4ZILA

Crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
213
structure length
210
Chain Sequence
KSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVVGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFDKLAAALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DSBA oxidoreductase
publication title The Redox State Regulates the Conformation of Rv2466c to Activate the Antitubercular Prodrug TP053.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (h37rv)
total genus 72
structure length 210
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zilA00
1Q98A 1VF4A 1ILOA 4V2NA 2VOCA 4HQZA 4ACSA 2IFQB 3UVHA 3WGXA 3WT1A 3Q19A 1X9WB 2RUEA 3G7YA 1TU8A 4TR3A 1OC8A 2K18A 4OFMA 4EO3A 2L59A 2YZUA 1TW9A 2NBSA 2C4JA 2VM1A 2HFDA 4TRXA 1SL2B 2GLRA 1TU7A 3FW2A 3TJFA 4FYBA 1A24A 4ZL9A 3VLNA 3FHKA 4POKA 2H30A 2KHPA 2RUFA 2C8UA 4HJMA 1XWAA 5G2ZA 3BJ5A 1I9DA 3IR4A 4OFNA 2FA4A 1XOAA 2YN1A 3PR8A 4MABA 3F3RA 1LU4A 3I43A 2PUKC 5D9VA 4ECCA 2M72A 20GSA 3HKRA 2H70A 4FYUA 10GSA 3CSJA 3IA1A 2MZCA 1XWCA 2V2GA 3ZIVA 5DAKB 1TJDA 2DMMA 5DALA 4XIHA 3UMAA 2CZ3A 4X1UA 3LORA 1S3CA 1GSQA 1O7UA 1AQVA 1BQ7A 2IMKA 2WDUA 3F4SA 1PKZA 5C00A 3E3EA 4GSNA 3APOA 14GSA 2NTOA 1AQXA 1PMTA 1GULA 3BOAA 5C04A 1SU9A 1M2DA 1SENA 9GSSA 1FVKA 1OAZA 4K7NA 2I1UA 3QAGA 1AQWA 3BCKA 3QOUA 4I97A 3GX8A 1J9BA 4OO4A 4PQ1A 3GMFA 2I9HA 2JADA 1GSDA 1U6TA 2IMFA 4I8BA 4MZCA 2YWNA 3D6IA 1ZZYA 4V1Ap 1AAZA 1SJIA 3TGZA 4KX4A 2R37A 3TOTA 2JZSA 2DJ0A 2TIRA 5D9WA 3GKXA 2OE1A 5G1LA 2CX4A 4OO5A 5D9XA 4ZBAA 1ZOFA 2CA8A 3KZQA 2N5BA 1B4PA 3HCZA 1IYIA 3G7JA 3IAM2 2JZRA 4GRFA 1V58A 2GTUA 3EMXA 4LL1B 5HR1A 4HUAA 5CYYA 1CQGA 2YWOA 4PURA 3UOMA 2WZ9A 2R2JA 1PL2A 2B7KA 2CX3A 1TK8B 1UN2A 1FAAA 1GRXA 1MDIA 5E59A 2WB9A 2R5GA 5H5SA 4XRAA 2ON7A 1UC7A 2V41A 3GHAA 3GH9A 1AC1A 1QQ2A 5JCWA 1G6YA 1SYXA 4GF0A 1NSWA 3J7Yb 4V1Ag 3DEXA 1A0FA 3MNGA 1O6JA 3UIWA 2YV7A 2QSIA 4AGSA 2V6KA 1Y6EA 3TJGA 1TRVA 5GAND 3FZAA 1TOFA 3CTGA 1GSUA 4ZB8A 1XWGA 4WF5A 1SKRB 1WJKA 4MPGA 2YOIA 2JSYA 1AW9A 2HRNA 5ELAA 4ILFA 3FYGA 1VGLA 4MF6A 3C8EA 2A2RA 5LD0A 2WS2A 4MK3A 4PGTA 5B7CA 5ID2B 3GSTA 4K0NA 3TRQA 1FB6A 1Z7RA 4GSSA 1G0TA 1XVQA 2WJUA 1WPIA 5J5NA 4GSTA 1ABAA 1NHYA 16GSA 3M0FA 4WETA 1K0OA 3CRTA 3EC3A 1X9MB 3DIEA 2LUSA 4O92A 2H01A 1YEPA 2H76A 1VF1A 2AV4A 4Q5FA 4F9ZA 5IPHA 3I6AA 3UARA 3M1GA 1H4OA 2LRTA 4OCEA 2VCXA 4TVEA 1WP0A 2GQLA 4KDUA 3J7Yk 3HHVA 5A4VA 1G7OA 5G31A 1WIKA 4OFTA 2AYTA 4POBA 5A5KA 2LKUA 4HEA2 4WKWA 5J41A 2HYXA 2GZPA 4FYCA 2LJKA 1A8YA 1R4WA 1ON4A 2XC2A 4MDCA 1KEBA 2FLSA 3WYWA 1QMVA 1SKWB 2B3SA 1JZOA 3LWAA 3KXOA 3IBHA 5ELGA 1TXXA 1U88A 1EOGA 2VL2A 4IVFA 1RK4A 3ZREA 2E2MA 1FB0A 3CMIA 4MH3A 1RQMA 5JWOB 3KIJA 4L8EA 1QUWA 4MZBA 4HQSA 1M9BA 1EP8A 1A0RP 3VWXA 2H1BA 1KTEA 4MJCA 2FGXA 1K3OA 2PN8A 5DDLA 4ZBDA 1V57A 1OC9B 3VK9A 4YAVA 4AJ7A 4XS4A 1HNBA 5ECPB 4I6XA 3WD6A 5KN0A 4DSRA 4MJEA 1OKDA 3KCMA 3QR6A 3GH6A 3GV1A 2VCQA 1WWJA 2XPDA 1K0MA 4IJIA 2VCTA 2OE0A 3RPPA 3F63A 1C72A 2EIRA 1A23A 2VD0A 4WEYA 3GX0A 4E8HA 3RHBA 5D9TA 3TDGA 3D5JA 3LFLA 1NW2A 4BA7A 3H79A 1PD21 3VWVA 3M9KA 1BG5A 2FCHA 3HD5A 1THXA 3APSA 2X8CA 1DBYA 2DJ2A 3KP8A 4PQIA 4MPFA 4PQHA 2FA8A 5B6MA 5D8IA 4RQXA 5EPFA 2FHEA 5HFIA 2PPTA 1K0DA 3ME7A 1SD8A 1SJZA 3FZ4A 1N2AA 3CBUA 4TXOB 1MD4A 2H19A 3Q74A 1EEJA 2DJKA 3D4MA 4HI7A 2H1DA 2VLVA 2CVDA 3QD9A 2G0FA 2RM5A 2YJ7A 2VCWA 2C1YA 3GKKA 3HVXA 3TUEA 3HDCA 2FUG2 4WR5A 2L4CA 3LGCA 4ZIJA 3GYKA 1V40A 1GNWA 1F9MA 3ERFA 2KLXA 1O73A 1XW9A 4KH7A 2YZHA 1F2EA 2TRCP 1PX6A 3F3QA 3LG6A 5D73A 1ST9A 3FRCA 4GQFA 2GQKA 3M8NA 2DMLA 2O89A 1A2LA 3TKQA 3P90A 3GTUB 3A2XA 4NV2A 2XPEA 2YWMA 3F0IA 3GRXA 3U6VA 2I3YA 3IHQA 4IS0A 4MJAA 1ZMAA 2BMXA 5CRDA 1T8EB 3ZRDA 3D0ZA 3KH9A 1K0NA 2NVLA 4L0WA 1GTUA 1A2MA 6GSXA 3C1RA 1TRWA 2O8VB 5ECLB 5HFGA 1GSFA 3I69A 1V2AA 4LMVA 4TOPA 3APQA 4WR4A 1R5AA 2ZCTA 1PX7A 3GUSA 1W89A 5L71A 1GLPA 5GSTA 1SK2A 2MBSA 2O85A 3EMPA 1GP1A 4POMA 2CZ2A 5GZZB 2IMEA 2PGTA 4N10A 2LEGA 2HZEA 3DKSA 2H6YA 1YF0A 3F6FA 2WCIA 1YKAA 4YH2A 4EVMA 4EL1A 1Z6MA 5DVBA 2V6OA 1BX9A 1K3YA 4JU5A 4RQRA 1I5GA 1X5DA 5ECOB 1HYUA 1B8XA 3DRNA 3BD2A 4K8MA 2LRCA 5G1KA 4QQ7A 4G19A 3TKSE 1GSSA 5JWQB 3L0HA 3FKFA 1EEMA 4IBPA 4ZILA 2HNLA 3QFAC 5GAPD 2LV3A 2IWTA 4MA9A 2F9SA 2K6VA 1U3AA 1EGRA 5IQYA 1XXUA 3D21A 3BCIA 2VCZA 3KJYA 2ES7A 1QGVA 4LMWA 2KP2A 2JACA 22GSA 2HRFA 2DBCA 2K9FA 2HE3A 1PSQA 1XPVA 5KN1A 1EZKA 3VFIA 2AAWA 5B8AA 1ML6A 3FZ9A 3HJMA 4JBBA 4IP6A 2GGTA 2OJLA 3C73A 3KEBA 2OA7A 1JZRA 2LJAA 2DJJA 3LQ7A 1VF2A 4HU9A 1TRSA 4LLRA 4OMVA 3P8WA 2YJHA 1USBA 2LJRA 4KB3A 4PUFC 2YCDA 4Z7XA 2N5FA 2B6MA 5EL8A 4ID0A 3UAPA 4G10A 5H5QA 2FD3A 1OE7A 2PWJA 3TRPA 5DCGA 5IMZA 5DJMA 1K3LA 3LYPA 3C1SA 2XHFA 3FY7A 4PNGA 3TOUA 2OBIA 1AUCA 2JZTA 3C7MA 2OBKA 2H73A 2C0DA 2GSQA 4NXIA 6GSSA 2AJQB 2B1LA 5D96A 4N0ZA 1TRUA 3LXZA 3PH9A 4FH8A 3FR9A 3US3A 5ENUA 1F6MC 2HSHA 2C0FA 5A4WA 2IMIA 4OWYA 1EOHA 4FO5A 1OE8A 4IJ3A 1M2AA 2MYGA 4I2TA 1QXHA 2X8HA 11GSA 1G7EA 3D22A 3LYKA 3EU3A 2GZYA 2KP1A 3IDVA 3Q6OA 4X43A 5F07A 4MLYA 1XWBA 2CAIA 5COHA 2H0IA 4JZQA 4MH2A 2OE3A 1XIYA 2G2QA 1QK8A 1XWKA 4V2MA 2R6KA 1GSYA 3QFBC 5DALB 3ZITA 1EWXA 1M2BA 2DJ1A 2GDRA 2J9HA 5AIVA 3VWWA 1PL1A 3KH7A 3M3MA 3FZ5A 3IXRA 1YF1A 4YQVA 3HYPA 1B4QA 4KNDA 1KBNA 4KCAA 4RUVA 4MJBA 3NIVA 3K8NA 1JFUA 2LQOA 4MP4A 4F2IA 1DE1A 2RIIA 3ZIJA 2C80A 2TRXA 2P5RA 1WE0A 2IJYA 2L6DA 5F8BA 4MMMA 5AGYA 5LNKe 6GSUA 2XBIA 1GNEA 2LRNA 1FO5A 2B1KA 6GSWA 1YEXA 5AN1A 1BJXA 2IPAA 3GURA 3HY2A 3H1NA 2OADA 4HZ4A 3F4TA 1OVNA 3HVVA 4TW5A 1WOUA 2KOKA 2QKEA 5AIXA 5FWGA 2ON5A 2HLSA 3LEFA 1S3DA 1E2YA 1X5EA 2VL2C 3ZMLA 2CQ9A 4D73A 2JU5A 2CT6A 1GSEA 3VI7A 1RW1A 2B7JA 3F8UA 3W6GA 4EE0A 3SBCA 3EVIA 5CRGA 2FNOA 2M46A 2NPBA 4DSSA 5IMVA 4J57E 4IGJA 2AB6A 3GA4A 1X5CA 4G9HA 4ZB6A 2MMOA 2PVQA 1DE2A 2GSSA 2XBQA 2VLTA 1K0BA 3NZNA 1SD9A 3IE3A 1F3BA 3TRXA 5JCUA 2AHEA 4EUYA 3ZYWA 4ZL7A 2L57A 2I81A 4K7OA 2VO4A 1SK1A 1TDIA 3ME8A 1DUGA 2E2GA 1LBKA 4XS1A 1TTZA 4CHSA 4I5QA 3ZLPA 4KCEA 4KA0A 3KD0A 2YNXA 1Z9HA 4WF4A 2IFQA 1NM3A 12GSA 4BWQA 4DSQA 1HQOA 5ECKB 4CW9A 7GSSA 3E9JB 2B5XA 1WMJA 4X0XA 4WBRD 4EC0A 3TJJA 2Z9SA 3ISOA 1ERTA 3DXBA 1TI1A 4ECJA 2R4VA 3EINA 4LL4B 6GSYA 3L9UA 1Z7PA 2GVPA 4EXJA 3G7IA 4ECBA 2QGVA 3TKPA 1B9YC 2DJ3A 4NHWA 5CAXA 2KUCA 3P2AA 1XZOA 3EE2A 4NAXA 2X99A 4TR1A 4XTSA 4F03A 4N30A 3FR6A 4KDYA 3TKSA 4GWRA 5CREA 1ERUA 3RAZA 4N11A 1OKTA 1XBSA 3RHCA 3UEMA 2MMNA 1T4YA 1Z6NA 2H0HA 2F51A 5DAKA 4NHZA 1X0RA 5KN3A 2ALBA 1SYRA 4TR0A 1OYJA 4JR6A 3W8SA 4J2FA 2YP6A 1A8LA 3RDWA 3TB2A 2IL3A 1O8XA 5EVOA 4JEDA 17GSA 3GKNA 3MDKA 4IQAA 4ULXA 4OCFA 5J4UA 4JE1A 2VM2A 3HA9A 5IIZA 2I4AA 1K0CA 1T00A 5FHIA 3N5OA 3GFKA 2H0GA 2RLIA 1GTBA 4F82A 5HQPA 1GWCA 1S3AA 3PINA 1MDJA 2P5QA 2K8VA 1FVJA 2OACA 2E7PA 1PA3A 3UL3A 4IKHA 1A2JA 3KGKA 3EU4A 1UA5A 5J3RA 1R26A 3CSIA 1O81A 4NPBA 1HNCA 4BWSA 2GQMA 3A2VA 4P3YB 5JWRB 2H8LA 5IMFA 3UVTA 4XHMA 4ZB9A 3FR3A 1GUKA 2WRTA 5D93A 3D4TA 1SL1B 2VIMA 3MAKA 1E6BA 1CQHA 5HR2A 8GSSA 2JSZA 1PQNA 4KAEA 4HU7A 1M9AA 1WRYA 4XS4B 1F3AA 3TCOA 2YWIA 4K9ZA 4ZXGA 1GUMA 1EV4A 3CRUA 1JZWA 4AF2A 3IPZA 3GN3A 4YQMA 1TP9A 3ZTLA 5B8BA 2JL4A 2EIOA 5IO2A 3A3TA 5CP1A 2LTKA 4XRDA 3ERWA 2HZFA 1N8JA 4AJ8A 2HSYA 3HZ8A 4IN0A 3W8JA 4K7IA 5DCHA 2X8GA 3CXGA 3S9FA 3DVXA 4J56E 4TR1B 1YJ6A 4CDOA 2ZUPA 4KSOA 1X9SB 2H1GA 1XFLA 5IMAA 4AJ6A 3KMOA 3WGDA 5G5EA 3DYRA 2HI7A 1XOBA 5CRWA 2CVKA 3HXSA 4KDXA 2QC7A 2A2SA 4IELA 4GXZA 2IIYA 5DJLA 3JCML 1H75A 5ECNB 3AY8A 3DD3A 4PUAA 2YV9A 4KUNA 3F9UA 4PX1A 1JLVA 1XW6A 3M9JA 1EGOA 5ID2A 2VL9A 4L0UA 4ML1A 2B5EA 3DMLA 1YKCA 4Q5RA 5AISA 4IQ1A 1B9XC 1TKDB 2H75A 4F0BA 2C3NA 1PGTA 2LS5A 5INYA 1U3IA 3KP9A 5IOXA 2NDOA 1YDKA 4BL7A 2FWHA 3P7XA 4O5RA 1M99A 2H1AA 13GSA 1ZYQB 18GSA 4KSMA 2L5OA 2F8FA 3L4NA 4K1FA 2GT5A 2VAFA 4L5LA 4YAPA 1Z3EA 1GH2A 3UBLA 1J0FA 1Q4JA 2L6CA 3QDNA 4JR4A 3V1WA 1THOA 4EDYA 4MF7A 3NOFA 4Q5QA 2GS3A 2PBJA 3EURA 2V1MA 4I2UA 2DSAA 1W4VA 2L5LA 2C3QA 2F3MA 1V98A 5GSSA 3QMXA 2CAQA 4POLA 3HJPA 5CO3A 4ZBBA 2VLUA 4O32A 4K6XA 2D2ZA 1HNAA 2EC4A 3GSSA 4HJ2A 4MCUA 4TXVA 2L4QA 1B48A 4GCIA 2P31A 4ZL8A 3L9VA 4MF5A 2O7KA 1O85A 2AUVA 5IMDA 1ZL9A 4LA1A 3ZVJD 1G6WA 4NMUA 4RI6A 2O87A 1R7HA 2MMAA 2FWEA 5A4UA 3DVWA 3R2QA 4NV5A 1FOVA 2HZEB 2LNTA 3EYTA 3SWLA 1OC9A 5ECHB 6GSVA 2VD1A 5G30A 1K0AA 1V9WA 4H86A 3H93A 3WT2A 2H71A 3DWVA 3HVSA 1FW1A 3LXTA 2VL3A 1JHBA 3MWHA 3IK9A 2DIYA 5IM9A 1TK5B 2VUPA 4WXTA 6GSTA 1VRSD 2LNSA 4F0CA 2GT6A 3F4RA 1U87A 5J9CA 3KTLA 1FG4A 3A2WA 1J08A 3IK7A 3GKMA 4K0GA 2CVBA 4ECIA 2PU9C 1YQ1A 1T7PB 4HOJA 3ZFBA 2YPMA 3KTBA 3VPQA 4IHUA 1XCCA 4O7HA 1BYEA 2DIZA 4GLTA 2HXKA 1UVZA 5F06A 2WGRA 1HD2A 3VURA 2E0QA 1TK0B 3IC4A 4K2DA 1JLWA 3QAWA 1AXDA 2FY6A 4TKYA 4IW9A 2ZNMA 2P0GA 4Q5NA 1ZCPA 1GL8A 3IV4A 4XCSA 3I9V2 3CTFA 4NWYA 4TXOA 3GL5A 3L78A 3TJBA 2YANA 2A4VA 2B5YA 5ECMB 1KNGA 5IPGA 1MEKA 5IO0A 3O6TA 4BVYA 5G5FA 1PRXA 3UJ1A 3CYNA 2X64A 3IRAA 2WULA 4EKZA 4E8EA 5B6NA 2J23A 5J9BA 2DLXA 2M80A 5KN2A 3ZMKA 2F8AA 1T4ZA 2C3TA 4RI7A 5ECIB 2EIQA 1O8WA 1MD3A 2C0EA 5F0GA 5LCZA 4HS1A 1SJ6A 3L9SA 1R5PA 4G2EA 2H72A 3GTUA 2CV4A 3ERGA 4V2LA 5ECQB 4DVCA 3KMNA 1YY7A 1EP7A 1ZGNA 2PERA 3ED3A 3TKSC 3KM6A 3RPNA 5KEJA 3O76A 3C71A 1PKWA 5H5RA 5JCGA 2BTOT 5E4WA 5HR3A 4GQCA 2DC5A 3ZZXA 2N5AA 1ACVA 5HFKA 4EF0A 1BEDA 2V32A 1MDKA 3ZL5A 2WFCA 1GTAA 2RM6A 5CRHA 5ECRB 5F05A 4JRRA 2IMDA 3BBYA 1ZYEA 2VCVA 3H4KA 3LSZA 4HZ2A 5DQYA 2MMZA 3ZVJA 1XVWA 2C0GA 3G9BA 4YQUA 3E0UA 1GTIA 1PN9A 5HR0A 4N0VA 1LJRA 1NHOA 3OR5A 2IN3A 3O3TA 2H74A 2R3XA 5EY6A 2BJXA 1BAYA 1QFNA 3N9JA 4PNFA 2GSTA 3A5WA 4WBJA 1ERWA 3PGTA 1JZDA 1M0UA 1URMA 1OC3A 1Z5YE 3TJKA 3EWLA 4ML6A 1SK0A 2OKAA 1DSBA 5FT3A 1T1VA 4KE3A 3HZ4A 19GSA 3IAS2 3UBKA 1AIUA 4XS6A 1VF3A 2LQQA 2GSRA 4MZWA 1ERVA 4TN8A 1FHEA 1M7TA 1XW5A 1Y25A 2PMTA 1TI3A 3F6DA 4QL9A 1MTCA 2K8SA 1SL0B 3GL3A 3VPTA 4EDZA 4IP1A 5IMCA 3CSHA 3MSZA 4TR4A 4HDEA 4D73B 3QAVA 2MBTA 4GTUA 3HJOA 5IOWA 4BVXA 1F37A 2PVOC 1GUHA 3U5RE 4DSSB 3GIXA 3H8QA 4L5OA 5DQSA 2H66A 1YZXA 2FWGA 4KW6A 3WGEA 2H6ZA 5ECSA 3VWUA 3GNJA 3LJRA 2LSTA 4FIWA 4QL7A 1IYHA 3FEUA 3QCPA 3VI5A 3RBTA 3TKRA 1GLQA 2REMA 3ZFLA 2HT9A 3IOSA 1SKSB 5ABRA 5CNWA 4DEJA 3DGQA 2FWFA 3FK8A 3Q18A 4KGIA 2GZZA 4BPYA 5DBQA 2H6XA 4OD7A 3QPMA 1T3BA 4ISDA 4PXOA 1EV9A
