4OWYA

Crystal structure of ahp1 from saccharomyces cerevisiae. investigating the electron transfers.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
169
Chain Sequence
DLVNKKFPAGDYKFQYIAISQSDCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin type-2
publication title Crystal Structure of Ahp1 from Saccharomyces cerevisiae. Investigating the electron transfers.
rcsb
source organism Saccharomyces cerevisiae
total genus 45
structure length 169
sequence length 174
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4owyA00
3GA4A 3FK8A 1DE2A 3MNGA 2O87A 3ME8A 1AQVA 5ID2B 1O8WA 3WGDA 5IO0A 4HDEA 4HOJA 5ELAA 1ERUA 2GSQA 4OWYA 1X9SB 1EEJA 2H0HA 4V2NA 4MDCA 3F6DA 3VURA 3TJJA 5IMAA 5DBQA 1WMJA 3F0IA 3KIJA 2YP6A 3ZL5A 2AV4A 5GZZB 5JWRB 4YQUA 1QQ2A 3IV4A 5H5QA 5ECMB 3S9FA 1NHOA 4PQIA 1M2DA 4MPGA 2IWTA 3E0UA 4FYUA 1TDIA 2XHFA 1PSQA 2OE3A 1Z5YE 20GSA 1GULA 5JCGA 3KTBA 7GSSA 2GS3A 4NPBA 2IMIA 2R37A 2ES7A 5HFGA 2I1UA 6GSXA 2PUKC 3KXOA 3C1RA 1LU4A 2K18A 1PMTA 1MDIA 4FYCA 2LTKA 4TVEA 4WBJA 4KA0A 2LRCA 2HXKA 3FEUA 1F3BA 3O76A 2VL9A 3GYKA 2N5FA 3EURA 2GDRA 1LBKA 1T00A 2F51A 4KNDA 1FHEA 1XIYA 3KMOA 3U6VA 1JZDA 4CHSA 5CP1A 3C8EA 4I6XA 4NMUA 1GTUA 3UJ1A 3M0FA 5E4WA 2YWNA 2H72A 2FA8A 5KN1A 1V2AA 3QPMA 19GSA 2OACA 5DALB 1Z7RA 4JEDA 2H1AA 1XVQA 3GRXA 5F8BA 3P8WA 2V2GA 3KTLA 1TU8A 3BD2A 2XBQA 3F8UA 5G5FA 2L5OA 4I2UA 2TRXA 4XTSA 5AIVA 2OE0A 3F4TA 2DMLA 4ULXA 1R5AA 1BG5A 1ML6A 2HZFA 4QL7A 3DRNA 4J57E 4L5OA 5ECRB 1NW2A 3D4TA 3UVHA 3FZ5A 5B7CA 2CX3A 1FB0A 3ZREA 3CRTA 5HFIA 4K1FA 3G7YA 3VWUA 4AJ6A 1AW9A 3F9UA 4XS4B 4IQ1A 1ZYEA 4K6XA 1M9BA 4TR1A 3KP9A 1SL2B 1THOA 2WZ9A 2VM1A 4O7HA 3UEMA 3MSZA 4Q5RA 1URMA 2B7KA 3MWHA 5IMZA 1NSWA 3FW2A 2HE3A 4E8EA 4V1Ap 4PUFC 4WR5A 1K0CA 2VOCA 5A4VA 1PGTA 4GLTA 4FYBA 1S3CA 3D22A 4DEJA 2O8VB 1EP7A 1GSSA 1O8XA 3M9JA 1OC9A 4HJ2A 2R2JA 5HQPA 5IIZA 2GTUA 1TRWA 1DSBA 2FD3A 2YV7A 3HD5A 2DJJA 2P0GA 1MTCA 4WEYA 3WYWA 2C4JA 2VCVA 5DAKB 