3WGEA 2RM5A 4KUNA 5J3RA 1YKCA 2R5GA 1SU9A 4XIHA 2HLSA 4CDOA 1XCCA 2RIIA 3H1NA 3FW2A 3UIWA 1U3IA 2VIMA 3UVTA 4OO4A 1XWAA 1HNAA 3D6IA 2E0QA 3APSA 5AIVA 2H1AA 4F9ZA 4OCEA 2GSQA 2AHEA 1ZYQB 2GT6A 2DJJA 1G0TA 14GSA 5B8BA 3DGQA 5FHIA 5F8BA 4K0NA 1GTIA 2LRTA 3VLNA 1UC7A 5FWGA 2IMIA 4K0GA 2CAIA 1F3BA 1QGVA 3KH7A 3HYPA 3GRXA 2F9SA 1SD9A 1WE0A 1UA5A 3TJBA 1X9WB 2LRNA 1NM3A 4Z7XA 4KX4A 3M3MA 4WBJA 4K9ZA 2N5FA 1EOGA 1Z7RA 1WWJA 5G1LA 2L57A 2BTOT 3ZLPA 3HZ4A 2CVKA 2CV4A 4KAEA 1FOHA 2GQKA 4POMA 4YH2A 2H1DA 2E2MA 3C1RA 3I69A 3ISOA 4HU7A 3ME8A 2LS5A 3JCML 5D8IA 1AC1A 2QKEA 4NHWA 3KJYA 4YQVA 1J0FA 1JZOA 3LWAA 3N9JA 1A0FA 5F07A 3TJKA 1KEBA 3FKFA 4K8MA 2FLSA 1A8LA 2X64A 3O76A 4MP4A 5IIZA 2MYGA 5IQYA 4LL1B 5D73A 3R3EA 2HYXA 3IDVA 2VCQA 3CXGA 2J9HA 1U6TA 2HFDA 2LUSA 2O89A 1GNWA 2H6YA 17GSA 1XWKA 3GKMA 1OE8A 3TJJA 10GSA 2B1KA 1U88A 1GSUA 2VCTA 5EY6A 5CO3A 4N30A 4HQSA 3LXTA 1XW6A 2VCVA 3SBCA 3I6AA 5ID2A 1WJKA 5KN0A 3PINA 1A23A 4EC0A 2V41A 4AJ7A 1T3BA 3EU3A 1K3OA 2DMLA 5ECNB 3HJMA 3HA9A 1X5CA 2K18A 3S9FA 1GSEA 2YNXA 2V6KA 3TOUA 2MMOA 4EDYA 4DEJA 4BWQA 1O8XA 1W4VA 4QL7A 5IMFA 4HJMA 1PA3A 3L9VA 1BJXA 1GP1A 3FZ4A 3VFIA 3IR4A 4Q5RA 3EMXA 4K7IA 3HZ8A 1GSFA 5FT3A 1M2BA 3TDGA 5INYA 3HY2A 1GH2A 2IMFA 4EXJA 2VLTA 1ILOA 3G9BA 1R5PA 2VL9A 2VL2C 4F0CA 2FGXA 1O7UA 3LEFA 2DC5A 3RHCA 3UAPA 1G6WA 3QD9A 2FWEA 4WKWA 1FVKA 1GNEA 1OAZA 2EIRA 2GQMA 1TRSA 2REMA 5CYYA 4RUVA 3ZL5A 2F51A 3ZFBA 3L4NA 2WZ9A 2L4QA 5F0GA 5G5FA 1FG4A 3CTFA 2NDOA 4BVXA 3I9V2 1XWBA 4O7HA 2YP6A 1GUMA 2HRFA 3GHAA 1J9BA 4GRFA 3VWUA 3KMNA 1M99A 1YEPA 4KW6A 2H74A 3M8NA 1TRVA 4MPGA 1QUWA 3HJOA 4EKZA 1OKTA 1XW9A 3WT1A 1LU4A 2OE0A 1A24A 1JHBA 4ZILA 5GSTA 4L0WA 9GSSA 5ECPB 2IMDA 5DJMA 3J7Yk 2C80A 1O73A 2JZSA 4I97A 4G19A 1SYXA 2WJUA 1M0UA 5A5KA 1O8WA 4NV2A 1GULA 2AB6A 3EC3A 3GMFA 1VF3A 2ZCTA 1PRXA 4IGJA 3A5IA 1MDKA 3TRQA 1KTEA 4FYUA 4V1Ap 22GSA 4TXOA 5JCUA 4RI6A 1M7TA 1PQNA 1NHOA 4BVYA 4GQCA 1PKWA 3ZIVA 1XOAA 5ECIB 4PUFC 3IHGA 4V1Ag 3DEXA 1YDKA 4POLA 3D5JA 2R0CA 2H71A 1Z7PA 1WOUA 3IK7A 2NVLA 5ELGA 2H70A 2X4AA 4IHUA 5A4VA 3FZAA 3KIJA 3LFLA 4KA0A 8GSSA 4ZL9A 1KBNA 2E2GA 1MD3A 1ZYEA 5F06A 3RPNA 1ZOFA 3A2WA 3EVIA 3J7Yb 1GUKA 5A4UA 4EF0A 2YZUA 2LSTA 5AISA 1PN0A 1TI3A 2C3TA 1SK1A 2RUFA 2XBIA 4TR0A 2HT9A 3H79A 5DDLA 3LQ7A 1FAAA 3FZ5A 4X1UA 2CZ2A 2M46A 4JE1A 2FA4A 2L4CA 4GSNA 1ZGNA 2AJQB 1TW9A 1FHEA 3LW9A 1GSQA 1WPIA 18GSA 5JCGA 3LYKA 5HQPA 4G10A 2GT5A 3ZVJA 5DALB 2WGRA 1S3CA 3WYWA 20GSA 2HRNA 3TJGA 1SKRB 5H5RA 3FY7A 2YPMA 1U87A 2KP1A 1H4OA 1K3LA 4O32A 1BQ7A 4IS0A 5KN1A 2F8FA 3WGXA 1EEMA 4ULXA 4KDYA 3P2AA 2F8AA 2I4AA 3GL3A 2FUG2 3PH9A 1DE1A 3QCPA 2FY6A 1OKDA 3FYGA 2LQOA 3GV1A 1B9XC 3MYDA 3UBKA 3M1GA 4LMWA 4MPFA 4L0UA 1SKSB 2VCZA 1Q4JA 3DRNA 2H30A 4XS4A 2H0IA 5IMCA 2GTUA 1PMTA 5B6NA 1TOFA 1RQMA 3QFAC 4JR4A 3FHKA 3L9UA 1SJIA 2H75A 2H72A 1EP8A 4LLRA 1V2AA 4IP6A 2WRTA 4NWYA 2MMNA 4L5OA 2PUKC 1B9YC 3IV4A 2CA8A 2LJAA 3HVXA 4ML1A 6GSWA 1XOBA 4K7NA 1V57A 2C3QA 4MZCA 1H75A 2B3SA 3UARA 4TVEA 3W8JA 3C71A 1NHYA 3E9JB 1M9BA 3LXZA 1ON4A 4CY8A 3SWLA 2FD3A 2JZRA 2TIRA 3VK9A 5IM9A 3GH9A 4QL9A 4FIWA 3GFKA 3QOUA 1WRYA 2YV7A 5E4WA 1ACVA 3NOFA 4ZB9A 1QMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERF A;  1Z5Y E;  4D73 A;  1OVN A;  3RAZ A;  4TR4 A;  4BPY A;  2WCI A;  3L9S A;  4LMV A;  19GS A;  5HFG A;  4K2D A;  2CVB A;  3CBU A;  1QFN A;  2HSY A;  1TK5 B;  2C0G A;  3BCK A;  2FCH A;  4MZW A;  1I5G A;  2H73 A;  3BOA A;  2FWG A;  1XXU A;  4PNG A;  4XCS A;  2HSH A;  1I9D A;  4CW9 A;  3TKS E;  2K9F A;  2V6O A;  5ECS A;  2KLX A;  1TU8 A;  3ZFL A;  4XRA A;  2HZE B;  2NPB A;  3F4R A;  3GTU B;  2H1G A;  4XS1 A;  4PQH A;  1N2A A;  3N5O A;  1PL1 A;  3TCO A;  1ERU A;  3KMO A;  3KM6 A;  5JWR B;  1YY7 A;  2DJ1 A;  2DIZ A;  2H19 A;  4V2L A;  1DSB A;  4IQ1 A;  2C0D A;  4MK3 A;  2XPD A;  4BWS A;  6GST A;  4TOP A;  1T7P B;  4YAV A;  1TU7 A;  4NMU A;  3O3T A;  4TN8 A;  1SEN A;  2LQQ A;  1JZD A;  2YWM A;  2CX4 A;  4MH3 A;  3DML A;  2OA7 A;  1OC3 A;  3BJ5 A;  1K0D A;  1Z6N A;  1IYH A;  1PD2 1;  1ERT A;  4WEY A;  4YQM A;  4MLY A;  2B6M A;  4KDU A;  2YWO A;  3FRC A;  4DSQ A;  2I81 A;  3IPZ A;  1AW9 A;  1R26 A;  4EL1 A;  4F2I A;  3IC4 A;  2OE1 A;  4IN0 A;  3BD2 A;  4HZ2 A;  4OD7 A;  1FO5 A;  4G2E A;  2X8H A;  4XRD A;  4IEL A;  1G7O A;  1EWX A;  1VF1 A;  5H5S A;  4WR5 A;  2MBT A;  4IJ3 A;  4POK A;  5DJL A;  1USB A;  5ENU A;  5CAX A;  3CTG A;  3VWX A;  2H01 A;  2WFC A;  3QAG A;  3G7I A;  3TB2 A;  5GAN D;  3MSZ A;  3CSH A;  1TDI A;  2YJ7 A;  3GX8 A;  4TR3 A;  3HXS A;  3QR6 A;  4F82 A;  6GSV A;  1MDI A;  3HHV A;  1FB0 A;  3KD0 A;  1CQH A;  5D9V A;  4N0Z A;  2WS2 A;  2DSA A;  4EVM A;  1M9A A;  4LA1 A;  1X0R A;  3IHQ A;  3G7J A;  4ILF A;  3GKN A;  2JZT A;  2VAF A;  1GTU A;  3DD3 A;  5ABR A;  4FH8 A;  3UEM A;  4GSS A;  4MF6 A;  1R4W A;  1AXD A;  3IAM 2;  4MF5 A;  5DBQ A;  3IAS 2;  2MBS A;  4ECJ A;  1SK2 A;  5D93 A;  1AQW A;  3K8N A;  2DJ2 A;  4HI7 A;  1WIK A;  1IYI A;  4OO5 A;  3A2X A;  4N10 A;  2DBC A;  2A2R A;  3L0H A;  5JWO B;  3V1W A;  1XVQ A;  1K0N A;  2YZH A;  2GDR A;  2FA8 A;  5J4U A;  2AV4 A;  1GSS A;  2PVO C;  4HQZ A;  3KH9 A;  1FOV A;  5D96 A;  3KTB A;  2ALB A;  4ECB A;  3F0I A;  4FYC A;  5HFK A;  1FW1 A;  2ZNM A;  4BL7 A;  4NPB A;  3RHB A;  1VRS D;  1HQO A;  1R5A A;  4JED A;  4BA7 A;  3FR9 A;  1OE7 A;  4KB3 A;  1GWC A;  4ZXG A;  2P31 A;  3MAK A;  3UJ1 A;  2VM2 A;  2L6C A;  2J23 A;  3TRP A;  2WB9 A;  3D4M A;  4LL4 B;  4ZBD A;  2XHF A;  4PUR A;  3EU4 A;  4GXZ A;  3F3R A;  1SL0 B;  2R37 A;  1THO A;  5F05 A;  4ZB8 A;  3RBT A;  4ISD A;  3VWW A;  4K7O A;  4I5Q A;  1BAY A;  3ZYW A;  1JLV A;  2B1L A;  1AIU A;  4HS1 A;  2K6V A;  1MTC A;  1UVZ A;  2H0H A;  3DXB A;  3CSJ A;  5B6M A;  5HR0 A;  1T00 A;  5KN2 A;  2ON7 A;  2B5X A;  2IFQ A;  1K0M A;  3KEB A;  1A2L A;  3FR6 A;  4MCU A;  2VCW A;  5IPG A;  4I6X A;  3TKS C;  4AF2 A;  3W8S A;  2GZZ A;  3GKX A;  4NAX A;  4IJI