3HD5A

Crystal structure of a thiol:disulfide interchange protein dsba from bordetella parapertussis
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
182
structure length
182
Chain Sequence
QGAQQYVNINPPMPSDTPGKIEVLEFFAYTCPHCAAIEPMVEDWAKTAPQDVVLKQVPIAFNAGMKPLQQLYYTLQALERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFDSFSVQTQVQRASQLAEAAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVVDQLIVQSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Crystal structure of a thiol:disulfide interchange protein dsbA from Bordetella parapertussis
rcsb
source organism Bordetella parapertussis
molecule tags Oxidoreductase
total genus 59
structure length 182
sequence length 182
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hd5A01
2F51A 4V2MA 3ZZXA 2JL4A 1XOAA 1GNWA 2RIIA 1TU8A 1BJXA 4J56E 4Q5FA 1PX7A 1EP8A 4WR4A 2JADA 1EV9A 4BL7A 1Z7PA 5CNWA 2ZUPA 4YQVA 4NHZA 5COHA 3V1WA 5HFIA 1JHBA 3F63A 2K6VA 5AIXA 4ZB6A 2DJ0A 1THXA 1WPIA 3FY7A 3GRXA 20GSA 3HVSA 4GSSA 2CT6A 1PMTA 3TOUA 2VCXA 2H8LA 4XIHA 4OCEA 1K3LA 2P5RA 2P31A 4TVEA 3DGQA 2C3TA 1XWKA 3ZRDA 1ABAA 2HT9A 1QQ2A 1U6TA 2RM5A 4EL1A 3CMIA 4EF0A 2HZFA 3KCMA 4O32A 3TGZA 5DDLA 1X9WB 2L6CA 3N5OA 2YWNA 2IFQB 5ELGA 1VF2A 1ZYEA 2V41A 5KEJA 4PQ1A 5ECRB 5H5QA 3HZ8A 2DBCA 2CVDA 3RPPA 1WRYA 3GKMA 1M0UA 2LRCA 2L5LA 1OAZA 4X0XA 3ZLPA 3HHVA 5F05A 2MZCA 5HR0A 4IBPA 3QFAC 1SYXA 2DLXA 11GSA 4F2IA 1C72A 3FKFA 3F3QA 4MP4A 1T1VA 2PMTA 5DJMA 5GZZB 2CAIA 2C8UA 5ECQB 5ENUA 4G10A 3D21A 4I8BA 5J3RA 1URMA 3KXOA 2ON5A 4FH8A 2KP2A 3WGDA 2X8CA 2O87A 3C73A 3IE3A 2L6DA 2WFCA 1R4WA 22GSA 3Q18A 1VF3A 4ECJA 4JU5A 5HR3A 1Z6NA 4PXOA 1YEXA 5CYYA 4D73B 3UARA 4HEA2 4GQCA 1EWXA 1WE0A 3O76A 2JZSA 5B8BA 1PN9A 3KIJA 4TXVA 2VL9A 3QFBC 2LJKA 3GKKA 3PH9A 4XCSA 4GSTA 1WOUA 1TI3A 1BAYA 4DEJA 3G9BA 4MZBA 3C8EA 3ZL5A 2AJQB 3P90A 1TRUA 2YOIA 4OFNA 4KA0A 2DSAA 1YKAA 2QKEA 1X5EA 1QK8A 5IMVA 4I97A 1Y25A 3FEUA 1GSUA 4JEDA 2YV7A 2J9HA 3KZQA 1A8YA 4TR1A 1M2AA 4EXJA 5CREA 3CRUA 4EUYA 3F3RA 1WMJA 3KH9A 3WYWA 1GSQA 3HCZA 3TJFA 2FUG2 2IMKA 3TKRA 1V57A 2NBSA 3GMFA 3VK9A 2I81A 4L0WA 1X0RA 1X5DA 2HE3A 4AJ6A 1TXXA 1TU7A 1VRSD 2H1DA 1T00A 1LJRA 2DIZA 4YQMA 2YWMA 4I6XA 3AY8A 3US3A 5ECPB 1NSWA 4L8EA 3VPTA 1H75A 1R26A 1YY7A 2VCVA 1XW9A 2I9HA 1XBSA 4BVXA 3IBHA 2DJJA 4PUFC 3BCKA 1M99A 2FWHA 1F3BA 2LRNA 4K9ZA 3TRXA 3QDNA 5D93A 3N9JA 4EE0A 5LNKe 3H4KA 1S3DA 2H75A 1AC1A 3ZMKA 4KDXA 3IK7A 3RDWA 1WIKA 2V6KA 1FB0A 3UVHA 4IGJA 4P3YB 17GSA 4XTSA 1QMVA 2GS3A 1PRXA 1SL1B 2AAWA 1ZGNA 1YF0A 1SU9A 5D9TA 1AW9A 1ZCPA 1O8XA 2E7PA 2FWGA 5HR1A 4PNFA 1H4OA 1G6YA 3I6AA 4HS1A 2GSTA 5DCGA 1FO5A 2OBKA 1W4VA 1FW1A 3F0IA 3TKPA 5ELAA 3F6DA 3C71A 3DXBA 2B6MA 2VCZA 1TRWA 4K7NA 3ZREA 3GFKA 2GSQA 3UJ1A 2M80A 1AXDA 2JU5A 2WDUA 2N5AA 5DQSA 1R7HA 1GUHA 4IQAA 1JZOA 2H0HA 4YH2A 5KN1A 4TOPA 6GSWA 2BMXA 2TRXA 2CZ3A 4BA7A 3IR4A 3QR6A 4ML6A 4O7HA 2V6OA 3TJBA 8GSSA 5IO2A 1T3BA 4NMUA 2B1KA 3UIWA 4I2UA 1O81A 5G31A 1TTZA 4IW9A 1AIUA 3EMXA 3FHKA 4MLYA 4OMVA 4J2FA 2LJRA 2FLSA 5IIZA 4N0ZA 4D73A 4HJ2A 1R5PA 2B1LA 3E3EA 2WGRA 1Z9HA 5ECKB 2GQLA 3UMAA 3CXGA 4QQ7A 10GSA 3UEMA 3ZVJA 4EKZA 1SL0B 4NHWA 2YJHA 6GSTA 4FYCA 1XOBA 2L5OA 2B5EA 1UA5A 2OE0A 1UVZA 2B7JA 2IMEA 4GF0A 1XWGA 1TW9A 4EDYA 2YCDA 5INYA 5GAPD 2KP1A 1K3YA 5G2ZA 6GSSA 2H6ZA 2IJYA 5G1LA 3ISOA 3TKSA 4DSQA 2JSZA 2K8VA 12GSA 4NPBA 4FIWA 5G1KA 2C3QA 3G7JA 5G30A 5CRDA 2WULA 1SKSB 2HNLA 2IN3A 2L59A 3S9FA 3ERWA 2PVOC 5IMFA 3GA4A 1USBA 4PUAA 1GSSA 3ZVJD 3DIEA 1A2JA 3GUSA 2BJXA 3NOFA 3GSSA 4EO3A 4MJAA 3QD9A 1R5AA 3A2XA 2DMLA 2NPBA 1SJZA 1IYHA 2GVPA 4PQIA 1VF4A 4K0NA 3W8SA 2H74A 4GSNA 2GLRA 1A0RP 5D96A 4MH2A 4ECBA 3TKSC 2VCQA 3IXRA 1SL2B 2WJUA 2FWEA 2GT5A 3EURA 4K7IA 2GSSA 3IHQA 3HXSA 1JZWA 5DQYA 1TKDB 2CV4A 3RHBA 3ZYWA 2PPTA 2DJ3A 4YQUA 3BD2A 2M46A 3EU3A 1FHEA 2C0DA 4FYUA 3IAS2 2VL2C 4ZILA 3FR3A 3DVWA 3I69A 2YNXA 2H71A 5ABRA 3MDKA 1Z7RA 3TOTA 3DEXA 2HRNA 1SD9A 4JBBA 2O7KA 2IMDA 1JLVA 4MCUA 2WZ9A 2AHEA 3HKRA 6GSVA 1PX6A 5B7CA 3WT2A 4ZBDA 5IMAA 2EC4A 4F82A 4Z7XA 2F8AA 1TRSA 2CVKA 1PKWA 1XFLA 2VIMA 2EIOA 1T4YA 5IM9A 5IPGA 2AYTA 16GSA 2FCHA 1LU4A 4JR6A 4OWYA 3TDGA 1XWBA 1EP7A 3A3TA 2H66A 3KD0A 2C3NA 3KMOA 4YAPA 3EVIA 2HLSA 5DVBA 3KJYA 3L78A 3CSHA 3M9JA 2VOCA 14GSA 5E59A 3IOSA 3CYNA 1E6BA 2VM2A 4DVCA 3CRTA 3LORA 6GSXA 4ILFA 2YZUA 4WETA 4GQFA 1A2LA 3VPQA 4ID0A 2IMFA 1WJKA 1XW5A 3TUEA 2B5YA 2OACA 2B7KA 2PERA 4KSMA 4JZQA 4ISDA 4HZ2A 3HA9A 4BPYA 2ZNMA 5F0GA 2H1GA 3SBCA 5FWGA 1OYJA 3F4SA 5KN0A 2LRTA 1EEMA 4X1UA 4TXOB 4KCEA 5HFGA 3BOAA 4KAEA 4EDZA 2F3MA 1J9BA 3PINA 1IYIA 4KX4A 5D8IA 3GIXA 1THOA 4HU9A 4MDCA 2GTUA 5B6MA 4KNDA 2H76A 1MDKA 3QAGA 1SJ6A 1XZOA 4KCAA 1O6JA 2LNTA 5DALB 4QL9A 4MPGA 4XRAA 3IK9A 4WBRD 2H0GA 1B9YC 2H72A 1ZZYA 2IMIA 5ECNB 4LMWA 2LKUA 4ZBAA 3GSTA 4CDOA 1GUMA 1XPVA 2OE1A 4MJCA 3HJPA 3L9UA 3LFLA 4Q5RA 5CRGA 2IL3A 1GULA 1EGRA 3H79A 4K0GA 1MEKA 2OADA 4RI6A 2KLXA 2H1BA 3ZTLA 1DE1A 2FWFA 5ECHB 4PX1A 2YWIA 3VI5A 2H70A 1M2DA 2A2SA 2HZEA 5HFKA 4NAXA 2P0GA 1YJ6A 1W89A 2QSIA 1CQGA 4OFMA 5CP1A 3TCOA 2ON7A 1B9XC 1LBKA 5IMCA 1ZYQB 1GSFA 3UAPA 2LTKA 3CSIA 2C0FA 3LYKA 4LMVA 3KP8A 4ZBBA 3GV1A 2DJ2A 2VLUA 2R3XA 4RI7A 1BYEA 5B6NA 3VWUA 2DC5A 5A5KA 3GKNA 5J4UA 1KBNA 1TRVA 4IJIA 4OD7A 3HVXA 1YZXA 2AV4A 4Q5QA 1GNEA 3GKXA 1ACVA 2B5XA 2C1YA 2YP6A 2MBTA 2F8FA 3WGXA 5EPFA 2JZRA 2RUEA 2OA7A 2NVLA 2CVBA 5JCUA 1EOHA 3BBYA 4JE1A 2OBIA 5HR2A 3JCML 2A4VA 4IVFA 1XVQA 3EMPA 5FT3A 2C80A 2VUPA 3QCPA 4IELA 3DD3A 3QOUA 4GWRA 4V2NA 4AGSA 1DUGA 1JFUA 2LNSA 3D0ZA 2XBQA 4ECIA 3O3TA 2HSHA 3E0UA 5CO3A 5JWOB 4ULXA 5IQYA 1EOGA 1MDIA 6GSUA 2YN1A 2J23A 4YAVA 4I5QA 4KUNA 5D9WA 2V2GA 5ECOB 4O92A 3TJJA 7GSSA 3DYRA 1PD21 3KP9A 4JR4A 2ALBA 3QAWA 3APQA 1Z6MA 6GSYA 3UBKA 2LJAA 4BVYA 2IFQA 3LQ7A 1ZOFA 5AISA 1VF1A 2GZZA 4PGTA 1GLPA 3M9KA 3TB2A 1GSEA 4ZL8A 2XC2A 2LSTA 4KDYA 3UVTA 1I9DA 2C0EA 1FB6A 18GSA 3L9SA 4ZIJA 2OE3A 3H1NA 3P7XA 1DSBA 2TIRA 2CQ9A 4N30A 1KNGA 1U3IA 3TJGA 2JZTA 1RK4A 3LXTA 4DSSB 2GQMA 1PKZA 3D22A 1TP9A 3PR8A 1SD8A 3Q6OA 5G5FA 5DALA 1UC7A 2VLTA 3HY2A 1OE7A 2E2GA 3CSJA 1A8LA 3GL3A 2L4QA 4MABA 3GN3A 2H0IA 5G5EA 3NIVA 4IHUA 1RW1A 5ECIB 4H86A 2KOKA 1GTUA 2IWTA 1PQNA 3DWVA 4IP6A 4F9ZA 2RUFA 4KH7A 2WCIA 4IJ3A 3UBLA 3GNJA 3WT1A 2X8HA 3A2VA 4BWQA 3VWWA 5ID2B 1I5GA 1NM3A 2YPMA 4AJ8A 2R4VA 2PUKC 3D5JA 5E4WA 4K2DA 4OO5A 2H73A 4EC0A 3D6IA 4K1FA 1U88A 1BEDA 2G2QA 4XS1A 1WWJA 5H5SA 5JCWA 5D9XA 2FA4A 1XW6A 3QPMA 3H93A 3CBUA 1N2AA 3ED3A 2VLVA 4ZB8A 2I1UA 1GSDA 2C4JA 4V1Ag 3W8JA 4AJ7A 2LQQA 5IOXA 2H6YA 1O85A 2LUSA 2IIYA 4N0VA 5GSSA 3R2QA 2YWOA 1QGVA 4Q5NA 4MJBA 3FYGA 2CAQA 1A2MA 2HFDA 3U5RE 1OKDA 4LA1A 1MD4A 5D9VA 3I43A 3KMNA 4IS0A 3HD5A 5ECMB 1B4PA 1F9MA 1DBYA 2OJLA 5EY6A 4GCIA 5DJLA 1V2AA 4MMMA 1M2BA 5DBQA 3TJKA 3MWHA 3FZ5A 2DJKA 5F8BA 3A5WA 5LD0A 1HNCA 3ZIVA 1MDJA 1ERWA 2E0QA 4G2EA 1EGOA 1ERVA 3ZFBA 1CQHA 2WS2A 3LEFA 1BG5A 4KSOA 4E8EA 5J41A 3APSA 2GZPA 4CHSA 5J5NA 1XCCA 1Z3EA 4PNGA 1OVNA 3K8NA 5F07A 4MK3A 2XPEA 1SK2A 4HOJA 2IPAA 2L4CA 3HVVA 3BJ5A 1VGLA 3DRNA 4KDUA 4F0BA 1K0NA 13GSA 2Z9SA 2FHEA 3F4TA 3KM6A 4LLRA 4ZL9A 1QXHA 1PSQA 1V9WA 3EINA 3M0FA 4XS4B 4FYBA 3HZ4A 4NWYA 4TKYA 4FO5A 3FZ9A 2OKAA 2XPDA 4KGIA 2PGTA 3ERGA 1SJIA 1AUCA 2WB9A 3TRPA 1ML6A 1OKTA 3TRQA 3RHCA 3P8WA 1GUKA 1GTBA 3EU4A 3EE2A 5JWRB 1SENA 1XWAA 2JSYA 2CZ2A 4JRRA 2H30A 1G7EA 5CRWA 3ZMLA 2YV9A 2BTOT 1X9MB 3KTBA 5CRHA 1XVWA 1FAAA 4ML1A 4RQRA 1S3CA 3IC4A 2EIRA 2X99A 4OFTA 1Q4JA 1G7OA 4DSSA 1TDIA 2P5QA 3HJMA 4X43A 1F37A 2CX4A 5IOWA 3SWLA 4WKWA 4F03A 4V1Ap 1AQXA 4POKA 3GH9A 1QFNA 3Q74A 1F2EA 5KN2A 3VWVA 4GXZA 1K0DA 5IMZA 4EVMA 2VCWA 3J7Yk 3LWAA 1GTIA 4DSRA 4MPFA 1OC3A 3LXZA 5C04A 1HYUA 2MMAA 2MMOA 4I2TA 1G6WA 2HXKA 1SK1A 3G7IA 1ST9A 1HQOA 5ID2A 1B48A 5IPHA 2MMNA 19GSA 3APOA 2A2RA 5FHIA 4WF4A 3TKSE 1AQWA 1GH2A 4WF5A 2K18A 3IPZA 1PL2A 4MJEA 2HRFA 1F3AA 2VD0A 4HZ4A 3UOMA 2N5FA 3MAKA 1FOVA 4V2LA 3M1GA 1EV4A 3C1SA 3MSZA 1SYRA 3GHAA 5L71A 4F0CA 2JACA 3IAM2 3F4RA 3IA1A 2LS5A 2G0FA 2VAFA 3GYKA 2LEGA 4TR3A 1HNAA 1QUWA 3L4NA 4CW9A 3IV4A 2I4AA 5JCGA 4K6XA 2GZYA 4HU7A 2E2MA 3IRAA 1A24A 2CX3A 1XXUA 5AGYA 3WD6A 1GP1A 3EYTA 4PQHA 4MF5A 4LL4B 2XBIA 1B4QA 4PURA 3J7Yb 2RLIA 4L5LA 2O89A 3LYPA 5ECLB 4IQ1A 4QL7A 3D4TA 1U87A 2VM1A 2RM6A 4O5RA 4IKHA 4OCFA 4GLTA 2O8VB 2K8SA 1X5CA 3GX8A 1OC9B 3C7MA 3RAZA 3VI7A 1EEJA 1WP0A 5A4VA 3A2WA 2YZHA 2PU9C 1HD2A 1SK0A 3E9JB 5GSTA 1GWCA 3FR9A 4TN8A 1SKRB 2FGXA 2PWJA 2TRCP 1V98A 5C00A 5D73A 4BWSA 3FR6A 4IP1A 3EWLA 3PGTA 4RUVA 1XWCA 1J08A 1Z5YE 3ZITA 4ZXGA 1JLWA 1K0BA 4N11A 2EIQA 3ME7A 1GL8A 1K0CA 4HUAA 4L0UA 1FVJA 1K0AA 2YJ7A 1M9AA 3U6VA 2MYGA 5DAKB 4XS4A 1ZMAA 2FNOA 3F6FA 3GX0A 3VURA 1PGTA 2VCTA 3F8UA 3BCIA 1YF1A 4XHMA 2R2JA 1V58A 1OC8A 3FRCA 4GRFA 2VO4A 2NDOA 1ERUA 4WR5A 1F6MC 1TK0B 1O73A 3GTUB 2K9FA 2O85A 1O7UA 1YEPA 1T8EB 3CTGA 5H5RA 1SKWB 1PL1A 1ON4A 3F9UA 4TW5A 3LJRA 4IN0A 4TR4A 2PN8A 3ZIJA 2H01A 2VL3A 3DMLA 2QGVA 3C1RA 3WGEA 2VD1A 3LG6A 1OE8A 1XIYA 2FD3A 3QMXA 1O8WA 2ZCTA 3ME8A 1A0FA 3ERFA 1ILOA 5JWQB 4ZL7A 2D2ZA 3DVXA 1J0FA 1EZKA 3LGCA 2WRTA 1HNBA 2V1MA 3GURA 2H19A 1G0TA 2DJ1A 3Q19A 3LSZA 4TXOA 4WEYA 3KH7A 4K8MA 2GSRA 1B8XA 2REMA 3KEBA 1T4ZA 4MF6A 4POBA 4G19A 2C0GA 3VLNA 4AF2A 2F9SA 5GAND 5LCZA 2HSYA 1N8JA 1BQ7A 2R37A 2N5BA 2FY6A 1TK5B 3G7YA 3VFIA 2AUVA 4J57E 4MA9A 3P2AA 4NV5A 4HI7A 3FK8A 4OO4A 3D4MA 2KHPA 2DMMA 1YQ1A 3HYPA 1Q98A 4K7OA 5DCHA 3OR5A 1MTCA 3KTLA 1GTAA 3QAVA 4G9HA 5IMDA 2KUCA 4RQXA 3FW2A 1K0MA 2X64A 3GH6A 3H8QA 4POLA 2CA8A 4HQZA 3M3MA 3W6GA 5J9CA 2QC7A 4XS6A 1JZDA 2I3YA 3NZNA 4HJMA 1T7PB 3HJOA 3IDVA 3L9VA 4L5OA 5J9BA 2R6KA 1GLQA 3EC3A 5F06A 3FZAA 2PVQA 3KGKA 3VWXA 1K3OA 1AQVA 1YKCA 5A4WA 4XRDA 1Y6EA 2AB6A 4N10A 2DIYA 2GT6A 1KTEA 2NTOA 2GQKA 5EL8A 5B8AA 5CAXA 4E8HA 2HI7A 4WBJA 2GDRA 3FZ4A 3RBTA 4NXIA 3DKSA 2R5GA 4KE3A 1OC9A 3HDCA 3MNGA 1U3AA 4GTUA 3CTFA 4MH3A 1NHOA 5HQPA 1BX9A 4MZCA 2X8GA 2M72A 1UN2A 1TJDA 4MF7A 4HQSA 4MZWA 1TOFA 1FG4A 2H1AA 2HZEB 1AAZA 5AIVA 2MBSA 1TI1A 1JZRA 2VL2A 2L57A 3GL5A 3RPNA 2PBJA 1E2YA 1NHYA 4POMA 1FVKA 4ACSA 1TK8B 3TKQA 1YDKA 4WXTA 4NV2A 2MMZA 1NW2A 1ZL9A 5IO0A 1KEBA 9GSSA 2B3SA 2V32A 1DE2A 4TR1B 1PA3A 4LL1B 1A23A 3O6TA 5DAKA 2H6XA 1MD3A 2XHFA 1GSYA 2YANA 2LQOA 1K0OA 1M9BA 1RQMA 1M7TA 2LV3A 3ZFLA 5ECSA 2GGTA 1ERTA 4HDEA 4ZB9A 4KB3A 1X9SB 2HYXA 3GTUA 5AN1A 5EVOA 2ES7A 4KW6A 4ECCA 1S3AA 3UL3A 3I9V2 4TR0A 5KN3A 5A4UA 1V40A 4TRXA 1GRXA 2FA8A 3M8NA 3L0HA