1Z3EA 2QKEA 4OFMA 4OFNA 3FHKA 4GWRA 1ERTA 1ZOFA 5DCHA 4TKYA 2MBTA 1K0MA 6GSWA 2H19A 4G2EA 1WPIA 2CV4A 2XPEA 2GQLA 1M0UA 2L6CA 1OE7A 2VIMA 2C0GA 2FHEA 3DYRA 4HEA2 1E2YA 5HR2A 2WJUA 1OVNA 4IVFA 4IP6A 3EWLA 5D9VA 5B6NA 4G9HA 1B8XA 2YN1A 4KAEA 2EIQA 2YWIA 2O85A 2WRTA 5HR3A 3TDGA 3IOSA 1IYHA 5COHA 2CT6A 4ISDA 2I4AA 2PVOC 2VL3A 4IP1A 3LXTA 1M2BA 1S3DA 1F9MA 5FHIA 4JR6A 1GNWA 1M9AA 4TR0A 1A0FA 4LMWA 3VWVA 4K7IA 4HZ2A 5A5KA 1AQWA 5G30A 3UMAA 4PNGA 1HQOA 3D0ZA 3CYNA 1RW1A 2GGTA 4Q5QA 2H1DA 2HZEB 5ECLB 1GSEA 4EKZA 4DSQA 1SL1B 3O6TA 2B5XA 2NPBA 1SKRB 2IL3A 4Q5NA 1TKDB 4LMVA 4IHUA 4KH7A 2TIRA 3IE3A 5L71A 1N2AA 1T7PB 5ID2A 2GQKA 2A2RA 3BCIA 4NV5A 4WETA 2IFQB 4XIHA 1WRYA 4BWQA 3CMIA 5F06A 1A2LA 2GSRA 5JWQB 1EGOA 1R7HA 4J56E 1TP9A 2WGRA 1J08A 3DVWA 3QR6A 3APSA 2VCWA 3ZRDA 5E59A 2D2ZA 2WS2A 1XW9A 1ZMAA 1ST9A 2I3YA 4F2IA 4EXJA 1USBA 5J9BA 1JZWA 1UN2A 5D73A 4L8EA 2DMMA 1ERVA 1YKAA 1TI3A 3Q74A 1GLPA 3HJPA 4WKWA 14GSA 1AIUA 3L4NA 1G6YA 1F37A 2DJ3A 1T8EB 3TJKA 4KDXA 4MJCA 4EDZA 3DGQA 1SKSB 3DWVA 3N9JA 3SWLA 3WGEA 1SK0A 5ECHB 5IPGA 3CXGA 4KUNA 1GSFA 4TXVA 2M46A 5INYA 1SJIA 1XWKA 1K0DA 3KMNA 1SJZA 4IN0A 3W8JA 4XCSA 1U87A 4HZ4A 2C1YA 5KN3A 3CRUA 4F82A 3IHQA 3JCML 2R5GA 2R3XA 2VLTA 1EGRA 2HSHA 3E9JB 2REMA 3EMXA 3GTUB 4IGJA 1WP0A 1KEBA 1OE8A 5DALA 2NDOA 3TKRA 4TR3A 1BEDA 4POBA 2ALBA 3KP8A 4HS1A 2JACA 2CAIA 5J9CA 2DC5A 3U5RE 4MJBA 3AY8A 3RDWA 2PERA 2V32A 4MABA 1BQ7A 4G19A 2AYTA 1V9WA 1OC3A 2JL4A 4HU7A 4TRXA 5D9TA 3VWXA 2GSTA 3A5WA 1EZKA 3QDNA 2TRCP 5IMFA 2CZ3A 1O85A 2PGTA 3CBUA 2YWOA 4L0WA 4XS4A 5ABRA 3N5OA 2AAWA 2GT5A 2CVKA 3TKQA 3KEBA 3QFBC 2LJAA 3IC4A 2P5QA 1THXA 3G9BA 4V2MA 2RUFA 2L4QA 4ZL9A 5ECKB 2ON5A 4MF7A 4D73B 3F3QA 1K3LA 1WE0A 4JBBA 1HNBA 1DBYA 1PRXA 4ZBAA 4CDOA 4KB3A 3C71A 3TB2A 3RPPA 1F6MC 1ERWA 4ACSA 1BAYA 1JHBA 3P2AA 2MMOA 3H4KA 4MZWA 2CA8A 3HZ8A 4X0XA 1FO5A 2QGVA 5DAKA 1SD9A 1S3AA 1XWCA 1G0TA 4ZB6A 1EV9A 2DJ1A 1V58A 4IQAA 3TJBA 3D4MA 4PX1A 3UBLA 2L59A 