A;  2H6X A;  2PVQ A;  3CSI A;  3D21 A;  2GZY A;  1JZR A;  3F6F A;  4H86 A;  2EC4 A;  4F03 A;  1AQV A;  3TGZ A;  1X9M B;  2JSY A;  5IMA A;  1ABA A;  2NTO A;  4K6X A;  4O92 A;  2IIY A;  3APO A;  4RI7 A;  2YV9 A;  4N11 A;  3LG6 A;  2AUV A;  1O6J A;  3APQ A;  2LRC A;  2V1M A;  2R6K A;  4GLT A;  2YWI A;  4TRX A;  4PXO A;  4K1F A;  4MF7 A;  1AQX A;  1V9W A;  5H5Q A;  3TKR A;  4HDE A;  3P90 A;  2JSZ A;  1FB6 A;  1ERV A;  5AGY A;  2G0F A;  2K8V A;  4TXO B;  1XPV A;  2H1B A;  2PBJ A;  1PKZ A;  5DAK A;  2H76 A;  5CNW A;  4GWR A;  2QC7 A;  4WBR D;  1RK4 A;  5LD0 A;  4EE0 A;  5IMV A;  4ZB6 A;  1M2A A;  4ZL8 A;  2IME A;  3GNJ A;  4POB A;  2NBS A;  3A3T A;  2M80 A;  4YQU A;  2LTK A;  3U6V A;  3ED3 A;  5ECM B;  4E8E A;  4MAB A;  2YN1 A;  3OR5 A;  4EUY A;  3O6T A;  2B5E A;  1WMJ A;  4ID0 A;  1N8J A;  2WUL A;  2GSS A;  3QFB C;  2O85 A;  4GQF A;  3HJP A;  1TK0 B;  2A4V A;  2MMA A;  2DJK A;  3F6D A;  1K3Y A;  2CVD A;  2K8S A;  4DSR A;  2AYT A;  5L71 A;  4L8E A;  2XC2 A;  3L78 A;  2VM1 A;  3M9K A;  2Z9S A;  4ZL7 A;  2EIQ A;  1O81 A;  3M9J A;  3F4T A;  1TP9 A;  5B7C A;  3US3 A;  1MD4 A;  3P7X A;  3R2Q A;  4KSM A;  3QDN A;  3VUR A;  1PL2 A;  1VF2 A;  1S3D A;  3M0F A;  1ML6 A;  2I1U A;  4DSS A;  3QAW A;  2PGT A;  1YF1 A;  3VWV A;  4OFT A;  5C04 A;  4AJ8 A;  1TJD A;  1TTZ A;  1XZO A;  5IPH A;  1O85 A;  1URM A;  5B8A A;  1OC9 A;  2TRC P;  5GAP D;  1R7H A;  1PSQ A;  1UN2 A;  2PMT A;  5ELA A;  1YKA A;  2L5L A;  5CRW A;  3UVH A;  2VL2 A;  5CRH A;  5AN1 A;  2XPE A;  2IJY A;  3ZZX A;  5AIX A;  5C00 A;  4HZ4 A;  1YZX A;  2B7J A;  3Q6O A;  1SYR A;  5CRE A;  1A2J A;  2F3M A;  4IKH A;  3ZVJ D;  1BED A;  4XHM A;  1A8Y A;  3F63 A;  1X9S B;  3GX0 A;  3BCI A;  5D9X A;  3NZN A;  1F9M A;  2O87 A;  3VI5 A;  1KNG A;  4HU9 A;  1GSY A;  2ZUP A;  3QAV A;  2DMM A;  4WF4 A;  3GKK A;  4I8B A;  3H4K A;  1SL1 B;  1B48 A;  1TI1 A;  2GLR A;  4IW9 A;  5DQS A;  2IMK A;  3ZIJ A;  4TR1 B;  4WR4 A;  4ACS A;  3VPQ A;  4L5L A;  4F0B A;  4HOJ A;  11GS A;  1YEX A;  2H6Z A;  4GF0 A;  3HDC A;  1OYJ A;  2LJK A;  4MJB A;  4WET A;  1PX7 A;  2KP2 A;  4D73 B;  2C4J A;  4X43 A;  2A2S A;  3Q74 A;  2LNS A;  2YAN A;  2G2Q A;  3GTU A;  3FK8 A;  5IMD A;  4KH7 A;  2KHP A;  2JAD A;  3UMA A;  3DWV A;  2MMZ A;  2GGT A;  2GZP A;  2HZF A;  2P5R A;  3EIN A;  3WGD A;  1JZW A;  2P0G A;  2MZC A;  2I9H A;  2P5Q A;  1J08 A;  3FR3 A;  3F9U A;  5JCW A;  1HNB A;  5IMZ A;  1RW1 A;  4GST A;  1EZK A;  1B4Q A;  3VI7 A;  2N5B A;  2L5O A;  2B5Y A;  1TKD B;  4KDX A;  3DVW A;  3PR8 A;  2PER A;  1YQ1 A;  2VLU A;  5EVO A;  3IXR A;  5G1K A;  3TUE A;  2LV3 A;  1X5D A;  3D4T A;  3HVV A;  5IO0 A;  1T4Y A;  3E3E A;  1Q98 A;  3ME7 A;  2KOK A;  1A2M A;  5G5E A;  3KTL A;  4MZB A;  5LCZ A;  2OBI A;  3F3Q A;  4IQA A;  5IOW A;  5HR3 A;  6GSU A;  2C8U A;  2QSI A;  1EP7 A;  3D22 A;  4I2T A;  4TW5 A;  4E8H A;  2YCD A;  3KXO A;  1C72 A;  1VF4 A;  1GTA A;  1Z9H A;  2IL3 A;  1B8X A;  3GN3 A;  4XS6 A;  4Q5F A;  1PGT A;  4MJE A;  5E59 A;  2VCX A;  3IK9 A;  3ZML A;  3HCZ A;  5GSS A;  3NIV A;  3KP8 A;  1EEJ A;  3MDK A;  3H93 A;  3IE3 A;  2RM6 A;  2VD0 A;  5KEJ A;  1Y25 A;  2CZ3 A;  2DJ3 A;  1ST9 A;  1JLW A;  3IRA A;  1V58 A;  4MJA A;  3LGC A;  5J41 A;  3GA4 A;  2L6D A;  3ZIT A;  2TRX A;  4CHS A;  4J57 E;  3FEU A;  3C1S A;  6GSS A;  2OE3 A;  1EGR A;  1F6M C;  4GCI A;  4PX1 A;  2PU9 C;  2V32 A;  3GYK A;  3E0U A;  1G7E A;  2E7P A;  4OFM A;  1DBY A;  5IO2 A;  5J5N A;  2D2Z A;  3TKQ A;  5JWQ B;  1Z3E A;  5EPF A;  2CT6 A;  2H66 A;  2ES7 A;  1QQ2 A;  1YJ6 A;  5DVB A;  1JFU A;  3I43 A;  2M72 A;  2FWH A;  2YJH A;  4O5R A;  2LEG A;  4RQR A;  1QK8 A;  3MNG A;  2DJ0 A;  2C0F A;  1CQG A;  4IVF A;  4ZIJ A;  2GQL A;  3F8U A;  1PN9 A;  4KGI A;  3C73 A;  2CAQ A;  5DCH A;  1ZCP A;  1AAZ A;  2PWJ A;  2N5A A;  3GIX A;  5ID2 B;  3HKR A;  2FNO A;  1M2D A;  2VUP A;  2RLI A;  5KN3 A;  1AUC A;  3BBY A;  2JU5 A;  3P8W A;  3EYT A;  4KND A;  4TKY A;  1EGO A;  3ZRD A;  2DLX A;  3ZTL A;  3GSS A;  1FVJ A;  3CRU A;  5ECH B;  4NXI A;  2LKU A;  2GS3 A;  1OC8 A;  1B4P A;  3CYN A;  5CRD A;  4WF5 A;  3QMX A;  1S3A A;  3TOT A;  1Y6E A;  3WT2 A;  2OKA A;  3CMI A;  3A5W A;  4QQ7 A;  1X5E A;  4KCA A;  3GUR A;  3ZRE A;  3UBL A;  5J9B A;  1GSD A;  1YF0 A;  1XWG A;  2IPA A;  4X0X A;  2QGV A;  1GLP A;  1G6Y A;  4NHZ A;  4KCE A;  4MH2 A;  1TRU A;  5HR1 A;  2LNT A;  1MDJ A;  4Q5Q A;  1T8E B;  4P3Y B;  3GUS A;  5A4W A;  3WD6 A;  4HUA A;  4MA9 A;  5ECL B;  4HEA 2;  3ERG A;  4ECI A;  2H8L A;  4IBP A;  1BG5 A;  1ZMA A;  1K0A A;  4J2F A;  2R3X A;  3C7M A;  3LSZ A;  4PQI A;  1GTB A;  1TRW A;  1T1V A;  2IFQ B;  1W89 A;  4OWY A;  4ZBA A;  2RUE A;  3GH6 A;  2X8C A;  2I3Y A;  4KSO A;  5ECR B;  5DQY A;  2PN8 A;  1GRX A;  1EV4 A;  3UOM A;  2OAC A;  1K0B A;  6GSX A;  3DYR A;  5EL8 A;  1K0O A;  1SL2 B;  2X99 A;  1NW2 A;  3VPT A;  5ECK B;  1A0R P;  4AJ6 A;  1HNC A;  3H8Q A;  3KP9 A;  1NSW A;  5G31 A;  3MWH A;  4XTS A;  1F37 A;  3UL3 A;  5IOX A;  2VOC A;  2CQ9 A;  5ECQ B;  3TRX A;  4OCF A;  2AAW A;  3KGK A;  4ECC A;  3PGT A;  4N0V A;  4MDC A;  3GST A;  2JL4 A;  4EO3 A;  2HNL A;  3TKP A;  1TK8 B;  3DVX A;  2C0E A;  4JRR A;  3LYP A;  1LJR A;  4JU5 A;  1DUG A;  1BX9 A;  1SD8 A;  2IWT A;  2OJL A;  3KZQ A;  3EUR A;  1SKW B;  2DIY A;  2PPT A;  1WP0 A;  1XVW A;  1V98 A;  5HR2 A;  3IOS A;  4JZQ A;  1V40 A;  2JAC A;  5DAK B;  4J56 E;  5ECO B;  1GLQ A;  4GTU A;  4RQX A;  3ERW A;  2V2G A;  3Q18 A;  5DAL A;  1XWC A;  4FO5 A;  2HE3 A;  4EDZ A;  2FHE A;  2VL3 A;  1T4Z A;  3AY8 A;  4I2U A;  2GVP A;  1QXH A;  3HVS A;  1BYE A;  3RDW A;  4JR6 A;  4G9H A;  4PQ1 A;  4AGS A;  2OAD A;  4HJ2 A;  2XBQ A;  3IBH A;  2GST A;  4V2M A;  3DKS A;  1EV9 A;  5HFI A;  4ML6 A;  4TXV A;  2X8G A;  3W6G A;  1LBK A;  1U3A A;  2IN3 A;  4OMV A;  2BMX A;  2KUC A;  2R4V A;  4V2N A;  5G2Z A;  4JBB A;  3C8E A;  12GS A;  3U5R E;  1EOH A;  1PX6 A;  3QPM A;  