chains in the Genus database with same CATH superfamily
1Q98A 1VF4A 1ILOA 4V2NA 2VOCA 4HQZA 4ACSA 2IFQB 3UVHA 3WGXA 3WT1A 3Q19A 1X9WB 2RUEA 3G7YA 1TU8A 4TR3A 1OC8A 2K18A 4OFMA 4EO3A 2L59A 2YZUA 1TW9A 2NBSA 2C4JA 2VM1A 2HFDA 4TRXA 1SL2B 2GLRA 1TU7A 3FW2A 3TJFA 4FYBA 1A24A 4ZL9A 3VLNA 3FHKA 4POKA 2H30A 2KHPA 2RUFA 2C8UA 4HJMA 1XWAA 5G2ZA 3BJ5A 1I9DA 3IR4A 4OFNA 2FA4A 1XOAA 2YN1A 3PR8A 4MABA 3F3RA 1LU4A 3I43A 2PUKC 5D9VA 4ECCA 2M72A 20GSA 3HKRA 1S3RA 2H70A 4FYUA 10GSA 3CSJA 3IA1A 2MZCA 1XWCA 2V2GA 3ZIVA 4PTSA 5DAKB 1TJDA 2DMMA 5DALA 4XIHA 3UMAA 2CZ3A 4X1UA 3LORA 1S3CA 1GSQA 1O7UA 1AQVA 1BQ7A 2IMKA 2WDUA 3F4SA 1PKZA 5C00A 3E3EA 4GSNA 3APOA 14GSA 2NTOA 1AQXA 1PMTA 1GULA 3BOAA 5C04A 1SU9A 1M2DA 1SENA 9GSSA 1FVKA 1OAZA 4K7NA 2I1UA 3QAGA 1AQWA 3BCKA 3QOUA 4I97A 3GX8A 1J9BA 4OO4A 4PQ1A 3EPTA 3GMFA 2I9HA 2JADA 1GSDA 2QA1A 1U6TA 2IMFA 4I8BA 4MZCA 2YWNA 3D6IA 1ZZYA 4V1Ap 1AAZA 1SJIA 3TGZA 4KX4A 2R37A 3TOTA 2JZSA 2DJ0A 2TIRA 3LW9A 5D9WA 3GKXA 2OE1A 5G1LA 2CX4A 4OO5A 5D9XA 4ZBAA 1ZOFA 2CA8A 3KZQA 2N5BA 1B4PA 3CQFA 3HCZA 1IYIA 3G7JA 2DKHA 3IAM2 2JZRA 4GRFA 1V58A 2GTUA 3EMXA 4LL1B 5HR1A 4HUAA 5CYYA 1CQGA 2YWOA 4PURA 3UOMA 2WZ9A 2R2JA 1PL2A 2B7KA 2CX3A 1TK8B 1UN2A 1FAAA 1GRXA 1MDIA 5E59A 2WB9A 2R5GA 5H5SA 4XRAA 2ON7A 1UC7A 2V41A 3GHAA 3GH9A 1AC1A 1QQ2A 5JCWA 1G6YA 1SYXA 4GF0A 1NSWA 3J7Yb 4V1Ag 3DEXA 1A0FA 3MNGA 1O6JA 3UIWA 2YV7A 2QSIA 4AGSA 5BRTA 2V6KA 1Y6EA 3TJGA 4HSCX 4EIPA 1TRVA 5GAND 3FZAA 1TOFA 3CTGA 1GSUA 4ZB8A 1XWGA 4WF5A 1SKRB 1WJKA 4MPGA 2YOIA 2JSYA 1AW9A 2HRNA 4ILFA 5ELAA 3FYGA 1VGLA 4MF6A 3C8EA 2A2RA 5LD0A 2WS2A 4MK3A 3PPUA 4PGTA 5B7CA 5ID2B 3GSTA 4K0NA 3TRQA 1FB6A 1Z7RA 4GSSA 1G0TA 1XVQA 2WJUA 1WPIA 5J5NA 4GSTA 1ABAA 1NHYA 16GSA 3M0FA 4WETA 1K0OA 3CRTA 3EC3A 1X9MB 3DIEA 2LUSA 4O92A 2H01A 1YEPA 2H76A 1VF1A 2AV4A 4Q5FA 4F9ZA 5IPHA 3I6AA 3UARA 3M1GA 1H4OA 2LRTA 4OCEA 2VCXA 4TVEA 1WP0A 2GQLA 4KDUA 3J7Yk 3HHVA 5A4VA 1G7OA 5G31A 1WIKA 4OFTA 2AYTA 4POBA 5A5KA 2LKUA 4HEA2 4WKWA 5J41A 2HYXA 2GZPA 4FYCA 2LJKA 1A8YA 1R4WA 1ON4A 2XC2A 4MDCA 1KEBA 2FLSA 3WYWA 1QMVA 1SKWB 2B3SA 1JZOA 3LWAA 3KXOA 3IBHA 5ELGA 1TXXA 1U88A 1EOGA 2VL2A 4IVFA 1RK4A 3ZREA 2E2MA 1FB0A 3CMIA 4MH3A 1M3JA 1RQMA 5JWOB 3KIJA 4L8EA 1QUWA 4MZBA 4HQSA 1M9BA 1EP8A 1A0RP 3VWXA 2H1BA 1KTEA 4MJCA 2FGXA 1K3OA 2PN8A 5DDLA 4ZBDA 1V57A 1OC9B 3VK9A 4YAVA 4AJ7A 4XS4A 1HNBA 5ECPB 4I6XA 3WD6A 5KN0A 4DSRA 4MJEA 1OKDA 3KCMA 3QR6A 3GH6A 3GV1A 2VCQA 1WWJA 2XPDA 1K0MA 4IJIA 2VCTA 2OE0A 3RPPA 3F63A 1C72A 2EIRA 1A23A 2VD0A 4WEYA 3GX0A 4E8HA 3RHBA 5D9TA 3TDGA 3D5JA 3LFLA 1NW2A 4BA7A 3H79A 1PD21 3VWVA 3M9KA 1BG5A 2FCHA 3HD5A 1THXA 3APSA 2X8CA 1DBYA 2DJ2A 3KP8A 4PQIA 4MPFA 4PQHA 2FA8A 5B6MA 5D8IA 4CY8A 4RQXA 5EPFA 2FHEA 5HFIA 2PPTA 1K0DA 3ME7A 1SD8A 1SJZA 3FZ4A 1N2AA 3CBUA 5KOXA 3IHGA 4TXOB 1MD4A 2H19A 3Q74A 1EEJA 2DJKA 3D4MA 4HI7A 2H1DA 2VLVA 2CVDA 3QD9A 2G0FA 4BVYB 2RM5A 2YJ7A 2VCWA 2C1YA 3GKKA 3HVXA 3TUEA 3HDCA 2FUG2 4WR5A 2L4CA 3LGCA 4ZIJA 3GYKA 1V40A 1GNWA 1F9MA 3ERFA 2KLXA 1O73A 1XW9A 4O5QA 4KH7A 2YZHA 1F2EA 2TRCP 1PX6A 2A4HA 3F3QA 3LG6A 5D73A 1ST9A 3FRCA 4GQFA 2GQKA 4FQUA 3M8NA 2DMLA 2O89A 1A2LA 3TKQA 3P90A 3GTUB 3A2XA 4NV2A 2XPEA 2YWMA 3F0IA 3GRXA 3U6VA 2I3YA 3IHQA 4IS0A 4MJAA 1ZMAA 2BMXA 5CRDA 1T8EB 2HRKA 3ZRDA 3D0ZA 3KH9A 1K0NA 2NVLA 4L0WA 1GTUA 1A2MA 6GSXA 3C1RA 1TRWA 2O8VB 5ECLB 5HFGA 1GSFA 3I69A 1V2AA 4LMVA 4TOPA 3APQA 4WR4A 4EIQA 1R5AA 2ZCTA 1PX7A 3GUSA 1W89A 5L71A 1GLPA 5GSTA 1SK2A 2MBSA 2O85A 3EMPA 1GP1A 4POMA 2CZ2A 4K5SA 5GZZB 2IMEA 2PGTA 4N10A 2LEGA 2HZEA 3DKSA 2H6YA 1YF0A 3F6FA 2WCIA 1YKAA 4YH2A 4EVMA 4EL1A 1Z6MA 4K5RA 5DVBA 2V6OA 1BX9A 1K3YA 4JU5A 4RQRA 1I5GA 2HRAA 1X5DA 5ECOB 1HYUA 1B8XA 3DRNA 3BD2A 4K8MA 2LRCA 5G1KA 4QQ7A 2QA2A 3MIXA 4G19A 3TKSE 1GSSA 5JWQB 3L0HA 3FKFA 4BIKA 1EEMA 4IBPA 4ZILA 2HNLA 3QFAC 5GAPD 2LV3A 2IWTA 4MA9A 4BVXB 2F9SA 2K6VA 1U3AA 4Z2TA 1EGRA 5IQYA 1XXUA 3D21A 3BCIA 2VCZA 3KJYA 2ES7A 1QGVA 4LMWA 2KP2A 2JACA 22GSA 2HRFA 2DBCA 2K9FA 4Z2RA 2HE3A 1PSQA 1XPVA 5KN1A 1EZKA 3VFIA 2AAWA 5B8AA 1ML6A 3FZ9A 3HJMA 4JBBA 4IP6A 2GGTA 2OJLA 3C73A 3KEBA 2OA7A 1JZRA 2LJAA 2DJJA 3LQ7A 1VF2A 4HU9A 1TRSA 2R0PA 4LLRA 4OMVA 3P8WA 2YJHA 1USBA 2LJRA 4KB3A 4PUFC 2YCDA 4Z7XA 2N5FA 2B6MA 5EL8A 3A5IA 3R3EA 4ID0A 3UAPA 4G10A 5H5QA 2FD3A 1OE7A 2PWJA 3TRPA 5DCGA 5IMZA 5DJMA 1K3LA 3LYPA 3C1SA 2XHFA 3FY7A 4PNGA 3TOUA 2OBIA 1AUCA 2JZTA 3C7MA 2OBKA 2H73A 2C0DA 2GSQA 4NXIA 6GSSA 2AJQB 2B1LA 5D96A 4N0ZA 1TRUA 3LXZA 3PH9A 4FH8A 3FR9A 3US3A 5ENUA 1F6MC 2HSHA 2C0FA 5A4WA 2IMIA 4OWYA 1EOHA 4FO5A 1OE8A 4IJ3A 1M2AA 2MYGA 4I2TA 1QXHA 2X8HA 11GSA 1G7EA 3D22A 3LYKA 3EU3A 2GZYA 2KP1A 3IDVA 3Q6OA 4X43A 5F07A 4MLYA 1XWBA 2CAIA 5COHA 2H0IA 4JZQA 4MH2A 2OE3A 1XIYA 2G2QA 1QK8A 1XWKA 1ZYNA 2X49A 4V2MA 2R6KA 1GSYA 3QFBC 5DALB 3ZITA 1EWXA 1M2BA 2DJ1A 2GDRA 2J9HA 5AIVA 3VWWA 1PL1A 3KH7A 3M3MA 3FZ5A 3IXRA 1YF1A 4YQVA 3HYPA 1B4QA 4KNDA 1KBNA 4KCAA 4RUVA 4MJBA 3NIVA 3K8NA 1JFUA 2LQOA 4MP4A 4F2IA 1DE1A 2RIIA 3ZIJA 2C80A 2TRXA 1M3IA 2P5RA 1WE0A 2IJYA 2L6DA 5F8BA 4MMMA 5AGYA 5LNKe 6GSUA 2XBIA 1GNEA 2LRNA 1FO5A 2B1KA 6GSWA 1YEXA 5AN1A 1BJXA 2IPAA 4KF9A 3GURA 3HY2A 3H1NA 2OADA 4HZ4A 3F4TA 1OVNA 3HVVA 4TW5A 1WOUA 2KOKA 2QKEA 5AIXA 5FWGA 2ON5A 2HLSA 3LEFA 1S3DA 1E2YA 1X5EA 2VL2C 3ZMLA 2CQ9A 4D73A 2JU5A 2CT6A 1GSEA 3VI7A 1RW1A 2B7JA 3F8UA 3W6GA 4EE0A 3SBCA 3EVIA 5CRGA 2FNOA 2M46A 2NPBA 4DSSA 5IMVA 4J57E 4IGJA 2AB6A 3IC8A 3GA4A 1X5CA 4G9HA 4ZB6A 2MMOA 2PVQA 1DE2A 2GSSA 2XBQA 4A5PA 2VLTA 4G0IA 1K0BA 3NZNA 1SD9A 3IE3A 1F3BA 3TRXA 5JCUA 2AHEA 4EUYA 3ZYWA 4ZL7A 2L57A 2I81A 4K7OA 2VO4A 1SK1A 1TDIA 3ME8A 1DUGA 2E2GA 1LBKA 4XS1A 1TTZA 4CHSA 4I5QA 3ZLPA 4KCEA 4KA0A 3KD0A 2YNXA 1Z9HA 4WF4A 2IFQA 1NM3A 12GSA 4BWQA 2R0GA 4DSQA 1HQOA 5ECKB 4CW9A 7GSSA 3E9JB 2B5XA 1WMJA 4X0XA 4WBRD 4EC0A 3TJJA 4O5UA 2Z9SA 3ISOA 1ERTA 3DXBA 1TI1A 4ECJA 2R4VA 3EINA 4LL4B 6GSYA 3L9UA 1Z7PA 2GVPA 4EXJA 3G7IA 4ECBA 2QGVA 3TKPA 1B9YC 2DJ3A 4NHWA 5CAXA 2KUCA 3P2AA 1XZOA 3EE2A 4NAXA 2X99A 4TR1A 4XTSA 4F03A 4N30A 3FR6A 4KDYA 3TKSA 4GWRA 5CREA 1ERUA 3RAZA 4N11A 1OKTA 1XBSA 3RHCA 3UEMA 2MMNA 1T4YA 1Z6NA 2H0HA 2F51A 5DAKA 5KOWA 4NHZA 1X0RA 5KN3A 2ALBA 1SYRA 4TR0A 1OYJA 4JR6A 3W8SA 4J2FA 2YP6A 1A8LA 3RDWA 3TB2A 2IL3A 2HSMA 1O8XA 5EVOA 4JEDA 17GSA 3GKNA 3MDKA 4IQAA 4ULXA 4OCFA 5J4UA 4JE1A 2VM2A 3HA9A 5IIZA 2I4AA 1K0CA 4MNNA 1T00A 5FHIA 3N5OA 3GFKA 2H0GA 2RLIA 1GTBA 4F82A 5HQPA 1GWCA 1S3AA 3PINA 1MDJA 2P5QA 2K8VA 1FVJA 2OACA 2E7PA 1PA3A 3UL3A 4IKHA 1A2JA 3KGKA 3EU4A 1UA5A 5J3RA 1R26A 3CSIA 1O81A 4NPBA 1HNCA 4BWSA 2GQMA 3A2VA 4P3YB 5JWRB 2H8LA 5IMFA 3UVTA 4XHMA 4ZB9A 3FR3A 1GUKA 2WRTA 5D93A 3D4TA 1SL1B 2VIMA 3MAKA 1E6BA 1CQHA 5HR2A 8GSSA 2JSZA 1PQNA 4KAEA 4HU7A 1M9AA 1WRYA 4XS4B 1F3AA 3TCOA 2YWIA 4K9ZA 4ZXGA 2DKIA 1GUMA 1EV4A 3CRUA 1JZWA 4AF2A 3IPZA 3GN3A 4YQMA 1TP9A 3ZTLA 5B8BA 2JL4A 2EIOA 5IO2A 3A3TA 5CP1A 2LTKA 4XRDA 3ERWA 4YKFA 2X4AA 2HZFA 1N8JA 4AJ8A 2HSYA 3HZ8A 4IN0A 3W8JA 4K7IA 5DCHA 2X8GA 3CXGA 3HVNA 3S9FA 3DVXA 4J56E 4TR1B 1YJ6A 4CDOA 2ZUPA 4KSOA 1X9SB 2H1GA 1XFLA 5IMAA 4AJ6A 3KMOA 3WGDA 5G5EA 3DYRA 2HI7A 1XOBA 5CRWA 2CVKA 2UZ8A 3HXSA 4KDXA 2QC7A 2A2SA 4IELA 4GXZA 2IIYA 5DJLA 3JCML 1H75A 5ECNB 3AY8A 3DD3A 4PUAA 2YV9A 4KUNA 3F9UA 4PX1A 1JLVA 1XW6A 3M9JA 1EGOA 5ID2A 2VL9A 4L0UA 4ML1A 2B5EA 3DMLA 1YKCA 4Q5RA 5AISA 4IQ1A 1B9XC 1TKDB 2H75A 4F0BA 2C3NA 1PFOA 1PGTA 2LS5A 5INYA 1U3IA 3KP9A 5IOXA 2NDOA 1YDKA 4BL7A 2FWHA 3P7XA 4O5RA 1M99A 2H1AA 13GSA 1ZYQB 18GSA 4KSMA 2L5OA 2F8FA 3L4NA 4K1FA 2GT5A 2VAFA 4CY6A 4L5LA 4YAPA 1Z3EA 1GH2A 3UBLA 1J0FA 1Q4JA 2L6CA 3QDNA 4JR4A 3V1WA 1THOA 2A2PA 4EDYA 4MF7A 3NOFA 4Z2UA 4Q5QA 2GS3A 2PBJA 3EURA 1FOHA 2V1MA 4I2UA 2DSAA 1W4VA 2L5LA 2C3QA 2F3MA 1V98A 5GSSA 3QMXA 2CAQA 4POLA 3HJPA 5CO3A 4ZBBA 2VLUA 4O32A 4K6XA 2D2ZA 1HNAA 2EC4A 3GSSA 4HJ2A 4MCUA 4TXVA 2L4QA 1B48A 4GCIA 2P31A 4ZL8A 3L9VA 4MF5A 2O7KA 1O85A 2AUVA 5IMDA 1ZL9A 4LA1A 3ZVJD 1G6WA 4NMUA 4RI6A 2O87A 1R7HA 2MMAA 2FWEA 5A4UA 3DVWA 3R2QA 4NV5A 1FOVA 2HZEB 2LNTA 3EYTA 3SWLA 4K2XA 1OC9A 5ECHB 6GSVA 2VD1A 5G30A 1K0AA 1V9WA 4H86A 3H93A 3WT2A 2H71A 3DWVA 3HVSA 1FW1A 3LXTA 2VL3A 1JHBA 3MWHA 3IK9A 2DIYA 5IM9A 1TK5B 2VUPA 4WXTA 6GSTA 1VRSD 2LNSA 4F0CA 2GT6A 3F4RA 1U87A 5J9CA 4ICYA 3KTLA 1FG4A 3A2WA 4USSA 1J08A 3IK7A 1PN0A 3GKMA 4K0GA 2CVBA 4ECIA 2PU9C 1YQ1A 1T7PB 4HOJA 3ZFBA 2YPMA 3KTBA 3VPQA 4IHUA 1XCCA 4O7HA 1BYEA 2DIZA 4GLTA 2HXKA 1UVZA 5F06A 2WGRA 4BL7B 1HD2A 3VURA 2E0QA 1TK0B 3IC4A 4K2DA 1JLWA 3QAWA 1AXDA 2FY6A 4TKYA 4IW9A 2ZNMA 2P0GA 4Q5NA 1ZCPA 1GL8A 3IV4A 4XCSA 