chains in the Genus database with same CATH superfamily
2F51A 4V2MA 3ZZXA 2JL4A 1XOAA 1GNWA 2RIIA 1TU8A 1BJXA 4J56E 3CQFA 4Q5FA 1PX7A 1EP8A 4WR4A 2JADA 1EV9A 4BL7A 1Z7PA 2QA2A 5CNWA 4MNNA 2ZUPA 4YQVA 4NHZA 5COHA 3V1WA 5HFIA 1JHBA 3F63A 2K6VA 5AIXA 4ZB6A 2DJ0A 1THXA 1WPIA 3FY7A 3GRXA 4Z2TA 20GSA 3HVSA 4GSSA 1ZYNA 2CT6A 1PMTA 3TOUA 2VCXA 2H8LA 4XIHA 4OCEA 1K3LA 2P5RA 2P31A 4TVEA 3DGQA 2C3TA 1XWKA 3ZRDA 1ABAA 2HT9A 1QQ2A 1U6TA 2RM5A 4EL1A 3CMIA 4EF0A 2HZFA 3KCMA 4O32A 3TGZA 5DDLA 1X9WB 2L6CA 3N5OA 2YWNA 4BVYB 2IFQB 5ELGA 1VF2A 3IC8A 1ZYEA 2V41A 5KEJA 4PQ1A 5ECRB 5H5QA 3HZ8A 2DBCA 2CVDA 3RPPA 1WRYA 3GKMA 1M0UA 2LRCA 2L5LA 1OAZA 4X0XA 3ZLPA 3HHVA 5F05A 2MZCA 5HR0A 4IBPA 3QFAC 1SYXA 2DLXA 11GSA 4F2IA 1C72A 3FKFA 3F3QA 4MP4A 1T1VA 2PMTA 5DJMA 5GZZB 2CAIA 2C8UA 5ECQB 5ENUA 1PFOA 4G10A 3D21A 4I8BA 5J3RA 1URMA 3KXOA 2ON5A 4FH8A 2KP2A 4YKFA 3WGDA 2X8CA 2O87A 3C73A 3IE3A 2L6DA 2WFCA 1R4WA 22GSA 3Q18A 1VF3A 4ECJA 4JU5A 5HR3A 1Z6NA 4PXOA 1YEXA 5CYYA 4D73B 3UARA 4HEA2 4GQCA 1EWXA 1WE0A 3O76A 2JZSA 5B8BA 1PN9A 3KIJA 4TXVA 2VL9A 3QFBC 2LJKA 3GKKA 3PH9A 4XCSA 4GSTA 1WOUA 1TI3A 1BAYA 4DEJA 3G9BA 4MZBA 3C8EA 3ZL5A 2AJQB 3P90A 1TRUA 2YOIA 4OFNA 4KA0A 2DSAA 1YKAA 2QKEA 1X5EA 1QK8A 5IMVA 4I97A 1Y25A 3FEUA 1GSUA 4JEDA 2YV7A 2J9HA 3KZQA 1A8YA 4TR1A 1M2AA 4EXJA 5CREA 3CRUA 4EUYA 3F3RA 1WMJA 3KH9A 3WYWA 1GSQA 3HCZA 3TJFA 2FUG2 2IMKA 3TKRA 1V57A 2NBSA 3GMFA 3VK9A 2I81A 4L0WA 1X0RA 1X5DA 2HE3A 4AJ6A 1TXXA 5BRTA 1TU7A 1VRSD 2H1DA 1T00A 1LJRA 2DIZA 4YQMA 2YWMA 4I6XA 3AY8A 3US3A 5ECPB 1NSWA 4L8EA 3VPTA 1H75A 1R26A 1S3RA 1YY7A 2VCVA 1XW9A 2I9HA 1XBSA 4BVXA 3IBHA 2DJJA 4HSCX 4PUFC 3BCKA 1M99A 2FWHA 1F3BA 2LRNA 4K9ZA 3TRXA 3QDNA 5D93A 3N9JA 4CY8A 4EE0A 3H4KA 5LNKe 1S3DA 2H75A 1AC1A 3ZMKA 4KDXA 3IK7A 3RDWA 1WIKA 2V6KA 1FB0A 3UVHA 4IGJA 4P3YB 17GSA 4XTSA 1QMVA 2GS3A 1PRXA 1SL1B 2AAWA 1ZGNA 1YF0A 1SU9A 5D9TA 1AW9A 1ZCPA 1O8XA 2E7PA 2FWGA 5HR1A 2R0PA 1H4OA 1G6YA 4PNFA 3I6AA 4HS1A 2GSTA 5DCGA 1FO5A 2OBKA 1W4VA 1FW1A 3F0IA 3TKPA 5ELAA 3F6DA 3C71A 3DXBA 2B6MA 2VCZA 1TRWA 4K7NA 3ZREA 3GFKA 2GSQA 3UJ1A 2M80A 1AXDA 2JU5A 2WDUA 4EIQA 2N5AA 5DQSA 1R7HA 1GUHA 5KOXA 4IQAA 1JZOA 2H0HA 4YH2A 5KN1A 4TOPA 3R3EA 6GSWA 2BMXA 2TRXA 2CZ3A 4BA7A 3IR4A 3QR6A 4ML6A 4O7HA 2V6OA 3TJBA 8GSSA 5IO2A 1FOHA 1T3BA 4NMUA 2B1KA 3UIWA 4I2UA 1O81A 5G31A 1TTZA 4IW9A 1AIUA 1M3JA 3EMXA 3FHKA 4MLYA 4OMVA 4J2FA 2LJRA 2FLSA 5IIZA 4N0ZA 4D73A 4HJ2A 1R5PA 2B1LA 3E3EA 2WGRA 1Z9HA 5ECKB 2GQLA 3UMAA 3CXGA 4QQ7A 10GSA 3UEMA 3ZVJA 4EKZA 1SL0B 4NHWA 2YJHA 6GSTA 4FYCA 1XOBA 2L5OA 2B5EA 4KF9A 1UA5A 2OE0A 1UVZA 2B7JA 2IMEA 4GF0A 1XWGA 1TW9A 4EDYA 2YCDA 5INYA 5GAPD 2KP1A 1K3YA 5G2ZA 6GSSA 2H6ZA 2IJYA 5G1LA 3ISOA 3TKSA 4DSQA 2JSZA 2K8VA 12GSA 4NPBA 4FIWA 5G1KA 2C3QA 3G7JA 5G30A 5CRDA 2WULA 1SKSB 2HNLA 2IN3A 2L59A 3S9FA 3ERWA 2PVOC 5IMFA 4CY6A 3GA4A 1USBA 4PUAA 1GSSA 4ICYA 3ZVJD 3DIEA 1A2JA 3GUSA 4Z2RA 2BJXA 3NOFA 3GSSA 4EO3A 4MJAA 3QD9A 1R5AA 1ZYPA 3A2XA 2DMLA 2NPBA 1SJZA 1IYHA 2GVPA 4PQIA 1VF4A 4K0NA 3W8SA 2H74A 4GSNA 2GLRA 1A0RP 5D96A 4MH2A 4ECBA 3TKSC 2VCQA 3IXRA 1SL2B 2WJUA 2FWEA 2GT5A 3EURA 4FQUA 4K7IA 2GSSA 3IHQA 3HXSA 1JZWA 5DQYA 1TKDB 2CV4A 3RHBA 3ZYWA 2PPTA 2DJ3A 4YQUA 3BD2A 2M46A 3EU3A 1FHEA 2C0DA 4FYUA 3IAS2 2VL2C 4ZILA 3FR3A 3DVWA 3I69A 2YNXA 2H71A 5ABRA 3MDKA 1Z7RA 3TOTA 3DEXA 2HRNA 1SD9A 4JBBA 2O7KA 2IMDA 1JLVA 4MCUA 2WZ9A 2AHEA 3HKRA 6GSVA 1PX6A 5B7CA 3WT2A 4ZBDA 5IMAA 2EC4A 4F82A 4Z7XA 2F8AA 1TRSA 2CVKA 4G0KA 1PKWA 1XFLA 2VIMA 2EIOA 1T4YA 5IM9A 5IPGA 2AYTA 16GSA 2FCHA 1LU4A 4JR6A 4OWYA 3TDGA 1XWBA 1EP7A 3A3TA 2H66A 3KD0A 2C3NA 3KMOA 4YAPA 3EVIA 2HLSA 5DVBA 3KJYA 3L78A 4Z2UA 3CSHA 3M9JA 2VOCA 2HRAA 14GSA 5E59A 3IOSA 3CYNA 1E6BA 2VM2A 4DVCA 3CRTA 3LORA 6GSXA 4ILFA 2YZUA 4WETA 4GQFA 1A2LA 3VPQA 4ID0A 2IMFA 1WJKA 1XW5A 3TUEA 2B5YA 2OACA 2B7KA 2PERA 4KSMA 4JZQA 4ISDA 4HZ2A 3HA9A 4BPYA 2ZNMA 5F0GA 2H1GA 3SBCA 5FWGA 1OYJA 3F4SA 5KN0A 2LRTA 1EEMA 4X1UA 4TXOB 4G0IA 4KCEA 5HFGA 3BOAA 4KAEA 4EDZA 2F3MA 1J9BA 3PINA 1IYIA 4KX4A 5D8IA 3GIXA 1THOA 4HU9A 4MDCA 2GTUA 5B6MA 4KNDA 2H76A 1MDKA 3QAGA 1SJ6A 1XZOA 4KCAA 1O6JA 2LNTA 5DALB 4QL9A 4MPGA 4K5SA 4XRAA 3IK9A 4WBRD 2H0GA 1B9YC 2H72A 1ZZYA 2IMIA 5ECNB 4LMWA 3LW9A 2LKUA 4ZBAA 3GSTA 4CDOA 1GUMA 1XPVA 2OE1A 4MJCA 3HJPA 3L9UA 3LFLA 4Q5RA 5CRGA 2IL3A 1GULA 1EGRA 3H79A 4K0GA 1MEKA 2OADA 4RI6A 2KLXA 2H1BA 3ZTLA 1DE1A 2FWFA 5ECHB 4PX1A 2YWIA 3VI5A 2H70A 1M2DA 2X4AA 2A2SA 2HZEA 5HFKA 4NAXA 2P0GA 1YJ6A 1W89A 2QSIA 1CQGA 4OFMA 5CP1A 3TCOA 2ON7A 1B9XC 1LBKA 3FMWA 5IMCA 1ZYQB 1GSFA 3UAPA 2LTKA 3CSIA 2C0FA 3LYKA 4LMVA 3KP8A 4ZBBA 3GV1A 2DJ2A 2VLUA 2R3XA 4RI7A 1BYEA 3A5IA 5B6NA 3VWUA 2DC5A 4YKGA 5A5KA 3GKNA 5J4UA 1KBNA 1TRVA 4IJIA 4OD7A 3HVXA 1YZXA 2AV4A 4Q5QA 1GNEA 3GKXA 1ACVA 2B5XA 2C1YA 2YP6A 2MBTA 2F8FA 3WGXA 5EPFA 2JZRA 2RUEA 2OA7A 4BIKA 2NVLA 2CVBA 5JCUA 1EOHA 3BBYA 4JE1A 2OBIA 5HR2A 3JCML 2A4VA 4IVFA 1XVQA 3EMPA 5FT3A 2C80A 2VUPA 3QCPA 4IELA 3DD3A 3QOUA 4GWRA 4V2NA 4AGSA 1DUGA 2R0CA 3HVNA 1JFUA 2LNSA 3D0ZA 2XBQA 4ECIA 3O3TA 2HSHA 3E0UA 5CO3A 5JWOB 4ULXA 5IQYA 1EOGA 1MDIA 6GSUA 2YN1A 2J23A 4YAVA 4I5QA 4KUNA 5D9WA 2V2GA 5ECOB 4O92A 3TJJA 7GSSA 3DYRA 1PD21 3KP9A 4JR4A 2ALBA 3QAWA 3APQA 1Z6MA 6GSYA 3UBKA 2LJAA 4BVYA 2IFQA 2UZ8A 3LQ7A 1ZOFA 5AISA 1VF1A 2GZZA 4PGTA 1GLPA 3M9KA 3TB2A 1PN0A 1GSEA 2QA1A 4ZL8A 2XC2A 2LSTA 4KDYA 3UVTA 1I9DA 2C0EA 1FB6A 18GSA 3L9SA 4ZIJA 2OE3A 4O5UA 3H1NA 3P7XA 1DSBA 2A4HA 2TIRA 2CQ9A 4N30A 1KNGA 1U3IA 3TJGA 2JZTA 1RK4A 3LXTA 4DSSB 2GQMA 1PKZA 3D22A 1TP9A 3PR8A 1SD8A 3Q6OA 5G5FA 5DALA 1UC7A 2VLTA 3HY2A 1OE7A 2E2GA 3CSJA 1A8LA 3GL3A 2L4QA 4MABA 3GN3A 2H0IA 5G5EA 3NIVA 4IHUA 1RW1A 5ECIB 4H86A 2KOKA 1GTUA 2IWTA 1PQNA 3DWVA 4IP6A 4F9ZA 2RUFA 4KH7A 2WCIA 4IJ3A 3UBLA 3GNJA 3WT1A 2X8HA 3A2VA 4BWQA 2X49A 3VWWA 5ID2B 1I5GA 1NM3A 2YPMA 4AJ8A 2R4VA 2PUKC 3D5JA 5E4WA 4K2DA 4OO5A 2H73A 4EC0A 3D6IA 4K1FA 1U88A 1BEDA 2G2QA 4XS1A 1WWJA 5H5SA 5JCWA 5D9XA 2FA4A 1XW6A 3QPMA 3H93A 3CBUA 1N2AA 3ED3A 2VLVA 4ZB8A 2I1UA 1GSDA 2C4JA 4V1Ag 3W8JA 4AJ7A 2LQQA 5IOXA 2H6YA 1O85A 2LUSA 2IIYA 4N0VA 5GSSA 3R2QA 2YWOA 1QGVA 4Q5NA 4MJBA 3FYGA 2CAQA 1A2MA 2HFDA 3U5RE 1OKDA 4LA1A 1MD4A 5D9VA 3I43A 3KMNA 4IS0A 3HD5A 5ECMB 1B4PA 1F9MA 1DBYA 2OJLA 5EY6A 4GCIA 5DJLA 1V2AA 4MMMA 1M2BA 5DBQA 3TJKA 3MWHA 3FZ5A 2DJKA 5F8BA 3A5WA 5LD0A 1HNCA 3ZIVA 1MDJA 1ERWA 2E0QA 4G2EA 1EGOA 1ERVA 3ZFBA 1CQHA 2WS2A 3LEFA 1BG5A 4KSOA 4E8EA 5J41A 3APSA 2GZPA 4CHSA 5J5NA 1XCCA 1Z3EA 4PNGA 1OVNA 3K8NA 5F07A 4MK3A 2A2PA 2XPEA 1SK2A 4HOJA 2IPAA 2L4CA 3HVVA 3BJ5A 1VGLA 3DRNA 4K2XA 4KDUA 4F0BA 1K0NA 13GSA 2Z9SA 2FHEA 3F4TA 3KM6A 4LLRA 4ZL9A 1QXHA 1PSQA 1V9WA 3EINA 3M0FA 4XS4B 4FYBA 3HZ4A 4NWYA 4TKYA 4FO5A 3FZ9A 4BVXB 2OKAA 2XPDA 4KGIA 2PGTA 3ERGA 1SJIA 1AUCA 2WB9A 3TRPA 1ML6A 1OKTA 3TRQA 3RHCA 3P8WA 1GUKA 1GTBA 3EU4A 3EE2A 5JWRB 1SENA 1XWAA 2JSYA 2CZ2A 4JRRA 2H30A 1G7EA 3MYDA 5CRWA 3ZMLA 2YV9A 2BTOT 1X9MB 3KTBA 5CRHA 1XVWA 1FAAA 4ML1A 4RQRA 1S3CA 3IC4A 2EIRA 2X99A 4OFTA 1Q4JA 1G7OA 4DSSA 1TDIA 2P5QA 3HJMA 4X43A 1F37A 2CX4A 5IOWA 3SWLA 4WKWA 4F03A 4V1Ap 1AQXA 4POKA 3GH9A 1QFNA 3Q74A 1F2EA 3MIXA 5KN2A 3VWVA 4GXZA 1K0DA 5IMZA 4EVMA 2VCWA 1XG8A 3EPTA 3J7Yk 3LWAA 1GTIA 4DSRA 4MPFA 1OC3A 3LXZA 5C04A 1HYUA 2MMAA 2MMOA 4I2TA 1G6WA 2HXKA 1SK1A 3G7IA 1ST9A 1HQOA 5ID2A 1B48A 5IPHA 2MMNA 19GSA 3APOA 2A2RA 5FHIA 4WF4A 3TKSE 1AQWA 1GH2A 4WF5A 2K18A 3IPZA 1PL2A 4MJEA 2HRFA 1F3AA 2VD0A 4HZ4A 3UOMA 2N5FA 3MAKA 1FOVA 4V2LA 2HRKA 3M1GA 1EV4A 3C1SA 3MSZA 1SYRA 3GHAA 5L71A 4F0CA 2JACA 3IAM2 3F4RA 3IA1A 2LS5A 2G0FA 2VAFA 3GYKA 2LEGA 4TR3A 1HNAA 1QUWA 3L4NA 4CW9A 4EIPA 3IV4A 2I4AA 5JCGA 4K6XA 2GZYA 4HU7A 2E2MA 3IRAA 1A24A 2CX3A 1XXUA 5AGYA 3WD6A 1GP1A 3EYTA 4PQHA 4MF5A 4LL4B 2XBIA 1B4QA 4PURA 3J7Yb 2RLIA 4L5LA 2O89A 3LYPA 5ECLB 4IQ1A 4QL7A 3D4TA 1U87A 2VM1A 2RM6A 4O5RA 4IKHA 4OCFA 4GLTA 2O8VB 2K8SA 1X5CA 3GX8A 1OC9B 3C7MA 3RAZA 3VI7A 1EEJA 1WP0A 5A4VA 3A2WA 2YZHA 2PU9C 1HD2A 1SK0A 3E9JB 5GSTA 1GWCA 3FR9A 4TN8A 1SKRB 2FGXA 2PWJA 2TRCP 1V98A 5C00A 5D73A 4BWSA 3FR6A 4IP1A 3EWLA 3PGTA 4RUVA 1XWCA 1J08A 1Z5YE 3ZITA 4A5PA 4ZXGA 1JLWA 1K0BA 4N11A 2EIQA 3ME7A 1GL8A 1K0CA 4HUAA 4K5RA 4L0UA 1FVJA 1K0AA 2YJ7A 3PPUA 1M9AA 3U6VA 2MYGA 5DAKB 4XS4A 1ZMAA 2FNOA 3F6FA 3GX0A 4O5QA 3VURA 1PGTA 2VCTA 3F8UA 3BCIA 2DKHA 1YF1A 4XHMA 2R2JA 1V58A 1OC8A 3FRCA 4GRFA 2VO4A 2NDOA 1ERUA 4WR5A 1F6MC 1TK0B 1O73A 3GTUB 2K9FA 