3DIE A;  1E6B A;  1GUH A;  1F3A A;  2VD1 A;  3TJF A;  3LOR A;  1E2Y A;  4XS4 B;  2CX3 A;  1VGL A;  2B7K A;  3GL5 A;  5D9W A;  4DSS B;  4IP1 A;  13GS A;  1SJZ A;  2OBK A;  1HYU A;  3EMP A;  1ZL9 A;  4NV5 A;  2EIO A;  1F2E A;  2C1Y A;  1GL8 A;  4MMM A;  4MJC A;  1K0C A;  5J9C A;  1OC9 B;  2HI7 A;  2YWN A;  3D0Z A;  1SK0 A;  4PGT A;  3ZMK A;  2HXK A;  2WDU A;  4YAP A;  16GS A;  3IA1 A;  2O7K A;  2VO4 A;  3G7Y A;  4FYB A;  5D9T A;  3HD5 A;  1THX A;  1DE2 A;  7GSS A;  3CRT A;  3EE2 A;  2LJR A;  1XIY A;  2ON5 A;  5DCG A;  3FZ9 A;  4TR1 A;  1SJ6 A;  5GZZ B;  1XBS A;  2H0G A;  2L59 A;  3Q19 A;  1XW5 A;  1ZZY A;  5CRG A;  1XFL A;  2FWF A;  5COH A;  4PUA A;  3TKS A;  4DVC A;  5G30 A;  1HD2 A;  5LNK e;  1TXX A;  4WXT A;  3KCM A;  3EWL A;  4KE3 A;  4PNF A;  2C3N A;  2YOI A;  3F4S A;  3LJR A;  2HZE A;  2R2J A;  1ERW A;  2GSR A;  3A2V A;  4OFN A;  5CP1 A;  1MEK A;  4Q5N A;  1Z6M A;  6GSY A;  2BJX A;  3RPP A;  4ZBB A;  2O8V B;  2VLV A;  3WGE A;  2RM5 A;  4KUN A;  5J3R A;  1YKC A;  2R5G A;  1SU9 A;  4XIH A;  2HLS A;  4CDO A;  1XCC A;  2RII A;  3H1N A;  3FW2 A;  3UIW A;  1U3I A;  2VIM A;  3UVT A;  4OO4 A;  1XWA A;  1HNA A;  3D6I A;  2E0Q A;  3APS A;  5AIV A;  2H1A A;  4F9Z A;  4OCE A;  2GSQ A;  2AHE A;  1ZYQ B;  2GT6 A;  2DJJ A;  1G0T A;  14GS A;  5B8B A;  3DGQ A;  5FHI A;  5F8B A;  4K0N A;  1GTI A;  2LRT A;  3VLN A;  1UC7 A;  5FWG A;  2IMI A;  4K0G A;  2CAI A;  1F3B A;  1QGV A;  3KH7 A;  3HYP A;  3GRX A;  2F9S A;  1SD9 A;  1WE0 A;  1UA5 A;  3TJB A;  1X9W B;  2LRN A;  1NM3 A;  4Z7X A;  4KX4 A;  3M3M A;  4WBJ A;  4K9Z A;  2N5F A;  1EOG A;  1Z7R A;  1WWJ A;  5G1L A;  2L57 A;  2BTO T;  3ZLP A;  3HZ4 A;  2CVK A;  2CV4 A;  4KAE A;  2GQK A;  4POM A;  4YH2 A;  2H1D A;  2E2M A;  3C1R A;  3I69 A;  3ISO A;  4HU7 A;  3ME8 A;  2LS5 A;  3JCM L;  5D8I A;  1AC1 A;  2QKE A;  4NHW A;  3KJY A;  4YQV A;  1J0F A;  1JZO A;  3LWA A;  3N9J A;  1A0F A;  5F07 A;  3TJK A;  1KEB A;  3FKF A;  4K8M A;  2FLS A;  1A8L A;  2X64 A;  3O76 A;  4MP4 A;  5IIZ A;  2MYG A;  5IQY A;  4LL1 B;  5D73 A;  2HYX A;  3IDV A;  2VCQ A;  3CXG A;  2J9H A;  1U6T A;  2HFD A;  2LUS A;  2O89 A;  1GNW A;  2H6Y A;  17GS A;  1XWK A;  3GKM A;  1OE8 A;  3TJJ A;  10GS A;  2B1K A;  1U88 A;  1GSU A;  2VCT A;  5EY6 A;  5CO3 A;  4N30 A;  4HQS A;  3LXT A;  1XW6 A;  2VCV A;  3SBC A;  3I6A A;  5ID2 A;  1WJK A;  5KN0 A;  3PIN A;  1A23 A;  4EC0 A;  2V41 A;  4AJ7 A;  1T3B A;  3EU3 A;  1K3O A;  2DML A;  5ECN B;  3HJM A;  3HA9 A;  1X5C A;  2K18 A;  3S9F A;  1GSE A;  2YNX A;  2V6K A;  3TOU A;  2MMO A;  4EDY A;  4DEJ A;  4BWQ A;  1O8X A;  1W4V A;  4QL7 A;  5IMF A;  4HJM A;  1PA3 A;  3L9V A;  1BJX A;  1GP1 A;  3FZ4 A;  3VFI A;  3IR4 A;  4Q5R A;  3EMX A;  4K7I A;  3HZ8 A;  1GSF A;  5FT3 A;  1M2B A;  3TDG A;  5INY A;  3HY2 A;  1GH2 A;  2IMF A;  4EXJ A;  2VLT A;  1ILO A;  3G9B A;  1R5P A;  2VL9 A;  2VL2 C;  4F0C A;  2FGX A;  1O7U A;  3LEF A;  2DC5 A;  3RHC A;  3UAP A;  1G6W A;  3QD9 A;  2FWE A;  4WKW A;  1FVK A;  1GNE A;  1OAZ A;  2EIR A;  2GQM A;  1TRS A;  2REM A;  5CYY A;  4RUV A;  3ZL5 A;  2F51 A;  3ZFB A;  3L4N A;  2WZ9 A;  2L4Q A;  5F0G A;  5G5F A;  1FG4 A;  3CTF A;  2NDO A;  4BVX A;  3I9V 2;  1XWB A;  4O7H A;  2YP6 A;  1GUM A;  2HRF A;  3GHA A;  1J9B A;  4GRF A;  3VWU A;  3KMN A;  1M99 A;  1YEP A;  4KW6 A;  2H74 A;  3M8N A;  1TRV A;  4MPG A;  1QUW A;  3HJO A;  4EKZ A;  1OKT A;  1XW9 A;  3WT1 A;  1LU4 A;  2OE0 A;  1A24 A;  1JHB A;  4ZIL A;  5GST A;  4L0W A;  9GSS A;  5ECP B;  2IMD A;  5DJM A;  3J7Y k;  2C80 A;  1O73 A;  2JZS A;  4I97 A;  4G19 A;  1SYX A;  2WJU A;  1M0U A;  5A5K A;  1O8W A;  4NV2 A;  1GUL A;  2AB6 A;  3EC3 A;  3GMF A;  1VF3 A;  2ZCT A;  1PRX A;  4IGJ A;  1MDK A;  3TRQ A;  1KTE A;  4FYU A;  4V1A p;  22GS A;  4TXO A;  5JCU A;  4RI6 A;  1M7T A;  1PQN A;  1NHO A;  4BVY A;  4GQC A;  1PKW A;  3ZIV A;  1XOA A;  5ECI B;  4PUF C;  4V1A g;  3DEX A;  1YDK A;  4POL A;  3D5J A;  2H71 A;  1Z7P A;  1WOU A;  3IK7 A;  2NVL A;  5ELG A;  2H70 A;  4IHU A;  5A4V A;  3FZA A;  3KIJ A;  3LFL A;  4KA0 A;  8GSS A;  4ZL9 A;  1KBN A;  2E2G A;  1MD3 A;  1ZYE A;  5F06 A;  3RPN A;  1ZOF A;  3A2W A;  3EVI A;  3J7Y b;  1GUK A;  5A4U A;  4EF0 A;  2YZU A;  2LST A;  5AIS A;  1TI3 A;  2C3T A;  1SK1 A;  2RUF A;  2XBI A;  4TR0 A;  2HT9 A;  3H79 A;  5DDL A;  3LQ7 A;  1FAA A;  3FZ5 A;  4X1U A;  2CZ2 A;  2M46 A;  4JE1 A;  2FA4 A;  2L4C A;  4GSN A;  1ZGN A;  2AJQ B;  1TW9 A;  1FHE A;  1GSQ A;  1WPI A;  18GS A;  5JCG A;  3LYK A;  5HQP A;  4G10 A;  2GT5 A;  3ZVJ A;  5DAL B;  2WGR A;  1S3C A;  3WYW A;  20GS A;  2HRN A;  3TJG A;  1SKR B;  5H5R A;  3FY7 A;  2YPM A;  1U87 A;  2KP1 A;  1H4O A;  1K3L A;  4O32 A;  1BQ7 A;  4IS0 A;  5KN1 A;  2F8F A;  3WGX A;  1EEM A;  4ULX A;  4KDY A;  3P2A A;  2F8A A;  2I4A A;  3GL3 A;  2FUG 2;  3PH9 A;  1DE1 A;  3QCP A;  2FY6 A;  1OKD A;  3FYG A;  2LQO A;  3GV1 A;  1B9X C;  3UBK A;  3M1G A;  4LMW A;  4MPF A;  4L0U A;  1SKS B;  2VCZ A;  1Q4J A;  3DRN A;  2H30 A;  4XS4 A;  2H0I A;  5IMC A;  2GTU A;  1PMT A;  5B6N A;  1TOF A;  1RQM A;  3QFA C;  4JR4 A;  3FHK A;  3L9U A;  1SJI A;  2H75 A;  2H72 A;  1EP8 A;  4LLR A;  1V2A A;  4IP6 A;  2WRT A;  4NWY A;  2MMN A;  4L5O A;  2PUK C;  1B9Y C;  3IV4 A;  2CA8 A;  2LJA A;  3HVX A;  4ML1 A;  6GSW A;  1XOB A;  4K7N A;  1V57 A;  2C3Q A;  4MZC A;  1H75 A;  2B3S A;  3UAR A;  4TVE A;  3W8J A;  3C71 A;  1NHY A;  3E9J B;  1M9B A;  3LXZ A;  1ON4 A;  3SWL A;  2FD3 A;  2JZR A;  2TIR A;  3VK9 A;  5IM9 A;  3GH9 A;  4QL9 A;  4FIW A;  3GFK A;  3QOU A;  1WRY A;  2YV7 A;  5E4W A;  1ACV A;  3NOF A;  4ZB9 A;  1QMV A; 
#chains in the Genus database with same CATH topology