3I9V2 3CTFA 4NWYA 4TXOA 3GL5A 3L78A 3TJBA 2YANA 2A4VA 2B5YA 5ECMB 1KNGA 5IPGA 1MEKA 5IO0A 3O6TA 4BVYA 5G5FA 1PRXA 3UJ1A 3CYNA 2X64A 1ZYPA 3IRAA 2WULA 4EKZA 4E8EA 5B6NA 2J23A 5J9BA 2DLXA 2M80A 5KN2A 3ZMKA 2F8AA 1T4ZA 2C3TA 4RI7A 5ECIB 2EIQA 1O8WA 1MD3A 2C0EA 5F0GA 5LCZA 4HS1A 1SJ6A 3L9SA 1R5PA 4G2EA 2H72A 3GTUA 2CV4A 3ERGA 4V2LA 5ECQB 4DVCA 3KMNA 1YY7A 1EP7A 1ZGNA 2PERA 3ED3A 3TKSC 3KM6A 3RPNA 5KEJA 3O76A 3C71A 1PKWA 5H5RA 5JCGA 2BTOT 5E4WA 5HR3A 4GQCA 2DC5A 3ZZXA 2N5AA 1ACVA 5HFKA 4EF0A 1BEDA 2V32A 1MDKA 3ZL5A 2WFCA 1GTAA 2RM6A 5CRHA 5ECRB 5F05A 4JRRA 2IMDA 3BBYA 1ZYEA 2VCVA 3H4KA 3LSZA 4HZ2A 5DQYA 2MMZA 4G0KA 3ZVJA 1XVWA 2C0GA 3G9BA 4YQUA 3E0UA 1GTIA 1PN9A 5HR0A 4N0VA 1LJRA 1NHOA 3OR5A 2IN3A 3O3TA 2H74A 2R3XA 5EY6A 2BJXA 1BAYA 1QFNA 3N9JA 4PNFA 2GSTA 3A5WA 4WBJA 1ERWA 3PGTA 1JZDA 1M0UA 1URMA 1OC3A 1Z5YE 3TJKA 3EWLA 4ML6A 1SK0A 2OKAA 1DSBA 5FT3A 1T1VA 4KE3A 3HZ4A 19GSA 3IAS2 3UBKA 1AIUA 4XS6A 1VF3A 2LQQA 2GSRA 3MYDA 4MZWA 1ERVA 4TN8A 1FHEA 1M7TA 1XW5A 1Y25A 2PMTA 1TI3A 3F6DA 4QL9A 5BMUA 1MTCA 2K8SA 1SL0B 3GL3A 3VPTA 4EDZA 4IP1A 5IMCA 3CSHA 3MSZA 4TR4A 4HDEA 4D73B 3QAVA 2MBTA 4GTUA 3HJOA 5IOWA 4BVXA 1F37A 2PVOC 1GUHA 3U5RE 4DSSB 3GIXA 3H8QA 4L5OA 5DQSA 2H66A 1YZXA 2FWGA 4G0LA 4KW6A 3WGEA 2H6ZA 5ECSA 3VWUA 3GNJA 3LJRA 2LSTA 4FIWA 4QL7A 1IYHA 3FEUA 3QCPA 3VI5A 3RBTA 3TKRA 1GLQA 2REMA 3ZFLA 2HT9A 1XG8A 3IOSA 1SKSB 5ABRA 5CNWA 2R0CA 4DEJA 3DGQA 4YKGA 2FWFA 3FK8A 4X4JA 3Q18A 4KGIA 2GZZA 4BPYA 5DBQA 2H6XA 4OD7A 3QPMA 1T3BA 4ISDA 4PXOA 3FMWA 1EV9A
chains in the Genus database with same CATH topology
1Q98A 1VF4A 1ILOA 4V2NA 2VOCA 4HQZA 4ACSA 2IFQB 3UVHA 3WGXA 3WT1A 3Q19A 1X9WB 2RUEA 3G7YA 1TU8A 4TR3A 1OC8A 2K18A 4OFMA 4EO3A 2L59A 2YZUA 1TW9A 2NBSA 2C4JA 2VM1A 2HFDA 4TRXA 1SL2B 2GLRA 1TU7A 3FW2A 3TJFA 4FYBA 1A24A 4ZL9A 3VLNA 3FHKA 4POKA 2H30A 2KHPA 2RUFA 2C8UA 4HJMA 1XWAA 5G2ZA 3BJ5A 1I9DA 3IR4A 4OFNA 2FA4A 1XOAA 2YN1A 3PR8A 4MABA 3F3RA 1LU4A 3I43A 2PUKC 5D9VA 4ECCA 2M72A 20GSA 3HKRA 2H70A 4FYUA 10GSA 3CSJA 3IA1A 2MZCA 1XWCA 2V2GA 3ZIVA 4PTSA 5DAKB 1TJDA 2DMMA 5DALA 4XIHA 3UMAA 2CZ3A 4X1UA 3LORA 1S3CA 1GSQA 1O7UA 1AQVA 1BQ7A 2IMKA 2WDUA 3F4SA 1PKZA 5C00A 3E3EA 4GSNA 3APOA 14GSA 2NTOA 1AQXA 1PMTA 1GULA 3BOAA 5C04A 1SU9A 1M2DA 1SENA 9GSSA 1FVKA 1OAZA 4K7NA 2I1UA 3QAGA 1AQWA 3BCKA 3QOUA 4I97A 3GX8A 1J9BA 4OO4A 4PQ1A 3EPTA 3GMFA 2I9HA 2JADA 1GSDA 2QA1A 1U6TA 2IMFA 4I8BA 4MZCA 2YWNA 3D6IA 1ZZYA 4V1Ap 1AAZA 1SJIA 3TGZA 4KX4A 2R37A 3TOTA 2JZSA 2DJ0A 2TIRA 3LW9A 5D9WA 3GKXA 2OE1A 5G1LA 2CX4A 4OO5A 5D9XA 4ZBAA 1ZOFA 2CA8A 3KZQA 2N5BA 1B4PA 3HCZA 1IYIA 3G7JA 2DKHA 3IAM2 2JZRA 4GRFA 1V58A 2GTUA 3EMXA 4LL1B 5HR1A 4HUAA 5CYYA 1CQGA 2YWOA 4PURA 3UOMA 2WZ9A 2R2JA 1PL2A 2B7KA 2CX3A 1TK8B 1UN2A 1FAAA 1GRXA 1MDIA 5E59A 2WB9A 2R5GA 5H5SA 4XRAA 2ON7A 1UC7A 2V41A 3GHAA 3GH9A 1AC1A 1QQ2A 5JCWA 1G6YA 1SYXA 4GF0A 1NSWA 3J7Yb 4V1Ag 3DEXA 1A0FA 3MNGA 1O6JA 3UIWA 2YV7A 2QSIA 4AGSA 5BRTA 2V6KA 1Y6EA 3TJGA 4EIPA 1TRVA 5GAND 3FZAA 1TOFA 3CTGA 1GSUA 4ZB8A 1XWGA 4WF5A 1SKRB 1WJKA 4MPGA 2YOIA 2JSYA 1AW9A 2HRNA 4ILFA 5ELAA 3FYGA 1VGLA 4MF6A 3C8EA 2A2RA 5LD0A 2WS2A 4MK3A 3PPUA 4PGTA 5B7CA 5ID2B 3GSTA 4K0NA 3TRQA 1FB6A 1Z7RA 4GSSA 1G0TA 1XVQA 2WJUA 1WPIA 5J5NA 4GSTA 1ABAA 1NHYA 16GSA 3M0FA 4WETA 1K0OA 3CRTA 3EC3A 1X9MB 3DIEA 2LUSA 4O92A 2H01A 1YEPA 2H76A 1VF1A 2AV4A 4Q5FA 4F9ZA 5IPHA 3I6AA 3UARA 3M1GA 1H4OA 2LRTA 4OCEA 2VCXA 4TVEA 1WP0A 2GQLA 4KDUA 3J7Yk 3HHVA 5A4VA 1G7OA 5G31A 1WIKA 4OFTA 2AYTA 4POBA 5A5KA 2LKUA 4HEA2 4WKWA 5J41A 2HYXA 2GZPA 4FYCA 2LJKA 1A8YA 1R4WA 1ON4A 2XC2A 4MDCA 1KEBA 2FLSA 3WYWA 1QMVA 1SKWB 2B3SA 1JZOA 3LWAA 3KXOA 3IBHA 5ELGA 1TXXA 1U88A 1EOGA 2VL2A 4IVFA 1RK4A 3ZREA 2E2MA 1FB0A 3CMIA 4MH3A 1RQMA 5JWOB 3KIJA 4L8EA 1QUWA 4MZBA 4HQSA 1M9BA 1EP8A 1A0RP 3VWXA 2H1BA 1KTEA 4MJCA 2FGXA 1K3OA 2PN8A 5DDLA 4ZBDA 1V57A 1OC9B 3VK9A 4YAVA 4AJ7A 4XS4A 1HNBA 5ECPB 4I6XA 3WD6A 5KN0A 4DSRA 4MJEA 1OKDA 3KCMA 3QR6A 3GH6A 3GV1A 2VCQA 1WWJA 2XPDA 1K0MA 4IJIA 2VCTA 2OE0A 3RPPA 3F63A 1C72A 2EIRA 1A23A 2VD0A 4WEYA 3GX0A 4E8HA 3RHBA 5D9TA 3TDGA 3D5JA 3LFLA 1NW2A 4BA7A 3H79A 1PD21 3VWVA 3M9KA 1BG5A 2FCHA 3HD5A 1THXA 3APSA 2X8CA 1DBYA 2DJ2A 3KP8A 4PQIA 4MPFA 4PQHA 2FA8A 5B6MA 5D8IA 4CY8A 4RQXA 5EPFA 2FHEA 5HFIA 2PPTA 1K0DA 3ME7A 1SD8A 1SJZA 3FZ4A 1N2AA 3CBUA 5KOXA 3IHGA 4TXOB 1MD4A 2H19A 3Q74A 1EEJA 2DJKA 3D4MA 4HI7A 2H1DA 2VLVA 2CVDA 3QD9A 2G0FA 4BVYB 2RM5A 2YJ7A 2VCWA 2C1YA 3GKKA 3HVXA 3TUEA 3HDCA 2FUG2 4WR5A 2L4CA 3LGCA 4ZIJA 3GYKA 1V40A 1GNWA 1F9MA 3ERFA 2KLXA 1O73A 1XW9A 4O5QA 4KH7A 2YZHA 1F2EA 2TRCP 1PX6A 2A4HA 3F3QA 3LG6A 5D73A 1ST9A 3FRCA 4GQFA 2GQKA 4FQUA 3M8NA 2DMLA 2O89A 1A2LA 3TKQA 3P90A 3GTUB 3A2XA 4NV2A 2XPEA 2YWMA 3F0IA 3GRXA 3U6VA 2I3YA 3IHQA 4IS0A 4MJAA 1ZMAA 2BMXA 5CRDA 1T8EB 2HRKA 3ZRDA 3D0ZA 3KH9A 1K0NA 2NVLA 4L0WA 1GTUA 1A2MA 6GSXA 3C1RA 1TRWA 2O8VB 5ECLB 5HFGA 1GSFA 3I69A 1V2AA 4LMVA 4TOPA 3APQA 4WR4A 4EIQA 1R5AA 2ZCTA 1PX7A 3GUSA 1W89A 5L71A 1GLPA 5GSTA 1SK2A 2MBSA 2O85A 3EMPA 1GP1A 4POMA 2CZ2A 4K5SA 5GZZB 2IMEA 2PGTA 4N10A 2LEGA 2HZEA 3DKSA 2H6YA 1YF0A 3F6FA 2WCIA 1YKAA 4YH2A 4EVMA 4EL1A 1Z6MA 4K5RA 5DVBA 2V6OA 1BX9A 1K3YA 4JU5A 4RQRA 1I5GA 2HRAA 1X5DA 5ECOB 1HYUA 1B8XA 3DRNA 3BD2A 4K8MA 2LRCA 5G1KA 4QQ7A 2QA2A 3MIXA 4G19A 3TKSE 1GSSA 5JWQB 3L0HA 3FKFA 1EEMA 4IBPA 4ZILA 2HNLA 3QFAC 5GAPD 2LV3A 2IWTA 4MA9A 4BVXB 2F9SA 2K6VA 1U3AA 4Z2TA 1EGRA 5IQYA 1XXUA 3D21A 3BCIA 2VCZA 3KJYA 2ES7A 1QGVA 4LMWA 2KP2A 2JACA 22GSA 2HRFA 2DBCA 2K9FA 4Z2RA 2HE3A 1PSQA 1XPVA 5KN1A 1EZKA 3VFIA 2AAWA 5B8AA 1ML6A 3FZ9A 3HJMA 4JBBA 4IP6A 2GGTA 2OJLA 3C73A 3KEBA 2OA7A 1JZRA 2LJAA 2DJJA 3LQ7A 1VF2A 4HU9A 1TRSA 2R0PA 4LLRA 4OMVA 3P8WA 2YJHA 1USBA 2LJRA 4KB3A 4PUFC 2YCDA 4Z7XA 2N5FA 2B6MA 5EL8A 3A5IA 3R3EA 4ID0A 3UAPA 4G10A 5H5QA 2FD3A 1OE7A 2PWJA 3TRPA 5DCGA 5IMZA 5DJMA 1K3LA 3LYPA 3C1SA 2XHFA 3FY7A 4PNGA 3TOUA 2OBIA 1AUCA 2JZTA 3C7MA 2OBKA 2H73A 2C0DA 2GSQA 4NXIA 6GSSA 2AJQB 2B1LA 5D96A 4N0ZA 1TRUA 3LXZA 3PH9A 4FH8A 3FR9A 3US3A 5ENUA 1F6MC 2HSHA 2C0FA 5A4WA 2IMIA 4OWYA 1EOHA 4FO5A 1OE8A 4IJ3A 1M2AA 2MYGA 4I2TA 1QXHA 2X8HA 11GSA 1G7EA 3D22A 3LYKA 3EU3A 2GZYA 2KP1A 3IDVA 3Q6OA 4X43A 5F07A 4MLYA 1XWBA 2CAIA 5COHA 2H0IA 4JZQA 4MH2A 2OE3A 1XIYA 2G2QA 1QK8A 1XWKA 1ZYNA 2X49A 4V2MA 2R6KA 1GSYA 3QFBC 5DALB 3ZITA 1EWXA 1M2BA 2DJ1A 2GDRA 2J9HA 5AIVA 3VWWA 1PL1A 3KH7A 3M3MA 3FZ5A 3IXRA 1YF1A 4YQVA 3HYPA 1B4QA 4KNDA 1KBNA 4KCAA 4RUVA 4MJBA 3NIVA 3K8NA 1JFUA 2LQOA 4MP4A 4F2IA 1DE1A 2RIIA 3ZIJA 2C80A 2TRXA 2P5RA 1WE0A 2IJYA 2L6DA 5F8BA 4MMMA 5AGYA 5LNKe 6GSUA 2XBIA 1GNEA 2LRNA 1FO5A 2B1KA 6GSWA 1YEXA 5AN1A 1BJXA 2IPAA 4KF9A 3GURA 3HY2A 3H1NA 2OADA 4HZ4A 3F4TA 1OVNA 3HVVA 4TW5A 1WOUA 2KOKA 2QKEA 5AIXA 5FWGA 2ON5A 2HLSA 3LEFA 1S3DA 1E2YA 1X5EA 2VL2C 3ZMLA 2CQ9A 4D73A 2JU5A 2CT6A 1GSEA 3VI7A 1RW1A 2B7JA 3F8UA 3W6GA 4EE0A 3SBCA 3EVIA 5CRGA 2FNOA 2M46A 2NPBA 4DSSA 5IMVA 4J57E 4IGJA 2AB6A 3IC8A 3GA4A 1X5CA 4G9HA 4ZB6A 2MMOA 2PVQA 1DE2A 2GSSA 2XBQA 4A5PA 2VLTA 4G0IA 1K0BA 3NZNA 1SD9A 3IE3A 1F3BA 3TRXA 5JCUA 2AHEA 4EUYA 3ZYWA 4ZL7A 2L57A 2I81A 4K7OA 2VO4A 1SK1A 1TDIA 3ME8A 1DUGA 2E2GA 1LBKA 4XS1A 1TTZA 4CHSA 4I5QA 3ZLPA 4KCEA 4KA0A 3KD0A 2YNXA 1Z9HA 4WF4A 2IFQA 1NM3A 12GSA 4BWQA 2R0GA 4DSQA 1HQOA 5ECKB 4CW9A 7GSSA 3E9JB 2B5XA 1WMJA 4X0XA 4WBRD 4EC0A 3TJJA 4O5UA 2Z9SA 3ISOA 1ERTA 3DXBA 1TI1A 4ECJA 2R4VA 3EINA 4LL4B 6GSYA 3L9UA 1Z7PA 2GVPA 4EXJA 3G7IA 4ECBA 2QGVA 3TKPA 1B9YC 2DJ3A 4NHWA 5CAXA 2KUCA 3P2AA 1XZOA 3EE2A 4NAXA 2X99A 4TR1A 4XTSA 4F03A 4N30A 3FR6A 4KDYA 3TKSA 4GWRA 5CREA 1ERUA 3RAZA 4N11A 1OKTA 1XBSA 3RHCA 3UEMA 2MMNA 1T4YA 1Z6NA 2H0HA 2F51A 5DAKA 5KOWA 4NHZA 1X0RA 5KN3A 2ALBA 1SYRA 4TR0A 1OYJA 4JR6A 3W8SA 4J2FA 2YP6A 1A8LA 3RDWA 3TB2A 2IL3A 2HSMA 1O8XA 5EVOA 4JEDA 17GSA 3GKNA 3MDKA 4IQAA 4ULXA 4OCFA 5J4UA 4JE1A 2VM2A 3HA9A 5IIZA 2I4AA 1K0CA 4MNNA 1T00A 5FHIA 3N5OA 3GFKA 2H0GA 2RLIA 1GTBA 4F82A 5HQPA 1GWCA 1S3AA 3PINA 1MDJA 2P5QA 2K8VA 1FVJA 2OACA 2E7PA 1PA3A 3UL3A 4IKHA 1A2JA 3KGKA 3EU4A 1UA5A 5J3RA 1R26A 3CSIA 1O81A 4NPBA 1HNCA 4BWSA 2GQMA 3A2VA 4P3YB 5JWRB 2H8LA 5IMFA 3UVTA 4XHMA 4ZB9A 3FR3A 1GUKA 2WRTA 5D93A 3D4TA 1SL1B 2VIMA 3MAKA 1E6BA 1CQHA 5HR2A 8GSSA 2JSZA 1PQNA 4KAEA 4HU7A 1M9AA 1WRYA 4XS4B 1F3AA 3TCOA 2YWIA 4K9ZA 4ZXGA 2DKIA 1GUMA 1EV4A 3CRUA 1JZWA 4AF2A 3IPZA 3GN3A 4YQMA 1TP9A 3ZTLA 5B8BA 2JL4A 2EIOA 5IO2A 3A3TA 5CP1A 2LTKA 4XRDA 3ERWA 4YKFA 2X4AA 2HZFA 1N8JA 4AJ8A 2HSYA 3HZ8A 4IN0A 3W8JA 4K7IA 5DCHA 2X8GA 3CXGA 3S9FA 3DVXA 4J56E 4TR1B 1YJ6A 4CDOA 2ZUPA 4KSOA 1X9SB 2H1GA 1XFLA 5IMAA 4AJ6A 3KMOA 3WGDA 5G5EA 3DYRA 2HI7A 1XOBA 5CRWA 2CVKA 2UZ8A 3HXSA 4KDXA 2QC7A 2A2SA 4IELA 4GXZA 2IIYA 5DJLA 3JCML 1H75A 5ECNB 3AY8A 3DD3A 4PUAA 2YV9A 4KUNA 3F9UA 4PX1A 1JLVA 1XW6A 3M9JA 1EGOA 5ID2A 2VL9A 4L0UA 4ML1A 2B5EA 3DMLA 1YKCA 4Q5RA 5AISA 4IQ1A 1B9XC 1TKDB 2H75A 4F0BA 2C3NA 1PGTA 2LS5A 5INYA 1U3IA 3KP9A 5IOXA 2NDOA 1YDKA 4BL7A 2FWHA 3P7XA 4O5RA 1M99A 2H1AA 13GSA 1ZYQB 18GSA 4KSMA 2L5OA 2F8FA 3L4NA 4K1FA 2GT5A 2VAFA 4CY6A 4L5LA 4YAPA 1Z3EA 1GH2A 3UBLA 1J0FA 1Q4JA 2L6CA 3QDNA 4JR4A 3V1WA 1THOA 2A2PA 4EDYA 4MF7A 3NOFA 4Z2UA 4Q5QA 2GS3A 2PBJA 3EURA 1FOHA 2V1MA 4I2UA 2DSAA 1W4VA 2L5LA 2C3QA 2F3MA 1V98A 5GSSA 3QMXA 2CAQA 4POLA 3HJPA 5CO3A 4ZBBA 2VLUA 4O32A 4K6XA 2D2ZA 1HNAA 2EC4A 3GSSA 4HJ2A 4MCUA 4TXVA 2L4QA 1B48A 4GCIA 2P31A 4ZL8A 3L9VA 4MF5A 