2O85A 1O7UA 1YEPA 1T8EB 3CTGA 5H5RA 1SKWB 1PL1A 1ON4A 4G0LA 1M3IA 3F9UA 4TW5A 3LJRA 4IN0A 4TR4A 4X4JA 2PN8A 3ZIJA 2H01A 2VL3A 3DMLA 2QGVA 3C1RA 3WGEA 2VD1A 3LG6A 1OE8A 1XIYA 2FD3A 3QMXA 4BL7B 1O8WA 2ZCTA 3ME8A 1A0FA 3ERFA 1ILOA 5JWQB 4ZL7A 2D2ZA 3DVXA 1J0FA 3IHGA 1EZKA 3LGCA 2WRTA 1HNBA 2V1MA 3GURA 2H19A 1G0TA 2DJ1A 3Q19A 3LSZA 4TXOA 4WEYA 3KH7A 2DKIA 4K8MA 2GSRA 1B8XA 2REMA 3KEBA 1T4ZA 4MF6A 4POBA 4G19A 2C0GA 3VLNA 4AF2A 2F9SA 5GAND 5LCZA 2HSYA 1N8JA 1BQ7A 2R37A 2N5BA 2FY6A 1TK5B 3G7YA 3VFIA 2AUVA 4J57E 4MA9A 3P2AA 4NV5A 4HI7A 3FK8A 4OO4A 3D4MA 2KHPA 2DMMA 1YQ1A 3HYPA 1Q98A 4K7OA 5DCHA 4PTSA 1MTCA 3OR5A 3KTLA 2HSMA 1GTAA 3QAVA 4G9HA 5IMDA 2KUCA 4USSA 4RQXA 3FW2A 1K0MA 2X64A 3GH6A 3H8QA 4POLA 2CA8A 4HQZA 3M3MA 3W6GA 5J9CA 2QC7A 4XS6A 1JZDA 2I3YA 3NZNA 4HJMA 1T7PB 3HJOA 3IDVA 3L9VA 4L5OA 5J9BA 2R6KA 1GLQA 3EC3A 2R0GA 5F06A 3FZAA 2PVQA 3KGKA 3VWXA 1K3OA 1AQVA 1YKCA 5A4WA 4XRDA 1Y6EA 2AB6A 4N10A 2DIYA 2GT6A 1KTEA 2NTOA 2GQKA 5EL8A 5B8AA 5CAXA 4E8HA 2HI7A 4WBJA 2GDRA 3FZ4A 3RBTA 4NXIA 3DKSA 2R5GA 4KE3A 1OC9A 3HDCA 3MNGA 1U3AA 4GTUA 3CTFA 4MH3A 1NHOA 5HQPA 1BX9A 4MZCA 2X8GA 2M72A 1UN2A 1TJDA 4MF7A 4HQSA 4MZWA 1TOFA 1FG4A 2H1AA 2HZEB 1AAZA 5AIVA 2MBSA 1TI1A 1JZRA 2VL2A 2L57A 3GL5A 3RPNA 2PBJA 1E2YA 1NHYA 4POMA 1FVKA 4ACSA 1TK8B 3TKQA 1YDKA 4WXTA 4NV2A 2MMZA 1NW2A 1ZL9A 5IO0A 1KEBA 9GSSA 2B3SA 2V32A 1DE2A 4TR1B 1PA3A 4LL1B 1A23A 3O6TA 5DAKA 2H6XA 1MD3A 2XHFA 1GSYA 2YANA 2LQOA 1K0OA 1M9BA 1RQMA 1M7TA 2LV3A 3ZFLA 5ECSA 2GGTA 1ERTA 4HDEA 4ZB9A 4KB3A 1X9SB 2HYXA 3GTUA 5AN1A 5EVOA 2ES7A 4KW6A 4ECCA 1S3AA 3UL3A 3I9V2 5KOWA 4TR0A 5KN3A 5A4UA 1V40A 4TRXA 1GRXA 2FA8A 3M8NA 5BMUA 3L0HA
chains in the Genus database with same CATH topology
2F51A 4V2MA 3ZZXA 2JL4A 1XOAA 1GNWA 2RIIA 1TU8A 1BJXA 4J56E 4Q5FA 1PX7A 1EP8A 4WR4A 2JADA 1EV9A 4BL7A 1Z7PA 2QA2A 5CNWA 4MNNA 2ZUPA 4YQVA 4NHZA 5COHA 3V1WA 5HFIA 1JHBA 3F63A 2K6VA 5AIXA 4ZB6A 2DJ0A 1THXA 1WPIA 3FY7A 3GRXA 4Z2TA 20GSA 3HVSA 4GSSA 1ZYNA 2CT6A 1PMTA 3TOUA 2VCXA 2H8LA 4XIHA 4OCEA 1K3LA 2P5RA 2P31A 4TVEA 3DGQA 2C3TA 1XWKA 3ZRDA 1ABAA 2HT9A 1QQ2A 1U6TA 2RM5A 4EL1A 3CMIA 4EF0A 2HZFA 3KCMA 4O32A 3TGZA 5DDLA 1X9WB 2L6CA 3N5OA 2YWNA 4BVYB 2IFQB 5ELGA 1VF2A 3IC8A 1ZYEA 2V41A 5KEJA 4PQ1A 5ECRB 5H5QA 3HZ8A 2DBCA 2CVDA 3RPPA 1WRYA 3GKMA 1M0UA 2LRCA 2L5LA 1OAZA 4X0XA 3ZLPA 3HHVA 5F05A 2MZCA 5HR0A 4IBPA 3QFAC 1SYXA 2DLXA 11GSA 4F2IA 1C72A 3FKFA 3F3QA 4MP4A 1T1VA 2PMTA 5DJMA 5GZZB 2CAIA 2C8UA 5ECQB 5ENUA 4G10A 3D21A 4I8BA 5J3RA 1URMA 3KXOA 2ON5A 4FH8A 2KP2A 4YKFA 3WGDA 2X8CA 2O87A 3C73A 3IE3A 2L6DA 2WFCA 1R4WA 22GSA 3Q18A 1VF3A 4ECJA 4JU5A 5HR3A 1Z6NA 4PXOA 1YEXA 5CYYA 4D73B 3UARA 4HEA2 4GQCA 1EWXA 1WE0A 3O76A 2JZSA 5B8BA 1PN9A 3KIJA 4TXVA 2VL9A 3QFBC 2LJKA 3GKKA 3PH9A 4XCSA 4GSTA 1WOUA 1TI3A 1BAYA 4DEJA 3G9BA 4MZBA 3C8EA 3ZL5A 2AJQB 3P90A 1TRUA 2YOIA 4OFNA 4KA0A 2DSAA 1YKAA 2QKEA 1X5EA 1QK8A 5IMVA 4I97A 1Y25A 3FEUA 1GSUA 4JEDA 2YV7A 2J9HA 3KZQA 1A8YA 4TR1A 1M2AA 4EXJA 5CREA 3CRUA 4EUYA 3F3RA 1WMJA 3KH9A 3WYWA 1GSQA 3HCZA 3TJFA 2FUG2 2IMKA 3TKRA 1V57A 2NBSA 3GMFA 3VK9A 2I81A 4L0WA 1X0RA 1X5DA 2HE3A 4AJ6A 1TXXA 5BRTA 1TU7A 1VRSD 2H1DA 1T00A 1LJRA 2DIZA 4YQMA 2YWMA 4I6XA 3AY8A 3US3A 5ECPB 1NSWA 4L8EA 3VPTA 1H75A 1R26A 1YY7A 2VCVA 1XW9A 2I9HA 1XBSA 4BVXA 3IBHA 2DJJA 4PUFC 3BCKA 1M99A 2FWHA 1F3BA 2LRNA 4K9ZA 3TRXA 3QDNA 5D93A 3N9JA 4CY8A 4EE0A 3H4KA 5LNKe 1S3DA 2H75A 1AC1A 3ZMKA 4KDXA 3IK7A 3RDWA 1WIKA 2V6KA 1FB0A 3UVHA 4IGJA 4P3YB 17GSA 4XTSA 1QMVA 2GS3A 1PRXA 1SL1B 2AAWA 1ZGNA 1YF0A 1SU9A 5D9TA 1AW9A 1ZCPA 1O8XA 2E7PA 2FWGA 5HR1A 2R0PA 1H4OA 1G6YA 4PNFA 3I6AA 4HS1A 2GSTA 5DCGA 1FO5A 2OBKA 1W4VA 1FW1A 3F0IA 3TKPA 5ELAA 3F6DA 3C71A 3DXBA 2B6MA 2VCZA 1TRWA 4K7NA 3ZREA 3GFKA 2GSQA 3UJ1A 2M80A 1AXDA 2JU5A 2WDUA 4EIQA 2N5AA 5DQSA 1R7HA 1GUHA 5KOXA 4IQAA 1JZOA 2H0HA 4YH2A 5KN1A 4TOPA 3R3EA 6GSWA 2BMXA 2TRXA 2CZ3A 4BA7A 3IR4A 3QR6A 4ML6A 4O7HA 2V6OA 3TJBA 8GSSA 5IO2A 1FOHA 1T3BA 4NMUA 2B1KA 3UIWA 4I2UA 1O81A 5G31A 1TTZA 4IW9A 1AIUA 3EMXA 3FHKA 4MLYA 4OMVA 4J2FA 2LJRA 2FLSA 5IIZA 4N0ZA 4D73A 4HJ2A 1R5PA 2B1LA 3E3EA 2WGRA 1Z9HA 5ECKB 2GQLA 3UMAA 3CXGA 4QQ7A 10GSA 3UEMA 3ZVJA 4EKZA 1SL0B 4NHWA 2YJHA 6GSTA 4FYCA 1XOBA 2L5OA 2B5EA 4KF9A 1UA5A 2OE0A 1UVZA 2B7JA 2IMEA 4GF0A 1XWGA 1TW9A 4EDYA 2YCDA 5INYA 5GAPD 2KP1A 1K3YA 5G2ZA 6GSSA 2H6ZA 2IJYA 5G1LA 3ISOA 3TKSA 4DSQA 2JSZA 2K8VA 12GSA 4NPBA 4FIWA 5G1KA 2C3QA 3G7JA 5G30A 5CRDA 2WULA 1SKSB 2HNLA 2IN3A 2L59A 3S9FA 3ERWA 2PVOC 5IMFA 4CY6A 3GA4A 1USBA 4PUAA 1GSSA 4ICYA 3ZVJD 3DIEA 1A2JA 3GUSA 4Z2RA 2BJXA 3NOFA 3GSSA 4EO3A 4MJAA 3QD9A 1R5AA 1ZYPA 3A2XA 2DMLA 2NPBA 1SJZA 1IYHA 2GVPA 4PQIA 1VF4A 4K0NA 3W8SA 2H74A 4GSNA 2GLRA 1A0RP 5D96A 4MH2A 4ECBA 3TKSC 2VCQA 3IXRA 1SL2B 2WJUA 2FWEA 2GT5A 3EURA 4FQUA 4K7IA 2GSSA 3IHQA 3HXSA 1JZWA 5DQYA 1TKDB 2CV4A 3RHBA 3ZYWA 2PPTA 2DJ3A 4YQUA 3BD2A 2M46A 3EU3A 1FHEA 2C0DA 4FYUA 3IAS2 2VL2C 4ZILA 3FR3A 3DVWA 3I69A 2YNXA 2H71A 5ABRA 3MDKA 1Z7RA 3TOTA 3DEXA 2HRNA 1SD9A 4JBBA 2O7KA 2IMDA 1JLVA 4MCUA 2WZ9A 2AHEA 3HKRA 6GSVA 1PX6A 5B7CA 3WT2A 4ZBDA 5IMAA 2EC4A 4F82A 4Z7XA 2F8AA 1TRSA 2CVKA 4G0KA 1PKWA 1XFLA 2VIMA 2EIOA 1T4YA 5IM9A 5IPGA 2AYTA 16GSA 2FCHA 1LU4A 4JR6A 4OWYA 3TDGA 1XWBA 1EP7A 3A3TA 2H66A 3KD0A 2C3NA 3KMOA 4YAPA 3EVIA 2HLSA 5DVBA 3KJYA 3L78A 4Z2UA 3CSHA 3M9JA 2VOCA 2HRAA 14GSA 5E59A 3IOSA 3CYNA 1E6BA 2VM2A 4DVCA 3CRTA 3LORA 6GSXA 4ILFA 2YZUA 4WETA 4GQFA 1A2LA 3VPQA 4ID0A 2IMFA 1WJKA 1XW5A 3TUEA 2B5YA 2OACA 2B7KA 2PERA 4KSMA 4JZQA 4ISDA 4HZ2A 3HA9A 4BPYA 2ZNMA 5F0GA 2H1GA 3SBCA 5FWGA 1OYJA 3F4SA 5KN0A 2LRTA 1EEMA 4X1UA 4TXOB 4G0IA 4KCEA 5HFGA 3BOAA 4KAEA 4EDZA 2F3MA 1J9BA 3PINA 1IYIA 4KX4A 5D8IA 3GIXA 1THOA 4HU9A 4MDCA 2GTUA 5B6MA 4KNDA 2H76A 1MDKA 3QAGA 1SJ6A 1XZOA 4KCAA 1O6JA 2LNTA 5DALB 4QL9A 4MPGA 4K5SA 4XRAA 3IK9A 4WBRD 2H0GA 1B9YC 2H72A 1ZZYA 2IMIA 5ECNB 4LMWA 3LW9A 2LKUA 4ZBAA 3GSTA 4CDOA 1GUMA 1XPVA 2OE1A 4MJCA 3HJPA 3L9UA 3LFLA 4Q5RA 5CRGA 2IL3A 1GULA 1EGRA 3H79A 4K0GA 1MEKA 2OADA 4RI6A 2KLXA 2H1BA 3ZTLA 1DE1A 2FWFA 5ECHB 4PX1A 2YWIA 3VI5A 2H70A 1M2DA 2X4AA 2A2SA 2HZEA 5HFKA 4NAXA 2P0GA 1YJ6A 1W89A 2QSIA 1CQGA 4OFMA 5CP1A 3TCOA 2ON7A 1B9XC 1LBKA 3FMWA 5IMCA 1ZYQB 1GSFA 3UAPA 2LTKA 3CSIA 2C0FA 3LYKA 4LMVA 3KP8A 4ZBBA 3GV1A 2DJ2A 2VLUA 2R3XA 4RI7A 1BYEA 3A5IA 5B6NA 3VWUA 2DC5A 4YKGA 5A5KA 3GKNA 5J4UA 1KBNA 1TRVA 4IJIA 4OD7A 3HVXA 1YZXA 2AV4A 4Q5QA 1GNEA 3GKXA 1ACVA 2B5XA 2C1YA 2YP6A 2MBTA 2F8FA 3WGXA 5EPFA 2JZRA 2RUEA 2OA7A 2NVLA 2CVBA 5JCUA 1EOHA 3BBYA 4JE1A 2OBIA 5HR2A 3JCML 2A4VA 4IVFA 1XVQA 3EMPA 5FT3A 2C80A 2VUPA 3QCPA 4IELA 3DD3A 3QOUA 4GWRA 4V2NA 4AGSA 1DUGA 2R0CA 1JFUA 2LNSA 3D0ZA 2XBQA 4ECIA 3O3TA 2HSHA 3E0UA 5CO3A 5JWOB 4ULXA 5IQYA 1EOGA 1MDIA 6GSUA 2YN1A 2J23A 4YAVA 4I5QA 4KUNA 5D9WA 2V2GA 5ECOB 4O92A 3TJJA 7GSSA 3DYRA 1PD21 3KP9A 4JR4A 2ALBA 3QAWA 3APQA 1Z6MA 6GSYA 3UBKA 2LJAA 4BVYA 2IFQA 2UZ8A 3LQ7A 1ZOFA 5AISA 1VF1A 2GZZA 4PGTA 1GLPA 3M9KA 3TB2A 1PN0A 1GSEA 2QA1A 4ZL8A 2XC2A 2LSTA 4KDYA 3UVTA 1I9DA 2C0EA 1FB6A 18GSA 3L9SA 4ZIJA 2OE3A 4O5UA 3H1NA 3P7XA 1DSBA 2A4HA 2TIRA 2CQ9A 4N30A 1KNGA 1U3IA 3TJGA 2JZTA 1RK4A 3LXTA 4DSSB 2GQMA 1PKZA 3D22A 1TP9A 3PR8A 1SD8A 3Q6OA 5G5FA 5DALA 1UC7A 2VLTA 3HY2A 1OE7A 2E2GA 3CSJA 1A8LA 3GL3A 2L4QA 4MABA 3GN3A 2H0IA 5G5EA 3NIVA 4IHUA 1RW1A 5ECIB 4H86A 2KOKA 1GTUA 2IWTA 1PQNA 3DWVA 4IP6A 4F9ZA 2RUFA 4KH7A 2WCIA 4IJ3A 3UBLA 3GNJA 3WT1A 2X8HA 3A2VA 4BWQA 2X49A 3VWWA 5ID2B 1I5GA 1NM3A 2YPMA 4AJ8A 2R4VA 2PUKC 3D5JA 5E4WA 4K2DA 4OO5A 2H73A 4EC0A 3D6IA 4K1FA 1U88A 1BEDA 2G2QA 4XS1A 1WWJA 5H5SA 5JCWA 5D9XA 2FA4A 1XW6A 3QPMA 3H93A 3CBUA 1N2AA 3ED3A 2VLVA 4ZB8A 2I1UA 1GSDA 2C4JA 4V1Ag 3W8JA 4AJ7A 2LQQA 5IOXA 2H6YA 1O85A 2LUSA 2IIYA 4N0VA 5GSSA 3R2QA 2YWOA 1QGVA 4Q5NA 4MJBA 3FYGA 2CAQA 1A2MA 2HFDA 3U5RE 1OKDA 4LA1A 1MD4A 5D9VA 3I43A 3KMNA 4IS0A 3HD5A 5ECMB 1B4PA 1F9MA 1DBYA 2OJLA 5EY6A 4GCIA 5DJLA 1V2AA 4MMMA 1M2BA 5DBQA 3TJKA 3MWHA 3FZ5A 2DJKA 5F8BA 3A5WA 5LD0A 1HNCA 3ZIVA 1MDJA 1ERWA 2E0QA 4G2EA 1EGOA 1ERVA 3ZFBA 1CQHA 2WS2A 3LEFA 1BG5A 4KSOA 4E8EA 5J41A 3APSA 2GZPA 4CHSA 5J5NA 1XCCA 1Z3EA 4PNGA 1OVNA 3K8NA 5F07A 4MK3A 2A2PA 2XPEA 1SK2A 4HOJA 2IPAA 2L4CA 3HVVA 3BJ5A 1VGLA 3DRNA 4K2XA 4KDUA 4F0BA 1K0NA 13GSA 2Z9SA 2FHEA 3F4TA 3KM6A 4LLRA 4ZL9A 1QXHA 1PSQA 1V9WA 3EINA 3M0FA 4XS4B 4FYBA 3HZ4A 4NWYA 4TKYA 4FO5A 3FZ9A 4BVXB 2OKAA 2XPDA 4KGIA 2PGTA 3ERGA 1SJIA 1AUCA 2WB9A 3TRPA 1ML6A 1OKTA 3TRQA 3RHCA 3P8WA 1GUKA 1GTBA 3EU4A 3EE2A 5JWRB 1SENA 1XWAA 2JSYA 2CZ2A 4JRRA 2H30A 1G7EA 3MYDA 5CRWA 3ZMLA 2YV9A 2BTOT 1X9MB 3KTBA 5CRHA 1XVWA 1FAAA 4ML1A 4RQRA 1S3CA 3IC4A 2EIRA 2X99A 4OFTA 1Q4JA 1G7OA 4DSSA 1TDIA 2P5QA 3HJMA 4X43A 1F37A 2CX4A 5IOWA 3SWLA 4WKWA 4F03A 4V1Ap 1AQXA 4POKA 3GH9A 1QFNA 3Q74A 1F2EA 3MIXA 5KN2A 3VWVA 4GXZA 1K0DA 5IMZA 4EVMA 2VCWA 3EPTA 3J7Yk 3LWAA 1GTIA 4DSRA 4MPFA 1OC3A 3LXZA 5C04A 1HYUA 2MMAA 2MMOA 4I2TA 1G6WA 2HXKA 1SK1A 3G7IA 1ST9A 1HQOA 5ID2A 1B48A 5IPHA 2MMNA 19GSA 3APOA 2A2RA 5FHIA 4WF4A 3TKSE 1AQWA 1GH2A 4WF5A 2K18A 3IPZA 1PL2A 4MJEA 2HRFA 1F3AA 2VD0A 4HZ4A 3UOMA 2N5FA 3MAKA 1FOVA 4V2LA 2HRKA 3M1GA 1EV4A 3C1SA 3MSZA 1SYRA 3GHAA 5L71A 4F0CA 2JACA 3IAM2 3F4RA 3IA1A 2LS5A 2G0FA 2VAFA 3GYKA 2LEGA 4TR3A 1HNAA 1QUWA 3L4NA 4CW9A 4EIPA 3IV4A 2I4AA 5JCGA 4K6XA 2GZYA 4HU7A 2E2MA 3IRAA 1A24A 2CX3A 1XXUA 5AGYA 3WD6A 1GP1A 3EYTA 4PQHA 4MF5A 4LL4B 2XBIA 1B4QA 4PURA 