 3ERF A;  1Z5Y E;  4D73 A;  1OVN A;  3RAZ A;  4TR4 A;  4BPY A;  2WCI A;  3L9S A;  4LMV A;  19GS A;  5HFG A;  4K2D A;  2CVB A;  3CBU A;  1QFN A;  2HSY A;  1TK5 B;  2C0G A;  3BCK A;  2FCH A;  4MZW A;  1I5G A;  2H73 A;  3BOA A;  2FWG A;  1XXU A;  4PNG A;  4XCS A;  2HSH A;  1I9D A;  4CW9 A;  3TKS E;  2K9F A;  2V6O A;  5ECS A;  2KLX A;  4O5Q A;  1TU8 A;  3ZFL A;  4XRA A;  2HZE B;  2NPB A;  3F4R A;  3GTU B;  2H1G A;  4XS1 A;  4PQH A;  1N2A A;  3N5O A;  1PL1 A;  3TCO A;  1ERU A;  3KMO A;  3KM6 A;  5JWR B;  4MNN A;  1YY7 A;  2DJ1 A;  2DIZ A;  2H19 A;  4V2L A;  1DSB A;  4IQ1 A;  2C0D A;  4MK3 A;  4K5R A;  2XPD A;  4BWS A;  6GST A;  4TOP A;  1T7P B;  4YAV A;  1TU7 A;  4NMU A;  3O3T A;  4TN8 A;  1SEN A;  2LQQ A;  1JZD A;  2YWM A;  2CX4 A;  4MH3 A;  4G0I A;  3DML A;  2OA7 A;  1OC3 A;  3BJ5 A;  1K0D A;  1Z6N A;  1IYH A;  1PD2 1;  1ERT A;  4WEY A;  4YQM A;  4MLY A;  2B6M A;  4KDU A;  2YWO A;  3FRC A;  4DSQ A;  2I81 A;  3IPZ A;  2A4H A;  1AW9 A;  1R26 A;  4EL1 A;  4F2I A;  3IC4 A;  2OE1 A;  4IN0 A;  3BD2 A;  4HZ2 A;  4OD7 A;  1FO5 A;  4G2E A;  4YKF A;  2X8H A;  4XRD A;  4IEL A;  1G7O A;  1EWX A;  1VF1 A;  5H5S A;  4WR5 A;  2MBT A;  4IJ3 A;  4POK A;  5DJL A;  1USB A;  5ENU A;  5CAX A;  3CTG A;  3VWX A;  2HSM A;  2H01 A;  2WFC A;  3QAG A;  3G7I A;  3TB2 A;  5GAN D;  3MSZ A;  3CSH A;  1TDI A;  2YJ7 A;  3GX8 A;  4TR3 A;  3HXS A;  3PPU A;  3QR6 A;  4F82 A;  6GSV A;  1MDI A;  3HHV A;  1FB0 A;  3KD0 A;  1CQH A;  5D9V A;  4N0Z A;  2WS2 A;  2DSA A;  4EVM A;  1M9A A;  4LA1 A;  1X0R A;  3IHQ A;  3G7J A;  4ILF A;  3GKN A;  2JZT A;  2R0P A;  2VAF A;  1GTU A;  3DD3 A;  5ABR A;  4FH8 A;  3UEM A;  4GSS A;  4MF6 A;  1R4W A;  1AXD A;  3IAM 2;  4MF5 A;  5DBQ A;  1M3I A;  3IAS 2;  2MBS A;  4ECJ A;  1SK2 A;  5D93 A;  1AQW A;  3K8N A;  2DJ2 A;  4HI7 A;  1WIK A;  1IYI A;  4OO5 A;  3A2X A;  2QA2 A;  4N10 A;  2DBC A;  2A2R A;  3L0H A;  5JWO B;  3V1W A;  1XVQ A;  1K0N A;  2YZH A;  2GDR A;  2FA8 A;  5J4U A;  4Z2R A;  2AV4 A;  1GSS A;  2PVO C;  4HQZ A;  3KH9 A;  1FOV A;  5D96 A;  3KTB A;  2ALB A;  4ECB A;  3F0I A;  4FYC A;  5HFK A;  1FW1 A;  2ZNM A;  4BL7 A;  4NPB A;  3RHB A;  1VRS D;  1HQO A;  1R5A A;  4JED A;  4BA7 A;  3FR9 A;  1OE7 A;  4KB3 A;  1GWC A;  4ZXG A;  2P31 A;  3MAK A;  3UJ1 A;  2VM2 A;  2L6C A;  2J23 A;  3TRP A;  2WB9 A;  3D4M A;  4LL4 B;  4ZBD A;  2XHF A;  4PUR A;  3EU4 A;  4GXZ A;  2DKI A;  3F3R A;  1SL0 B;  2R37 A;  1THO A;  5F05 A;  4ZB8 A;  3RBT A;  4ISD A;  3VWW A;  4K7O A;  4I5Q A;  1BAY A;  3ZYW A;  1JLV A;  2B1L A;  1AIU A;  4HS1 A;  2K6V A;  1MTC A;  1UVZ A;  2H0H A;  3DXB A;  3CSJ A;  5B6M A;  4FQU A;  5HR0 A;  1T00 A;  5KN2 A;  2ON7 A;  2B5X A;  2IFQ A;  1K0M A;  3KEB A;  1A2L A;  3FR6 A;  4MCU A;  2VCW A;  4BVX B;  5IPG A;  4I6X A;  3TKS C;  4AF2 A;  3W8S A;  2GZZ A;  3GKX A;  4NAX A;  4IJI A;  2H6X A;  2PVQ A;  3CSI A;  3D21 A;  2GZY A;  1JZR A;  4CY6 A;  3F6F A;  4H86 A;  2EC4 A;  4F03 A;  1AQV A;  3TGZ A;  1X9M B;  2JSY A;  5IMA A;  1ABA A;  2NTO A;  4K6X A;  4O92 A;  2IIY A;  3APO A;  4RI7 A;  2YV9 A;  4N11 A;  3LG6 A;  2AUV A;  1O6J A;  3APQ A;  2LRC A;  2V1M A;  2R6K A;  4GLT A;  2YWI A;  4TRX A;  4PXO A;  4K1F A;  4ICY A;  4MF7 A;  1AQX A;  1V9W A;  5H5Q A;  3TKR A;  4HDE A;  3P90 A;  2JSZ A;  1FB6 A;  1ERV A;  5AGY A;  2G0F A;  2K8V A;  3FMW A;  4TXO B;  1XPV A;  2H1B A;  1M3J A;  4BVY B;  2PBJ A;  1PKZ A;  5DAK A;  2DKH A;  2H76 A;  5CNW A;  4GWR A;  2QC7 A;  4WBR D;  1RK4 A;  5LD0 A;  4EE0 A;  5IMV A;  4ZB6 A;  1M2A A;  4ZL8 A;  2IME A;  3GNJ A;  4POB A;  2NBS A;  3A3T A;  2M80 A;  4YQU A;  2LTK A;  3U6V A;  3ED3 A;  5ECM B;  4E8E A;  4MAB A;  2YN1 A;  3OR5 A;  4EUY A;  3O6T A;  2B5E A;  1WMJ A;  4ID0 A;  1N8J A;  2WUL A;  2GSS A;  3QFB C;  2O85 A;  4GQF A;  3HJP A;  1TK0 B;  5KOX A;  2A4V A;  2MMA A;  2DJK A;  3F6D A;  1K3Y A;  2CVD A;  2K8S A;  4DSR A;  2AYT A;  1ZYN A;  5L71 A;  3CQF A;  4L8E A;  2XC2 A;  3L78 A;  2VM1 A;  3M9K A;  2Z9S A;  4ZL7 A;  2EIQ A;  1O81 A;  5BMU A;  3M9J A;  3F4T A;  1TP9 A;  5B7C A;  3US3 A;  1MD4 A;  3P7X A;  3R2Q A;  4KSM A;  3QDN A;  3VUR A;  1PL2 A;  1VF2 A;  1S3D A;  3M0F A;  1ML6 A;  2I1U A;  4DSS A;  3QAW A;  2PGT A;  1YF1 A;  3VWV A;  4OFT A;  5C04 A;  4AJ8 A;  1TJD A;  1TTZ A;  1XZO A;  5IPH A;  1O85 A;  1URM A;  5B8A A;  1OC9 A;  2TRC P;  5GAP D;  1R7H A;  1PSQ A;  1UN2 A;  2PMT A;  5ELA A;  1YKA A;  2L5L A;  5CRW A;  3UVH A;  2VL2 A;  5CRH A;  5AN1 A;  5KOW A;  2XPE A;  2IJY A;  3ZZX A;  5AIX A;  5C00 A;  4HZ4 A;  1YZX A;  2B7J A;  3Q6O A;  1SYR A;  5CRE A;  1A2J A;  2F3M A;  4IKH A;  3ZVJ D;  4K2X A;  1BED A;  4XHM A;  1A8Y A;  3F63 A;  1X9S B;  3GX0 A;  3BCI A;  5D9X A;  3NZN A;  1F9M A;  2O87 A;  3VI5 A;  1KNG A;  4HU9 A;  1GSY A;  2ZUP A;  3QAV A;  2DMM A;  4WF4 A;  3GKK A;  2A2P A;  4I8B A;  3H4K A;  1SL1 B;  1B48 A;  1TI1 A;  2GLR A;  4IW9 A;  5DQS A;  3EPT A;  2IMK A;  3ZIJ A;  4TR1 B;  4WR4 A;  4ACS A;  3VPQ A;  4L5L A;  4F0B A;  4HOJ A;  11GS A;  1YEX A;  4Z2U A;  2H6Z A;  4GF0 A;  3HDC A;  1OYJ A;  2LJK A;  4MJB A;  4WET A;  1PX7 A;  2KP2 A;  4D73 B;  2C4J A;  4X43 A;  2A2S A;  3Q74 A;  2LNS A;  2YAN A;  2G2Q A;  3GTU A;  3FK8 A;  5IMD A;  4KH7 A;  2KHP A;  2JAD A;  3UMA A;  3DWV A;  2MMZ A;  2GGT A;  2GZP A;  2HZF A;  2P5R A;  3EIN A;  3WGD A;  1JZW A;  2P0G A;  2MZC A;  2I9H A;  2P5Q A;  1J08 A;  3FR3 A;  3F9U A;  5JCW A;  1HNB A;  5IMZ A;  1RW1 A;  4GST A;  4PTS A;  1EZK A;  1B4Q A;  4X4J A;  3VI7 A;  2N5B A;  2L5O A;  2B5Y A;  1TKD B;  4KDX A;  3DVW A;  3PR8 A;  2PER A;  1YQ1 A;  2VLU A;  5EVO A;  3IXR A;  5G1K A;  3TUE A;  2LV3 A;  1X5D A;  3D4T A;  3HVV A;  5IO0 A;  1T4Y A;  3E3E A;  1Q98 A;  3ME7 A;  2KOK A;  1A2M A;  5G5E A;  3KTL A;  4MZB A;  5LCZ A;  2OBI A;  3F3Q A;  4IQA A;  5IOW A;  5HR3 A;  6GSU A;  2C8U A;  2QSI A;  1EP7 A;  3D22 A;  4I2T A;  4TW5 A;  4E8H A;  2YCD A;  3KXO A;  1C72 A;  1VF4 A;  1GTA A;  1Z9H A;  2IL3 A;  1B8X A;  3GN3 A;  4XS6 A;  4Q5F A;  1PGT A;  4MJE A;  5E59 A;  2VCX A;  3IK9 A;  4EIQ A;  3ZML A;  3HCZ A;  5GSS A;  3NIV A;  3KP8 A;  1EEJ A;  3MDK A;  3H93 A;  3IE3 A;  2RM6 A;  2VD0 A;  