2O7KA 1O85A 2AUVA 5IMDA 1ZL9A 4LA1A 3ZVJD 1G6WA 4NMUA 4RI6A 2O87A 1R7HA 2MMAA 2FWEA 5A4UA 3DVWA 3R2QA 4NV5A 1FOVA 2HZEB 2LNTA 3EYTA 3SWLA 4K2XA 1OC9A 5ECHB 6GSVA 2VD1A 5G30A 1K0AA 1V9WA 4H86A 3H93A 3WT2A 2H71A 3DWVA 3HVSA 1FW1A 3LXTA 2VL3A 1JHBA 3MWHA 3IK9A 2DIYA 5IM9A 1TK5B 2VUPA 4WXTA 6GSTA 1VRSD 2LNSA 4F0CA 2GT6A 3F4RA 1U87A 5J9CA 4ICYA 3KTLA 1FG4A 3A2WA 4USSA 1J08A 3IK7A 1PN0A 3GKMA 4K0GA 2CVBA 4ECIA 2PU9C 1YQ1A 1T7PB 4HOJA 3ZFBA 2YPMA 3KTBA 3VPQA 4IHUA 1XCCA 4O7HA 1BYEA 2DIZA 4GLTA 2HXKA 1UVZA 5F06A 2WGRA 4BL7B 1HD2A 3VURA 2E0QA 1TK0B 3IC4A 4K2DA 1JLWA 3QAWA 1AXDA 2FY6A 4TKYA 4IW9A 2ZNMA 2P0GA 4Q5NA 1ZCPA 1GL8A 3IV4A 4XCSA 3I9V2 3CTFA 4NWYA 4TXOA 3GL5A 3L78A 3TJBA 2YANA 2A4VA 2B5YA 5ECMB 1KNGA 5IPGA 1MEKA 5IO0A 3O6TA 4BVYA 5G5FA 1PRXA 3UJ1A 3CYNA 2X64A 1ZYPA 3IRAA 2WULA 4EKZA 4E8EA 5B6NA 2J23A 5J9BA 2DLXA 2M80A 5KN2A 3ZMKA 2F8AA 1T4ZA 2C3TA 4RI7A 5ECIB 2EIQA 1O8WA 1MD3A 2C0EA 5F0GA 5LCZA 4HS1A 1SJ6A 3L9SA 1R5PA 4G2EA 2H72A 3GTUA 2CV4A 3ERGA 4V2LA 5ECQB 4DVCA 3KMNA 1YY7A 1EP7A 1ZGNA 2PERA 3ED3A 3TKSC 3KM6A 3RPNA 5KEJA 3O76A 3C71A 1PKWA 5H5RA 5JCGA 2BTOT 5E4WA 5HR3A 4GQCA 2DC5A 3ZZXA 2N5AA 1ACVA 5HFKA 4EF0A 1BEDA 2V32A 1MDKA 3ZL5A 2WFCA 1GTAA 2RM6A 5CRHA 5ECRB 5F05A 4JRRA 2IMDA 3BBYA 1ZYEA 2VCVA 3H4KA 3LSZA 4HZ2A 5DQYA 2MMZA 4G0KA 3ZVJA 1XVWA 2C0GA 3G9BA 4YQUA 3E0UA 1GTIA 1PN9A 5HR0A 4N0VA 1LJRA 1NHOA 3OR5A 2IN3A 3O3TA 2H74A 2R3XA 5EY6A 2BJXA 1BAYA 1QFNA 3N9JA 4PNFA 2GSTA 3A5WA 4WBJA 1ERWA 3PGTA 1JZDA 1M0UA 1URMA 1OC3A 1Z5YE 3TJKA 3EWLA 4ML6A 1SK0A 2OKAA 1DSBA 5FT3A 1T1VA 4KE3A 3HZ4A 19GSA 3IAS2 3UBKA 1AIUA 4XS6A 1VF3A 2LQQA 2GSRA 3MYDA 4MZWA 1ERVA 4TN8A 1FHEA 1M7TA 1XW5A 1Y25A 2PMTA 1TI3A 3F6DA 4QL9A 5BMUA 1MTCA 2K8SA 1SL0B 3GL3A 3VPTA 4EDZA 4IP1A 5IMCA 3CSHA 3MSZA 4TR4A 4HDEA 4D73B 3QAVA 2MBTA 4GTUA 3HJOA 5IOWA 4BVXA 1F37A 2PVOC 1GUHA 3U5RE 4DSSB 3GIXA 3H8QA 4L5OA 5DQSA 2H66A 1YZXA 2FWGA 4G0LA 4KW6A 3WGEA 2H6ZA 5ECSA 3VWUA 3GNJA 3LJRA 2LSTA 4FIWA 4QL7A 1IYHA 3FEUA 3QCPA 3VI5A 3RBTA 3TKRA 1GLQA 2REMA 3ZFLA 2HT9A 3IOSA 1SKSB 5ABRA 5CNWA 2R0CA 4DEJA 3DGQA 4YKGA 2FWFA 3FK8A 4X4JA 3Q18A 4KGIA 2GZZA 4BPYA 5DBQA 2H6XA 4OD7A 3QPMA 1T3BA 4ISDA 4PXOA 3FMWA 1EV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q98 A;  1VF4 A;  1ILO A;  4V2N A;  2VOC A;  4HQZ A;  4ACS A;  2IFQ B;  3UVH A;  3WGX A;  3WT1 A;  3Q19 A;  1X9W B;  2RUE A;  3G7Y A;  1TU8 A;  4TR3 A;  1OC8 A;  2K18 A;  4OFM A;  4EO3 A;  2L59 A;  2YZU A;  1TW9 A;  2NBS A;  2C4J A;  2VM1 A;  2HFD A;  4TRX A;  1SL2 B;  2GLR A;  1TU7 A;  3FW2 A;  3TJF A;  4FYB A;  1A24 A;  4ZL9 A;  3VLN A;  3FHK A;  4POK A;  2H30 A;  2KHP A;  2RUF A;  2C8U A;  4HJM A;  1XWA A;  5G2Z A;  3BJ5 A;  1I9D A;  3IR4 A;  4OFN A;  2FA4 A;  1XOA A;  2YN1 A;  3PR8 A;  4MAB A;  3F3R A;  1LU4 A;  3I43 A;  2PUK C;  5D9V A;  4ECC A;  2M72 A;  20GS A;  3HKR A;  2H70 A;  4FYU A;  10GS A;  3CSJ A;  3IA1 A;  2MZC A;  1XWC A;  2V2G A;  3ZIV A;  5DAK B;  1TJD A;  2DMM A;  5DAL A;  4XIH A;  3UMA A;  2CZ3 A;  4X1U A;  3LOR A;  1S3C A;  1GSQ A;  1O7U A;  1AQV A;  1BQ7 A;  2IMK A;  2WDU A;  3F4S A;  1PKZ A;  5C00 A;  3E3E A;  4GSN A;  3APO A;  14GS A;  2NTO A;  1AQX A;  1PMT A;  1GUL A;  3BOA A;  5C04 A;  1SU9 A;  1M2D A;  1SEN A;  9GSS A;  1FVK A;  1OAZ A;  4K7N A;  2I1U A;  3QAG A;  1AQW A;  3BCK A;  3QOU A;  4I97 A;  3GX8 A;  1J9B A;  4OO4 A;  4PQ1 A;  3GMF A;  2I9H A;  2JAD A;  1GSD A;  1U6T A;  2IMF A;  4I8B A;  4MZC A;  2YWN A;  3D6I A;  1ZZY A;  4V1A p;  1AAZ A;  1SJI A;  3TGZ A;  4KX4 A;  2R37 A;  3TOT A;  2JZS A;  2DJ0 A;  2TIR A;  5D9W A;  3GKX A;  2OE1 A;  5G1L A;  2CX4 A;  4OO5 A;  5D9X A;  4ZBA A;  1ZOF A;  2CA8 A;  3KZQ A;  2N5B A;  1B4P A;  3HCZ A;  1IYI A;  3G7J A;  3IAM 2;  2JZR A;  4GRF A;  1V58 A;  2GTU A;  3EMX A;  4LL1 B;  5HR1 A;  4HUA A;  5CYY A;  1CQG A;  2YWO A;  4PUR A;  3UOM A;  2WZ9 A;  2R2J A;  1PL2 A;  2B7K A;  2CX3 A;  1TK8 B;  1UN2 A;  1FAA A;  1GRX A;  1MDI A;  5E59 A;  2WB9 A;  2R5G A;  5H5S A;  4XRA A;  2ON7 A;  1UC7 A;  2V41 A;  3GHA A;  3GH9 A;  1AC1 A;  1QQ2 A;  5JCW A;  1G6Y A;  1SYX A;  4GF0 A;  1NSW A;  3J7Y b;  4V1A g;  3DEX A;  1A0F A;  3MNG A;  1O6J A;  3UIW A;  2YV7 A;  2QSI A;  4AGS A;  2V6K A;  1Y6E A;  3TJG A;  1TRV A;  5GAN D;  3FZA A;  1TOF A;  3CTG A;  1GSU A;  4ZB8 A;  1XWG A;  4WF5 A;  1SKR B;  1WJK A;  4MPG A;  2YOI A;  2JSY A;  1AW9 A;  2HRN A;  5ELA A;  4ILF A;  3FYG A;  1VGL A;  4MF6 A;  3C8E A;  2A2R A;  5LD0 A;  2WS2 A;  4MK3 A;  4PGT A;  5B7C A;  5ID2 B;  3GST A;  4K0N A;  3TRQ A;  1FB6 A;  1Z7R A;  4GSS A;  1G0T A;  1XVQ A;  2WJU A;  1WPI A;  5J5N A;  4GST A;  1ABA A;  1NHY A;  16GS A;  3M0F A;  4WET A;  1K0O A;  3CRT A;  3EC3 A;  1X9M B;  3DIE A;  2LUS A;  4O92 A;  2H01 A;  1YEP A;  2H76 A;  1VF1 A;  2AV4 A;  4Q5F A;  4F9Z A;  5IPH A;  3I6A A;  3UAR A;  3M1G A;  1H4O A;  2LRT A;  4OCE A;  2VCX A;  4TVE A;  1WP0 A;  2GQL A;  4KDU A;  3J7Y k;  3HHV A;  5A4V A;  1G7O A;  5G31 A;  1WIK A;  4OFT A;  2AYT A;  4POB A;  5A5K A;  2LKU A;  4HEA 2;  4WKW A;  5J41 A;  2HYX A;  2GZP A;  4FYC A;  2LJK A;  1A8Y A;  1R4W A;  1ON4 A;  2XC2 A;  4MDC A;  1KEB A;  2FLS A;  3WYW A;  1QMV A;  1SKW B;  2B3S A;  1JZO A;  3LWA A;  3KXO A;  3IBH A;  5ELG A;  1TXX A;  1U88 A;  1EOG A;  2VL2 A;  4IVF A;  1RK4 A;  3ZRE A;  2E2M A;  1FB0 A;  3CMI A;  4MH3 A;  1RQM A;  5JWO B;  3KIJ A;  4L8E A;  1QUW A;  4MZB A;  4HQS A;  1M9B A;  1EP8 A;  1A0R P;  3VWX A;  2H1B A;  1KTE A;  4MJC A;  2FGX A;  1K3O A;  2PN8 A;  5DDL A;  4ZBD A;  1V57 A;  1OC9 B;  3VK9 A;  4YAV A;  4AJ7 A;  4XS4 A;  1HNB A;  5ECP B;  4I6X A;  3WD6 A;  5KN0 A;  4DSR A;  4MJE A;  1OKD A;  3KCM A;  3QR6 A;  3GH6 A;  3GV1 A;  2VCQ A;  1WWJ A;  2XPD A;  1K0M A;  4IJI A;  2VCT A;  2OE0 A;  3RPP A;  3F63 A;  1C72 A;  2EIR A;  1A23 A;  2VD0 A;  4WEY A;  3GX0 A;  4E8H A;  3RHB A;  5D9T A;  3TDG A;  3D5J A;  3LFL A;  1NW2 A;  4BA7 A;  3H79 A;  1PD2 1;  3VWV A;  3M9K A;  1BG5 A;  2FCH A;  3HD5 A;  1THX A;  3APS A;  2X8C A;  1DBY A;  2DJ2 A;  3KP8 A;  4PQI A;  4MPF A;  4PQH A;  2FA8 A;  5B6M A;  5D8I A;  4RQX A;  5EPF A;  2FHE A;  5HFI A;  2PPT A;  1K0D A;  3ME7 A;  1SD8 A;  1SJZ A;  3FZ4 A;  1N2A A;  3CBU A;  4TXO B;  1MD4 A;  2H19 A;  3Q74 A;  1EEJ A;  2DJK A;  3D4M A;  4HI7 A;  2H1D A;  2VLV A;  2CVD A;  3QD9 A;  2G0F A;  2RM5 A;  2YJ7 A;  2VCW A;  2C1Y A;  3GKK A;  3HVX A;  3TUE A;  3HDC A;  2FUG 2;  4WR5 A;  2L4C A;  3LGC A;  4ZIJ A;  3GYK A;  1V40 A;  1GNW A;  1F9M A;  3ERF A;  2KLX A;  1O73 A;  1XW9 A;  4KH7 A;  2YZH A;  1F2E A;  2TRC P;  1PX6 A;  3F3Q A;  3LG6 A;  5D73 A;  1ST9 A;  3FRC A;  4GQF A;  2GQK A;  3M8N A;  2DML A;  2O89 A;  1A2L A;  3TKQ A;  3P90 A;  3GTU B;  3A2X A;  4NV2 A;  2XPE A;  2YWM A;  3F0I A;  3GRX A;  3U6V A;  2I3Y A;  3IHQ A;  4IS0 A;  4MJA A;  1ZMA A;  2BMX A;  5CRD A;  1T8E B;  3ZRD A;  3D0Z A;  3KH9 A;  1K0N A;  2NVL A;  4L0W A;  1GTU A;  1A2M A;  6GSX A;  3C1R A;  1TRW A;  2O8V B;  5ECL B;  5HFG A;  1GSF A;  3I69 A;  1V2A A;  4LMV A;  4TOP A;  3APQ A;  4WR4 A;  1R5A A;  2ZCT A;  1PX7 A;  3GUS A;  1W89 A;  5L71 A;  1GLP A;  5GST A;  1SK2 A;  2MBS A;  2O85 A;  3EMP A;  1GP1 A;  4POM A;  2CZ2 A;  5GZZ B;  2IME A;  2PGT A;  4N10 A;  2LEG A;  2HZE A;  3DKS A;  2H6Y A;  1YF0 A;  3F6F A;  2WCI A;  1YKA A;  4YH2 A;  4EVM A;  4EL1 A;  1Z6M A;  5DVB A;  2V6O A;  1BX9 A;  1K3Y A;  4JU5 A;  4RQR A;  1I5G A;  1X5D A;  5ECO B;  1HYU A;  1B8X A;  3DRN A;  3BD2 A;  4K8M A;  2LRC A;  5G1K A;  4QQ7 A;  4G19 A;  3TKS E;  1GSS A;  5JWQ B;  3L0H A;  3FKF A;  1EEM A;  4IBP A;  4ZIL A;  2HNL A;  3QFA C;  5GAP D;  2LV3 A;  2IWT A;  4MA9 A;  2F9S A;  2K6V A;  1U3A A;  1EGR A;  5IQY A;  1XXU A;  3D21 A;  3BCI A;  2VCZ A;  3KJY A;  2ES7 A;  1QGV A;  4LMW A;  2KP2 A;  2JAC A;  22GS A;  2HRF A;  2DBC A;  2K9F A;  2HE3 A;  1PSQ A;  1XPV A;  5KN1 A;  1EZK A;  3VFI A;  2AAW A;  5B8A A;  1ML6 A;  3FZ9 A;  3HJM A;  4JBB A;  4IP6 A;  2GGT A;  2OJL A;  3C73 A;  3KEB A;  2OA7 A;  1JZR A;  2LJA A;  2DJJ A;  3LQ7 A;  1VF2 A;  4HU9 A;  1TRS A;  4LLR A;  4OMV A;  3P8W A;  2YJH A;  1USB A;  2LJR A;  4KB3 A;  4PUF C;  2YCD A;  4Z7X A;  2N5F A;  2B6M A;  5EL8 A;  4ID0 A;  3UAP A;  4G10 A;  5H5Q A;  2FD3 A;  1OE7 A;  2PWJ A;  3TRP A;  5DCG A;  5IMZ A;  5DJM A;  1K3L A;  3LYP A;  3C1S A;  2XHF A;  3FY7 A;  4PNG A;  3TOU A;  2OBI A;  1AUC A;  2JZT A;  3C7M A;  2OBK A;  2H73 A;  2C0D A;  2GSQ A;  4NXI A;  6GSS A;  2AJQ B;  2B1L A;  5D96 A;  4N0Z A;  1TRU A;  3LXZ A;  3PH9 A;  4FH8 A;  3FR9 A;  3US3 A;  5ENU A;  1F6M C;  2HSH A;  2C0F A;  5A4W A;  2IMI A;  4OWY A;  1EOH A;  4FO5 A;  1OE8 A;  4IJ3 A;  1M2A A;  2MYG A;  4I2T A;  1QXH A;  2X8H A;  11GS A;  1G7E A;  3D22 A;  3LYK A;  3EU3 A;  2GZY A;  2KP1 A;  3IDV A;  3Q6O A;  4X43 A;  5F07 A;  4MLY A;  1XWB A;  2CAI A;  5COH A;  2H0I A;  4JZQ A;  4MH2 A;  2OE3 A;  1XIY A;  2G2Q A;  1QK8 A;  1XWK A;  4V2M A;  2R6K A;  1GSY A;  3QFB C;  5DAL B;  3ZIT A;  1EWX A;  1M2B A;  2DJ1 A;  2GDR A;  2J9H A;  5AIV A;  3VWW A;  1PL1 A;  3KH7 A;  3M3M A;  3FZ5 A;  3IXR A;  1YF1 A;  4YQV A;  3HYP A;  1B4Q A;  4KND A;  1KBN A;  4KCA A;  4RUV A;  4MJB A;  3NIV A;  3K8N A;  1JFU A;  2LQO A;  4MP4 A;  4F2I A;  1DE1 A;  2RII A;  3ZIJ A;  2C80 A;  2TRX A;  2P5R A;  1WE0 