3J7Yb 2RLIA 4L5LA 2O89A 3LYPA 5ECLB 4IQ1A 4QL7A 3D4TA 1U87A 2VM1A 2RM6A 4O5RA 4IKHA 4OCFA 4GLTA 2O8VB 2K8SA 1X5CA 3GX8A 1OC9B 3C7MA 3RAZA 3VI7A 1EEJA 1WP0A 5A4VA 3A2WA 2YZHA 2PU9C 1HD2A 1SK0A 3E9JB 5GSTA 1GWCA 3FR9A 4TN8A 1SKRB 2FGXA 2PWJA 2TRCP 1V98A 5C00A 5D73A 4BWSA 3FR6A 4IP1A 3EWLA 3PGTA 4RUVA 1XWCA 1J08A 1Z5YE 3ZITA 4A5PA 4ZXGA 1JLWA 1K0BA 4N11A 2EIQA 3ME7A 1GL8A 1K0CA 4HUAA 4K5RA 4L0UA 1FVJA 1K0AA 2YJ7A 3PPUA 1M9AA 3U6VA 2MYGA 5DAKB 4XS4A 1ZMAA 2FNOA 3F6FA 3GX0A 4O5QA 3VURA 1PGTA 2VCTA 3F8UA 3BCIA 2DKHA 1YF1A 4XHMA 2R2JA 1V58A 1OC8A 3FRCA 4GRFA 2VO4A 2NDOA 1ERUA 4WR5A 1F6MC 1TK0B 1O73A 3GTUB 2K9FA 2O85A 1O7UA 1YEPA 1T8EB 3CTGA 5H5RA 1SKWB 1PL1A 1ON4A 4G0LA 3F9UA 4TW5A 3LJRA 4IN0A 4TR4A 4X4JA 2PN8A 3ZIJA 2H01A 2VL3A 3DMLA 2QGVA 3C1RA 3WGEA 2VD1A 3LG6A 1OE8A 1XIYA 2FD3A 3QMXA 4BL7B 1O8WA 2ZCTA 3ME8A 1A0FA 3ERFA 1ILOA 5JWQB 4ZL7A 2D2ZA 3DVXA 1J0FA 3IHGA 1EZKA 3LGCA 2WRTA 1HNBA 2V1MA 3GURA 2H19A 1G0TA 2DJ1A 3Q19A 3LSZA 4TXOA 4WEYA 3KH7A 2DKIA 4K8MA 2GSRA 1B8XA 2REMA 3KEBA 1T4ZA 4MF6A 4POBA 4G19A 2C0GA 3VLNA 4AF2A 2F9SA 5GAND 5LCZA 2HSYA 1N8JA 1BQ7A 2R37A 2N5BA 2FY6A 1TK5B 3G7YA 3VFIA 2AUVA 4J57E 4MA9A 3P2AA 4NV5A 4HI7A 3FK8A 4OO4A 3D4MA 2KHPA 2DMMA 1YQ1A 3HYPA 1Q98A 4K7OA 5DCHA 4PTSA 1MTCA 3OR5A 3KTLA 2HSMA 1GTAA 3QAVA 4G9HA 5IMDA 2KUCA 4USSA 4RQXA 3FW2A 1K0MA 2X64A 3GH6A 3H8QA 4POLA 2CA8A 4HQZA 3M3MA 3W6GA 5J9CA 2QC7A 4XS6A 1JZDA 2I3YA 3NZNA 4HJMA 1T7PB 3HJOA 3IDVA 3L9VA 4L5OA 5J9BA 2R6KA 1GLQA 3EC3A 2R0GA 5F06A 3FZAA 2PVQA 3KGKA 3VWXA 1K3OA 1AQVA 1YKCA 5A4WA 4XRDA 1Y6EA 2AB6A 4N10A 2DIYA 2GT6A 1KTEA 2NTOA 2GQKA 5EL8A 5B8AA 5CAXA 4E8HA 2HI7A 4WBJA 2GDRA 3FZ4A 3RBTA 4NXIA 3DKSA 2R5GA 4KE3A 1OC9A 3HDCA 3MNGA 1U3AA 4GTUA 3CTFA 4MH3A 1NHOA 5HQPA 1BX9A 4MZCA 2X8GA 2M72A 1UN2A 1TJDA 4MF7A 4HQSA 4MZWA 1TOFA 1FG4A 2H1AA 2HZEB 1AAZA 5AIVA 2MBSA 1TI1A 1JZRA 2VL2A 2L57A 3GL5A 3RPNA 2PBJA 1E2YA 1NHYA 4POMA 1FVKA 4ACSA 1TK8B 3TKQA 1YDKA 4WXTA 4NV2A 2MMZA 1NW2A 1ZL9A 5IO0A 1KEBA 9GSSA 2B3SA 2V32A 1DE2A 4TR1B 1PA3A 4LL1B 1A23A 3O6TA 5DAKA 2H6XA 1MD3A 2XHFA 1GSYA 2YANA 2LQOA 1K0OA 1M9BA 1RQMA 1M7TA 2LV3A 3ZFLA 5ECSA 2GGTA 1ERTA 4HDEA 4ZB9A 4KB3A 1X9SB 2HYXA 3GTUA 5AN1A 5EVOA 2ES7A 4KW6A 4ECCA 1S3AA 3UL3A 3I9V2 5KOWA 4TR0A 5KN3A 5A4UA 1V40A 4TRXA 1GRXA 2FA8A 3M8NA 5BMUA 3L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F51 A;  4V2M A;  3ZZX A;  2JL4 A;  1XOA A;  1GNW A;  2RII A;  1TU8 A;  1BJX A;  4J56 E;  4Q5F A;  1PX7 A;  1EP8 A;  4WR4 A;  2JAD A;  1EV9 A;  4BL7 A;  1Z7P A;  5CNW A;  2ZUP A;  4YQV A;  4NHZ A;  5COH A;  3V1W A;  5HFI A;  1JHB A;  3F63 A;  2K6V A;  5AIX A;  4ZB6 A;  2DJ0 A;  1THX A;  1WPI A;  3FY7 A;  3GRX A;  20GS A;  3HVS A;  4GSS A;  2CT6 A;  1PMT A;  3TOU A;  2VCX A;  2H8L A;  4XIH A;  4OCE A;  1K3L A;  2P5R A;  2P31 A;  4TVE A;  3DGQ A;  2C3T A;  1XWK A;  3ZRD A;  1ABA A;  2HT9 A;  1QQ2 A;  1U6T A;  2RM5 A;  4EL1 A;  3CMI A;  4EF0 A;  2HZF A;  3KCM A;  4O32 A;  3TGZ A;  5DDL A;  1X9W B;  2L6C A;  3N5O A;  2YWN A;  2IFQ B;  5ELG A;  1VF2 A;  1ZYE A;  2V41 A;  5KEJ A;  4PQ1 A;  5ECR B;  5H5Q A;  3HZ8 A;  2DBC A;  2CVD A;  3RPP A;  1WRY A;  3GKM A;  1M0U A;  2LRC A;  2L5L A;  1OAZ A;  4X0X A;  3ZLP A;  3HHV A;  5F05 A;  2MZC A;  5HR0 A;  4IBP A;  3QFA C;  1SYX A;  2DLX A;  11GS A;  4F2I A;  1C72 A;  3FKF A;  3F3Q A;  4MP4 A;  1T1V A;  2PMT A;  5DJM A;  5GZZ B;  2CAI A;  2C8U A;  5ECQ B;  5ENU A;  4G10 A;  3D21 A;  4I8B A;  5J3R A;  1URM A;  3KXO A;  2ON5 A;  4FH8 A;  2KP2 A;  3WGD A;  2X8C A;  2O87 A;  3C73 A;  3IE3 A;  2L6D A;  2WFC A;  1R4W A;  22GS A;  3Q18 A;  1VF3 A;  4ECJ A;  4JU5 A;  5HR3 A;  1Z6N A;  4PXO A;  1YEX A;  5CYY A;  4D73 B;  3UAR A;  4HEA 2;  4GQC A;  1EWX A;  1WE0 A;  3O76 A;  2JZS A;  5B8B A;  1PN9 A;  3KIJ A;  4TXV A;  2VL9 A;  3QFB C;  2LJK A;  3GKK A;  3PH9 A;  4XCS A;  4GST A;  1WOU A;  1TI3 A;  1BAY A;  4DEJ A;  3G9B A;  4MZB A;  3C8E A;  3ZL5 A;  2AJQ B;  3P90 A;  1TRU A;  2YOI A;  4OFN A;  4KA0 A;  2DSA A;  1YKA A;  2QKE A;  1X5E A;  1QK8 A;  5IMV A;  4I97 A;  1Y25 A;  3FEU A;  1GSU A;  4JED A;  2YV7 A;  2J9H A;  3KZQ A;  1A8Y A;  4TR1 A;  1M2A A;  4EXJ A;  5CRE A;  3CRU A;  4EUY A;  3F3R A;  1WMJ A;  3KH9 A;  3WYW A;  1GSQ A;  3HCZ A;  3TJF A;  2FUG 2;  2IMK A;  3TKR A;  1V57 A;  2NBS A;  3GMF A;  3VK9 A;  2I81 A;  4L0W A;  1X0R A;  1X5D A;  2HE3 A;  4AJ6 A;  1TXX A;  1TU7 A;  1VRS D;  2H1D A;  1T00 A;  1LJR A;  2DIZ A;  4YQM A;  2YWM A;  4I6X A;  3AY8 A;  3US3 A;  5ECP B;  1NSW A;  4L8E A;  3VPT A;  1H75 A;  1R26 A;  1YY7 A;  2VCV A;  1XW9 A;  2I9H A;  1XBS A;  4BVX A;  3IBH A;  2DJJ A;  4PUF C;  3BCK A;  1M99 A;  2FWH A;  1F3B A;  2LRN A;  4K9Z A;  3TRX A;  3QDN A;  5D93 A;  3N9J A;  4EE0 A;  5LNK e;  3H4K A;  1S3D A;  2H75 A;  1AC1 A;  3ZMK A;  4KDX A;  3IK7 A;  3RDW A;  1WIK A;  2V6K A;  1FB0 A;  3UVH A;  4IGJ A;  4P3Y B;  17GS A;  4XTS A;  1QMV A;  2GS3 A;  1PRX A;  1SL1 B;  2AAW A;  1ZGN A;  1YF0 A;  1SU9 A;  5D9T A;  1AW9 A;  1ZCP A;  1O8X A;  2E7P A;  2FWG A;  5HR1 A;  4PNF A;  1H4O A;  1G6Y A;  3I6A A;  4HS1 A;  2GST A;  5DCG A;  1FO5 A;  2OBK A;  1W4V A;  1FW1 A;  3F0I A;  3TKP A;  5ELA A;  3F6D A;  3C71 A;  3DXB A;  2B6M A;  2VCZ A;  1TRW A;  4K7N A;  3ZRE A;  3GFK A;  2GSQ A;  3UJ1 A;  2M80 A;  1AXD A;  2JU5 A;  2WDU A;  2N5A A;  5DQS A;  1R7H A;  1GUH A;  4IQA A;  1JZO A;  2H0H A;  4YH2 A;  5KN1 A;  4TOP A;  6GSW A;  2BMX A;  2TRX A;  2CZ3 A;  4BA7 A;  3IR4 A;  3QR6 A;  4ML6 A;  4O7H A;  2V6O A;  3TJB A;  8GSS A;  5IO2 A;  1T3B A;  4NMU A;  2B1K A;  3UIW A;  4I2U A;  1O81 A;  5G31 A;  1TTZ A;  4IW9 A;  1AIU A;  3EMX A;  3FHK A;  4MLY A;  4OMV A;  4J2F A;  2LJR A;  2FLS A;  5IIZ A;  4N0Z A;  4D73 A;  4HJ2 A;  1R5P A;  2B1L A;  3E3E A;  2WGR A;  1Z9H A;  5ECK B;  2GQL A;  3UMA A;  3CXG A;  4QQ7 A;  10GS A;  3UEM A;  3ZVJ A;  4EKZ A;  1SL0 B;  4NHW A;  2YJH A;  6GST A;  4FYC A;  1XOB A;  2L5O A;  2B5E A;  1UA5 A;  2OE0 A;  1UVZ A;  2B7J A;  2IME A;  4GF0 A;  1XWG A;  1TW9 A;  4EDY A;  2YCD A;  5INY A;  5GAP D;  2KP1 A;  1K3Y A;  5G2Z A;  6GSS A;  2H6Z A;  2IJY A;  5G1L A;  3ISO A;  3TKS A;  4DSQ A;  2JSZ A;  2K8V A;  12GS A;  4NPB A;  4FIW A;  5G1K A;  2C3Q A;  3G7J A;  5G30 A;  5CRD A;  2WUL A;  1SKS B;  2HNL A;  2IN3 A;  2L59 A;  3S9F A;  3ERW A;  2PVO C;  5IMF A;  3GA4 A;  1USB A;  4PUA A;  1GSS A;  3ZVJ D;  3DIE A;  1A2J A;  3GUS A;  2BJX A;  3NOF A;  3GSS A;  4EO3 A;  4MJA A;  3QD9 A;  1R5A A;  3A2X A;  2DML A;  2NPB A;  1SJZ A;  1IYH A;  2GVP A;  4PQI A;  1VF4 A;  4K0N A;  3W8S A;  2H74 A;  4GSN A;  2GLR A;  1A0R P;  5D96 A;  4MH2 A;  4ECB A;  3TKS C;  2VCQ A;  3IXR A;  1SL2 B;  2WJU A;  2FWE A;  2GT5 A;  3EUR A;  4K7I A;  2GSS A;  3IHQ A;  3HXS A;  1JZW A;  5DQY A;  1TKD B;  2CV4 A;  3RHB A;  3ZYW A;  2PPT A;  2DJ3 A;  4YQU A;  3BD2 A;  2M46 A;  3EU3 A;  1FHE A;  2C0D A;  4FYU A;  3IAS 2;  2VL2 C;  4ZIL A;  3FR3 A;  3DVW A;  3I69 A;  2YNX A;  2H71 A;  5ABR A;  3MDK A;  1Z7R A;  3TOT A;  3DEX A;  2HRN A;  1SD9 A;  4JBB A;  2O7K A;  2IMD A;  1JLV A;  4MCU A;  2WZ9 A;  2AHE A;  3HKR A;  6GSV A;  1PX6 A;  5B7C A;  3WT2 A;  4ZBD A;  5IMA A;  2EC4 A;  4F82 A;  4Z7X A;  2F8A A;  1TRS A;  2CVK A;  1PKW A;  1XFL A;  2VIM A;  2EIO A;  1T4Y A;  5IM9 A;  5IPG A;  2AYT A;  16GS A;  2FCH A;  1LU4 A;  4JR6 A;  4OWY A;  3TDG A;  1XWB A;  1EP7 A;  3A3T A;  2H66 A;  3KD0 A;  2C3N A;  3KMO A;  4YAP A;  3EVI A;  2HLS A;  5DVB A;  3KJY A;  3L78 A;  3CSH A;  3M9J A;  2VOC A;  14GS A;  5E59 A;  3IOS A;  3CYN A;  1E6B A;  2VM2 A;  4DVC A;  3CRT A;  3LOR A;  6GSX A;  4ILF A;  2YZU A;  4WET A;  4GQF A;  1A2L A;  3VPQ A;  4ID0 A;  2IMF A;  1WJK A;  1XW5 A;  3TUE A;  2B5Y A;  2OAC A;  2B7K A;  2PER A;  4KSM A;  4JZQ A;  4ISD A;  4HZ2 A;  3HA9 A;  4BPY A;  2ZNM A;  5F0G A;  2H1G A;  3SBC A;  5FWG A;  1OYJ A;  3F4S A;  5KN0 A;  2LRT A;  1EEM A;  4X1U A;  4TXO B;  4KCE A;  5HFG A;  3BOA A;  4KAE A;  4EDZ A;  2F3M A;  1J9B A;  3PIN A;  1IYI A;  4KX4 A;  5D8I A;  3GIX A;  1THO A;  4HU9 A;  4MDC A;  2GTU A;  5B6M A;  4KND A;  2H76 A;  1MDK A;  3QAG A;  1SJ6 A;  1XZO A;  4KCA A;  1O6J A;  2LNT A;  5DAL B;  4QL9 A;  4MPG A;  4XRA A;  3IK9 A;  4WBR D;  2H0G A;  1B9Y C;  2H72 A;  1ZZY A;  2IMI A;  5ECN B;  4LMW A;  2LKU A;  4ZBA A;  3GST A;  4CDO A;  1GUM A;  1XPV A;  2OE1 A;  4MJC A;  3HJP A;  3L9U A;  3LFL A;  4Q5R A;  5CRG A;  2IL3 A;  1GUL A;  1EGR A;  3H79 A;  4K0G A;  1MEK A;  2OAD A;  4RI6 A;  2KLX A;  2H1B A;  3ZTL A;  1DE1 A;  2FWF A;  5ECH B;  4PX1 A;  2YWI A;  3VI5 A;  2H70 A;  1M2D A;  2A2S A;  2HZE A;  5HFK A;  4NAX A;  2P0G A;  1YJ6 A;  1W89 A;  2QSI A;  1CQG A;  4OFM A;  5CP1 A;  3TCO A;  2ON7 A;  1B9X C;  1LBK A;  5IMC A;  1ZYQ B;  1GSF A;  3UAP A;  2LTK A;  3CSI A;  2C0F A;  3LYK A;  4LMV A;  3KP8 A;  4ZBB A;  3GV1 A;  2DJ2 A;  2VLU A;  2R3X A;  4RI7 A;  1BYE A;  5B6N A;  3VWU A;  2DC5 A;  5A5K A;  3GKN A;  5J4U A;  1KBN A;  1TRV A;  4IJI A;  4OD7 A;  3HVX A;  1YZX A;  2AV4 A;  4Q5Q A;  1GNE A;  3GKX A;  1ACV A;  2B5X A;  2C1Y A;  2YP6 A;  2MBT A;  2F8F A;  3WGX A;  5EPF A;  2JZR A;  2RUE A;  2OA7 A;  2NVL A;  2CVB A;  5JCU A;  1EOH A;  3BBY A;  4JE1 A;  2OBI A;  5HR2 A;  3JCM L;  2A4V A;  4IVF A;  1XVQ A;  3EMP A;  5FT3 A;  2C80 A;  2VUP A;  3QCP A;  4IEL