5KEJ A;  1Y25 A;  2CZ3 A;  2DJ3 A;  1ST9 A;  1JLW A;  3IRA A;  1V58 A;  4MJA A;  3LGC A;  3MIX A;  3GA4 A;  5J41 A;  2L6D A;  3ZIT A;  2TRX A;  4CHS A;  4J57 E;  3FEU A;  3C1S A;  6GSS A;  2OE3 A;  1EGR A;  1F6M C;  4GCI A;  4PX1 A;  2V32 A;  2PU9 C;  3GYK A;  3E0U A;  1G7E A;  2E7P A;  4OFM A;  1DBY A;  5IO2 A;  5J5N A;  2D2Z A;  3TKQ A;  5JWQ B;  1Z3E A;  5EPF A;  2CT6 A;  2H66 A;  2ES7 A;  1QQ2 A;  1YJ6 A;  5DVB A;  1JFU A;  3I43 A;  2M72 A;  2FWH A;  2YJH A;  4O5R A;  2LEG A;  4RQR A;  1QK8 A;  3MNG A;  2DJ0 A;  2C0F A;  1CQG A;  4IVF A;  4ZIJ A;  4G0L A;  2GQL A;  3F8U A;  1PN9 A;  4KGI A;  3C73 A;  4A5P A;  2CAQ A;  5DCH A;  1ZCP A;  1AAZ A;  2PWJ A;  2N5A A;  3GIX A;  5ID2 B;  3HKR A;  2FNO A;  4G0K A;  1M2D A;  2VUP A;  2RLI A;  5KN3 A;  1AUC A;  3BBY A;  2JU5 A;  3P8W A;  3EYT A;  4KND A;  4TKY A;  1EGO A;  3ZRD A;  2DLX A;  3ZTL A;  3GSS A;  1FVJ A;  3CRU A;  5ECH B;  2R0G A;  4NXI A;  2LKU A;  2GS3 A;  1OC8 A;  1B4P A;  3CYN A;  5CRD A;  4WF5 A;  4BL7 B;  3QMX A;  1S3A A;  3TOT A;  1Y6E A;  3WT2 A;  2OKA A;  3CMI A;  3A5W A;  4QQ7 A;  1X5E A;  4KCA A;  3GUR A;  3ZRE A;  3UBL A;  5J9B A;  1GSD A;  1YF0 A;  1XWG A;  2IPA A;  4X0X A;  2QGV A;  1GLP A;  1G6Y A;  4NHZ A;  4KCE A;  4MH2 A;  1TRU A;  5HR1 A;  2LNT A;  1MDJ A;  4Q5Q A;  1T8E B;  4P3Y B;  3GUS A;  5A4W A;  3WD6 A;  4HUA A;  3HVN A;  4MA9 A;  5ECL B;  4HEA 2;  3ERG A;  4ECI A;  2H8L A;  4IBP A;  1BG5 A;  1ZMA A;  2HRA A;  3IC8 A;  1K0A A;  4J2F A;  2R3X A;  3C7M A;  3LSZ A;  4PQI A;  1GTB A;  1TRW A;  1T1V A;  2IFQ B;  1W89 A;  4OWY A;  4ZBA A;  1XG8 A;  2RUE A;  3GH6 A;  2X8C A;  2I3Y A;  4KSO A;  5ECR B;  5DQY A;  2PN8 A;  1GRX A;  1EV4 A;  3UOM A;  2OAC A;  1K0B A;  6GSX A;  3DYR A;  2HRK A;  5EL8 A;  1K0O A;  1SL2 B;  4O5U A;  2X99 A;  1NW2 A;  3VPT A;  5ECK B;  1A0R P;  4AJ6 A;  1HNC A;  3H8Q A;  3KP9 A;  4EIP A;  1NSW A;  5G31 A;  3MWH A;  4XTS A;  1F37 A;  3UL3 A;  5IOX A;  2VOC A;  2CQ9 A;  5ECQ B;  3TRX A;  4OCF A;  2AAW A;  3KGK A;  4ECC A;  3PGT A;  4N0V A;  4MDC A;  3GST A;  2JL4 A;  4EO3 A;  2HNL A;  3TKP A;  1TK8 B;  3DVX A;  2C0E A;  4JRR A;  3LYP A;  1LJR A;  4JU5 A;  1DUG A;  1BX9 A;  1SD8 A;  2IWT A;  2OJL A;  3KZQ A;  3EUR A;  1SKW B;  2DIY A;  2PPT A;  1WP0 A;  1XVW A;  1V98 A;  5HR2 A;  3IOS A;  4JZQ A;  1V40 A;  2JAC A;  5DAK B;  4J56 E;  5ECO B;  1GLQ A;  4GTU A;  4RQX A;  3ERW A;  2V2G A;  3Q18 A;  5DAL A;  1XWC A;  4FO5 A;  2HE3 A;  4EDZ A;  2FHE A;  2VL3 A;  1T4Z A;  3AY8 A;  4I2U A;  2GVP A;  1QXH A;  3HVS A;  1BYE A;  3RDW A;  4JR6 A;  4G9H A;  4PQ1 A;  4AGS A;  2OAD A;  4HJ2 A;  2XBQ A;  3IBH A;  2GST A;  4V2M A;  3DKS A;  1EV9 A;  5HFI A;  4ML6 A;  4YKG A;  2QA1 A;  4TXV A;  3W6G A;  2X8G A;  1LBK A;  1U3A A;  2IN3 A;  4OMV A;  2BMX A;  2KUC A;  2R4V A;  4V2N A;  5G2Z A;  4JBB A;  3C8E A;  12GS A;  3U5R E;  2X49 A;  1EOH A;  1PX6 A;  3QPM A;  3DIE A;  1E6B A;  1GUH A;  1F3A A;  2VD1 A;  5BRT A;  3TJF A;  3LOR A;  1E2Y A;  4XS4 B;  2CX3 A;  1VGL A;  2B7K A;  3GL5 A;  5D9W A;  4DSS B;  4IP1 A;  13GS A;  1SJZ A;  2OBK A;  1HYU A;  3EMP A;  2UZ8 A;  1ZL9 A;  4NV5 A;  2EIO A;  4BIK A;  1F2E A;  2C1Y A;  1GL8 A;  4MMM A;  4MJC A;  1K0C A;  5J9C A;  1OC9 B;  2HI7 A;  2YWN A;  4K5S A;  3D0Z A;  1SK0 A;  4PGT A;  3ZMK A;  2HXK A;  2WDU A;  4YAP A;  16GS A;  3IA1 A;  1ZYP A;  2O7K A;  2VO4 A;  3G7Y A;  4FYB A;  5D9T A;  3HD5 A;  1THX A;  1DE2 A;  7GSS A;  3CRT A;  3EE2 A;  2LJR A;  1XIY A;  2ON5 A;  4Z2T A;  5DCG A;  3FZ9 A;  4TR1 A;  1SJ6 A;  5GZZ B;  1XBS A;  2H0G A;  2L59 A;  3Q19 A;  1XW5 A;  1ZZY A;  5CRG A;  1XFL A;  2FWF A;  5COH A;  4PUA A;  3TKS A;  4DVC A;  5G30 A;  1HD2 A;  4KF9 A;  5LNK e;  1TXX A;  4USS A;  4WXT A;  3KCM A;  3EWL A;  4KE3 A;  4PNF A;  2C3N A;  2YOI A;  3F4S A;  3LJR A;  2HZE A;  2R2J A;  1ERW A;  2GSR A;  3A2V A;  4OFN A;  5CP1 A;  1MEK A;  4Q5N A;  1Z6M A;  6GSY A;  2BJX A;  3RPP A;  4ZBB A;  2O8V B;  2VLV A;  3WGE A;  2RM5 A;  4KUN A;  5J3R A;  1YKC A;  2R5G A;  1SU9 A;  4XIH A;  2HLS A;  4CDO A;  1XCC A;  2RII A;  3H1N A;  3FW2 A;  3UIW A;  1U3I A;  2VIM A;  3UVT A;  1S3R A;  4OO4 A;  1XWA A;  1HNA A;  3D6I A;  2E0Q A;  3APS A;  5AIV A;  2H1A A;  4F9Z A;  4OCE A;  2GSQ A;  2AHE A;  1ZYQ B;  2GT6 A;  2DJJ A;  1G0T A;  14GS A;  5B8B A;  3DGQ A;  5FHI A;  5F8B A;  4K0N A;  1GTI A;  2LRT A;  3VLN A;  1UC7 A;  5FWG A;  2IMI A;  4K0G A;  2CAI A;  1F3B A;  1QGV A;  3KH7 A;  3HYP A;  3GRX A;  2F9S A;  1SD9 A;  1WE0 A;  1UA5 A;  3TJB A;  1X9W B;  2LRN A;  1NM3 A;  4Z7X A;  4KX4 A;  3M3M A;  4WBJ A;  4K9Z A;  2N5F A;  1EOG A;  1Z7R A;  1WWJ A;  5G1L A;  2L57 A;  2BTO T;  3ZLP A;  3HZ4 A;  2CVK A;  2CV4 A;  4KAE A;  1FOH A;  2GQK A;  4POM A;  4YH2 A;  2H1D A;  2E2M A;  3C1R A;  3I69 A;  3ISO A;  4HU7 A;  3ME8 A;  2LS5 A;  3JCM L;  5D8I A;  1AC1 A;  2QKE A;  4NHW A;  3KJY A;  4YQV A;  1J0F A;  1JZO A;  3LWA A;  3N9J A;  1A0F A;  5F07 A;  3TJK A;  1KEB A;  3FKF A;  4K8M A;  2FLS A;  1A8L A;  2X64 A;  3O76 A;  4MP4 A;  5IIZ A;  2MYG A;  5IQY A;  4LL1 B;  5D73 A;  3R3E A;  2HYX A;  3IDV A;  2VCQ A;  3CXG A;  2J9H A;  1U6T A;  2HFD A;  2LUS A;  2O89 A;  1GNW A;  2H6Y A;  17GS A;  1XWK A;  3GKM A;  1OE8 A;  3TJJ A;  10GS A;  2B1K A;  1U88 A;  1GSU A;  2VCT A;  5EY6 A;  5CO3 A;  4N30 A;  4HQS A;  3LXT A;  1XW6 A;  2VCV A;  3SBC A;  3I6A A;  5ID2 A;  1WJK A;  5KN0 A;  3PIN A;  1A23 A;  4EC0 A;  2V41 A;  4AJ7 A;  1T3B A;  3EU3 A;  1K3O A;  2DML A;  5ECN B;  3HJM A;  3HA9 A;  1X5C A;  2K18 A;  3S9F A;  1GSE A;  2YNX A;  2V6K A;  3TOU A;  2MMO A;  4EDY A;  4DEJ A;  4BWQ A;  1O8X A;  1W4V A;  4QL7 A;  5IMF A;  4HJM A;  1PA3 A;  3L9V A;  1BJX A;  1GP1 A;  3FZ4 A;  3VFI A;  3IR4 A;  4Q5R A;  3EMX A;  4K7I A;  3HZ8 A;  1GSF A;  5FT3 A;  1M2B A;  3TDG A;  5INY A;  3HY2 A;  1GH2 A;  2IMF A;  4EXJ A;  2VLT A;  1ILO A;  3G9B A;  1R5P A;  2VL9 