A;  2IJY A;  2L6D A;  5F8B A;  4MMM A;  5AGY A;  5LNK e;  6GSU A;  2XBI A;  1GNE A;  2LRN A;  1FO5 A;  2B1K A;  6GSW A;  1YEX A;  5AN1 A;  1BJX A;  2IPA A;  3GUR A;  3HY2 A;  3H1N A;  2OAD A;  4HZ4 A;  3F4T A;  1OVN A;  3HVV A;  4TW5 A;  1WOU A;  2KOK A;  2QKE A;  5AIX A;  5FWG A;  2ON5 A;  2HLS A;  3LEF A;  1S3D A;  1E2Y A;  1X5E A;  2VL2 C;  3ZML A;  2CQ9 A;  4D73 A;  2JU5 A;  2CT6 A;  1GSE A;  3VI7 A;  1RW1 A;  2B7J A;  3F8U A;  3W6G A;  4EE0 A;  3SBC A;  3EVI A;  5CRG A;  2FNO A;  2M46 A;  2NPB A;  4DSS A;  5IMV A;  4J57 E;  4IGJ A;  2AB6 A;  3GA4 A;  1X5C A;  4G9H A;  4ZB6 A;  2MMO A;  2PVQ A;  1DE2 A;  2GSS A;  2XBQ A;  2VLT A;  1K0B A;  3NZN A;  1SD9 A;  3IE3 A;  1F3B A;  3TRX A;  5JCU A;  2AHE A;  4EUY A;  3ZYW A;  4ZL7 A;  2L57 A;  2I81 A;  4K7O A;  2VO4 A;  1SK1 A;  1TDI A;  3ME8 A;  1DUG A;  2E2G A;  1LBK A;  4XS1 A;  1TTZ A;  4CHS A;  4I5Q A;  3ZLP A;  4KCE A;  4KA0 A;  3KD0 A;  2YNX A;  1Z9H A;  4WF4 A;  2IFQ A;  1NM3 A;  12GS A;  4BWQ A;  4DSQ A;  1HQO A;  5ECK B;  4CW9 A;  7GSS A;  3E9J B;  2B5X A;  1WMJ A;  4X0X A;  4WBR D;  4EC0 A;  3TJJ A;  2Z9S A;  3ISO A;  1ERT A;  3DXB A;  1TI1 A;  4ECJ A;  2R4V A;  3EIN A;  4LL4 B;  6GSY A;  3L9U A;  1Z7P A;  2GVP A;  4EXJ A;  3G7I A;  4ECB A;  2QGV A;  3TKP A;  1B9Y C;  2DJ3 A;  4NHW A;  5CAX A;  2KUC A;  3P2A A;  1XZO A;  3EE2 A;  4NAX A;  2X99 A;  4TR1 A;  4XTS A;  4F03 A;  4N30 A;  3FR6 A;  4KDY A;  3TKS A;  4GWR A;  5CRE A;  1ERU A;  3RAZ A;  4N11 A;  1OKT A;  1XBS A;  3RHC A;  3UEM A;  2MMN A;  1T4Y A;  1Z6N A;  2H0H A;  2F51 A;  5DAK A;  4NHZ A;  1X0R A;  5KN3 A;  2ALB A;  1SYR A;  4TR0 A;  1OYJ A;  4JR6 A;  3W8S A;  4J2F A;  2YP6 A;  1A8L A;  3RDW A;  3TB2 A;  2IL3 A;  1O8X A;  5EVO A;  4JED A;  17GS A;  3GKN A;  3MDK A;  4IQA A;  4ULX A;  4OCF A;  5J4U A;  4JE1 A;  2VM2 A;  3HA9 A;  5IIZ A;  2I4A A;  1K0C A;  1T00 A;  5FHI A;  3N5O A;  3GFK A;  2H0G A;  2RLI A;  1GTB A;  4F82 A;  5HQP A;  1GWC A;  1S3A A;  3PIN A;  1MDJ A;  2P5Q A;  2K8V A;  1FVJ A;  2OAC A;  2E7P A;  1PA3 A;  3UL3 A;  4IKH A;  1A2J A;  3KGK A;  3EU4 A;  1UA5 A;  5J3R A;  1R26 A;  3CSI A;  1O81 A;  4NPB A;  1HNC A;  4BWS A;  2GQM A;  3A2V A;  4P3Y B;  5JWR B;  2H8L A;  5IMF A;  3UVT A;  4XHM A;  4ZB9 A;  3FR3 A;  1GUK A;  2WRT A;  5D93 A;  3D4T A;  1SL1 B;  2VIM A;  3MAK A;  1E6B A;  1CQH A;  5HR2 A;  8GSS A;  2JSZ A;  1PQN A;  4KAE A;  4HU7 A;  1M9A A;  1WRY A;  4XS4 B;  1F3A A;  3TCO A;  2YWI A;  4K9Z A;  4ZXG A;  1GUM A;  1EV4 A;  3CRU A;  1JZW A;  4AF2 A;  3IPZ A;  3GN3 A;  4YQM A;  1TP9 A;  3ZTL A;  5B8B A;  2JL4 A;  2EIO A;  5IO2 A;  3A3T A;  5CP1 A;  2LTK A;  4XRD A;  3ERW A;  2HZF A;  1N8J A;  4AJ8 A;  2HSY A;  3HZ8 A;  4IN0 A;  3W8J A;  4K7I A;  5DCH A;  2X8G A;  3CXG A;  3S9F A;  3DVX A;  4J56 E;  4TR1 B;  1YJ6 A;  4CDO A;  2ZUP A;  4KSO A;  1X9S B;  2H1G A;  1XFL A;  5IMA A;  4AJ6 A;  3KMO A;  3WGD A;  5G5E A;  3DYR A;  2HI7 A;  1XOB A;  5CRW A;  2CVK A;  3HXS A;  4KDX A;  2QC7 A;  2A2S A;  4IEL A;  4GXZ A;  2IIY A;  5DJL A;  3JCM L;  1H75 A;  5ECN B;  3AY8 A;  3DD3 A;  4PUA A;  2YV9 A;  4KUN A;  3F9U A;  4PX1 A;  1JLV A;  1XW6 A;  3M9J A;  1EGO A;  5ID2 A;  2VL9 A;  4L0U A;  4ML1 A;  2B5E A;  3DML A;  1YKC A;  4Q5R A;  5AIS A;  4IQ1 A;  1B9X C;  1TKD B;  2H75 A;  4F0B A;  2C3N A;  1PGT A;  2LS5 A;  5INY A;  1U3I A;  3KP9 A;  5IOX A;  2NDO A;  1YDK A;  4BL7 A;  2FWH A;  3P7X A;  4O5R A;  1M99 A;  2H1A A;  13GS A;  1ZYQ B;  18GS A;  4KSM A;  2L5O A;  2F8F A;  3L4N A;  4K1F A;  2GT5 A;  2VAF A;  4L5L A;  4YAP A;  1Z3E A;  1GH2 A;  3UBL A;  1J0F A;  1Q4J A;  2L6C A;  3QDN A;  4JR4 A;  3V1W A;  1THO A;  4EDY A;  4MF7 A;  3NOF A;  4Q5Q A;  2GS3 A;  2PBJ A;  3EUR A;  2V1M A;  4I2U A;  2DSA A;  1W4V A;  2L5L A;  2C3Q A;  2F3M A;  1V98 A;  5GSS A;  3QMX A;  2CAQ A;  4POL A;  3HJP A;  5CO3 A;  4ZBB A;  2VLU A;  4O32 A;  4K6X A;  2D2Z A;  1HNA A;  2EC4 A;  3GSS A;  4HJ2 A;  4MCU A;  4TXV A;  2L4Q A;  1B48 A;  4GCI A;  2P31 A;  4ZL8 A;  3L9V A;  4MF5 A;  2O7K A;  1O85 A;  2AUV A;  5IMD A;  1ZL9 A;  4LA1 A;  3ZVJ D;  1G6W A;  4NMU A;  4RI6 A;  2O87 A;  1R7H A;  2MMA A;  2FWE A;  5A4U A;  3DVW A;  3R2Q A;  4NV5 A;  1FOV A;  2HZE B;  2LNT A;  3EYT A;  3SWL A;  1OC9 A;  5ECH B;  6GSV A;  2VD1 A;  5G30 A;  1K0A A;  1V9W A;  4H86 A;  3H93 A;  3WT2 A;  2H71 A;  3DWV A;  3HVS A;  1FW1 A;  3LXT A;  2VL3 A;  1JHB A;  3MWH A;  3IK9 A;  2DIY A;  5IM9 A;  1TK5 B;  2VUP A;  4WXT A;  6GST A;  1VRS D;  2LNS A;  4F0C A;  2GT6 A;  3F4R A;  1U87 A;  5J9C A;  3KTL A;  1FG4 A;  3A2W A;  1J08 A;  3IK7 A;  3GKM A;  4K0G A;  2CVB A;  4ECI A;  2PU9 C;  1YQ1 A;  1T7P B;  4HOJ A;  3ZFB A;  2YPM A;  3KTB A;  3VPQ A;  4IHU A;  1XCC A;  4O7H A;  1BYE A;  2DIZ A;  4GLT A;  2HXK A;  1UVZ A;  5F06 A;  2WGR A;  1HD2 A;  3VUR A;  2E0Q A;  1TK0 B;  3IC4 A;  4K2D A;  1JLW A;  3QAW A;  1AXD A;  2FY6 A;  4TKY A;  4IW9 A;  2ZNM A;  2P0G A;  4Q5N A;  1ZCP A;  1GL8 A;  3IV4 A;  4XCS A;  3I9V 2;  3CTF A;  4NWY A;  4TXO A;  3GL5 A;  3L78 A;  3TJB A;  2YAN A;  2A4V A;  2B5Y A;  5ECM B;  1KNG A;  5IPG A;  1MEK A;  5IO0 A;  3O6T A;  4BVY A;  5G5F A;  1PRX A;  3UJ1 A;  3CYN A;  2X64 A;  3IRA A;  2WUL A;  4EKZ A;  4E8E A;  5B6N A;  2J23 A;  5J9B A;  2DLX A;  2M80 A;  5KN2 A;  3ZMK A;  2F8A A;  1T4Z A;  2C3T A;  4RI7 A;  5ECI B;  2EIQ A;  1O8W A;  1MD3 A;  2C0E A;  5F0G A;  5LCZ A;  4HS1 A;  1SJ6 A;  3L9S A;  1R5P A;  4G2E A;  2H72 A;  3GTU A;  2CV4 A;  3ERG A;  4V2L A;  5ECQ B;  4DVC A;  3KMN A;  1YY7 A;  1EP7 A;  1ZGN A;  2PER A;  3ED3 A;  3TKS C;  3KM6 A;  3RPN A;  5KEJ A;  3O76 A;  3C71 A;  1PKW A;  5H5R A;  5JCG A;  2BTO T;  5E4W A;  5HR3 A;  4GQC A;  2DC5 A;  3ZZX A;  2N5A A;  1ACV A;  5HFK A;  4EF0 A;  1BED A;  2V32 A;  1MDK A;  3ZL5 A;  2WFC A;  1GTA A;  2RM6 A;  5CRH A;  5ECR B;  5F05 A;  4JRR A;  2IMD A;  3BBY A;  1ZYE A;  2VCV A;  3H4K A;  3LSZ A;  4HZ2 A;  5DQY A;  2MMZ A;  3ZVJ A;  1XVW A;  2C0G A;  3G9B A;  4YQU A;  3E0U A;  1GTI A;  1PN9 A;  5HR0 A;  4N0V A;  1LJR A;  1NHO A;  3OR5 A;  2IN3 A;  3O3T A;  2H74 A;  2R3X A;  5EY6 A;  2BJX A;  1BAY A;  1QFN A;  3N9J A;  4PNF A;  2GST A;  3A5W A;  4WBJ A;  1ERW A;  3PGT A;  1JZD A;  1M0U A;  1URM A;  1OC3 A;  1Z5Y E;  3TJK A;  3EWL A;  4ML6 A;  1SK0 A;  2OKA A;  1DSB A;  5FT3 A;  1T1V A;  4KE3 A;  3HZ4 A;  19GS A;  3IAS 2;  3UBK A;  1AIU A;  4XS6 A;  1VF3 A;  2LQQ A;  2GSR A;  4MZW A;  1ERV A;  4TN8 A;  1FHE A;  1M7T A;  1XW5 A;  1Y25 A;  2PMT A;  1TI3 A;  3F6D A;  4QL9 A;  1MTC A;  2K8S A;  1SL0 B;  3GL3 A;  3VPT A;  4EDZ A;  4IP1 A;  5IMC A;  3CSH A;  3MSZ A;  4TR4 A;  4HDE A;  4D73 B;  3QAV A;  2MBT A;  4GTU A;  3HJO A;  5IOW A;  4BVX A;  1F37 A;  2PVO C;  1GUH A;  3U5R E;  4DSS B;  3GIX A;  3H8Q A;  4L5O A;  5DQS A;  2H66 A;  1YZX A;  2FWG A;  4KW6 A;  3WGE A;  2H6Z A;  5ECS A;  3VWU A;  3GNJ A;  3LJR A;  2LST A;  4FIW A;  4QL7 A;  1IYH A;  3FEU A;  3QCP A;  3VI5 A;  3RBT A;  3TKR A;  1GLQ A;  2REM A;  3ZFL A;  2HT9 A;  3IOS A;  1SKS B;  5ABR A;  5CNW A;  4DEJ A;  3DGQ A;  2FWF A;  3FK8 A;  3Q18 A;  4KGI A;  2GZZ A;  4BPY A;  5DBQ A;  2H6X A;  4OD7 A;  3QPM A;  1T3B A;  4ISD A;  4PXO A;  1EV9 A; 
#chains in the Genus database with same CATH topology
 1Q98 A;  1VF4 A;  1ILO A;  4V2N A;  2VOC A;  4HQZ A;  4ACS A;  2IFQ B;  3UVH A;  3WGX A;  3WT1 A;  3Q19 A;  1X9W B;  2RUE A;  3G7Y A;  1TU8 A;  4TR3 A;  1OC8 A;  2K18 A;  4OFM A;  4EO3 A;  2L59 A;  2YZU A;  1TW9 A;  2NBS A;  2C4J A;  2VM1 A;  2HFD A;  4TRX A;  1SL2 B;  2GLR A;  1TU7 A;  3FW2 A;  3TJF A;  4FYB A;  1A24 A;  4ZL9 A;  3VLN A;  3FHK A;  4POK A;  2H30 A;  2KHP A;  2RUF A;  2C8U A;  4HJM A;  1XWA A;  5G2Z A;  3BJ5 A;  1I9D A;  3IR4 A;  4OFN A;  2FA4 A;  1XOA A;  2YN1 A;  3PR8 A;  4MAB A;  3F3R A;  1LU4 A;  3I43 A;  2PUK C;  5D9V A;  4ECC A;  2M72 A;  20GS A;  3HKR A;  1S3R A;  2H70 A;  4FYU A;  10GS A;  3CSJ A;  3IA1 A;  2MZC A;  1XWC A;  2V2G A;  3ZIV A;  4PTS A;  5DAK B;  1TJD A;  2DMM A;  5DAL A;  4XIH A;  3UMA A;  2CZ3 A;  4X1U A;  3LOR A;  1S3C A;  1GSQ A;  1O7U A;  1AQV A;  1BQ7 A;  2IMK A;  2WDU A;  3F4S A;  1PKZ A;  5C00 A;  3E3E A;  4GSN A;  3APO A;  14GS A;  2NTO A;  1AQX A;  1PMT A;  1GUL A;  3BOA A;  5C04 A;  1SU9 A;  1M2D A;  1SEN A;  9GSS A;  1FVK A;  1OAZ A;  4K7N A;  2I1U A;  3QAG A;  1AQW A;  3BCK A;  3QOU A;  4I97 A;  3GX8 A;  1J9B A;  4OO4 A;  4PQ1 A;  3EPT A;  3GMF A;  2I9H A;  2JAD A;  1GSD A;  2QA1 A;  1U6T A;  2IMF A;  4I8B A;  4MZC A;  2YWN A;  3D6I A;  1ZZY A;  4V1A p;  1AAZ A;  1SJI A;  3TGZ A;  4KX4 A;  2R37 A;  3TOT A;  2JZS A;  2DJ0 A;  2TIR A;  3LW9 A;  5D9W A;  3GKX A;  2OE1 A;  5G1L A;  2CX4 A;  4OO5 A;  5D9X A;  4ZBA A;  1ZOF A;  2CA8 A;  3KZQ A;  2N5B A;  1B4P A;  3CQF A;  3HCZ A;  1IYI A;  3G7J A;  2DKH A;  3IAM 2;  2JZR A;  4GRF A;  1V58 A;  2GTU A;  3EMX A;  4LL1 B;  5HR1 A;  4HUA A;  5CYY A;  1CQG A;  2YWO A;  4PUR A;  3UOM A;  2WZ9 A;  2R2J A;  1PL2 A;  2B7K A;  2CX3 A;  1TK8 B;  1UN2 A;  1FAA A;  1GRX A;  1MDI A;  5E59 A;  2WB9 A;  2R5G A;  5H5S A;  4XRA A;  2ON7 A;  1UC7 A;  2V41 A;  3GHA A;  3GH9 A;  1AC1 A;  1QQ2 A;  5JCW A;  1G6Y A;  1SYX A;  4GF0 A;  1NSW A;  3J7Y b;  4V1A g;  3DEX A;  1A0F A;  3MNG A;  1O6J A;  3UIW A;  2YV7 