A;  3DD3 A;  3QOU A;  4GWR A;  4V2N A;  4AGS A;  1DUG A;  1JFU A;  2LNS A;  3D0Z A;  2XBQ A;  4ECI A;  3O3T A;  2HSH A;  3E0U A;  5CO3 A;  5JWO B;  4ULX A;  5IQY A;  1EOG A;  1MDI A;  6GSU A;  2YN1 A;  2J23 A;  4YAV A;  4I5Q A;  4KUN A;  5D9W A;  2V2G A;  5ECO B;  4O92 A;  3TJJ A;  7GSS A;  3DYR A;  1PD2 1;  3KP9 A;  4JR4 A;  2ALB A;  3QAW A;  3APQ A;  1Z6M A;  6GSY A;  3UBK A;  2LJA A;  4BVY A;  2IFQ A;  3LQ7 A;  1ZOF A;  5AIS A;  1VF1 A;  2GZZ A;  4PGT A;  1GLP A;  3M9K A;  3TB2 A;  1GSE A;  4ZL8 A;  2XC2 A;  2LST A;  4KDY A;  3UVT A;  1I9D A;  2C0E A;  1FB6 A;  18GS A;  3L9S A;  4ZIJ A;  2OE3 A;  3H1N A;  3P7X A;  1DSB A;  2TIR A;  2CQ9 A;  4N30 A;  1KNG A;  1U3I A;  3TJG A;  2JZT A;  1RK4 A;  3LXT A;  4DSS B;  2GQM A;  1PKZ A;  3D22 A;  1TP9 A;  3PR8 A;  1SD8 A;  3Q6O A;  5G5F A;  5DAL A;  1UC7 A;  2VLT A;  3HY2 A;  1OE7 A;  2E2G A;  3CSJ A;  1A8L A;  3GL3 A;  2L4Q A;  4MAB A;  3GN3 A;  2H0I A;  5G5E A;  3NIV A;  4IHU A;  1RW1 A;  5ECI B;  4H86 A;  2KOK A;  1GTU A;  2IWT A;  1PQN A;  3DWV A;  4IP6 A;  4F9Z A;  2RUF A;  4KH7 A;  2WCI A;  4IJ3 A;  3UBL A;  3GNJ A;  3WT1 A;  2X8H A;  3A2V A;  4BWQ A;  3VWW A;  5ID2 B;  1I5G A;  1NM3 A;  2YPM A;  4AJ8 A;  2R4V A;  2PUK C;  3D5J A;  5E4W A;  4K2D A;  4OO5 A;  2H73 A;  4EC0 A;  3D6I A;  4K1F A;  1U88 A;  1BED A;  2G2Q A;  4XS1 A;  1WWJ A;  5H5S A;  5JCW A;  5D9X A;  2FA4 A;  1XW6 A;  3QPM A;  3H93 A;  3CBU A;  1N2A A;  3ED3 A;  2VLV A;  4ZB8 A;  2I1U A;  1GSD A;  2C4J A;  4V1A g;  3W8J A;  4AJ7 A;  2LQQ A;  5IOX A;  2H6Y A;  1O85 A;  2LUS A;  2IIY A;  4N0V A;  5GSS A;  3R2Q A;  2YWO A;  1QGV A;  4Q5N A;  4MJB A;  3FYG A;  2CAQ A;  1A2M A;  2HFD A;  3U5R E;  1OKD A;  4LA1 A;  1MD4 A;  5D9V A;  3I43 A;  3KMN A;  4IS0 A;  3HD5 A;  5ECM B;  1B4P A;  1F9M A;  1DBY A;  2OJL A;  5EY6 A;  4GCI A;  5DJL A;  1V2A A;  4MMM A;  1M2B A;  5DBQ A;  3TJK A;  3MWH A;  3FZ5 A;  2DJK A;  5F8B A;  3A5W A;  5LD0 A;  1HNC A;  3ZIV A;  1MDJ A;  1ERW A;  2E0Q A;  4G2E A;  1EGO A;  1ERV A;  3ZFB A;  1CQH A;  2WS2 A;  3LEF A;  1BG5 A;  4KSO A;  4E8E A;  5J41 A;  3APS A;  2GZP A;  4CHS A;  5J5N A;  1XCC A;  1Z3E A;  4PNG A;  1OVN A;  3K8N A;  5F07 A;  4MK3 A;  2XPE A;  1SK2 A;  4HOJ A;  2IPA A;  2L4C A;  3HVV A;  3BJ5 A;  1VGL A;  3DRN A;  4KDU A;  4F0B A;  1K0N A;  13GS A;  2Z9S A;  2FHE A;  3F4T A;  3KM6 A;  4LLR A;  4ZL9 A;  1QXH A;  1PSQ A;  1V9W A;  3EIN A;  3M0F A;  4XS4 B;  4FYB A;  3HZ4 A;  4NWY A;  4TKY A;  4FO5 A;  3FZ9 A;  2OKA A;  2XPD A;  4KGI A;  2PGT A;  3ERG A;  1SJI A;  1AUC A;  2WB9 A;  3TRP A;  1ML6 A;  1OKT A;  3TRQ A;  3RHC A;  3P8W A;  1GUK A;  1GTB A;  3EU4 A;  3EE2 A;  5JWR B;  1SEN A;  1XWA A;  2JSY A;  2CZ2 A;  4JRR A;  2H30 A;  1G7E A;  5CRW A;  3ZML A;  2YV9 A;  2BTO T;  1X9M B;  3KTB A;  5CRH A;  1XVW A;  1FAA A;  4ML1 A;  4RQR A;  1S3C A;  3IC4 A;  2EIR A;  2X99 A;  4OFT A;  1Q4J A;  1G7O A;  4DSS A;  1TDI A;  2P5Q A;  3HJM A;  4X43 A;  1F37 A;  2CX4 A;  5IOW A;  3SWL A;  4WKW A;  4F03 A;  4V1A p;  1AQX A;  4POK A;  3GH9 A;  1QFN A;  3Q74 A;  1F2E A;  5KN2 A;  3VWV A;  4GXZ A;  1K0D A;  5IMZ A;  4EVM A;  2VCW A;  3J7Y k;  3LWA A;  1GTI A;  4DSR A;  4MPF A;  1OC3 A;  3LXZ A;  5C04 A;  1HYU A;  2MMA A;  2MMO A;  4I2T A;  1G6W A;  2HXK A;  1SK1 A;  3G7I A;  1ST9 A;  1HQO A;  5ID2 A;  1B48 A;  5IPH A;  2MMN A;  19GS A;  3APO A;  2A2R A;  5FHI A;  4WF4 A;  3TKS E;  1AQW A;  1GH2 A;  4WF5 A;  2K18 A;  3IPZ A;  1PL2 A;  4MJE A;  2HRF A;  1F3A A;  2VD0 A;  4HZ4 A;  3UOM A;  2N5F A;  3MAK A;  1FOV A;  4V2L A;  3M1G A;  1EV4 A;  3C1S A;  3MSZ A;  1SYR A;  3GHA A;  5L71 A;  4F0C A;  2JAC A;  3IAM 2;  3F4R A;  3IA1 A;  2LS5 A;  2G0F A;  2VAF A;  3GYK A;  2LEG A;  4TR3 A;  1HNA A;  1QUW A;  3L4N A;  4CW9 A;  3IV4 A;  2I4A A;  5JCG A;  4K6X A;  2GZY A;  4HU7 A;  2E2M A;  3IRA A;  1A24 A;  2CX3 A;  1XXU A;  5AGY A;  3WD6 A;  1GP1 A;  3EYT A;  4PQH A;  4MF5 A;  4LL4 B;  2XBI A;  1B4Q A;  4PUR A;  3J7Y b;  2RLI A;  4L5L A;  2O89 A;  3LYP A;  5ECL B;  4IQ1 A;  4QL7 A;  3D4T A;  1U87 A;  2VM1 A;  2RM6 A;  4O5R A;  4IKH A;  4OCF A;  4GLT A;  2O8V B;  2K8S A;  1X5C A;  3GX8 A;  1OC9 B;  3C7M A;  3RAZ A;  3VI7 A;  1EEJ A;  1WP0 A;  5A4V A;  3A2W A;  2YZH A;  2PU9 C;  1HD2 A;  1SK0 A;  3E9J B;  5GST A;  1GWC A;  3FR9 A;  4TN8 A;  1SKR B;  2FGX A;  2PWJ A;  2TRC P;  1V98 A;  5C00 A;  5D73 A;  4BWS A;  3FR6 A;  4IP1 A;  3EWL A;  3PGT A;  4RUV A;  1XWC A;  1J08 A;  1Z5Y E;  3ZIT A;  4ZXG A;  1JLW A;  1K0B A;  4N11 A;  2EIQ A;  3ME7 A;  1GL8 A;  1K0C A;  4HUA A;  4L0U A;  1FVJ A;  1K0A A;  2YJ7 A;  1M9A A;  3U6V A;  2MYG A;  5DAK B;  4XS4 A;  1ZMA A;  2FNO A;  3F6F A;  3GX0 A;  3VUR A;  1PGT A;  2VCT A;  3F8U A;  3BCI A;  1YF1 A;  4XHM A;  2R2J A;  1V58 A;  1OC8 A;  3FRC A;  4GRF A;  2VO4 A;  2NDO A;  1ERU A;  4WR5 A;  1F6M C;  1TK0 B;  1O73 A;  3GTU B;  2K9F A;  2O85 A;  1O7U A;  1YEP A;  1T8E B;  3CTG A;  5H5R A;  1SKW B;  1PL1 A;  1ON4 A;  3F9U A;  4TW5 A;  3LJR A;  4IN0 A;  4TR4 A;  2PN8 A;  3ZIJ A;  2H01 A;  2VL3 A;  3DML A;  2QGV A;  3C1R A;  3WGE A;  2VD1 A;  3LG6 A;  1OE8 A;  1XIY A;  2FD3 A;  3QMX A;  1O8W A;  2ZCT A;  3ME8 A;  1A0F A;  3ERF A;  1ILO A;  5JWQ B;  4ZL7 A;  2D2Z A;  3DVX A;  1J0F A;  1EZK A;  3LGC A;  2WRT A;  1HNB A;  2V1M A;  3GUR A;  2H19 A;  1G0T A;  2DJ1 A;  3Q19 A;  3LSZ A;  4TXO A;  4WEY A;  3KH7 A;  4K8M A;  2GSR A;  1B8X A;  2REM A;  3KEB A;  1T4Z A;  4MF6 A;  4POB A;  4G19 A;  2C0G A;  3VLN A;  4AF2 A;  2F9S A;  5GAN D;  5LCZ A;  2HSY A;  1N8J A;  1BQ7 A;  2R37 A;  2N5B A;  2FY6 A;  1TK5 B;  3G7Y A;  3VFI A;  2AUV A;  4J57 E;  4MA9 A;  3P2A A;  4NV5 A;  4HI7 A;  3FK8 A;  4OO4 A;  3D4M A;  2KHP A;  2DMM A;  1YQ1 A;  3HYP A;  1Q98 A;  4K7O A;  5DCH A;  3OR5 A;  1MTC A;  3KTL A;  1GTA A;  3QAV A;  4G9H A;  5IMD A;  2KUC A;  4RQX A;  3FW2 A;  1K0M A;  2X64 A;  3GH6 A;  3H8Q A;  4POL A;  2CA8 A;  4HQZ A;  3M3M A;  3W6G A;  5J9C A;  2QC7 A;  4XS6 A;  1JZD A;  2I3Y A;  3NZN A;  4HJM A;  1T7P B;  3HJO A;  3IDV A;  3L9V A;  4L5O A;  5J9B A;  2R6K A;  1GLQ A;  3EC3 A;  5F06 A;  3FZA A;  2PVQ A;  3KGK A;  3VWX A;  1K3O A;  1AQV A;  1YKC A;  5A4W A;  4XRD A;  1Y6E A;  2AB6 A;  4N10 A;  2DIY A;  2GT6 A;  1KTE A;  2NTO A;  2GQK A;  5EL8 A;  5B8A A;  5CAX A;  4E8H A;  2HI7 A;  4WBJ A;  2GDR A;  3FZ4 A;  3RBT A;  4NXI A;  3DKS A;  2R5G A;  4KE3 A;  1OC9 A;  3HDC A;  3MNG A;  1U3A A;  4GTU A;  3CTF A;  4MH3 A;  1NHO A;  5HQP A;  1BX9 A;  4MZC A;  2X8G A;  2M72 A;  1UN2 A;  1TJD A;  4MF7 A;  4HQS A;  4MZW A;  1TOF A;  1FG4 A;  2H1A A;  2HZE B;  1AAZ A;  5AIV A;  2MBS A;  1TI1 A;  1JZR A;  2VL2 A;  2L57 A;  3GL5 A;  3RPN A;  2PBJ A;  1E2Y A;  1NHY A;  4POM A;  1FVK A;  4ACS A;  1TK8 B;  3TKQ A;  1YDK A;  4WXT A;  4NV2 A;  2MMZ A;  1NW2 A;  1ZL9 A;  5IO0 A;  1KEB A;  9GSS A;  2B3S A;  2V32 A;  1DE2 A;  4TR1 B;  1PA3 A;  4LL1 B;  1A23 A;  3O6T A;  5DAK A;  2H6X A;  1MD3 A;  2XHF A;  1GSY A;  2YAN A;  2LQO A;  1K0O A;  1M9B A;  1RQM A;  1M7T A;  2LV3 A;  3ZFL A;  5ECS A;  2GGT A;  1ERT A;  4HDE A;  4ZB9 A;  4KB3 A;  1X9S B;  2HYX A;  3GTU A;  5AN1 A;  5EVO A;  2ES7 A;  4KW6 A;  4ECC A;  1S3A A;  3UL3 A;  3I9V 2;  4TR0 A;  5KN3 A;  5A4U A;  1V40 A;  4TRX A;  1GRX A;  2FA8 A;  3M8N A;  3L0H A; 
#chains in the Genus database with same CATH topology
 2F51 A;  4V2M A;  3ZZX A;  2JL4 A;  1XOA A;  1GNW A;  2RII A;  1TU8 A;  1BJX A;  4J56 E;  3CQF A;  4Q5F A;  1PX7 A;  1EP8 A;  4WR4 A;  2JAD A;  1EV9 A;  4BL7 A;  1Z7P A;  2QA2 A;  5CNW A;  4MNN A;  2ZUP A;  4YQV A;  4NHZ A;  5COH A;  3V1W A;  5HFI A;  1JHB A;  3F63 A;  2K6V A;  5AIX A;  4ZB6 A;  2DJ0 A;  1THX A;  1WPI A;  3FY7 A;  3GRX A;  4Z2T A;  20GS A;  3HVS A;  4GSS A;  1ZYN A;  2CT6 A;  1PMT A;  3TOU A;  2VCX A;  2H8L A;  4XIH A;  4OCE A;  1K3L A;  2P5R A;  2P31 A;  4TVE A;  3DGQ A;  2C3T A;  1XWK A;  3ZRD A;  1ABA A;  2HT9 A;  1QQ2 A;  1U6T A;  2RM5 A;  4EL1 A;  3CMI A;  4EF0 A;  2HZF A;  3KCM A;  4O32 A;  3TGZ A;  5DDL A;  1X9W B;  2L6C A;  3N5O A;  2YWN A;  4BVY B;  2IFQ B;  5ELG A;  1VF2 A;  3IC8 A;  1ZYE A;  2V41 A;  5KEJ A;  4PQ1 A;  5ECR B;  5H5Q A;  3HZ8 A;  2DBC A;  2CVD A;  3RPP A;  1WRY A;  3GKM A;  1M0U A;  2LRC A;  2L5L A;  1OAZ A;  4X0X A;  3ZLP A;  3HHV A;  5F05 A;  2MZC A;  5HR0 A;  4IBP A;  3QFA C;  1SYX A;  2DLX A;  11GS A;  4F2I A;  1C72 A;  3FKF A;  3F3Q A;  4MP4 A;  1T1V A;  2PMT A;  5DJM A;  5GZZ B;  2CAI A;  2C8U A;  5ECQ B;  5ENU A;  1PFO A;  4G10 A;  3D21 A;  4I8B A;  5J3R A;  1URM A;  3KXO A;  2ON5 A;  4FH8 A;  2KP2 A;  4YKF A;  3WGD A;  2X8C A;  2O87 A;  3C73 A;  3IE3 A;  2L6D A;  2WFC A;  1R4W A;  22GS A;  3Q18 A;  1VF3 A;  4ECJ A;  4JU5 A;  5HR3 A;  1Z6N A;  4PXO A;  1YEX A;  5CYY A;  4D73 B;  3UAR A;  4HEA 2;  4GQC A;  1EWX A;  1WE0 A;  3O76 A;  2JZS A;  5B8B A;  1PN9 A;  3KIJ A;  4TXV A;  2VL9 A;  3QFB C;  2LJK A;  3GKK A;  3PH9 A;  4XCS A;  4GST A;  1WOU A;  1TI3 A;  1BAY A;  4DEJ A;  3G9B A;  4MZB A;  3C8E A;  3ZL5 A;  2AJQ B;  3P90 A;  1TRU A;  2YOI A;  4OFN A;  4KA0 A;  2DSA A;  1YKA A;  2QKE A;  1X5E A;  1QK8 A;  5IMV A;  4I97 A;  1Y25 A;  3FEU A;  1GSU A;  4JED A;  2YV7 A;  2J9H A;  3KZQ A;  1A8Y A;  4TR1 A;  1M2A A;  4EXJ A;  5CRE A;  3CRU A;  4EUY A;  3F3R A;  1WMJ A;  