A;  2VL2 C;  4F0C A;  2FGX A;  1O7U A;  3LEF A;  2DC5 A;  3RHC A;  3UAP A;  1G6W A;  3QD9 A;  2FWE A;  4WKW A;  1FVK A;  1GNE A;  1OAZ A;  2EIR A;  2GQM A;  1TRS A;  2REM A;  5CYY A;  4RUV A;  3ZL5 A;  2F51 A;  3ZFB A;  3L4N A;  2WZ9 A;  2L4Q A;  5F0G A;  5G5F A;  1FG4 A;  3CTF A;  2NDO A;  4BVX A;  3I9V 2;  1XWB A;  4O7H A;  2YP6 A;  1GUM A;  2HRF A;  3GHA A;  1J9B A;  4GRF A;  3VWU A;  3KMN A;  1M99 A;  1YEP A;  4KW6 A;  2H74 A;  3M8N A;  1TRV A;  4MPG A;  1QUW A;  3HJO A;  4EKZ A;  1OKT A;  1XW9 A;  3WT1 A;  1LU4 A;  2OE0 A;  1A24 A;  1JHB A;  4ZIL A;  5GST A;  1PFO A;  4L0W A;  9GSS A;  5ECP B;  2IMD A;  5DJM A;  3J7Y k;  2C80 A;  1O73 A;  2JZS A;  4I97 A;  4G19 A;  1SYX A;  2WJU A;  1M0U A;  5A5K A;  1O8W A;  4NV2 A;  1GUL A;  2AB6 A;  3EC3 A;  3GMF A;  1VF3 A;  2ZCT A;  1PRX A;  4IGJ A;  3A5I A;  1MDK A;  3TRQ A;  1KTE A;  4FYU A;  4V1A p;  22GS A;  4TXO A;  5JCU A;  4RI6 A;  1M7T A;  1PQN A;  1NHO A;  4BVY A;  4GQC A;  1PKW A;  3ZIV A;  1XOA A;  5ECI B;  4PUF C;  3IHG A;  4V1A g;  3DEX A;  1YDK A;  4POL A;  3D5J A;  2R0C A;  2H71 A;  1Z7P A;  1WOU A;  3IK7 A;  2NVL A;  5ELG A;  2H70 A;  2X4A A;  4IHU A;  5A4V A;  3FZA A;  3KIJ A;  3LFL A;  4KA0 A;  8GSS A;  4ZL9 A;  1KBN A;  2E2G A;  1MD3 A;  1ZYE A;  5F06 A;  3RPN A;  1ZOF A;  3A2W A;  3EVI A;  3J7Y b;  1GUK A;  5A4U A;  4EF0 A;  2YZU A;  2LST A;  5AIS A;  1PN0 A;  1TI3 A;  2C3T A;  1SK1 A;  2RUF A;  2XBI A;  4TR0 A;  2HT9 A;  3H79 A;  5DDL A;  3LQ7 A;  1FAA A;  3FZ5 A;  4X1U A;  2CZ2 A;  2M46 A;  4JE1 A;  2FA4 A;  2L4C A;  4GSN A;  1ZGN A;  2AJQ B;  1TW9 A;  1FHE A;  3LW9 A;  1GSQ A;  1WPI A;  18GS A;  5JCG A;  3LYK A;  5HQP A;  4G10 A;  2GT5 A;  3ZVJ A;  5DAL B;  2WGR A;  1S3C A;  3WYW A;  20GS A;  2HRN A;  3TJG A;  1SKR B;  5H5R A;  3FY7 A;  2YPM A;  1U87 A;  2KP1 A;  4HSC X;  1H4O A;  1K3L A;  4O32 A;  1BQ7 A;  4IS0 A;  5KN1 A;  2F8F A;  3WGX A;  1EEM A;  4ULX A;  4KDY A;  3P2A A;  2F8A A;  2I4A A;  3GL3 A;  2FUG 2;  3PH9 A;  1DE1 A;  3QCP A;  2FY6 A;  1OKD A;  3FYG A;  2LQO A;  3GV1 A;  1B9X C;  3MYD A;  3UBK A;  3M1G A;  4LMW A;  4MPF A;  4L0U A;  1SKS B;  2VCZ A;  1Q4J A;  3DRN A;  2H30 A;  4XS4 A;  2H0I A;  5IMC A;  2GTU A;  1PMT A;  5B6N A;  1TOF A;  1RQM A;  3QFA C;  4JR4 A;  3FHK A;  3L9U A;  1SJI A;  2H75 A;  2H72 A;  1EP8 A;  4LLR A;  1V2A A;  4IP6 A;  2WRT A;  4NWY A;  2MMN A;  4L5O A;  2PUK C;  1B9Y C;  3IV4 A;  2CA8 A;  2LJA A;  3HVX A;  4ML1 A;  6GSW A;  1XOB A;  4K7N A;  1V57 A;  2C3Q A;  4MZC A;  1H75 A;  2B3S A;  3UAR A;  4TVE A;  3W8J A;  3C71 A;  1NHY A;  3E9J B;  1M9B A;  3LXZ A;  1ON4 A;  4CY8 A;  3SWL A;  2FD3 A;  2JZR A;  2TIR A;  3VK9 A;  5IM9 A;  3GH9 A;  4QL9 A;  4FIW A;  3GFK A;  3QOU A;  1WRY A;  2YV7 A;  5E4W A;  1ACV A;  3NOF A;  4ZB9 A;  1QMV A; 
#chains in the Genus database with same CATH homology
 3ERF A;  1Z5Y E;  4D73 A;  1OVN A;  3RAZ A;  4TR4 A;  4BPY A;  2WCI A;  3L9S A;  4LMV A;  19GS A;  5HFG A;  4K2D A;  2CVB A;  3CBU A;  1QFN A;  2HSY A;  1TK5 B;  2C0G A;  3BCK A;  2FCH A;  4MZW A;  1I5G A;  2H73 A;  3BOA A;  2FWG A;  1XXU A;  4PNG A;  4XCS A;  2HSH A;  1I9D A;  4CW9 A;  3TKS E;  2K9F A;  2V6O A;  5ECS A;  2KLX A;  4O5Q A;  1TU8 A;  3ZFL A;  4XRA A;  2HZE B;  2NPB A;  3F4R A;  3GTU B;  2H1G A;  4XS1 A;  4PQH A;  1N2A A;  3N5O A;  1PL1 A;  3TCO A;  1ERU A;  3KMO A;  3KM6 A;  5JWR B;  4MNN A;  1YY7 A;  2DJ1 A;  2DIZ A;  2H19 A;  4V2L A;  1DSB A;  4IQ1 A;  2C0D A;  4MK3 A;  4K5R A;  2XPD A;  4BWS A;  6GST A;  4TOP A;  1T7P B;  4YAV A;  1TU7 A;  4NMU A;  3O3T A;  4TN8 A;  1SEN A;  2LQQ A;  1JZD A;  2YWM A;  2CX4 A;  4MH3 A;  4G0I A;  3DML A;  2OA7 A;  1OC3 A;  3BJ5 A;  1K0D A;  1Z6N A;  1IYH A;  1PD2 1;  1ERT A;  4WEY A;  4YQM A;  4MLY A;  2B6M A;  4KDU A;  2YWO A;  3FRC A;  4DSQ A;  2I81 A;  3IPZ A;  2A4H A;  1AW9 A;  1R26 A;  4EL1 A;  4F2I A;  3IC4 A;  2OE1 A;  4IN0 A;  3BD2 A;  4HZ2 A;  4OD7 A;  1FO5 A;  4G2E A;  4YKF A;  2X8H A;  4XRD A;  4IEL A;  1G7O A;  1EWX A;  1VF1 A;  5H5S A;  4WR5 A;  2MBT A;  4IJ3 A;  4POK A;  5DJL A;  1USB A;  5ENU A;  5CAX A;  3CTG A;  3VWX A;  2HSM A;  2H01 A;  2WFC A;  3QAG A;  3G7I A;  3TB2 A;  5GAN D;  3MSZ A;  3CSH A;  1TDI A;  2YJ7 A;  3GX8 A;  4TR3 A;  3HXS A;  3PPU A;  3QR6 A;  4F82 A;  6GSV A;  1MDI A;  3HHV A;  1FB0 A;  3KD0 A;  1CQH A;  5D9V A;  4N0Z A;  2WS2 A;  2DSA A;  4EVM A;  1M9A A;  4LA1 A;  1X0R A;  3IHQ A;  3G7J A;  4ILF A;  3GKN A;  2JZT A;  2R0P A;  2VAF A;  1GTU A;  3DD3 A;  5ABR A;  4FH8 A;  3UEM A;  4GSS A;  4MF6 A;  1R4W A;  1AXD A;  3IAM 2;  4MF5 A;  5DBQ A;  3IAS 2;  2MBS A;  4ECJ A;  1SK2 A;  5D93 A;  1AQW A;  3K8N A;  2DJ2 A;  4HI7 A;  1WIK A;  1IYI A;  4OO5 A;  3A2X A;  2QA2 A;  4N10 A;  2DBC A;  2A2R A;  3L0H A;  5JWO B;  3V1W A;  1XVQ A;  1K0N A;  2YZH A;  2GDR A;  2FA8 A;  5J4U A;  4Z2R A;  2AV4 A;  1GSS A;  2PVO C;  4HQZ A;  3KH9 A;  1FOV A;  5D96 A;  3KTB A;  2ALB A;  4ECB A;  3F0I A;  4FYC A;  5HFK A;  1FW1 A;  2ZNM A;  4BL7 A;  4NPB A;  3RHB A;  1VRS D;  1HQO A;  1R5A A;  4JED A;  4BA7 A;  3FR9 A;  1OE7 A;  4KB3 A;  1GWC A;  4ZXG A;  2P31 A;  3MAK A;  3UJ1 A;  2VM2 A;  2L6C A;  2J23 A;  3TRP A;  2WB9 A;  3D4M A;  4LL4 B;  4ZBD A;  2XHF A;  4PUR A;  3EU4 A;  4GXZ A;  2DKI A;  3F3R A;  1SL0 B;  2R37 A;  1THO A;  5F05 A;  4ZB8 A;  3RBT A;  4ISD A;  3VWW A;  4K7O A;  4I5Q A;  1BAY A;  3ZYW A;  1JLV A;  2B1L A;  1AIU A;  4HS1 A;  2K6V A;  1MTC A;  1UVZ A;  2H0H A;  3DXB A;  3CSJ A;  5B6M A;  4FQU A;  5HR0 A;  1T00 A;  5KN2 A;  2ON7 A;  2B5X A;  2IFQ A;  1K0M A;  3KEB A;  1A2L A;  3FR6 A;  4MCU A;  2VCW A;  4BVX B;  5IPG A;  4I6X A;  3TKS C;  4AF2 A;  3W8S A;  2GZZ A;  3GKX A;  4NAX A;  4IJI A;  2H6X A;  2PVQ A;  3CSI A;  3D21 A;  2GZY A;  1JZR A;  4CY6 A;  3F6F A;  4H86 A;  2EC4 A;  4F03 A;  1AQV A;  3TGZ A;  1X9M B;  2JSY A;  5IMA A;  1ABA A;  2NTO A;  4K6X A;  4O92 