A;  2QSI A;  4AGS A;  5BRT A;  2V6K A;  1Y6E A;  3TJG A;  4HSC X;  4EIP A;  1TRV A;  5GAN D;  3FZA A;  1TOF A;  3CTG A;  1GSU A;  4ZB8 A;  1XWG A;  4WF5 A;  1SKR B;  1WJK A;  4MPG A;  2YOI A;  2JSY A;  1AW9 A;  2HRN A;  4ILF A;  5ELA A;  3FYG A;  1VGL A;  4MF6 A;  3C8E A;  2A2R A;  5LD0 A;  2WS2 A;  4MK3 A;  3PPU A;  4PGT A;  5B7C A;  5ID2 B;  3GST A;  4K0N A;  3TRQ A;  1FB6 A;  1Z7R A;  4GSS A;  1G0T A;  1XVQ A;  2WJU A;  1WPI A;  5J5N A;  4GST A;  1ABA A;  1NHY A;  16GS A;  3M0F A;  4WET A;  1K0O A;  3CRT A;  3EC3 A;  1X9M B;  3DIE A;  2LUS A;  4O92 A;  2H01 A;  1YEP A;  2H76 A;  1VF1 A;  2AV4 A;  4Q5F A;  4F9Z A;  5IPH A;  3I6A A;  3UAR A;  3M1G A;  1H4O A;  2LRT A;  4OCE A;  2VCX A;  4TVE A;  1WP0 A;  2GQL A;  4KDU A;  3J7Y k;  3HHV A;  5A4V A;  1G7O A;  5G31 A;  1WIK A;  4OFT A;  2AYT A;  4POB A;  5A5K A;  2LKU A;  4HEA 2;  4WKW A;  5J41 A;  2HYX A;  2GZP A;  4FYC A;  2LJK A;  1A8Y A;  1R4W A;  1ON4 A;  2XC2 A;  4MDC A;  1KEB A;  2FLS A;  3WYW A;  1QMV A;  1SKW B;  2B3S A;  1JZO A;  3LWA A;  3KXO A;  3IBH A;  5ELG A;  1TXX A;  1U88 A;  1EOG A;  2VL2 A;  4IVF A;  1RK4 A;  3ZRE A;  2E2M A;  1FB0 A;  3CMI A;  4MH3 A;  1M3J A;  1RQM A;  5JWO B;  3KIJ A;  4L8E A;  1QUW A;  4MZB A;  4HQS A;  1M9B A;  1EP8 A;  1A0R P;  3VWX A;  2H1B A;  1KTE A;  4MJC A;  2FGX A;  1K3O A;  2PN8 A;  5DDL A;  4ZBD A;  1V57 A;  1OC9 B;  3VK9 A;  4YAV A;  4AJ7 A;  4XS4 A;  1HNB A;  5ECP B;  4I6X A;  3WD6 A;  5KN0 A;  4DSR A;  4MJE A;  1OKD A;  3KCM A;  3QR6 A;  3GH6 A;  3GV1 A;  2VCQ A;  1WWJ A;  2XPD A;  1K0M A;  4IJI A;  2VCT A;  2OE0 A;  3RPP A;  3F63 A;  1C72 A;  2EIR A;  1A23 A;  2VD0 A;  4WEY A;  3GX0 A;  4E8H A;  3RHB A;  5D9T A;  3TDG A;  3D5J A;  3LFL A;  1NW2 A;  4BA7 A;  3H79 A;  1PD2 1;  3VWV A;  3M9K A;  1BG5 A;  2FCH A;  3HD5 A;  1THX A;  3APS A;  2X8C A;  1DBY A;  2DJ2 A;  3KP8 A;  4PQI A;  4MPF A;  4PQH A;  2FA8 A;  5B6M A;  5D8I A;  4CY8 A;  4RQX A;  5EPF A;  2FHE A;  5HFI A;  2PPT A;  1K0D A;  3ME7 A;  1SD8 A;  1SJZ A;  3FZ4 A;  1N2A A;  3CBU A;  5KOX A;  3IHG A;  4TXO B;  1MD4 A;  2H19 A;  3Q74 A;  1EEJ A;  2DJK A;  3D4M A;  4HI7 A;  2H1D A;  2VLV A;  2CVD A;  3QD9 A;  2G0F A;  4BVY B;  2RM5 A;  2YJ7 A;  2VCW A;  2C1Y A;  3GKK A;  3HVX A;  3TUE A;  3HDC A;  2FUG 2;  4WR5 A;  2L4C A;  3LGC A;  4ZIJ A;  3GYK A;  1V40 A;  1GNW A;  1F9M A;  3ERF A;  2KLX A;  1O73 A;  1XW9 A;  4O5Q A;  4KH7 A;  2YZH A;  1F2E A;  2TRC P;  1PX6 A;  2A4H A;  3F3Q A;  3LG6 A;  5D73 A;  1ST9 A;  3FRC A;  4GQF A;  2GQK A;  4FQU A;  3M8N A;  2DML A;  2O89 A;  1A2L A;  3TKQ A;  3P90 A;  3GTU B;  3A2X A;  4NV2 A;  2XPE A;  2YWM A;  3F0I A;  3GRX A;  3U6V A;  2I3Y A;  3IHQ A;  4IS0 A;  4MJA A;  1ZMA A;  2BMX A;  5CRD A;  1T8E B;  2HRK A;  3ZRD A;  3D0Z A;  3KH9 A;  1K0N A;  2NVL A;  4L0W A;  1GTU A;  1A2M A;  6GSX A;  3C1R A;  1TRW A;  2O8V B;  5ECL B;  5HFG A;  1GSF A;  3I69 A;  1V2A A;  4LMV A;  4TOP A;  3APQ A;  4WR4 A;  4EIQ A;  1R5A A;  2ZCT A;  1PX7 A;  3GUS A;  1W89 A;  5L71 A;  1GLP A;  5GST A;  1SK2 A;  2MBS A;  2O85 A;  3EMP A;  1GP1 A;  4POM A;  2CZ2 A;  4K5S A;  5GZZ B;  2IME A;  2PGT A;  4N10 A;  2LEG A;  2HZE A;  3DKS A;  2H6Y A;  1YF0 A;  3F6F A;  2WCI A;  1YKA A;  4YH2 A;  4EVM A;  4EL1 A;  1Z6M A;  4K5R A;  5DVB A;  2V6O A;  1BX9 A;  1K3Y A;  4JU5 A;  4RQR A;  1I5G A;  2HRA A;  1X5D A;  5ECO B;  1HYU A;  1B8X A;  3DRN A;  3BD2 A;  4K8M A;  2LRC A;  5G1K A;  4QQ7 A;  2QA2 A;  3MIX A;  4G19 A;  3TKS E;  1GSS A;  5JWQ B;  3L0H A;  3FKF A;  4BIK A;  1EEM A;  4IBP A;  4ZIL A;  2HNL A;  3QFA C;  5GAP D;  2LV3 A;  2IWT A;  4MA9 A;  4BVX B;  2F9S A;  2K6V A;  1U3A A;  4Z2T A;  1EGR A;  5IQY A;  1XXU A;  3D21 A;  3BCI A;  2VCZ A;  3KJY A;  2ES7 A;  1QGV A;  4LMW A;  2KP2 A;  2JAC A;  22GS A;  2HRF A;  2DBC A;  2K9F A;  4Z2R A;  2HE3 A;  1PSQ A;  1XPV A;  5KN1 A;  1EZK A;  3VFI A;  2AAW A;  5B8A A;  1ML6 A;  3FZ9 A;  3HJM A;  4JBB A;  4IP6 A;  2GGT A;  2OJL A;  3C73 A;  3KEB A;  2OA7 A;  1JZR A;  2LJA A;  2DJJ A;  3LQ7 A;  1VF2 A;  4HU9 A;  1TRS A;  2R0P A;  4LLR A;  4OMV A;  3P8W A;  2YJH A;  1USB A;  2LJR A;  4KB3 A;  4PUF C;  2YCD A;  4Z7X A;  2N5F A;  2B6M A;  5EL8 A;  3A5I A;  3R3E A;  4ID0 A;  3UAP A;  4G10 A;  5H5Q A;  2FD3 A;  1OE7 A;  2PWJ A;  3TRP A;  5DCG A;  5IMZ A;  5DJM A;  1K3L A;  3LYP A;  3C1S A;  2XHF A;  3FY7 A;  4PNG A;  3TOU A;  2OBI A;  1AUC A;  2JZT A;  3C7M A;  2OBK A;  2H73 A;  2C0D A;  2GSQ A;  4NXI A;  6GSS A;  2AJQ B;  2B1L A;  5D96 A;  4N0Z A;  1TRU A;  3LXZ A;  3PH9 A;  4FH8 A;  3FR9 A;  3US3 A;  5ENU A;  1F6M C;  2HSH A;  2C0F A;  5A4W A;  2IMI A;  4OWY A;  1EOH A;  4FO5 A;  1OE8 A;  4IJ3 A;  1M2A A;  2MYG A;  4I2T A;  1QXH A;  2X8H A;  11GS A;  1G7E A;  3D22 A;  3LYK A;  3EU3 A;  2GZY A;  2KP1 A;  3IDV A;  3Q6O A;  4X43 A;  5F07 A;  4MLY A;  1XWB A;  2CAI A;  5COH A;  2H0I A;  4JZQ A;  4MH2 A;  2OE3 A;  1XIY A;  2G2Q A;  1QK8 A;  1XWK A;  1ZYN A;  2X49 A;  4V2M A;  2R6K A;  1GSY A;  3QFB C;  5DAL B;  3ZIT A;  1EWX A;  1M2B A;  2DJ1 A;  2GDR A;  2J9H A;  5AIV A;  3VWW A;  1PL1 A;  3KH7 A;  3M3M A;  3FZ5 A;  3IXR A;  1YF1 A;  4YQV A;  3HYP A;  1B4Q A;  4KND A;  1KBN A;  4KCA A;  4RUV A;  4MJB A;  3NIV A;  3K8N A;  1JFU A;  2LQO A;  4MP4 A;  4F2I A;  1DE1 A;  2RII A;  3ZIJ A;  2C80 A;  2TRX A;  1M3I A;  2P5R A;  1WE0 A;  2IJY A;  2L6D A;  5F8B A;  4MMM A;  5AGY A;  5LNK e;  6GSU A;  2XBI A;  1GNE A;  2LRN A;  1FO5 A;  2B1K A;  6GSW A;  1YEX A;  5AN1 A;  1BJX A;  2IPA A;  4KF9 A;  3GUR A;  3HY2 A;  3H1N A;  2OAD A;  4HZ4 A;  3F4T A;  1OVN A;  3HVV A;  4TW5 A;  1WOU A;  2KOK A;  2QKE A;  5AIX A;  5FWG A;  2ON5 A;  2HLS A;  3LEF A;  1S3D A;  1E2Y A;  1X5E A;  2VL2 C;  3ZML A;  2CQ9 A;  4D73 A;  2JU5 A;  2CT6 A;  1GSE A;  3VI7 A;  1RW1 A;  2B7J A;  3F8U A;  3W6G A;  4EE0 A;  3SBC A;  3EVI A;  5CRG A;  2FNO A;  2M46 A;  2NPB A;  4DSS A;  5IMV A;  4J57 E;  4IGJ A;  2AB6 A;  3IC8 A;  3GA4 A;  1X5C A;  4G9H A;  4ZB6 A;  2MMO A;  2PVQ A;  1DE2 A;  2GSS A;  2XBQ A;  4A5P A;  2VLT A;  4G0I A;  1K0B A;  3NZN A;  1SD9 A;  3IE3 A;  1F3B A;  3TRX A;  5JCU A;  2AHE A;  4EUY A;  3ZYW A;  4ZL7 A;  2L57 A;  2I81 A;  4K7O A;  2VO4 A;  1SK1 A;  1TDI A;  3ME8 A;  1DUG A;  2E2G A;  1LBK A;  4XS1 A;  1TTZ A;  4CHS A;  4I5Q A;  3ZLP A;  4KCE A;  4KA0 A;  3KD0 A;  2YNX A;  1Z9H A;  4WF4 A;  2IFQ A;  1NM3 A;  12GS A;  4BWQ A;  2R0G A;  4DSQ A;  1HQO A;  5ECK B;  4CW9 A;  7GSS A;  3E9J B;  2B5X A;  1WMJ A;  4X0X A;  4WBR D;  4EC0 A;  3TJJ A;  4O5U A;  2Z9S A;  3ISO A;  1ERT A;  3DXB A;  1TI1 A;  4ECJ A;  2R4V A;  3EIN A;  4LL4 B;  6GSY A;  3L9U A;  1Z7P A;  2GVP A;  4EXJ A;  3G7I A;  4ECB A;  2QGV A;  3TKP A;  1B9Y C;  2DJ3 A;  4NHW A;  5CAX A;  2KUC A;  3P2A A;  1XZO A;  3EE2 A;  4NAX A;  2X99 A;  4TR1 A;  4XTS A;  4F03 A;  4N30 A;  3FR6 A;  4KDY A;  3TKS A;  4GWR A;  5CRE A;  1ERU A;  3RAZ A;  4N11 A;  1OKT A;  1XBS A;  3RHC A;  3UEM A;  2MMN A;  1T4Y A;  1Z6N A;  2H0H A;  2F51 A;  5DAK A;  5KOW A;  4NHZ A;  1X0R A;  5KN3 A;  2ALB A;  1SYR A;  4TR0 A;  1OYJ A;  4JR6 A;  3W8S A;  4J2F A;  2YP6 A;  1A8L A;  3RDW A;  3TB2 A;  2IL3 A;  2HSM A;  1O8X A;  5EVO A;  4JED A;  17GS A;  3GKN A;  3MDK A;  4IQA A;  4ULX A;  4OCF A;  5J4U A;  4JE1 A;  2VM2 A;  3HA9 A;  5IIZ A;  2I4A A;  1K0C A;  4MNN A;  1T00 A;  5FHI A;  3N5O A;  3GFK A;  2H0G A;  2RLI A;  1GTB A;  4F82 A;  5HQP A;  1GWC A;  1S3A A;  3PIN A;  1MDJ A;  2P5Q A;  2K8V A;  1FVJ A;  2OAC A;  2E7P A;  1PA3 A;  3UL3 A;  4IKH A;  1A2J A;  3KGK A;  3EU4 A;  1UA5 A;  5J3R A;  1R26 A;  3CSI A;  1O81 A;  4NPB A;  1HNC A;  4BWS A;  2GQM A;  3A2V A;  4P3Y B;  5JWR B;  2H8L A;  5IMF A;  3UVT A;  4XHM A;  4ZB9 A;  3FR3 A;  1GUK A;  2WRT A;  5D93 A;  3D4T A;  1SL1 B;  2VIM A;  3MAK A;  1E6B A;  1CQH A;  5HR2 A;  8GSS A;  2JSZ A;  1PQN A;  4KAE A;  4HU7 A;  1M9A A;  1WRY A;  4XS4 B;  1F3A A;  3TCO A;  2YWI A;  4K9Z A;  4ZXG A;  2DKI A;  1GUM A;  1EV4 A;  3CRU A;  1JZW A;  4AF2 A;  3IPZ A;  3GN3 A;  4YQM A;  1TP9 A;  3ZTL A;  5B8B A;  2JL4 A;  2EIO A;  5IO2 A;  3A3T A;  5CP1 A;  2LTK A;  4XRD A;  3ERW A;  4YKF A;  2X4A A;  2HZF A;  1N8J A;  4AJ8 A;  2HSY A;  3HZ8 A;  4IN0 A;  3W8J A;  4K7I A;  5DCH A;  2X8G A;  3CXG A;  3HVN A;  3S9F A;  3DVX A;  4J56 E;  4TR1 B;  1YJ6 A;  4CDO A;  2ZUP A;  4KSO A;  1X9S B;  2H1G A;  1XFL A;  5IMA A;  4AJ6 A;  3KMO A;  3WGD A;  5G5E A;  3DYR A;  2HI7 A;  1XOB A;  5CRW A;  2CVK A;  2UZ8 A;  3HXS A;  4KDX A;  2QC7 A;  2A2S A;  4IEL A;  4GXZ A;  2IIY A;  5DJL A;  3JCM L;  1H75 A;  5ECN B;  3AY8 A;  3DD3 A;  4PUA A;  2YV9 A;  4KUN A;  3F9U A;  4PX1 A;  1JLV A;  1XW6 A;  3M9J A;  1EGO A;  5ID2 A;  2VL9 A;  4L0U A;  4ML1 A;  2B5E A;  3DML A;  1YKC A;  4Q5R A;  5AIS A;  4IQ1 A;  1B9X C;  1TKD B;  2H75 A;  4F0B A;  2C3N A;  1PFO A;  1PGT A;  2LS5 A;  5INY A;  1U3I A;  3KP9 A;  5IOX A;  2NDO A;  1YDK A;  4BL7 A;  2FWH A;  3P7X A;  4O5R A;  1M99 A;  2H1A A;  13GS A;  1ZYQ B;  18GS A;  4KSM A;  2L5O A;  2F8F A;  3L4N A;  4K1F A;  2GT5 A;  2VAF A;  4CY6 A;  4L5L A;  4YAP A;  1Z3E A;  1GH2 A;  3UBL A;  1J0F A;  1Q4J A;  2L6C A;  3QDN A;  4JR4 A;  3V1W A;  1THO A;  2A2P A;  4EDY A;  4MF7 A;  3NOF A;  4Z2U A;  4Q5Q A;  2GS3 A;  2PBJ A;  3EUR