3KH9 A;  3WYW A;  1GSQ A;  3HCZ A;  3TJF A;  2FUG 2;  2IMK A;  3TKR A;  1V57 A;  2NBS A;  3GMF A;  3VK9 A;  2I81 A;  4L0W A;  1X0R A;  1X5D A;  2HE3 A;  4AJ6 A;  1TXX A;  5BRT A;  1TU7 A;  1VRS D;  2H1D A;  1T00 A;  1LJR A;  2DIZ A;  4YQM A;  2YWM A;  4I6X A;  3AY8 A;  3US3 A;  5ECP B;  1NSW A;  4L8E A;  3VPT A;  1H75 A;  1R26 A;  1S3R A;  1YY7 A;  2VCV A;  1XW9 A;  2I9H A;  1XBS A;  4BVX A;  3IBH A;  2DJJ A;  4HSC X;  4PUF C;  3BCK A;  1M99 A;  2FWH A;  1F3B A;  2LRN A;  4K9Z A;  3TRX A;  3QDN A;  5D93 A;  3N9J A;  4CY8 A;  4EE0 A;  3H4K A;  5LNK e;  1S3D A;  2H75 A;  1AC1 A;  3ZMK A;  4KDX A;  3IK7 A;  3RDW A;  1WIK A;  2V6K A;  1FB0 A;  3UVH A;  4IGJ A;  4P3Y B;  17GS A;  4XTS A;  1QMV A;  2GS3 A;  1PRX A;  1SL1 B;  2AAW A;  1ZGN A;  1YF0 A;  1SU9 A;  5D9T A;  1AW9 A;  1ZCP A;  1O8X A;  2E7P A;  2FWG A;  5HR1 A;  2R0P A;  1H4O A;  1G6Y A;  4PNF A;  3I6A A;  4HS1 A;  2GST A;  5DCG A;  1FO5 A;  2OBK A;  1W4V A;  1FW1 A;  3F0I A;  3TKP A;  5ELA A;  3F6D A;  3C71 A;  3DXB A;  2B6M A;  2VCZ A;  1TRW A;  4K7N A;  3ZRE A;  3GFK A;  2GSQ A;  3UJ1 A;  2M80 A;  1AXD A;  2JU5 A;  2WDU A;  4EIQ A;  2N5A A;  5DQS A;  1R7H A;  1GUH A;  5KOX A;  4IQA A;  1JZO A;  2H0H A;  4YH2 A;  5KN1 A;  4TOP A;  3R3E A;  6GSW A;  2BMX A;  2TRX A;  2CZ3 A;  4BA7 A;  3IR4 A;  3QR6 A;  4ML6 A;  4O7H A;  2V6O A;  3TJB A;  8GSS A;  5IO2 A;  1FOH A;  1T3B A;  4NMU A;  2B1K A;  3UIW A;  4I2U A;  1O81 A;  5G31 A;  1TTZ A;  4IW9 A;  1AIU A;  1M3J A;  3EMX A;  3FHK A;  4MLY A;  4OMV A;  4J2F A;  2LJR A;  2FLS A;  5IIZ A;  4N0Z A;  4D73 A;  4HJ2 A;  1R5P A;  2B1L A;  3E3E A;  2WGR A;  1Z9H A;  5ECK B;  2GQL A;  3UMA A;  3CXG A;  4QQ7 A;  10GS A;  3UEM A;  3ZVJ A;  4EKZ A;  1SL0 B;  4NHW A;  2YJH A;  6GST A;  4FYC A;  1XOB A;  2L5O A;  2B5E A;  4KF9 A;  1UA5 A;  2OE0 A;  1UVZ A;  2B7J A;  2IME A;  4GF0 A;  1XWG A;  1TW9 A;  4EDY A;  2YCD A;  5INY A;  5GAP D;  2KP1 A;  1K3Y A;  5G2Z A;  6GSS A;  2H6Z A;  2IJY A;  5G1L A;  3ISO A;  3TKS A;  4DSQ A;  2JSZ A;  2K8V A;  12GS A;  4NPB A;  4FIW A;  5G1K A;  2C3Q A;  3G7J A;  5G30 A;  5CRD A;  2WUL A;  1SKS B;  2HNL A;  2IN3 A;  2L59 A;  3S9F A;  3ERW A;  2PVO C;  5IMF A;  4CY6 A;  3GA4 A;  1USB A;  4PUA A;  1GSS A;  4ICY A;  3ZVJ D;  3DIE A;  1A2J A;  3GUS A;  4Z2R A;  2BJX A;  3NOF A;  3GSS A;  4EO3 A;  4MJA A;  3QD9 A;  1R5A A;  1ZYP A;  3A2X A;  2DML A;  2NPB A;  1SJZ A;  1IYH A;  2GVP A;  4PQI A;  1VF4 A;  4K0N A;  3W8S A;  2H74 A;  4GSN A;  2GLR A;  1A0R P;  5D96 A;  4MH2 A;  4ECB A;  3TKS C;  2VCQ A;  3IXR A;  1SL2 B;  2WJU A;  2FWE A;  2GT5 A;  3EUR A;  4FQU A;  4K7I A;  2GSS A;  3IHQ A;  3HXS A;  1JZW A;  5DQY A;  1TKD B;  2CV4 A;  3RHB A;  3ZYW A;  2PPT A;  2DJ3 A;  4YQU A;  3BD2 A;  2M46 A;  3EU3 A;  1FHE A;  2C0D A;  4FYU A;  3IAS 2;  2VL2 C;  4ZIL A;  3FR3 A;  3DVW A;  3I69 A;  2YNX A;  2H71 A;  5ABR A;  3MDK A;  1Z7R A;  3TOT A;  3DEX A;  2HRN A;  1SD9 A;  4JBB A;  2O7K A;  2IMD A;  1JLV A;  4MCU A;  2WZ9 A;  2AHE A;  3HKR A;  6GSV A;  1PX6 A;  5B7C A;  3WT2 A;  4ZBD A;  5IMA A;  2EC4 A;  4F82 A;  4Z7X A;  2F8A A;  1TRS A;  2CVK A;  4G0K A;  1PKW A;  1XFL A;  2VIM A;  2EIO A;  1T4Y A;  5IM9 A;  5IPG A;  2AYT A;  16GS A;  2FCH A;  1LU4 A;  4JR6 A;  4OWY A;  3TDG A;  1XWB A;  1EP7 A;  3A3T A;  2H66 A;  3KD0 A;  2C3N A;  3KMO A;  4YAP A;  3EVI A;  2HLS A;  5DVB A;  3KJY A;  3L78 A;  4Z2U A;  3CSH A;  3M9J A;  2VOC A;  2HRA A;  14GS A;  5E59 A;  3IOS A;  3CYN A;  1E6B A;  2VM2 A;  4DVC A;  3CRT A;  3LOR A;  6GSX A;  4ILF A;  2YZU A;  4WET A;  4GQF A;  1A2L A;  3VPQ A;  4ID0 A;  2IMF A;  1WJK A;  1XW5 A;  3TUE A;  2B5Y A;  2OAC A;  2B7K A;  2PER A;  4KSM A;  4JZQ A;  4ISD A;  4HZ2 A;  3HA9 A;  4BPY A;  2ZNM A;  5F0G A;  2H1G A;  3SBC A;  5FWG A;  1OYJ A;  3F4S A;  5KN0 A;  2LRT A;  1EEM A;  4X1U A;  4TXO B;  4G0I A;  4KCE A;  5HFG A;  3BOA A;  4KAE A;  4EDZ A;  2F3M A;  1J9B A;  3PIN A;  1IYI A;  4KX4 A;  5D8I A;  3GIX A;  1THO A;  4HU9 A;  4MDC A;  2GTU A;  5B6M A;  4KND A;  2H76 A;  1MDK A;  3QAG A;  1SJ6 A;  1XZO A;  4KCA A;  1O6J A;  2LNT A;  5DAL B;  4QL9 A;  4MPG A;  4K5S A;  4XRA A;  3IK9 A;  4WBR D;  2H0G A;  1B9Y C;  2H72 A;  1ZZY A;  2IMI A;  5ECN B;  4LMW A;  3LW9 A;  2LKU A;  4ZBA A;  3GST A;  4CDO A;  1GUM A;  1XPV A;  2OE1 A;  4MJC A;  3HJP A;  3L9U A;  3LFL A;  4Q5R A;  5CRG A;  2IL3 A;  1GUL A;  1EGR A;  3H79 A;  4K0G A;  1MEK A;  2OAD A;  4RI6 A;  2KLX A;  2H1B A;  3ZTL A;  1DE1 A;  2FWF A;  5ECH B;  4PX1 A;  2YWI A;  3VI5 A;  2H70 A;  1M2D A;  2X4A A;  2A2S A;  2HZE A;  5HFK A;  4NAX A;  2P0G A;  1YJ6 A;  1W89 A;  2QSI A;  1CQG A;  4OFM A;  5CP1 A;  3TCO A;  2ON7 A;  1B9X C;  1LBK A;  3FMW A;  5IMC A;  1ZYQ B;  1GSF A;  3UAP A;  2LTK A;  3CSI A;  2C0F A;  3LYK A;  4LMV A;  3KP8 A;  4ZBB A;  3GV1 A;  2DJ2 A;  2VLU A;  2R3X A;  4RI7 A;  1BYE A;  3A5I A;  5B6N A;  3VWU A;  2DC5 A;  4YKG A;  5A5K A;  3GKN A;  5J4U A;  1KBN A;  1TRV A;  4IJI A;  4OD7 A;  3HVX A;  1YZX A;  2AV4 A;  4Q5Q A;  1GNE A;  3GKX A;  1ACV A;  2B5X A;  2C1Y A;  2YP6 A;  2MBT A;  2F8F A;  3WGX A;  5EPF A;  2JZR A;  2RUE A;  2OA7 A;  4BIK A;  2NVL A;  2CVB A;  5JCU A;  1EOH A;  3BBY A;  4JE1 A;  2OBI A;  5HR2 A;  3JCM L;  2A4V A;  4IVF A;  1XVQ A;  3EMP A;  5FT3 A;  2C80 A;  2VUP A;  3QCP A;  4IEL A;  3DD3 A;  3QOU A;  4GWR A;  4V2N A;  4AGS A;  1DUG A;  2R0C A;  3HVN A;  1JFU A;  2LNS A;  3D0Z A;  2XBQ A;  4ECI A;  3O3T A;  2HSH A;  3E0U A;  5CO3 A;  5JWO B;  4ULX A;  5IQY A;  1EOG A;  1MDI A;  6GSU A;  2YN1 A;  2J23 A;  4YAV A;  4I5Q A;  4KUN A;  5D9W A;  2V2G A;  5ECO B;  4O92 A;  3TJJ A;  7GSS A;  3DYR A;  1PD2 1;  3KP9 A;  4JR4 A;  2ALB A;  3QAW A;  3APQ A;  1Z6M A;  6GSY A;  3UBK A;  2LJA A;  4BVY A;  2IFQ A;  2UZ8 A;  3LQ7 A;  1ZOF A;  5AIS A;  1VF1 A;  2GZZ A;  4PGT A;  1GLP A;  3M9K A;  3TB2 A;  1PN0 A;  1GSE A;  2QA1 A;  4ZL8 A;  2XC2 A;  2LST A;  4KDY A;  3UVT A;  1I9D A;  2C0E A;  1FB6 A;  18GS A;  3L9S A;  4ZIJ A;  2OE3 A;  4O5U A;  3H1N A;  3P7X A;  1DSB A;  2A4H A;  2TIR A;  2CQ9 A;  4N30 A;  1KNG A;  1U3I A;  3TJG A;  2JZT A;  1RK4 A;  3LXT A;  4DSS B;  2GQM A;  1PKZ A;  3D22 A;  1TP9 A;  3PR8 A;  1SD8 A;  3Q6O A;  5G5F A;  5DAL A;  1UC7 A;  2VLT A;  3HY2 A;  1OE7 A;  2E2G A;  3CSJ A;  1A8L A;  3GL3 A;  2L4Q A;  4MAB A;  3GN3 A;  2H0I A;  5G5E A;  3NIV A;  4IHU A;  1RW1 A;  5ECI B;  4H86 A;  2KOK A;  1GTU A;  2IWT A;  1PQN A;  3DWV A;  4IP6 A;  4F9Z A;  2RUF A;  4KH7 A;  2WCI A;  4IJ3 A;  3UBL A;  3GNJ A;  3WT1 A;  2X8H A;  3A2V A;  4BWQ A;  2X49 A;  3VWW A;  5ID2 B;  1I5G A;  1NM3 A;  2YPM A;  4AJ8 A;  2R4V A;  2PUK C;  3D5J A;  5E4W A;  4K2D A;  4OO5 A;  2H73 A;  4EC0 A;  3D6I A;  4K1F A;  1U88 A;  1BED A;  2G2Q A;  4XS1 A;  1WWJ A;  5H5S A;  5JCW A;  5D9X A;  2FA4 A;  1XW6 A;  3QPM A;  3H93 A;  3CBU A;  1N2A A;  3ED3 A;  2VLV A;  4ZB8 A;  2I1U A;  1GSD A;  2C4J A;  4V1A g;  3W8J A;  4AJ7 A;  2LQQ A;  5IOX A;  2H6Y A;  1O85 A;  2LUS A;  2IIY A;  4N0V A;  5GSS A;  3R2Q A;  2YWO A;  1QGV A;  4Q5N A;  4MJB A;  3FYG A;  2CAQ A;  1A2M A;  2HFD A;  3U5R E;  1OKD A;  4LA1 A;  1MD4 A;  5D9V A;  3I43 A;  3KMN A;  4IS0 A;  3HD5 A;  5ECM B;  1B4P A;  1F9M A;  1DBY A;  2OJL A;  5EY6 A;  4GCI A;  5DJL A;  1V2A A;  4MMM A;  1M2B A;  5DBQ A;  3TJK A;  3MWH A;  3FZ5 A;  2DJK A;  5F8B A;  3A5W A;  5LD0 A;  1HNC A;  3ZIV A;  1MDJ A;  1ERW A;  2E0Q A;  4G2E A;  1EGO A;  1ERV A;  3ZFB A;  1CQH A;  2WS2 A;  3LEF A;  1BG5 A;  4KSO A;  4E8E A;  5J41 A;  3APS A;  2GZP A;  4CHS A;  5J5N A;  1XCC A;  1Z3E A;  4PNG A;  1OVN A;  3K8N A;  5F07 A;  4MK3 A;  2A2P A;  2XPE A;  1SK2 A;  4HOJ A;  2IPA A;  2L4C A;  3HVV A;  3BJ5 A;  1VGL A;  3DRN A;  4K2X A;  4KDU A;  4F0B A;  1K0N A;  13GS A;  2Z9S A;  2FHE A;  3F4T A;  3KM6 A;  4LLR A;  4ZL9 A;  1QXH A;  1PSQ A;  1V9W A;  3EIN A;  3M0F A;  4XS4 B;  4FYB A;  3HZ4 A;  4NWY A;  4TKY A;  4FO5 A;  3FZ9 A;  4BVX B;  2OKA A;  2XPD A;  4KGI A;  2PGT A;  3ERG A;  1SJI A;  1AUC A;  2WB9 A;  3TRP A;  1ML6 A;  1OKT A;  3TRQ A;  3RHC A;  3P8W A;  1GUK A;  1GTB A;  3EU4 A;  3EE2 A;  5JWR B;  1SEN A;  1XWA A;  2JSY A;  2CZ2 A;  4JRR A;  2H30 A;  1G7E A;  3MYD A;  5CRW A;  3ZML A;  2YV9 A;  2BTO T;  1X9M B;  3KTB A;  5CRH A;  1XVW A;  1FAA A;  4ML1 A;  4RQR A;  1S3C A;  3IC4 A;  2EIR A;  2X99 A;  4OFT A;  1Q4J A;  1G7O A;  4DSS A;  1TDI A;  2P5Q A;  3HJM A;  4X43 A;  1F37 A;  2CX4 A;  5IOW A;  3SWL A;  4WKW A;  4F03 A;  4V1A p;  1AQX A;  4POK A;  3GH9 A;  1QFN A;  3Q74 A;  1F2E A;  3MIX A;  5KN2 A;  3VWV A;  4GXZ A;  1K0D A;  5IMZ A;  4EVM A;  2VCW A;  1XG8 A;  3EPT A;  3J7Y k;  3LWA A;  1GTI A;  4DSR A;  4MPF A;  1OC3 A;  3LXZ A;  5C04 A;  1HYU A;  2MMA A;  2MMO A;  4I2T A;  1G6W A;  2HXK A;  1SK1 A;  3G7I A;  1ST9 A;  1HQO A;  5ID2 A;  1B48 A;  5IPH A;  2MMN A;  19GS A;  3APO A;  2A2R A;  5FHI A;  4WF4 A;  3TKS E;  1AQW A;  1GH2 A;  4WF5 A;  2K18 A;  3IPZ A;  1PL2 A;  4MJE A;  2HRF A;  1F3A A;  2VD0 A;  4HZ4 A;  3UOM A;  2N5F A;  3MAK A;  1FOV A;  4V2L A;  2HRK A;  3M1G A;  1EV4 A;  3C1S A;  3MSZ A;  1SYR A;  3GHA A;  5L71 A;  4F0C A;  2JAC A;  3IAM 2;  3F4R A;  3IA1 A;  2LS5 A;  2G0F A;  2VAF A;  3GYK A;  2LEG A;  4TR3 A;  1HNA A;  1QUW A;  3L4N A;  4CW9 A;  4EIP A;  3IV4 