A;  2IIY A;  3APO A;  4RI7 A;  2YV9 A;  4N11 A;  3LG6 A;  2AUV A;  1O6J A;  3APQ A;  2LRC A;  2V1M A;  2R6K A;  4GLT A;  2YWI A;  4TRX A;  4PXO A;  4K1F A;  4ICY A;  4MF7 A;  1AQX A;  1V9W A;  5H5Q A;  3TKR A;  4HDE A;  3P90 A;  2JSZ A;  1FB6 A;  1ERV A;  5AGY A;  2G0F A;  2K8V A;  3FMW A;  4TXO B;  1XPV A;  2H1B A;  4BVY B;  2PBJ A;  1PKZ A;  5DAK A;  2DKH A;  2H76 A;  5CNW A;  4GWR A;  2QC7 A;  4WBR D;  1RK4 A;  5LD0 A;  4EE0 A;  5IMV A;  4ZB6 A;  1M2A A;  4ZL8 A;  2IME A;  3GNJ A;  4POB A;  2NBS A;  3A3T A;  2M80 A;  4YQU A;  2LTK A;  3U6V A;  3ED3 A;  5ECM B;  4E8E A;  4MAB A;  2YN1 A;  3OR5 A;  4EUY A;  3O6T A;  2B5E A;  1WMJ A;  4ID0 A;  1N8J A;  2WUL A;  2GSS A;  3QFB C;  2O85 A;  4GQF A;  3HJP A;  1TK0 B;  5KOX A;  2A4V A;  2MMA A;  2DJK A;  3F6D A;  1K3Y A;  2CVD A;  2K8S A;  4DSR A;  2AYT A;  1ZYN A;  5L71 A;  4L8E A;  2XC2 A;  3L78 A;  2VM1 A;  3M9K A;  2Z9S A;  4ZL7 A;  2EIQ A;  1O81 A;  5BMU A;  3M9J A;  3F4T A;  1TP9 A;  5B7C A;  3US3 A;  1MD4 A;  3P7X A;  3R2Q A;  4KSM A;  3QDN A;  3VUR A;  1PL2 A;  1VF2 A;  1S3D A;  3M0F A;  1ML6 A;  2I1U A;  4DSS A;  3QAW A;  2PGT A;  1YF1 A;  3VWV A;  4OFT A;  5C04 A;  4AJ8 A;  1TJD A;  1TTZ A;  1XZO A;  5IPH A;  1O85 A;  1URM A;  5B8A A;  1OC9 A;  2TRC P;  5GAP D;  1R7H A;  1PSQ A;  1UN2 A;  2PMT A;  5ELA A;  1YKA A;  2L5L A;  5CRW A;  3UVH A;  2VL2 A;  5CRH A;  5AN1 A;  5KOW A;  2XPE A;  2IJY A;  3ZZX A;  5AIX A;  5C00 A;  4HZ4 A;  1YZX A;  2B7J A;  3Q6O A;  1SYR A;  5CRE A;  1A2J A;  2F3M A;  4IKH A;  3ZVJ D;  4K2X A;  1BED A;  4XHM A;  1A8Y A;  3F63 A;  1X9S B;  3GX0 A;  3BCI A;  5D9X A;  3NZN A;  1F9M A;  2O87 A;  3VI5 A;  1KNG A;  4HU9 A;  1GSY A;  2ZUP A;  3QAV A;  2DMM A;  4WF4 A;  3GKK A;  2A2P A;  4I8B A;  3H4K A;  1SL1 B;  1B48 A;  1TI1 A;  2GLR A;  4IW9 A;  5DQS A;  3EPT A;  2IMK A;  3ZIJ A;  4TR1 B;  4WR4 A;  4ACS A;  3VPQ A;  4L5L A;  4F0B A;  4HOJ A;  11GS A;  1YEX A;  4Z2U A;  2H6Z A;  4GF0 A;  3HDC A;  1OYJ A;  2LJK A;  4MJB A;  4WET A;  1PX7 A;  2KP2 A;  4D73 B;  2C4J A;  4X43 A;  2A2S A;  3Q74 A;  2LNS A;  2YAN A;  2G2Q A;  3GTU A;  3FK8 A;  5IMD A;  4KH7 A;  2KHP A;  2JAD A;  3UMA A;  3DWV A;  2MMZ A;  2GGT A;  2GZP A;  2HZF A;  2P5R A;  3EIN A;  3WGD A;  1JZW A;  2P0G A;  2MZC A;  2I9H A;  2P5Q A;  1J08 A;  3FR3 A;  3F9U A;  5JCW A;  1HNB A;  5IMZ A;  1RW1 A;  4GST A;  4PTS A;  1EZK A;  1B4Q A;  4X4J A;  3VI7 A;  2N5B A;  2L5O A;  2B5Y A;  1TKD B;  4KDX A;  3DVW A;  3PR8 A;  2PER A;  1YQ1 A;  2VLU A;  5EVO A;  3IXR A;  5G1K A;  3TUE A;  2LV3 A;  1X5D A;  3D4T A;  3HVV A;  5IO0 A;  1T4Y A;  3E3E A;  1Q98 A;  3ME7 A;  2KOK A;  1A2M A;  5G5E A;  3KTL A;  4MZB A;  5LCZ A;  2OBI A;  3F3Q A;  4IQA A;  5IOW A;  5HR3 A;  6GSU A;  2C8U A;  2QSI A;  1EP7 A;  3D22 A;  4I2T A;  4TW5 A;  4E8H A;  2YCD A;  3KXO A;  1C72 A;  1VF4 A;  1GTA A;  1Z9H A;  2IL3 A;  1B8X A;  3GN3 A;  4XS6 A;  4Q5F A;  1PGT A;  4MJE A;  5E59 A;  2VCX A;  3IK9 A;  4EIQ A;  3ZML A;  3HCZ A;  5GSS A;  3NIV A;  3KP8 A;  1EEJ A;  3MDK A;  3H93 A;  3IE3 A;  2RM6 A;  2VD0 A;  5KEJ A;  1Y25 A;  2CZ3 A;  2DJ3 A;  1ST9 A;  1JLW A;  3IRA A;  1V58 A;  4MJA A;  3LGC A;  3MIX A;  3GA4 A;  5J41 A;  2L6D A;  3ZIT A;  2TRX A;  4CHS A;  4J57 E;  3FEU A;  3C1S A;  6GSS A;  2OE3 A;  1EGR A;  1F6M C;  4GCI A;  4PX1 A;  2PU9 C;  2V32 A;  3GYK A;  3E0U A;  1G7E A;  2E7P A;  4OFM A;  1DBY A;  5IO2 A;  5J5N A;  2D2Z A;  3TKQ A;  5JWQ B;  1Z3E A;  5EPF A;  2CT6 A;  2H66 A;  2ES7 A;  1QQ2 A;  1YJ6 A;  5DVB A;  1JFU A;  3I43 A;  2M72 A;  2FWH A;  2YJH A;  4O5R A;  2LEG A;  4RQR A;  1QK8 A;  3MNG A;  2DJ0 A;  2C0F A;  1CQG A;  4IVF A;  4ZIJ A;  4G0L A;  2GQL A;  3F8U A;  1PN9 A;  4KGI A;  3C73 A;  4A5P A;  2CAQ A;  5DCH A;  1ZCP A;  1AAZ A;  2PWJ A;  2N5A A;  3GIX A;  5ID2 B;  3HKR A;  2FNO A;  4G0K A;  1M2D A;  2VUP A;  2RLI A;  5KN3 A;  1AUC A;  3BBY A;  2JU5 A;  3P8W A;  3EYT A;  4KND A;  4TKY A;  1EGO A;  3ZRD A;  2DLX A;  3ZTL A;  3GSS A;  1FVJ A;  3CRU A;  5ECH B;  2R0G A;  4NXI A;  2LKU A;  2GS3 A;  1OC8 A;  1B4P A;  3CYN A;  5CRD A;  4WF5 A;  4BL7 B;  3QMX A;  1S3A A;  3TOT A;  1Y6E A;  3WT2 A;  2OKA A;  3CMI A;  3A5W A;  4QQ7 A;  1X5E A;  4KCA A;  3GUR A;  3ZRE A;  3UBL A;  5J9B A;  1GSD A;  1YF0 A;  1XWG A;  2IPA A;  4X0X A;  2QGV A;  1GLP A;  1G6Y A;  4NHZ A;  4KCE A;  4MH2 A;  1TRU A;  5HR1 A;  2LNT A;  1MDJ A;  4Q5Q A;  1T8E B;  4P3Y B;  3GUS A;  5A4W A;  3WD6 A;  4HUA A;  4MA9 A;  5ECL B;  4HEA 2;  3ERG A;  4ECI A;  2H8L A;  4IBP A;  1BG5 A;  1ZMA A;  2HRA A;  3IC8 A;  1K0A A;  4J2F A;  2R3X A;  3C7M A;  3LSZ A;  4PQI A;  1GTB A;  1TRW A;  1T1V A;  2IFQ B;  1W89 A;  4OWY A;  4ZBA A;  2RUE A;  3GH6 A;  2X8C A;  2I3Y A;  4KSO A;  5ECR B;  5DQY A;  2PN8 A;  1GRX A;  1EV4 A;  3UOM A;  2OAC A;  1K0B A;  6GSX A;  3DYR A;  2HRK A;  5EL8 A;  1K0O A;  1SL2 B;  4O5U A;  2X99 A;  1NW2 A;  3VPT A;  5ECK B;  1A0R P;  4AJ6 A;  1HNC A;  3H8Q A;  3KP9 A;  4EIP A;  1NSW A;  5G31 A;  3MWH A;  4XTS A;  1F37 A;  3UL3 A;  5IOX A;  2VOC A;  2CQ9 A;  5ECQ B;  3TRX A;  4OCF A;  2AAW A;  3KGK A;  4ECC A;  3PGT A;  4N0V A;  4MDC A;  3GST A;  2JL4 A;  4EO3 A;  2HNL A;  3TKP A;  1TK8 B;  3DVX A;  2C0E A;  4JRR A;  3LYP A;  1LJR A;  4JU5 A;  1DUG A;  1BX9 A;  1SD8 A;  2IWT A;  2OJL A;  3KZQ A;  3EUR A;  1SKW B;  2DIY A;  2PPT A;  1WP0 A;  1XVW A;  1V98 A;  5HR2 A;  3IOS A;  4JZQ A;  1V40 A;  2JAC A;  5DAK B;  4J56 E;  5ECO B;  1GLQ A;  4GTU A;  4RQX A;  3ERW A;  2V2G A;  3Q18 A;  5DAL A;  1XWC A;  4FO5 A;  2HE3 A;  4EDZ A;  2FHE A;  2VL3 A;  1T4Z A;  3AY8 A;  4I2U A;  2GVP A;  1QXH A;  3HVS A;  1BYE A;  3RDW A;  4JR6 A;  4G9H A;  4PQ1 A;  4AGS A;  2OAD A;  4HJ2 A;  2XBQ A;  3IBH A;  2GST A;  4V2M A;  3DKS A;  1EV9 A;  5HFI A;  4ML6 A;  4YKG A;  2QA1 A;  4TXV A;  2X8G A;  3W6G A;  1LBK A;  1U3A A;  2IN3 A;  4OMV A;  2BMX A;  2KUC A;  2R4V A;  