A;  1FOH A;  2V1M A;  4I2U A;  2DSA A;  1W4V A;  2L5L A;  2C3Q A;  2F3M A;  1V98 A;  5GSS A;  3QMX A;  2CAQ A;  4POL A;  3HJP A;  5CO3 A;  4ZBB A;  2VLU A;  4O32 A;  4K6X A;  2D2Z A;  1HNA A;  2EC4 A;  3GSS A;  4HJ2 A;  4MCU A;  4TXV A;  2L4Q A;  1B48 A;  4GCI A;  2P31 A;  4ZL8 A;  3L9V A;  4MF5 A;  2O7K A;  1O85 A;  2AUV A;  5IMD A;  1ZL9 A;  4LA1 A;  3ZVJ D;  1G6W A;  4NMU A;  4RI6 A;  2O87 A;  1R7H A;  2MMA A;  2FWE A;  5A4U A;  3DVW A;  3R2Q A;  4NV5 A;  1FOV A;  2HZE B;  2LNT A;  3EYT A;  3SWL A;  4K2X A;  1OC9 A;  5ECH B;  6GSV A;  2VD1 A;  5G30 A;  1K0A A;  1V9W A;  4H86 A;  3H93 A;  3WT2 A;  2H71 A;  3DWV A;  3HVS A;  1FW1 A;  3LXT A;  2VL3 A;  1JHB A;  3MWH A;  3IK9 A;  2DIY A;  5IM9 A;  1TK5 B;  2VUP A;  4WXT A;  6GST A;  1VRS D;  2LNS A;  4F0C A;  2GT6 A;  3F4R A;  1U87 A;  5J9C A;  4ICY A;  3KTL A;  1FG4 A;  3A2W A;  4USS A;  1J08 A;  3IK7 A;  1PN0 A;  3GKM A;  4K0G A;  2CVB A;  4ECI A;  2PU9 C;  1YQ1 A;  1T7P B;  4HOJ A;  3ZFB A;  2YPM A;  3KTB A;  3VPQ A;  4IHU A;  1XCC A;  4O7H A;  1BYE A;  2DIZ A;  4GLT A;  2HXK A;  1UVZ A;  5F06 A;  2WGR A;  4BL7 B;  1HD2 A;  3VUR A;  2E0Q A;  1TK0 B;  3IC4 A;  4K2D A;  1JLW A;  3QAW A;  1AXD A;  2FY6 A;  4TKY A;  4IW9 A;  2ZNM A;  2P0G A;  4Q5N A;  1ZCP A;  1GL8 A;  3IV4 A;  4XCS A;  3I9V 2;  3CTF A;  4NWY A;  4TXO A;  3GL5 A;  3L78 A;  3TJB A;  2YAN A;  2A4V A;  2B5Y A;  5ECM B;  1KNG A;  5IPG A;  1MEK A;  5IO0 A;  3O6T A;  4BVY A;  5G5F A;  1PRX A;  3UJ1 A;  3CYN A;  2X64 A;  1ZYP A;  3IRA A;  2WUL A;  4EKZ A;  4E8E A;  5B6N A;  2J23 A;  5J9B A;  2DLX A;  2M80 A;  5KN2 A;  3ZMK A;  2F8A A;  1T4Z A;  2C3T A;  4RI7 A;  5ECI B;  2EIQ A;  1O8W A;  1MD3 A;  2C0E A;  5F0G A;  5LCZ A;  4HS1 A;  1SJ6 A;  3L9S A;  1R5P A;  4G2E A;  2H72 A;  3GTU A;  2CV4 A;  3ERG A;  4V2L A;  5ECQ B;  4DVC A;  3KMN A;  1YY7 A;  1EP7 A;  1ZGN A;  2PER A;  3ED3 A;  3TKS C;  3KM6 A;  3RPN A;  5KEJ A;  3O76 A;  3C71 A;  1PKW A;  5H5R A;  5JCG A;  2BTO T;  5E4W A;  5HR3 A;  4GQC A;  2DC5 A;  3ZZX A;  2N5A A;  1ACV A;  5HFK A;  4EF0 A;  1BED A;  2V32 A;  1MDK A;  3ZL5 A;  2WFC A;  1GTA A;  2RM6 A;  5CRH A;  5ECR B;  5F05 A;  4JRR A;  2IMD A;  3BBY A;  1ZYE A;  2VCV A;  3H4K A;  3LSZ A;  4HZ2 A;  5DQY A;  2MMZ A;  4G0K A;  3ZVJ A;  1XVW A;  2C0G A;  3G9B A;  4YQU A;  3E0U A;  1GTI A;  1PN9 A;  5HR0 A;  4N0V A;  1LJR A;  1NHO A;  3OR5 A;  2IN3 A;  3O3T A;  2H74 A;  2R3X A;  5EY6 A;  2BJX A;  1BAY A;  1QFN A;  3N9J A;  4PNF A;  2GST A;  3A5W A;  4WBJ A;  1ERW A;  3PGT A;  1JZD A;  1M0U A;  1URM A;  1OC3 A;  1Z5Y E;  3TJK A;  3EWL A;  4ML6 A;  1SK0 A;  2OKA A;  1DSB A;  5FT3 A;  1T1V A;  4KE3 A;  3HZ4 A;  19GS A;  3IAS 2;  3UBK A;  1AIU A;  4XS6 A;  1VF3 A;  2LQQ A;  2GSR A;  3MYD A;  4MZW A;  1ERV A;  4TN8 A;  1FHE A;  1M7T A;  1XW5 A;  1Y25 A;  2PMT A;  1TI3 A;  3F6D A;  4QL9 A;  5BMU A;  1MTC A;  2K8S A;  1SL0 B;  3GL3 A;  3VPT A;  4EDZ A;  4IP1 A;  5IMC A;  3CSH A;  3MSZ A;  4TR4 A;  4HDE A;  4D73 B;  3QAV A;  2MBT A;  4GTU A;  3HJO A;  5IOW A;  4BVX A;  1F37 A;  2PVO C;  1GUH A;  3U5R E;  4DSS B;  3GIX A;  3H8Q A;  4L5O A;  5DQS A;  2H66 A;  1YZX A;  2FWG A;  4G0L A;  4KW6 A;  3WGE A;  2H6Z A;  5ECS A;  3VWU A;  3GNJ A;  3LJR A;  2LST A;  4FIW A;  4QL7 A;  1IYH A;  3FEU A;  3QCP A;  3VI5 A;  3RBT A;  3TKR A;  1GLQ A;  2REM A;  3ZFL A;  2HT9 A;  1XG8 A;  3IOS A;  1SKS B;  5ABR A;  5CNW A;  2R0C A;  4DEJ A;  3DGQ A;  4YKG A;  2FWF A;  3FK8 A;  4X4J A;  3Q18 A;  4KGI A;  2GZZ A;  4BPY A;  5DBQ A;  2H6X A;  4OD7 A;  3QPM A;  1T3B A;  4ISD A;  4PXO A;  3FMW A;  1EV9 A; 
#chains in the Genus database with same CATH homology
 1Q98 A;  1VF4 A;  1ILO A;  4V2N A;  2VOC A;  4HQZ A;  4ACS A;  2IFQ B;  3UVH A;  3WGX A;  3WT1 A;  3Q19 A;  1X9W B;  2RUE A;  3G7Y A;  1TU8 A;  4TR3 A;  1OC8 A;  2K18 A;  4OFM A;  4EO3 A;  2L59 A;  2YZU A;  1TW9 A;  2NBS A;  2C4J A;  2VM1 A;  2HFD A;  4TRX A;  1SL2 B;  2GLR A;  1TU7 A;  3FW2 A;  3TJF A;  4FYB A;  1A24 A;  4ZL9 A;  3VLN A;  3FHK A;  4POK A;  2H30 A;  2KHP A;  2RUF A;  2C8U A;  4HJM A;  1XWA A;  5G2Z A;  3BJ5 A;  1I9D A;  3IR4 A;  4OFN A;  2FA4 A;  1XOA A;  2YN1 A;  3PR8 A;  4MAB A;  3F3R A;  1LU4 A;  3I43 A;  2PUK C;  5D9V A;  4ECC A;  2M72 A;  20GS A;  3HKR A;  2H70 A;  4FYU A;  10GS A;  3CSJ A;  3IA1 A;  2MZC A;  1XWC A;  2V2G A;  3ZIV A;  4PTS A;  5DAK B;  1TJD A;  2DMM A;  5DAL A;  4XIH A;  3UMA A;  2CZ3 A;  4X1U A;  3LOR A;  1S3C A;  1GSQ A;  1O7U A;  1AQV A;  1BQ7 A;  2IMK A;  2WDU A;  3F4S A;  1PKZ A;  5C00 A;  3E3E A;  4GSN A;  3APO A;  14GS A;  2NTO A;  1AQX A;  1PMT A;  1GUL A;  3BOA A;  5C04 A;  1SU9 A;  1M2D A;  1SEN A;  9GSS A;  1FVK A;  1OAZ A;  4K7N A;  2I1U A;  3QAG A;  1AQW A;  3BCK A;  3QOU A;  4I97 A;  3GX8 A;  1J9B A;  4OO4 A;  4PQ1 A;  3EPT A;  3GMF A;  2I9H A;  2JAD A;  1GSD A;  2QA1 A;  1U6T A;  2IMF A;  4I8B A;  4MZC A;  2YWN A;  3D6I A;  1ZZY A;  4V1A p;  1AAZ A;  1SJI A;  3TGZ A;  4KX4 A;  2R37 A;  3TOT A;  2JZS A;  2DJ0 A;  2TIR A;  3LW9 A;  5D9W A;  3GKX A;  2OE1 A;  5G1L A;  2CX4 A;  4OO5 A;  5D9X A;  4ZBA A;  1ZOF A;  2CA8 A;  3KZQ A;  2N5B A;  1B4P A;  3HCZ A;  1IYI A;  3G7J A;  2DKH A;  3IAM 2;  2JZR A;  4GRF A;  1V58 A;  2GTU A;  3EMX A;  4LL1 B;  5HR1 A;  4HUA A;  5CYY A;  1CQG A;  2YWO A;  4PUR A;  3UOM A;  2WZ9 A;  2R2J A;  1PL2 A;  2B7K A;  2CX3 A;  1TK8 B;  1UN2 A;  1FAA A;  1GRX A;  1MDI A;  5E59 A;  2WB9 A;  2R5G A;  5H5S A;  4XRA A;  2ON7 A;  1UC7 A;  2V41 A;  3GHA A;  3GH9 A;  1AC1 A;  1QQ2 A;  5JCW A;  1G6Y A;  1SYX A;  4GF0 A;  1NSW A;  3J7Y b;  4V1A g;  3DEX A;  1A0F A;  3MNG A;  1O6J A;  3UIW A;  2YV7 A;  2QSI A;  4AGS A;  5BRT A;  2V6K A;  1Y6E A;  3TJG A;  4EIP A;  1TRV A;  5GAN D;  3FZA A;  1TOF A;  3CTG A;  1GSU A;  4ZB8 A;  1XWG A;  4WF5 A;  1SKR B;  1WJK A;  4MPG A;  2YOI A;  2JSY A;  1AW9 A;  2HRN A;  4ILF A;  5ELA A;  3FYG A;  1VGL A;  4MF6 A;  3C8E A;  2A2R A;  5LD0 A;  2WS2 A;  4MK3 A;  3PPU A;  4PGT A;  5B7C A;  5ID2 B;  3GST A;  4K0N A;  3TRQ A;  1FB6 A;  1Z7R A;  4GSS A;  1G0T A;  1XVQ A;  2WJU A;  1WPI A;  5J5N A;  4GST A;  1ABA A;  1NHY A;  16GS A;  3M0F A;  4WET A;  1K0O A;  3CRT A;  3EC3 A;  1X9M B;  3DIE A;  2LUS A;  4O92 A;  2H01 A;  1YEP A;  2H76 A;  1VF1 A;  2AV4 A;  4Q5F A;  4F9Z A;  5IPH A;  3I6A A;  3UAR A;  3M1G A;  1H4O A;  2LRT A;  4OCE A;  2VCX A;  4TVE A;  1WP0 A;  2GQL A;  4KDU A;  3J7Y k;  3HHV A;  5A4V A;  1G7O A;  5G31 A;  1WIK A;  4OFT A;  2AYT A;  4POB A;  5A5K A;  2LKU A;  4HEA 2;  4WKW A;  5J41 A;  2HYX A;  2GZP A;  4FYC A;  2LJK A;  1A8Y A;  1R4W A;  1ON4 A;  2XC2 A;  4MDC A;  1KEB A;  2FLS A;  3WYW A;  1QMV A;  1SKW B;  2B3S A;  1JZO A;  3LWA A;  3KXO A;  3IBH A;  5ELG A;  1TXX A;  1U88 A;  1EOG A;  2VL2 A;  4IVF A;  1RK4 A;  3ZRE A;  2E2M A;  1FB0 A;  3CMI A;  4MH3 A;  1RQM A;  5JWO B;  3KIJ A;  4L8E A;  1QUW A;  4MZB A;  4HQS A;  1M9B A;  1EP8 A;  1A0R P;  3VWX A;  2H1B A;  1KTE A;  4MJC A;  2FGX A;  1K3O A;  2PN8 A;  5DDL A;  4ZBD A;  1V57 A;  1OC9 B;  3VK9 A;  4YAV A;  4AJ7 A;  4XS4 A;  1HNB A;  5ECP B;  4I6X A;  3WD6 A;  5KN0 A;  4DSR A;  4MJE A;  1OKD A;  3KCM A;  3QR6 A;  3GH6 A;  3GV1 A;  2VCQ A;  1WWJ A;  2XPD A;  1K0M A;  4IJI A;  2VCT A;  2OE0 A;  3RPP A;  3F63 A;  1C72 A;  2EIR A;  1A23 A;  2VD0 A;  4WEY A;  3GX0 A;  4E8H A;  3RHB A;  5D9T A;  3TDG A;  3D5J A;  3LFL A;  1NW2 A;  4BA7 A;  3H79 A;  1PD2 1;  3VWV A;  3M9K A;  1BG5 A;  2FCH A;  3HD5 A;  1THX A;  3APS A;  2X8C A;  1DBY A;  2DJ2 A;  3KP8 A;  4PQI A;  4MPF A;  4PQH A;  2FA8 A;  5B6M A;  5D8I A;  4CY8 A;  4RQX A;  5EPF A;  2FHE A;  5HFI A;  2PPT A;  1K0D A;  3ME7 A;  1SD8 A;  1SJZ A;  3FZ4 A;  1N2A A;  3CBU A;  5KOX A;  3IHG A;  4TXO B;  1MD4 A;  2H19 A;  3Q74 A;  1EEJ A;  2DJK A;  3D4M A;  4HI7 A;  2H1D A;  2VLV A;  2CVD A;  3QD9 A;  2G0F A;  4BVY B;  2RM5 A;  2YJ7 A;  2VCW A;  2C1Y A;  3GKK A;  3HVX A;  3TUE A;  3HDC A;  2FUG 2;  4WR5 A;  2L4C A;  3LGC A;  4ZIJ A;  3GYK A;  1V40 A;  1GNW A;  1F9M A;  3ERF A;  2KLX A;  1O73 A;  1XW9 A;  4O5Q A;  4KH7 A;  2YZH A;  1F2E A;  2TRC P;  1PX6 A;  2A4H A;  3F3Q A;  3LG6 A;  5D73 A;  1ST9 A;  3FRC A;  4GQF A;  2GQK A;  4FQU A;  3M8N A;  2DML A;  2O89 A;  1A2L A;  3TKQ A;  3P90 A;  3GTU B;  3A2X A;  4NV2 A;  2XPE A;  2YWM A;  3F0I A;  3GRX A;  3U6V A;  2I3Y A;  3IHQ A;  4IS0 A;  4MJA A;  1ZMA A;  2BMX A;  5CRD A;  1T8E B;  2HRK A;  3ZRD A;  3D0Z A;  3KH9 A;  1K0N A;  2NVL A;  4L0W A;  1GTU A;  1A2M A;  6GSX A;  3C1R A;  1TRW A;  2O8V B;  5ECL B;  5HFG A;  1GSF A;  3I69 A;  1V2A A;  4LMV A;  4TOP A;  3APQ A;  4WR4 A;  4EIQ A;  1R5A A;  2ZCT A;  1PX7 A;  3GUS A;  1W89 A;  5L71 A;  1GLP A;  5GST A;  1SK2 A;  2MBS A;  2O85 A;  3EMP A;  1GP1 A;  4POM A;  2CZ2 A;  4K5S A;  5GZZ B;  2IME A;  2PGT A;  4N10 A;  2LEG A;  2HZE A;  3DKS A;  2H6Y A;  1YF0 A;  3F6F A;  2WCI A;  1YKA A;  4YH2 A;  4EVM A;  4EL1 A;  1Z6M A;  4K5R A;  5DVB A;  2V6O A;  1BX9 A;  1K3Y A;  4JU5 A;  4RQR A;  1I5G A;  2HRA A;  1X5D A;  5ECO B;  1HYU A;  1B8X A;  3DRN A;  3BD2 A;  4K8M A;  2LRC A;  5G1K A;  4QQ7 A;  2QA2 A;  3MIX A;  4G19 A;  3TKS E;  1GSS A;  5JWQ B;  3L0H A;  3FKF A;  1EEM A;  4IBP A;  4ZIL A;  2HNL A;  3QFA C;  5GAP D;  2LV3 A;  2IWT A;  4MA9 