A;  2I4A A;  5JCG A;  4K6X A;  2GZY A;  4HU7 A;  2E2M A;  3IRA A;  1A24 A;  2CX3 A;  1XXU A;  5AGY A;  3WD6 A;  1GP1 A;  3EYT A;  4PQH A;  4MF5 A;  4LL4 B;  2XBI A;  1B4Q A;  4PUR A;  3J7Y b;  2RLI A;  4L5L A;  2O89 A;  3LYP A;  5ECL B;  4IQ1 A;  4QL7 A;  3D4T A;  1U87 A;  2VM1 A;  2RM6 A;  4O5R A;  4IKH A;  4OCF A;  4GLT A;  2O8V B;  2K8S A;  1X5C A;  3GX8 A;  1OC9 B;  3C7M A;  3RAZ A;  3VI7 A;  1EEJ A;  1WP0 A;  5A4V A;  3A2W A;  2YZH A;  2PU9 C;  1HD2 A;  1SK0 A;  3E9J B;  5GST A;  1GWC A;  3FR9 A;  4TN8 A;  1SKR B;  2FGX A;  2PWJ A;  2TRC P;  1V98 A;  5C00 A;  5D73 A;  4BWS A;  3FR6 A;  4IP1 A;  3EWL A;  3PGT A;  4RUV A;  1XWC A;  1J08 A;  1Z5Y E;  3ZIT A;  4A5P A;  4ZXG A;  1JLW A;  1K0B A;  4N11 A;  2EIQ A;  3ME7 A;  1GL8 A;  1K0C A;  4HUA A;  4K5R A;  4L0U A;  1FVJ A;  1K0A A;  2YJ7 A;  3PPU A;  1M9A A;  3U6V A;  2MYG A;  5DAK B;  4XS4 A;  1ZMA A;  2FNO A;  3F6F A;  3GX0 A;  4O5Q A;  3VUR A;  1PGT A;  2VCT A;  3F8U A;  3BCI A;  2DKH A;  1YF1 A;  4XHM A;  2R2J A;  1V58 A;  1OC8 A;  3FRC A;  4GRF A;  2VO4 A;  2NDO A;  1ERU A;  4WR5 A;  1F6M C;  1TK0 B;  1O73 A;  3GTU B;  2K9F A;  2O85 A;  1O7U A;  1YEP A;  1T8E B;  3CTG A;  5H5R A;  1SKW B;  1PL1 A;  1ON4 A;  4G0L A;  1M3I A;  3F9U A;  4TW5 A;  3LJR A;  4IN0 A;  4TR4 A;  4X4J A;  2PN8 A;  3ZIJ A;  2H01 A;  2VL3 A;  3DML A;  2QGV A;  3C1R A;  3WGE A;  2VD1 A;  3LG6 A;  1OE8 A;  1XIY A;  2FD3 A;  3QMX A;  4BL7 B;  1O8W A;  2ZCT A;  3ME8 A;  1A0F A;  3ERF A;  1ILO A;  5JWQ B;  4ZL7 A;  2D2Z A;  3DVX A;  1J0F A;  3IHG A;  1EZK A;  3LGC A;  2WRT A;  1HNB A;  2V1M A;  3GUR A;  2H19 A;  1G0T A;  2DJ1 A;  3Q19 A;  3LSZ A;  4TXO A;  4WEY A;  3KH7 A;  2DKI A;  4K8M A;  2GSR A;  1B8X A;  2REM A;  3KEB A;  1T4Z A;  4MF6 A;  4POB A;  4G19 A;  2C0G A;  3VLN A;  4AF2 A;  2F9S A;  5GAN D;  5LCZ A;  2HSY A;  1N8J A;  1BQ7 A;  2R37 A;  2N5B A;  2FY6 A;  1TK5 B;  3G7Y A;  3VFI A;  2AUV A;  4J57 E;  4MA9 A;  3P2A A;  4NV5 A;  4HI7 A;  3FK8 A;  4OO4 A;  3D4M A;  2KHP A;  2DMM A;  1YQ1 A;  3HYP A;  1Q98 A;  4K7O A;  5DCH A;  4PTS A;  1MTC A;  3OR5 A;  3KTL A;  2HSM A;  1GTA A;  3QAV A;  4G9H A;  5IMD A;  2KUC A;  4USS A;  4RQX A;  3FW2 A;  1K0M A;  2X64 A;  3GH6 A;  3H8Q A;  4POL A;  2CA8 A;  4HQZ A;  3M3M A;  3W6G A;  5J9C A;  2QC7 A;  4XS6 A;  1JZD A;  2I3Y A;  3NZN A;  4HJM A;  1T7P B;  3HJO A;  3IDV A;  3L9V A;  4L5O A;  5J9B A;  2R6K A;  1GLQ A;  3EC3 A;  2R0G A;  5F06 A;  3FZA A;  2PVQ A;  3KGK A;  3VWX A;  1K3O A;  1AQV A;  1YKC A;  5A4W A;  4XRD A;  1Y6E A;  2AB6 A;  4N10 A;  2DIY A;  2GT6 A;  1KTE A;  2NTO A;  2GQK A;  5EL8 A;  5B8A A;  5CAX A;  4E8H A;  2HI7 A;  4WBJ A;  2GDR A;  3FZ4 A;  3RBT A;  4NXI A;  3DKS A;  2R5G A;  4KE3 A;  1OC9 A;  3HDC A;  3MNG A;  1U3A A;  4GTU A;  3CTF A;  4MH3 A;  1NHO A;  5HQP A;  1BX9 A;  4MZC A;  2X8G A;  2M72 A;  1UN2 A;  1TJD A;  4MF7 A;  4HQS A;  4MZW A;  1TOF A;  1FG4 A;  2H1A A;  2HZE B;  1AAZ A;  5AIV A;  2MBS A;  1TI1 A;  1JZR A;  2VL2 A;  2L57 A;  3GL5 A;  3RPN A;  2PBJ A;  1E2Y A;  1NHY A;  4POM A;  1FVK A;  4ACS A;  1TK8 B;  3TKQ A;  1YDK A;  4WXT A;  4NV2 A;  2MMZ A;  1NW2 A;  1ZL9 A;  5IO0 A;  1KEB A;  9GSS A;  2B3S A;  2V32 A;  1DE2 A;  4TR1 B;  1PA3 A;  4LL1 B;  1A23 A;  3O6T A;  5DAK A;  2H6X A;  1MD3 A;  2XHF A;  1GSY A;  2YAN A;  2LQO A;  1K0O A;  1M9B A;  1RQM A;  1M7T A;  2LV3 A;  3ZFL A;  5ECS A;  2GGT A;  1ERT A;  4HDE A;  4ZB9 A;  4KB3 A;  1X9S B;  2HYX A;  3GTU A;  5AN1 A;  5EVO A;  2ES7 A;  4KW6 A;  4ECC A;  1S3A A;  3UL3 A;  3I9V 2;  5KOW A;  4TR0 A;  5KN3 A;  5A4U A;  1V40 A;  4TRX A;  1GRX A;  2FA8 A;  3M8N A;  5BMU A;  3L0H A; 
#chains in the Genus database with same CATH homology
 2F51 A;  4V2M A;  3ZZX A;  2JL4 A;  1XOA A;  1GNW A;  2RII A;  1TU8 A;  1BJX A;  4J56 E;  4Q5F A;  1PX7 A;  1EP8 A;  4WR4 A;  2JAD A;  1EV9 A;  4BL7 A;  1Z7P A;  2QA2 A;  5CNW A;  4MNN A;  2ZUP A;  4YQV A;  4NHZ A;  5COH A;  3V1W A;  5HFI A;  1JHB A;  3F63 A;  2K6V A;  5AIX A;  4ZB6 A;  2DJ0 A;  1THX A;  1WPI A;  3FY7 A;  3GRX A;  4Z2T A;  20GS A;  3HVS A;  4GSS A;  1ZYN A;  2CT6 A;  1PMT A;  3TOU A;  2VCX A;  2H8L A;  4XIH A;  4OCE A;  1K3L A;  2P5R A;  2P31 A;  4TVE A;  3DGQ A;  2C3T A;  1XWK A;  3ZRD A;  1ABA A;  2HT9 A;  1QQ2 A;  1U6T A;  2RM5 A;  4EL1 A;  3CMI A;  4EF0 A;  2HZF A;  3KCM A;  4O32 A;  3TGZ A;  5DDL A;  1X9W B;  2L6C A;  3N5O A;  2YWN A;  4BVY B;  2IFQ B;  5ELG A;  1VF2 A;  3IC8 A;  1ZYE A;  2V41 A;  5KEJ A;  4PQ1 A;  5ECR B;  5H5Q A;  3HZ8 A;  2DBC A;  2CVD A;  3RPP A;  1WRY A;  3GKM A;  1M0U A;  2LRC A;  2L5L A;  1OAZ A;  4X0X A;  3ZLP A;  3HHV A;  5F05 A;  2MZC A;  5HR0 A;  4IBP A;  3QFA C;  1SYX A;  2DLX A;  11GS A;  4F2I A;  1C72 A;  3FKF A;  3F3Q A;  4MP4 A;  1T1V A;  2PMT A;  5DJM A;  5GZZ B;  2CAI A;  2C8U A;  5ECQ B;  5ENU A;  4G10 A;  3D21 A;  4I8B A;  5J3R A;  1URM A;  3KXO A;  2ON5 A;  4FH8 A;  2KP2 A;  4YKF A;  3WGD A;  2X8C A;  2O87 A;  3C73 A;  3IE3 A;  2L6D A;  2WFC A;  1R4W A;  22GS A;  3Q18 A;  1VF3 A;  4ECJ A;  4JU5 A;  5HR3 A;  1Z6N A;  4PXO A;  1YEX A;  5CYY A;  4D73 B;  3UAR A;  4HEA 2;  4GQC A;  1EWX A;  1WE0 A;  3O76 A;  2JZS A;  5B8B A;  1PN9 A;  3KIJ A;  4TXV A;  2VL9 A;  3QFB C;  2LJK A;  3GKK A;  3PH9 A;  4XCS A;  4GST A;  1WOU A;  1TI3 A;  1BAY A;  4DEJ A;  3G9B A;  4MZB A;  3C8E A;  3ZL5 A;  2AJQ B;  3P90 A;  1TRU A;  2YOI A;  4OFN A;  4KA0 A;  2DSA A;  1YKA A;  2QKE A;  1X5E A;  1QK8 A;  5IMV A;  4I97 A;  1Y25 A;  3FEU A;  1GSU A;  4JED A;  2YV7 A;  2J9H A;  3KZQ A;  1A8Y A;  4TR1 A;  1M2A A;  4EXJ A;  5CRE A;  3CRU A;  4EUY A;  3F3R A;  1WMJ A;  3KH9 A;  3WYW A;  1GSQ A;  3HCZ A;  3TJF A;  2FUG 2;  2IMK A;  3TKR A;  1V57 A;  2NBS A;  3GMF A;  3VK9 A;  2I81 A;  4L0W A;  1X0R A;  1X5D A;  2HE3 A;  4AJ6 A;  1TXX A;  5BRT A;  1TU7 A;  1VRS D;  2H1D A;  1T00 A;  1LJR A;  2DIZ A;  4YQM A;  2YWM A;  4I6X A;  3AY8 A;  3US3 A;  5ECP B;  1NSW A;  4L8E A;  3VPT A;  1H75 A;  1R26 A;  1YY7 A;  2VCV A;  1XW9 A;  2I9H A;  1XBS A;  4BVX A;  3IBH A;  2DJJ A;  4PUF C;  3BCK A;  1M99 A;  2FWH A;  1F3B A;  2LRN A;  4K9Z A;  3TRX A;  3QDN A;  5D93 A;  3N9J A;  4CY8 A;  4EE0 A;  3H4K A;  5LNK e;  1S3D A;  2H75 A;  1AC1 A;  3ZMK A;  4KDX A;  3IK7 A;  3RDW A;  1WIK A;  2V6K A;  1FB0 A;  3UVH A;  4IGJ A;  4P3Y B;  17GS A;  4XTS A;  1QMV A;  2GS3 A;  1PRX A;  1SL1 B;  2AAW A;  1ZGN A;  1YF0 A;  1SU9 A;  5D9T A;  1AW9 A;  1ZCP A;  1O8X A;  2E7P A;  2FWG A;  5HR1 A;  2R0P A;  1H4O A;  1G6Y A;  4PNF A;  3I6A A;  4HS1 A;  2GST A;  5DCG A;  1FO5 A;  2OBK A;  1W4V A;  1FW1 A;  3F0I A;  3TKP A;  5ELA A;  3F6D A;  3C71 A;  3DXB A;  2B6M A;  2VCZ A;  1TRW A;  4K7N A;  3ZRE A;  3GFK A;  2GSQ A;  3UJ1 A;  2M80 A;  1AXD A;  2JU5 A;  2WDU A;  4EIQ A;  2N5A A;  5DQS A;  1R7H A;  1GUH A;  5KOX A;  4IQA A;  1JZO A;  2H0H A;  4YH2 A;  5KN1 A;  4TOP A;  3R3E A;  6GSW A;  2BMX A;  2TRX A;  2CZ3 A;  4BA7 A;  3IR4 A;  3QR6 A;  4ML6 A;  4O7H A;  2V6O A;  3TJB A;  8GSS A;  5IO2 A;  1FOH A;  1T3B A;  4NMU A;  2B1K A;  3UIW A;  4I2U A;  1O81 A;  5G31 A;  1TTZ A;  4IW9 A;  1AIU A;  3EMX A;  3FHK A;  4MLY A;  4OMV A;  4J2F A;  2LJR A;  2FLS A;  5IIZ A;  4N0Z A;  4D73 A;  4HJ2 A;  1R5P A;  2B1L A;  3E3E A;  2WGR A;  1Z9H A;  5ECK B;  2GQL A;  3UMA A;  3CXG A;  4QQ7 A;  10GS A;  3UEM A;  3ZVJ A;  4EKZ A;  1SL0 B;  4NHW A;  2YJH A;  6GST A;  4FYC A;  1XOB A;  2L5O A;  2B5E A;  4KF9 A;  1UA5 A;  2OE0 A;  1UVZ A;  2B7J A;  2IME A;  4GF0 A;  1XWG A;  1TW9 A;  4EDY A;  2YCD A;  5INY A;  5GAP D;  2KP1 A;  1K3Y A;  5G2Z A;  6GSS A;  2H6Z A;  2IJY A;  5G1L A;  3ISO A;  3TKS A;  4DSQ A;  2JSZ A;  2K8V A;  12GS A;  4NPB A;  4FIW A;  5G1K A;  2C3Q A;  3G7J A;  5G30 A;  5CRD A;  2WUL A;  1SKS B;  2HNL A;  2IN3 A;  2L59 A;  3S9F A;  3ERW A;  2PVO C;  5IMF A;  4CY6 A;  3GA4 A;  1USB A;  4PUA A;  1GSS A;  4ICY A;  3ZVJ D;  3DIE A;  1A2J A;  3GUS A;  4Z2R A;  2BJX A;  3NOF A;  3GSS A;  4EO3 A;  4MJA A;  3QD9 A;  1R5A A;  1ZYP A;  3A2X A;  2DML A;  2NPB A;  1SJZ A;  1IYH A;  2GVP A;  4PQI A;  1VF4 A;  4K0N A;  3W8S A;  2H74 A;  4GSN A;  2GLR A;  1A0R P;  5D96 A;  4MH2 A;  4ECB A;  3TKS C;  2VCQ A;  3IXR A;  1SL2 B;  2WJU A;  2FWE A;  2GT5 A;  3EUR A;  4FQU A;  4K7I A;  2GSS A;  3IHQ A;  3HXS A;  1JZW A;  5DQY A;  1TKD B;  2CV4 A;  3RHB A;  3ZYW A;  2PPT A;  2DJ3 A;  4YQU A;  3BD2 A;  2M46 A;  3EU3 A;  1FHE A;  2C0D A;  4FYU A;  3IAS 2;  2VL2 C;  4ZIL A;  3FR3 A;  3DVW A;  3I69 A;  2YNX A;  2H71 A;  5ABR A;  3MDK A;  1Z7R A;  3TOT A;  3DEX A;  2HRN A;  1SD9 A;  4JBB A;  2O7K A;  2IMD A;  1JLV A;  4MCU A;  2WZ9 A;  2AHE A;  3HKR A;  6GSV A;  1PX6 A;  5B7C A;  3WT2 A;  4ZBD A;  5IMA A;  2EC4 A;  4F82 A;  4Z7X A;  2F8A A;  1TRS A;  2CVK A;  4G0K A;  1PKW A;  1XFL A;  2VIM A;  2EIO A;  1T4Y A;  5IM9 A;  5IPG A;  2AYT A;  16GS A;  2FCH A;  1LU4 A;  4JR6 A;  4OWY A;  3TDG A;  1XWB A;  1EP7 A;  3A3T A;  2H66 A;  3KD0 A;  2C3N A;  3KMO A;  4YAP A;  3EVI A;  2HLS A;  5DVB A;  3KJY A;  3L78 A;  4Z2U A;  3CSH A;  3M9J A;  2VOC A;  2HRA A;  14GS A;  5E59 A;  3IOS A;  3CYN A;  1E6B A;  2VM2 A;  4DVC A;  3CRT A;  3LOR A;  6GSX A;  4ILF A;  2YZU A;  4WET A;  4GQF A;  1A2L A;  3VPQ A;  4ID0 A;  2IMF A;  1WJK A;  1XW5 A;  3TUE A;  2B5Y A;  2OAC A;  