4V2N A;  5G2Z A;  4JBB A;  3C8E A;  12GS A;  3U5R E;  2X49 A;  1EOH A;  1PX6 A;  3QPM A;  3DIE A;  1E6B A;  1GUH A;  1F3A A;  2VD1 A;  5BRT A;  3TJF A;  3LOR A;  1E2Y A;  4XS4 B;  2CX3 A;  1VGL A;  2B7K A;  3GL5 A;  5D9W A;  4DSS B;  4IP1 A;  13GS A;  1SJZ A;  2OBK A;  1HYU A;  3EMP A;  2UZ8 A;  1ZL9 A;  4NV5 A;  2EIO A;  1F2E A;  2C1Y A;  1GL8 A;  4MMM A;  4MJC A;  1K0C A;  5J9C A;  1OC9 B;  2HI7 A;  2YWN A;  4K5S A;  3D0Z A;  1SK0 A;  4PGT A;  3ZMK A;  2HXK A;  2WDU A;  4YAP A;  16GS A;  3IA1 A;  1ZYP A;  2O7K A;  2VO4 A;  3G7Y A;  4FYB A;  5D9T A;  3HD5 A;  1THX A;  1DE2 A;  7GSS A;  3CRT A;  3EE2 A;  2LJR A;  1XIY A;  2ON5 A;  4Z2T A;  5DCG A;  3FZ9 A;  4TR1 A;  1SJ6 A;  5GZZ B;  1XBS A;  2H0G A;  2L59 A;  3Q19 A;  1XW5 A;  1ZZY A;  5CRG A;  1XFL A;  2FWF A;  5COH A;  4PUA A;  3TKS A;  4DVC A;  5G30 A;  1HD2 A;  4KF9 A;  5LNK e;  1TXX A;  4USS A;  4WXT A;  3KCM A;  3EWL A;  4KE3 A;  4PNF A;  2C3N A;  2YOI A;  3F4S A;  3LJR A;  2HZE A;  2R2J A;  1ERW A;  2GSR A;  3A2V A;  4OFN A;  5CP1 A;  1MEK A;  4Q5N A;  1Z6M A;  6GSY A;  2BJX A;  3RPP A;  4ZBB A;  2O8V B;  2VLV A;  3WGE A;  2RM5 A;  4KUN A;  5J3R A;  1YKC A;  2R5G A;  1SU9 A;  4XIH A;  2HLS A;  4CDO A;  1XCC A;  2RII A;  3H1N A;  3FW2 A;  3UIW A;  1U3I A;  2VIM A;  3UVT A;  4OO4 A;  1XWA A;  1HNA A;  3D6I A;  2E0Q A;  3APS A;  5AIV A;  2H1A A;  4F9Z A;  4OCE A;  2GSQ A;  2AHE A;  1ZYQ B;  2GT6 A;  2DJJ A;  1G0T A;  14GS A;  5B8B A;  3DGQ A;  5FHI A;  5F8B A;  4K0N A;  1GTI A;  2LRT A;  3VLN A;  1UC7 A;  5FWG A;  2IMI A;  4K0G A;  2CAI A;  1F3B A;  1QGV A;  3KH7 A;  3HYP A;  3GRX A;  2F9S A;  1SD9 A;  1WE0 A;  1UA5 A;  3TJB A;  1X9W B;  2LRN A;  1NM3 A;  4Z7X A;  4KX4 A;  3M3M A;  4WBJ A;  4K9Z A;  2N5F A;  1EOG A;  1Z7R A;  1WWJ A;  5G1L A;  2L57 A;  2BTO T;  3ZLP A;  3HZ4 A;  2CVK A;  2CV4 A;  4KAE A;  1FOH A;  2GQK A;  4POM A;  4YH2 A;  2H1D A;  2E2M A;  3C1R A;  3I69 A;  3ISO A;  4HU7 A;  3ME8 A;  2LS5 A;  3JCM L;  5D8I A;  1AC1 A;  2QKE A;  4NHW A;  3KJY A;  4YQV A;  1J0F A;  1JZO A;  3LWA A;  3N9J A;  1A0F A;  5F07 A;  3TJK A;  1KEB A;  3FKF A;  4K8M A;  2FLS A;  1A8L A;  2X64 A;  3O76 A;  4MP4 A;  5IIZ A;  2MYG A;  5IQY A;  4LL1 B;  5D73 A;  3R3E A;  2HYX A;  3IDV A;  2VCQ A;  3CXG A;  2J9H A;  1U6T A;  2HFD A;  2LUS A;  2O89 A;  1GNW A;  2H6Y A;  17GS A;  1XWK A;  3GKM A;  1OE8 A;  3TJJ A;  10GS A;  2B1K A;  1U88 A;  1GSU A;  2VCT A;  5EY6 A;  5CO3 A;  4N30 A;  4HQS A;  3LXT A;  1XW6 A;  2VCV A;  3SBC A;  3I6A A;  5ID2 A;  1WJK A;  5KN0 A;  3PIN A;  1A23 A;  4EC0 A;  2V41 A;  4AJ7 A;  1T3B A;  3EU3 A;  1K3O A;  2DML A;  5ECN B;  3HJM A;  3HA9 A;  1X5C A;  2K18 A;  3S9F A;  1GSE A;  2YNX A;  2V6K A;  3TOU A;  2MMO A;  4EDY A;  4DEJ A;  4BWQ A;  1O8X A;  1W4V A;  4QL7 A;  5IMF A;  4HJM A;  1PA3 A;  3L9V A;  1BJX A;  1GP1 A;  3FZ4 A;  3VFI A;  3IR4 A;  4Q5R A;  3EMX A;  4K7I A;  3HZ8 A;  1GSF A;  5FT3 A;  1M2B A;  3TDG A;  5INY A;  3HY2 A;  1GH2 A;  2IMF A;  4EXJ A;  2VLT A;  1ILO A;  3G9B A;  1R5P A;  2VL9 A;  2VL2 C;  4F0C A;  2FGX A;  1O7U A;  3LEF A;  2DC5 A;  3RHC A;  3UAP A;  1G6W A;  3QD9 A;  2FWE A;  4WKW A;  1FVK A;  1GNE A;  1OAZ A;  2EIR A;  2GQM A;  1TRS A;  2REM A;  5CYY A;  4RUV A;  3ZL5 A;  2F51 A;  3ZFB A;  3L4N A;  2WZ9 A;  2L4Q A;  5F0G A;  5G5F A;  1FG4 A;  3CTF A;  2NDO A;  4BVX A;  3I9V 2;  1XWB A;  4O7H A;  2YP6 A;  1GUM A;  2HRF A;  3GHA A;  1J9B A;  4GRF A;  3VWU A;  3KMN A;  1M99 A;  1YEP A;  4KW6 A;  2H74 A;  3M8N A;  1TRV A;  4MPG A;  1QUW A;  3HJO A;  4EKZ A;  1OKT A;  1XW9 A;  3WT1 A;  1LU4 A;  2OE0 A;  1A24 A;  1JHB A;  4ZIL A;  5GST A;  4L0W A;  9GSS A;  5ECP B;  2IMD A;  5DJM A;  3J7Y k;  2C80 A;  1O73 A;  2JZS A;  4I97 A;  4G19 A;  1SYX A;  2WJU A;  1M0U A;  5A5K A;  1O8W A;  4NV2 A;  1GUL A;  2AB6 A;  3EC3 A;  3GMF A;  1VF3 A;  2ZCT A;  1PRX A;  4IGJ A;  3A5I A;  1MDK A;  3TRQ A;  1KTE A;  4FYU A;  4V1A p;  22GS A;  4TXO A;  5JCU A;  4RI6 A;  1M7T A;  1PQN A;  1NHO A;  4BVY A;  4GQC A;  1PKW A;  3ZIV A;  1XOA A;  5ECI B;  4PUF C;  3IHG A;  4V1A g;  3DEX A;  1YDK A;  4POL A;  3D5J A;  2R0C A;  2H71 A;  1Z7P A;  1WOU A;  3IK7 A;  2NVL A;  5ELG A;  2H70 A;  2X4A A;  4IHU A;  5A4V A;  3FZA A;  3KIJ A;  3LFL A;  4KA0 A;  8GSS A;  4ZL9 A;  1KBN A;  2E2G A;  1MD3 A;  1ZYE A;  5F06 A;  3RPN A;  1ZOF A;  3A2W A;  3EVI A;  3J7Y b;  1GUK A;  5A4U A;  4EF0 A;  2YZU A;  2LST A;  5AIS A;  1PN0 A;  1TI3 A;  2C3T A;  1SK1 A;  2RUF A;  2XBI A;  4TR0 A;  2HT9 A;  3H79 A;  5DDL A;  3LQ7 A;  1FAA A;  3FZ5 A;  4X1U A;  2CZ2 A;  2M46 A;  4JE1 A;  2FA4 A;  2L4C A;  4GSN A;  1ZGN A;  2AJQ B;  1TW9 A;  1FHE A;  3LW9 A;  1GSQ A;  1WPI A;  18GS A;  5JCG A;  3LYK A;  5HQP A;  4G10 A;  2GT5 A;  3ZVJ A;  5DAL B;  2WGR A;  1S3C A;  3WYW A;  20GS A;  2HRN A;  3TJG A;  1SKR B;  5H5R A;  3FY7 A;  2YPM A;  1U87 A;  2KP1 A;  1H4O A;  1K3L A;  4O32 A;  1BQ7 A;  4IS0 A;  5KN1 A;  2F8F A;  3WGX A;  1EEM A;  4ULX A;  4KDY A;  3P2A A;  2F8A A;  2I4A A;  3GL3 A;  2FUG 2;  3PH9 A;  1DE1 A;  3QCP A;  2FY6 A;  1OKD A;  3FYG A;  2LQO A;  3GV1 A;  1B9X C;  3MYD A;  3UBK A;  3M1G A;  4LMW A;  4MPF A;  4L0U A;  1SKS B;  2VCZ A;  1Q4J A;  3DRN A;  2H30 A;  4XS4 A;  2H0I A;  5IMC A;  2GTU A;  1PMT A;  5B6N A;  1TOF A;  1RQM A;  3QFA C;  4JR4 A;  3FHK A;  3L9U A;  1SJI A;  2H75 A;  2H72 A;  1EP8 A;  4LLR A;  1V2A A;  4IP6 A;  2WRT A;  4NWY A;  2MMN A;  4L5O A;  2PUK C;  1B9Y C;  3IV4 A;  2CA8 A;  2LJA A;  3HVX A;  4ML1 A;  6GSW A;  1XOB A;  4K7N A;  1V57 A;  2C3Q A;  4MZC A;  1H75 A;  2B3S A;  3UAR A;  4TVE A;  3W8J A;  3C71 A;  1NHY A;  3E9J B;  1M9B A;  3LXZ A;  1ON4 A;  4CY8 A;  3SWL A;  2FD3 A;  2JZR A;  2TIR A;  3VK9 A;  5IM9 A;  3GH9 A;  4QL9 A;  4FIW A;  3GFK A;  3QOU A;  1WRY A;  2YV7 A;  5E4W A;  1ACV A;  3NOF A;  4ZB9 A;  1QMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...