A;  4BVX B;  2F9S A;  2K6V A;  1U3A A;  4Z2T A;  1EGR A;  5IQY A;  1XXU A;  3D21 A;  3BCI A;  2VCZ A;  3KJY A;  2ES7 A;  1QGV A;  4LMW A;  2KP2 A;  2JAC A;  22GS A;  2HRF A;  2DBC A;  2K9F A;  4Z2R A;  2HE3 A;  1PSQ A;  1XPV A;  5KN1 A;  1EZK A;  3VFI A;  2AAW A;  5B8A A;  1ML6 A;  3FZ9 A;  3HJM A;  4JBB A;  4IP6 A;  2GGT A;  2OJL A;  3C73 A;  3KEB A;  2OA7 A;  1JZR A;  2LJA A;  2DJJ A;  3LQ7 A;  1VF2 A;  4HU9 A;  1TRS A;  2R0P A;  4LLR A;  4OMV A;  3P8W A;  2YJH A;  1USB A;  2LJR A;  4KB3 A;  4PUF C;  2YCD A;  4Z7X A;  2N5F A;  2B6M A;  5EL8 A;  3A5I A;  3R3E A;  4ID0 A;  3UAP A;  4G10 A;  5H5Q A;  2FD3 A;  1OE7 A;  2PWJ A;  3TRP A;  5DCG A;  5IMZ A;  5DJM A;  1K3L A;  3LYP A;  3C1S A;  2XHF A;  3FY7 A;  4PNG A;  3TOU A;  2OBI A;  1AUC A;  2JZT A;  3C7M A;  2OBK A;  2H73 A;  2C0D A;  2GSQ A;  4NXI A;  6GSS A;  2AJQ B;  2B1L A;  5D96 A;  4N0Z A;  1TRU A;  3LXZ A;  3PH9 A;  4FH8 A;  3FR9 A;  3US3 A;  5ENU A;  1F6M C;  2HSH A;  2C0F A;  5A4W A;  2IMI A;  4OWY A;  1EOH A;  4FO5 A;  1OE8 A;  4IJ3 A;  1M2A A;  2MYG A;  4I2T A;  1QXH A;  2X8H A;  11GS A;  1G7E A;  3D22 A;  3LYK A;  3EU3 A;  2GZY A;  2KP1 A;  3IDV A;  3Q6O A;  4X43 A;  5F07 A;  4MLY A;  1XWB A;  2CAI A;  5COH A;  2H0I A;  4JZQ A;  4MH2 A;  2OE3 A;  1XIY A;  2G2Q A;  1QK8 A;  1XWK A;  1ZYN A;  2X49 A;  4V2M A;  2R6K A;  1GSY A;  3QFB C;  5DAL B;  3ZIT A;  1EWX A;  1M2B A;  2DJ1 A;  2GDR A;  2J9H A;  5AIV A;  3VWW A;  1PL1 A;  3KH7 A;  3M3M A;  3FZ5 A;  3IXR A;  1YF1 A;  4YQV A;  3HYP A;  1B4Q A;  4KND A;  1KBN A;  4KCA A;  4RUV A;  4MJB A;  3NIV A;  3K8N A;  1JFU A;  2LQO A;  4MP4 A;  4F2I A;  1DE1 A;  2RII A;  3ZIJ A;  2C80 A;  2TRX A;  2P5R A;  1WE0 A;  2IJY A;  2L6D A;  5F8B A;  4MMM A;  5AGY A;  5LNK e;  6GSU A;  2XBI A;  1GNE A;  2LRN A;  1FO5 A;  2B1K A;  6GSW A;  1YEX A;  5AN1 A;  1BJX A;  2IPA A;  4KF9 A;  3GUR A;  3HY2 A;  3H1N A;  2OAD A;  4HZ4 A;  3F4T A;  1OVN A;  3HVV A;  4TW5 A;  1WOU A;  2KOK A;  2QKE A;  5AIX A;  5FWG A;  2ON5 A;  2HLS A;  3LEF A;  1S3D A;  1E2Y A;  1X5E A;  2VL2 C;  3ZML A;  2CQ9 A;  4D73 A;  2JU5 A;  2CT6 A;  1GSE A;  3VI7 A;  1RW1 A;  2B7J A;  3F8U A;  3W6G A;  4EE0 A;  3SBC A;  3EVI A;  5CRG A;  2FNO A;  2M46 A;  2NPB A;  4DSS A;  5IMV A;  4J57 E;  4IGJ A;  2AB6 A;  3IC8 A;  3GA4 A;  1X5C A;  4G9H A;  4ZB6 A;  2MMO A;  2PVQ A;  1DE2 A;  2GSS A;  2XBQ A;  4A5P A;  2VLT A;  4G0I A;  1K0B A;  3NZN A;  1SD9 A;  3IE3 A;  1F3B A;  3TRX A;  5JCU A;  2AHE A;  4EUY A;  3ZYW A;  4ZL7 A;  2L57 A;  2I81 A;  4K7O A;  2VO4 A;  1SK1 A;  1TDI A;  3ME8 A;  1DUG A;  2E2G A;  1LBK A;  4XS1 A;  1TTZ A;  4CHS A;  4I5Q A;  3ZLP A;  4KCE A;  4KA0 A;  3KD0 A;  2YNX A;  1Z9H A;  4WF4 A;  2IFQ A;  1NM3 A;  12GS A;  4BWQ A;  2R0G A;  4DSQ A;  1HQO A;  5ECK B;  4CW9 A;  7GSS A;  3E9J B;  2B5X A;  1WMJ A;  4X0X A;  4WBR D;  4EC0 A;  3TJJ A;  4O5U A;  2Z9S A;  3ISO A;  1ERT A;  3DXB A;  1TI1 A;  4ECJ A;  2R4V A;  3EIN A;  4LL4 B;  6GSY A;  3L9U A;  1Z7P A;  2GVP A;  4EXJ A;  3G7I A;  4ECB A;  2QGV A;  3TKP A;  1B9Y C;  2DJ3 A;  4NHW A;  5CAX A;  2KUC A;  3P2A A;  1XZO A;  3EE2 A;  4NAX A;  2X99 A;  4TR1 A;  4XTS A;  4F03 A;  4N30 A;  3FR6 A;  4KDY A;  3TKS A;  4GWR A;  5CRE A;  1ERU A;  3RAZ A;  4N11 A;  1OKT A;  1XBS A;  3RHC A;  3UEM A;  2MMN A;  1T4Y A;  1Z6N A;  2H0H A;  2F51 A;  5DAK A;  5KOW A;  4NHZ A;  1X0R A;  5KN3 A;  2ALB A;  1SYR A;  4TR0 A;  1OYJ A;  4JR6 A;  3W8S A;  4J2F A;  2YP6 A;  1A8L A;  3RDW A;  3TB2 A;  2IL3 A;  2HSM A;  1O8X A;  5EVO A;  4JED A;  17GS A;  3GKN A;  3MDK A;  4IQA A;  4ULX A;  4OCF A;  5J4U A;  4JE1 A;  2VM2 A;  3HA9 A;  5IIZ A;  2I4A A;  1K0C A;  4MNN A;  1T00 A;  5FHI A;  3N5O A;  3GFK A;  2H0G A;  2RLI A;  1GTB A;  4F82 A;  5HQP A;  1GWC A;  1S3A A;  3PIN A;  1MDJ A;  2P5Q A;  2K8V A;  1FVJ A;  2OAC A;  2E7P A;  1PA3 A;  3UL3 A;  4IKH A;  1A2J A;  3KGK A;  3EU4 A;  1UA5 A;  5J3R A;  1R26 A;  3CSI A;  1O81 A;  4NPB A;  1HNC A;  4BWS A;  2GQM A;  3A2V A;  4P3Y B;  5JWR B;  2H8L A;  5IMF A;  3UVT A;  4XHM A;  4ZB9 A;  3FR3 A;  1GUK A;  2WRT A;  5D93 A;  3D4T A;  1SL1 B;  2VIM A;  3MAK A;  1E6B A;  1CQH A;  5HR2 A;  8GSS A;  2JSZ A;  1PQN A;  4KAE A;  4HU7 A;  1M9A A;  1WRY A;  4XS4 B;  1F3A A;  3TCO A;  2YWI A;  4K9Z A;  4ZXG A;  2DKI A;  1GUM A;  1EV4 A;  3CRU A;  1JZW A;  4AF2 A;  3IPZ A;  3GN3 A;  4YQM A;  1TP9 A;  3ZTL A;  5B8B A;  2JL4 A;  2EIO A;  5IO2 A;  3A3T A;  5CP1 A;  2LTK A;  4XRD A;  3ERW A;  4YKF A;  2X4A A;  2HZF A;  1N8J A;  4AJ8 A;  2HSY A;  3HZ8 A;  4IN0 A;  3W8J A;  4K7I A;  5DCH A;  2X8G A;  3CXG A;  3S9F A;  3DVX A;  4J56 E;  4TR1 B;  1YJ6 A;  4CDO A;  2ZUP A;  4KSO A;  1X9S B;  2H1G A;  1XFL A;  5IMA A;  4AJ6 A;  3KMO A;  3WGD A;  5G5E A;  3DYR A;  2HI7 A;  1XOB A;  5CRW A;  2CVK A;  2UZ8 A;  3HXS A;  4KDX A;  2QC7 A;  2A2S A;  4IEL A;  4GXZ A;  2IIY A;  5DJL A;  3JCM L;  1H75 A;  5ECN B;  3AY8 A;  3DD3 A;  4PUA A;  2YV9 A;  4KUN A;  3F9U A;  4PX1 A;  1JLV A;  1XW6 A;  3M9J A;  1EGO A;  5ID2 A;  2VL9 A;  4L0U A;  4ML1 A;  2B5E A;  3DML A;  1YKC A;  4Q5R A;  5AIS A;  4IQ1 A;  1B9X C;  1TKD B;  2H75 A;  4F0B A;  2C3N A;  1PGT A;  2LS5 A;  5INY A;  1U3I A;  3KP9 A;  5IOX A;  2NDO A;  1YDK A;  4BL7 A;  2FWH A;  3P7X A;  4O5R A;  1M99 A;  2H1A A;  13GS A;  1ZYQ B;  18GS A;  4KSM A;  2L5O A;  2F8F A;  3L4N A;  4K1F A;  2GT5 A;  2VAF A;  4CY6 A;  4L5L A;  4YAP A;  1Z3E A;  1GH2 A;  3UBL A;  1J0F A;  1Q4J A;  2L6C A;  3QDN A;  4JR4 A;  3V1W A;  1THO A;  2A2P A;  4EDY A;  4MF7 A;  3NOF A;  4Z2U A;  4Q5Q A;  2GS3 A;  2PBJ A;  3EUR A;  1FOH A;  2V1M A;  4I2U A;  2DSA A;  1W4V A;  2L5L A;  2C3Q A;  2F3M A;  1V98 A;  5GSS A;  3QMX A;  2CAQ A;  4POL A;  3HJP A;  5CO3 A;  4ZBB A;  2VLU A;  4O32 A;  4K6X A;  2D2Z A;  1HNA A;  2EC4 A;  3GSS A;  4HJ2 A;  4MCU A;  4TXV A;  2L4Q A;  1B48 A;  4GCI A;  2P31 A;  4ZL8 A;  3L9V A;  4MF5 A;  2O7K A;  1O85 A;  2AUV A;  5IMD A;  1ZL9 A;  4LA1 A;  3ZVJ D;  1G6W A;  4NMU A;  4RI6 A;  2O87 A;  1R7H A;  2MMA A;  2FWE A;  5A4U A;  3DVW A;  3R2Q A;  4NV5 A;  1FOV A;  2HZE B;  2LNT A;  3EYT A;  3SWL A;  4K2X A;  1OC9 A;  5ECH B;  6GSV A;  2VD1 A;  5G30 A;  1K0A A;  1V9W A;  4H86 A;  3H93 A;  3WT2 A;  2H71 A;  3DWV A;  3HVS A;  1FW1 A;  3LXT A;  2VL3 A;  1JHB A;  3MWH A;  3IK9 A;  2DIY A;  5IM9 A;  1TK5 B;  2VUP A;  4WXT A;  6GST A;  1VRS D;  2LNS A;  4F0C A;  2GT6 A;  3F4R A;  1U87 A;  5J9C A;  4ICY A;  3KTL A;  1FG4 A;  3A2W A;  4USS A;  1J08 A;  3IK7 A;  1PN0 A;  3GKM A;  4K0G A;  2CVB A;  4ECI A;  2PU9 C;  1YQ1 A;  1T7P B;  4HOJ A;  3ZFB A;  2YPM A;  3KTB A;  3VPQ A;  4IHU A;  1XCC A;  4O7H A;  1BYE A;  2DIZ A;  4GLT A;  2HXK A;  1UVZ A;  5F06 A;  2WGR A;  4BL7 B;  1HD2 A;  3VUR A;  2E0Q A;  1TK0 B;  3IC4 A;  4K2D A;  1JLW A;  3QAW A;  1AXD A;  2FY6 A;  4TKY A;  4IW9 A;  2ZNM A;  2P0G A;  4Q5N A;  1ZCP A;  1GL8 A;  3IV4 A;  4XCS A;  3I9V 2;  3CTF A;  4NWY A;  4TXO A;  3GL5 A;  3L78 A;  3TJB A;  2YAN A;  2A4V A;  2B5Y A;  5ECM B;  1KNG A;  5IPG A;  1MEK A;  5IO0 A;  3O6T A;  4BVY A;  5G5F A;  1PRX A;  3UJ1 A;  3CYN A;  2X64 A;  1ZYP A;  3IRA A;  2WUL A;  4EKZ A;  4E8E A;  5B6N A;  2J23 A;  5J9B A;  2DLX A;  2M80 A;  5KN2 A;  3ZMK A;  2F8A A;  1T4Z A;  2C3T A;  4RI7 A;  5ECI B;  2EIQ A;  1O8W A;  1MD3 A;  2C0E A;  5F0G A;  5LCZ A;  4HS1 A;  1SJ6 A;  3L9S A;  1R5P A;  4G2E A;  2H72 A;  3GTU A;  2CV4 A;  3ERG A;  4V2L A;  5ECQ B;  4DVC A;  3KMN A;  1YY7 A;  1EP7 A;  1ZGN A;  2PER A;  3ED3 A;  3TKS C;  3KM6 A;  3RPN A;  5KEJ A;  3O76 A;  3C71 A;  1PKW A;  5H5R A;  5JCG A;  2BTO T;  5E4W A;  5HR3 A;  4GQC A;  2DC5 A;  3ZZX A;  2N5A A;  1ACV A;  5HFK A;  4EF0 A;  1BED A;  2V32 A;  1MDK A;  3ZL5 A;  2WFC A;  1GTA A;  2RM6 A;  5CRH A;  5ECR B;  5F05 A;  4JRR A;  2IMD A;  3BBY A;  1ZYE A;  2VCV A;  3H4K A;  3LSZ A;  4HZ2 A;  5DQY A;  2MMZ A;  4G0K A;  3ZVJ A;  1XVW A;  2C0G A;  3G9B A;  4YQU A;  3E0U A;  1GTI A;  1PN9 A;  5HR0 A;  4N0V A;  1LJR A;  1NHO A;  3OR5 A;  2IN3 A;  3O3T A;  2H74 A;  2R3X A;  5EY6 A;  2BJX A;  1BAY A;  1QFN A;  3N9J A;  4PNF A;  2GST A;  3A5W A;  4WBJ A;  1ERW A;  3PGT A;  1JZD A;  1M0U A;  1URM A;  1OC3 A;  1Z5Y E;  3TJK A;  3EWL A;  4ML6 A;  1SK0 A;  2OKA A;  1DSB A;  5FT3 A;  1T1V A;  4KE3 A;  3HZ4 A;  19GS A;  3IAS 2;  3UBK A;  1AIU A;  4XS6 A;  1VF3 A;  2LQQ A;  2GSR A;  3MYD A;  4MZW A;  1ERV A;  4TN8 A;  1FHE A;  1M7T A;  1XW5 A;  1Y25 A;  2PMT A;  1TI3 A;  3F6D A;  4QL9 A;  5BMU A;  1MTC A;  2K8S A;  1SL0 B;  3GL3 A;  3VPT A;  4EDZ A;  4IP1 A;  5IMC A;  3CSH A;  3MSZ A;  4TR4 A;  4HDE A;  4D73 B;  3QAV A;  2MBT A;  4GTU A;  3HJO A;  5IOW A;  4BVX A;  1F37 A;  2PVO C;  1GUH A;  3U5R E;  4DSS B;  3GIX A;  3H8Q A;  4L5O A;  5DQS A;  2H66 A;  1YZX A;  2FWG A;  4G0L A;  4KW6 A;  3WGE A;  2H6Z A;  5ECS A;  3VWU A;  3GNJ A;  3LJR A;  2LST A;  4FIW A;  4QL7 A;  1IYH A;  3FEU A;  3QCP A;  3VI5 A;  3RBT A;  3TKR A;  1GLQ A;  2REM A;  3ZFL A;  2HT9 A;  3IOS A;  1SKS B;  5ABR A;  5CNW A;  2R0C A;  4DEJ A;  3DGQ A;  4YKG A;  2FWF A;  3FK8 A;  4X4J A;  3Q18 A;  4KGI A;  2GZZ A;  4BPY A;  5DBQ A;  2H6X A;  4OD7 A;  3QPM A;  1T3B A;  4ISD A;  4PXO A;  3FMW A;  1EV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...