2B7K A;  2PER A;  4KSM A;  4JZQ A;  4ISD A;  4HZ2 A;  3HA9 A;  4BPY A;  2ZNM A;  5F0G A;  2H1G A;  3SBC A;  5FWG A;  1OYJ A;  3F4S A;  5KN0 A;  2LRT A;  1EEM A;  4X1U A;  4TXO B;  4G0I A;  4KCE A;  5HFG A;  3BOA A;  4KAE A;  4EDZ A;  2F3M A;  1J9B A;  3PIN A;  1IYI A;  4KX4 A;  5D8I A;  3GIX A;  1THO A;  4HU9 A;  4MDC A;  2GTU A;  5B6M A;  4KND A;  2H76 A;  1MDK A;  3QAG A;  1SJ6 A;  1XZO A;  4KCA A;  1O6J A;  2LNT A;  5DAL B;  4QL9 A;  4MPG A;  4K5S A;  4XRA A;  3IK9 A;  4WBR D;  2H0G A;  1B9Y C;  2H72 A;  1ZZY A;  2IMI A;  5ECN B;  4LMW A;  3LW9 A;  2LKU A;  4ZBA A;  3GST A;  4CDO A;  1GUM A;  1XPV A;  2OE1 A;  4MJC A;  3HJP A;  3L9U A;  3LFL A;  4Q5R A;  5CRG A;  2IL3 A;  1GUL A;  1EGR A;  3H79 A;  4K0G A;  1MEK A;  2OAD A;  4RI6 A;  2KLX A;  2H1B A;  3ZTL A;  1DE1 A;  2FWF A;  5ECH B;  4PX1 A;  2YWI A;  3VI5 A;  2H70 A;  1M2D A;  2X4A A;  2A2S A;  2HZE A;  5HFK A;  4NAX A;  2P0G A;  1YJ6 A;  1W89 A;  2QSI A;  1CQG A;  4OFM A;  5CP1 A;  3TCO A;  2ON7 A;  1B9X C;  1LBK A;  3FMW A;  5IMC A;  1ZYQ B;  1GSF A;  3UAP A;  2LTK A;  3CSI A;  2C0F A;  3LYK A;  4LMV A;  3KP8 A;  4ZBB A;  3GV1 A;  2DJ2 A;  2VLU A;  2R3X A;  4RI7 A;  1BYE A;  3A5I A;  5B6N A;  3VWU A;  2DC5 A;  4YKG A;  5A5K A;  3GKN A;  5J4U A;  1KBN A;  1TRV A;  4IJI A;  4OD7 A;  3HVX A;  1YZX A;  2AV4 A;  4Q5Q A;  1GNE A;  3GKX A;  1ACV A;  2B5X A;  2C1Y A;  2YP6 A;  2MBT A;  2F8F A;  3WGX A;  5EPF A;  2JZR A;  2RUE A;  2OA7 A;  2NVL A;  2CVB A;  5JCU A;  1EOH A;  3BBY A;  4JE1 A;  2OBI A;  5HR2 A;  3JCM L;  2A4V A;  4IVF A;  1XVQ A;  3EMP A;  5FT3 A;  2C80 A;  2VUP A;  3QCP A;  4IEL A;  3DD3 A;  3QOU A;  4GWR A;  4V2N A;  4AGS A;  1DUG A;  2R0C A;  1JFU A;  2LNS A;  3D0Z A;  2XBQ A;  4ECI A;  3O3T A;  2HSH A;  3E0U A;  5CO3 A;  5JWO B;  4ULX A;  5IQY A;  1EOG A;  1MDI A;  6GSU A;  2YN1 A;  2J23 A;  4YAV A;  4I5Q A;  4KUN A;  5D9W A;  2V2G A;  5ECO B;  4O92 A;  3TJJ A;  7GSS A;  3DYR A;  1PD2 1;  3KP9 A;  4JR4 A;  2ALB A;  3QAW A;  3APQ A;  1Z6M A;  6GSY A;  3UBK A;  2LJA A;  4BVY A;  2IFQ A;  2UZ8 A;  3LQ7 A;  1ZOF A;  5AIS A;  1VF1 A;  2GZZ A;  4PGT A;  1GLP A;  3M9K A;  3TB2 A;  1PN0 A;  1GSE A;  2QA1 A;  4ZL8 A;  2XC2 A;  2LST A;  4KDY A;  3UVT A;  1I9D A;  2C0E A;  1FB6 A;  18GS A;  3L9S A;  4ZIJ A;  2OE3 A;  4O5U A;  3H1N A;  3P7X A;  1DSB A;  2A4H A;  2TIR A;  2CQ9 A;  4N30 A;  1KNG A;  1U3I A;  3TJG A;  2JZT A;  1RK4 A;  3LXT A;  4DSS B;  2GQM A;  1PKZ A;  3D22 A;  1TP9 A;  3PR8 A;  1SD8 A;  3Q6O A;  5G5F A;  5DAL A;  1UC7 A;  2VLT A;  3HY2 A;  1OE7 A;  2E2G A;  3CSJ A;  1A8L A;  3GL3 A;  2L4Q A;  4MAB A;  3GN3 A;  2H0I A;  5G5E A;  3NIV A;  4IHU A;  1RW1 A;  5ECI B;  4H86 A;  2KOK A;  1GTU A;  2IWT A;  1PQN A;  3DWV A;  4IP6 A;  4F9Z A;  2RUF A;  4KH7 A;  2WCI A;  4IJ3 A;  3UBL A;  3GNJ A;  3WT1 A;  2X8H A;  3A2V A;  4BWQ A;  2X49 A;  3VWW A;  5ID2 B;  1I5G A;  1NM3 A;  2YPM A;  4AJ8 A;  2R4V A;  2PUK C;  3D5J A;  5E4W A;  4K2D A;  4OO5 A;  2H73 A;  4EC0 A;  3D6I A;  4K1F A;  1U88 A;  1BED A;  2G2Q A;  4XS1 A;  1WWJ A;  5H5S A;  5JCW A;  5D9X A;  2FA4 A;  1XW6 A;  3QPM A;  3H93 A;  3CBU A;  1N2A A;  3ED3 A;  2VLV A;  4ZB8 A;  2I1U A;  1GSD A;  2C4J A;  4V1A g;  3W8J A;  4AJ7 A;  2LQQ A;  5IOX A;  2H6Y A;  1O85 A;  2LUS A;  2IIY A;  4N0V A;  5GSS A;  3R2Q A;  2YWO A;  1QGV A;  4Q5N A;  4MJB A;  3FYG A;  2CAQ A;  1A2M A;  2HFD A;  3U5R E;  1OKD A;  4LA1 A;  1MD4 A;  5D9V A;  3I43 A;  3KMN A;  4IS0 A;  3HD5 A;  5ECM B;  1B4P A;  1F9M A;  1DBY A;  2OJL A;  5EY6 A;  4GCI A;  5DJL A;  1V2A A;  4MMM A;  1M2B A;  5DBQ A;  3TJK A;  3MWH A;  3FZ5 A;  2DJK A;  5F8B A;  3A5W A;  5LD0 A;  1HNC A;  3ZIV A;  1MDJ A;  1ERW A;  2E0Q A;  4G2E A;  1EGO A;  1ERV A;  3ZFB A;  1CQH A;  2WS2 A;  3LEF A;  1BG5 A;  4KSO A;  4E8E A;  5J41 A;  3APS A;  2GZP A;  4CHS A;  5J5N A;  1XCC A;  1Z3E A;  4PNG A;  1OVN A;  3K8N A;  5F07 A;  4MK3 A;  2A2P A;  2XPE A;  1SK2 A;  4HOJ A;  2IPA A;  2L4C A;  3HVV A;  3BJ5 A;  1VGL A;  3DRN A;  4K2X A;  4KDU A;  4F0B A;  1K0N A;  13GS A;  2Z9S A;  2FHE A;  3F4T A;  3KM6 A;  4LLR A;  4ZL9 A;  1QXH A;  1PSQ A;  1V9W A;  3EIN A;  3M0F A;  4XS4 B;  4FYB A;  3HZ4 A;  4NWY A;  4TKY A;  4FO5 A;  3FZ9 A;  4BVX B;  2OKA A;  2XPD A;  4KGI A;  2PGT A;  3ERG A;  1SJI A;  1AUC A;  2WB9 A;  3TRP A;  1ML6 A;  1OKT A;  3TRQ A;  3RHC A;  3P8W A;  1GUK A;  1GTB A;  3EU4 A;  3EE2 A;  5JWR B;  1SEN A;  1XWA A;  2JSY A;  2CZ2 A;  4JRR A;  2H30 A;  1G7E A;  3MYD A;  5CRW A;  3ZML A;  2YV9 A;  2BTO T;  1X9M B;  3KTB A;  5CRH A;  1XVW A;  1FAA A;  4ML1 A;  4RQR A;  1S3C A;  3IC4 A;  2EIR A;  2X99 A;  4OFT A;  1Q4J A;  1G7O A;  4DSS A;  1TDI A;  2P5Q A;  3HJM A;  4X43 A;  1F37 A;  2CX4 A;  5IOW A;  3SWL A;  4WKW A;  4F03 A;  4V1A p;  1AQX A;  4POK A;  3GH9 A;  1QFN A;  3Q74 A;  1F2E A;  3MIX A;  5KN2 A;  3VWV A;  4GXZ A;  1K0D A;  5IMZ A;  4EVM A;  2VCW A;  3EPT A;  3J7Y k;  3LWA A;  1GTI A;  4DSR A;  4MPF A;  1OC3 A;  3LXZ A;  5C04 A;  1HYU A;  2MMA A;  2MMO A;  4I2T A;  1G6W A;  2HXK A;  1SK1 A;  3G7I A;  1ST9 A;  1HQO A;  5ID2 A;  1B48 A;  5IPH A;  2MMN A;  19GS A;  3APO A;  2A2R A;  5FHI A;  4WF4 A;  3TKS E;  1AQW A;  1GH2 A;  4WF5 A;  2K18 A;  3IPZ A;  1PL2 A;  4MJE A;  2HRF A;  1F3A A;  2VD0 A;  4HZ4 A;  3UOM A;  2N5F A;  3MAK A;  1FOV A;  4V2L A;  2HRK A;  3M1G A;  1EV4 A;  3C1S A;  3MSZ A;  1SYR A;  3GHA A;  5L71 A;  4F0C A;  2JAC A;  3IAM 2;  3F4R A;  3IA1 A;  2LS5 A;  2G0F A;  2VAF A;  3GYK A;  2LEG A;  4TR3 A;  1HNA A;  1QUW A;  3L4N A;  4CW9 A;  4EIP A;  3IV4 A;  2I4A A;  5JCG A;  4K6X A;  2GZY A;  4HU7 A;  2E2M A;  3IRA A;  1A24 A;  2CX3 A;  1XXU A;  5AGY A;  3WD6 A;  1GP1 A;  3EYT A;  4PQH A;  4MF5 A;  4LL4 B;  2XBI A;  1B4Q A;  4PUR A;  3J7Y b;  2RLI A;  4L5L A;  2O89 A;  3LYP A;  5ECL B;  4IQ1 A;  4QL7 A;  3D4T A;  1U87 A;  2VM1 A;  2RM6 A;  4O5R A;  4IKH A;  4OCF A;  4GLT A;  2O8V B;  2K8S A;  1X5C A;  3GX8 A;  1OC9 B;  3C7M A;  3RAZ A;  3VI7 A;  1EEJ A;  1WP0 A;  5A4V A;  3A2W A;  2YZH A;  2PU9 C;  1HD2 A;  1SK0 A;  3E9J B;  5GST A;  1GWC A;  3FR9 A;  4TN8 A;  1SKR B;  2FGX A;  2PWJ A;  2TRC P;  1V98 A;  5C00 A;  5D73 A;  4BWS A;  3FR6 A;  4IP1 A;  3EWL A;  3PGT A;  4RUV A;  1XWC A;  1J08 A;  1Z5Y E;  3ZIT A;  4A5P A;  4ZXG A;  1JLW A;  1K0B A;  4N11 A;  2EIQ A;  3ME7 A;  1GL8 A;  1K0C A;  4HUA A;  4K5R A;  4L0U A;  1FVJ A;  1K0A A;  2YJ7 A;  3PPU A;  1M9A A;  3U6V A;  2MYG A;  5DAK B;  4XS4 A;  1ZMA A;  2FNO A;  3F6F A;  3GX0 A;  4O5Q A;  3VUR A;  1PGT A;  2VCT A;  3F8U A;  3BCI A;  2DKH A;  1YF1 A;  4XHM A;  2R2J A;  1V58 A;  1OC8 A;  3FRC A;  4GRF A;  2VO4 A;  2NDO A;  1ERU A;  4WR5 A;  1F6M C;  1TK0 B;  1O73 A;  3GTU B;  2K9F A;  2O85 A;  1O7U A;  1YEP A;  1T8E B;  3CTG A;  5H5R A;  1SKW B;  1PL1 A;  1ON4 A;  4G0L A;  3F9U A;  4TW5 A;  3LJR A;  4IN0 A;  4TR4 A;  4X4J A;  2PN8 A;  3ZIJ A;  2H01 A;  2VL3 A;  3DML A;  2QGV A;  3C1R A;  3WGE A;  2VD1 A;  3LG6 A;  1OE8 A;  1XIY A;  2FD3 A;  3QMX A;  4BL7 B;  1O8W A;  2ZCT A;  3ME8 A;  1A0F A;  3ERF A;  1ILO A;  5JWQ B;  4ZL7 A;  2D2Z A;  3DVX A;  1J0F A;  3IHG A;  1EZK A;  3LGC A;  2WRT A;  1HNB A;  2V1M A;  3GUR A;  2H19 A;  1G0T A;  2DJ1 A;  3Q19 A;  3LSZ A;  4TXO A;  4WEY A;  3KH7 A;  2DKI A;  4K8M A;  2GSR A;  1B8X A;  2REM A;  3KEB A;  1T4Z A;  4MF6 A;  4POB A;  4G19 A;  2C0G A;  3VLN A;  4AF2 A;  2F9S A;  5GAN D;  5LCZ A;  2HSY A;  1N8J A;  1BQ7 A;  2R37 A;  2N5B A;  2FY6 A;  1TK5 B;  3G7Y A;  3VFI A;  2AUV A;  4J57 E;  4MA9 A;  3P2A A;  4NV5 A;  4HI7 A;  3FK8 A;  4OO4 A;  3D4M A;  2KHP A;  2DMM A;  1YQ1 A;  3HYP A;  1Q98 A;  4K7O A;  5DCH A;  4PTS A;  1MTC A;  3OR5 A;  3KTL A;  2HSM A;  1GTA A;  3QAV A;  4G9H A;  5IMD A;  2KUC A;  4USS A;  4RQX A;  3FW2 A;  1K0M A;  2X64 A;  3GH6 A;  3H8Q A;  4POL A;  2CA8 A;  4HQZ A;  3M3M A;  3W6G A;  5J9C A;  2QC7 A;  4XS6 A;  1JZD A;  2I3Y A;  3NZN A;  4HJM A;  1T7P B;  3HJO A;  3IDV A;  3L9V A;  4L5O A;  5J9B A;  2R6K A;  1GLQ A;  3EC3 A;  2R0G A;  5F06 A;  3FZA A;  2PVQ A;  3KGK A;  3VWX A;  1K3O A;  1AQV A;  1YKC A;  5A4W A;  4XRD A;  1Y6E A;  2AB6 A;  4N10 A;  2DIY A;  2GT6 A;  1KTE A;  2NTO A;  2GQK A;  5EL8 A;  5B8A A;  5CAX A;  4E8H A;  2HI7 A;  4WBJ A;  2GDR A;  3FZ4 A;  3RBT A;  4NXI A;  3DKS A;  2R5G A;  4KE3 A;  1OC9 A;  3HDC A;  3MNG A;  1U3A A;  4GTU A;  3CTF A;  4MH3 A;  1NHO A;  5HQP A;  1BX9 A;  4MZC A;  2X8G A;  2M72 A;  1UN2 A;  1TJD A;  4MF7 A;  4HQS A;  4MZW A;  1TOF A;  1FG4 A;  2H1A A;  2HZE B;  1AAZ A;  5AIV A;  2MBS A;  1TI1 A;  1JZR A;  2VL2 A;  2L57 A;  3GL5 A;  3RPN A;  2PBJ A;  1E2Y A;  1NHY A;  4POM A;  1FVK A;  4ACS A;  1TK8 B;  3TKQ A;  1YDK A;  4WXT A;  4NV2 A;  2MMZ A;  1NW2 A;  1ZL9 A;  5IO0 A;  1KEB A;  9GSS A;  2B3S A;  2V32 A;  1DE2 A;  4TR1 B;  1PA3 A;  4LL1 B;  1A23 A;  3O6T A;  5DAK A;  2H6X A;  1MD3 A;  2XHF A;  1GSY A;  2YAN A;  2LQO A;  1K0O A;  1M9B A;  1RQM A;  1M7T A;  2LV3 A;  3ZFL A;  5ECS A;  2GGT A;  1ERT A;  4HDE A;  4ZB9 A;  4KB3 A;  1X9S B;  2HYX A;  3GTU A;  5AN1 A;  5EVO A;  2ES7 A;  4KW6 A;  4ECC A;  1S3A A;  3UL3 A;  3I9V 2;  5KOW A;  4TR0 A;  5KN3 A;  5A4U A;  1V40 A;  4TRX A;  1GRX A;  2FA8 A;  3M8N A;  5BMU A;  3L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...