2XC2A 2GT6A 1G6WA 4PURA 1YQ1A 1YF0A 2C80A 3GX0A 3MDKA 5EPFA 4P3YB 1PD21 2KLXA 4MK3A 1YZXA 3A3TA 2YANA 4ZL7A 2JZTA 4JU5A 1H4OA 4MJEA 2WDUA 2VCXA 3HDCA 4NHWA 2VCZA 3FKFA 3EU3A 4NWYA 4RUVA 1CQHA 1QXHA 1H75A 1MEKA 4IJ3A 2EC4A 4WXTA 1ZGNA 3ZFLA 4BWSA 2AJQB 3GUSA 4MPFA 2FCHA 3GSTA 1VF1A 1QFNA 1FVJA 2NBSA 3HKRA 2WULA 1TU7A 3W8SA 5IOXA 4IELA 3EU4A 1TK0B 2DBCA 4OO4A 2R4VA 4H86A 1EV4A 1GTAA 3F3RA 2HYXA 2HZEA 3QAGA 3KJYA 1Q4JA 3VWWA 3CSIA 2FWGA 3KGKA 3QD9A 4ML1A 1EWXA 2YOIA 10GSA 4MJAA 2GZYA 3C73A 1ILOA 5IMCA 1UC7A 1MD4A 4Q5FA 3ZMKA 2PPTA 5EY6A 2HNLA 5ELGA 3IK7A 4MLYA 8GSSA 5GSSA 1KTEA 2V6KA 2CVBA 3UIWA 2IFQA 3I69A 22GSA 4OD7A 4MZBA 5CO3A 1QUWA 6GSVA 2E7PA 2B1LA 3P7XA 1R5PA 1PX7A 2H6ZA 3HJMA 2CZ2A 2JU5A 2IJYA 2H75A 5HFKA 3ZFBA 2YJ7A 3I43A 1CQGA 4ZBBA 1XWAA 4MA9A 4PNFA 2P31A 4ZXGA 3BBYA 4KCEA 1FG4A 3WD6A 4QL9A 3CTFA 4PQ1A 4L5LA 1A8LA 1O73A 5DJLA 5IM9A 3G7JA 2OA7A 5F05A 2VD0A 4MCUA 1U3AA 4POKA 3VLNA 2C0FA 3LXZA 4V2LA 2YNXA 2F9SA 1VF2A 4TOPA 4OMVA 3PR8A 1WOUA 1SD8A 5G1KA 3O3TA 3QAVA 3I6AA 4YH2A 4G10A 11GSA 1AC1A 2VL2C 3QCPA 3ME7A 12GSA 3ZMLA 4ID0A 3HXSA 2FGXA 4YQMA 1EOHA 1A24A 1GTBA 3GFKA 2DIZA 4QQ7A 3HZ4A 3IRAA 2HSYA 1TRVA 3LWAA 4GTUA 3GTUA 4RQXA 1AUCA 4I97A 1W4VA 2GVPA 5J41A 1FB6A 4KSOA 2M72A 3ZIVA 4WF5A 3BOAA 1NM3A 3TRXA 3UARA 3TJFA 3GKKA 5AGYA 3FZ9A 2BJXA 1O81A 3GN3A 3Q19A 4E8HA 1QGVA 3EMPA 3UAPA 1MD3A 3HVXA 3KD0A 2X8CA 4DSSB 2FA4A 4I8BA 2EIRA 3F6FA 3QFAC 4TXOB 3RHCA 2OADA 2RM5A 3ZVJD 1V40A 1T1VA 4NV2A 3HY2A 3GURA 5EVOA 3ZVJA 1N8JA 1MDJA 2P5RA 3F63A 1X9MB 1SKWB 1Z9HA 4D73A 4HJMA 1HYUA 1YEXA 5B8AA 1DUGA 1YJ6A 5D93A 2BTOT 3LSZA 3HA9A 3BJ5A 4KW6A 2JSYA 3QAWA 2LV3A 1GSUA 1Z6NA 1A2MA 2IN3A 1TXXA 2O7KA 3A2XA 3H8QA 3H79A 2KOKA 2VAFA 4XS1A 2QC7A 1YF1A 1VRSD 3BCKA 4ILFA 1B4QA 4OCEA 1SYXA 2LNSA 3M3MA 2I9HA 2YZHA 2B3SA 1Y6EA 1SL0B 4YQVA 4X1UA 2JZSA 2PMTA 1HD2A 3KM6A 1YEPA 5DQYA 4DSRA 1GLQA 2PN8A 2OBIA 3LFLA 1BJXA 5JCUA 4KX4A 1EP8A 3HVVA 4ECJA 3RHBA 2DLXA 2FWHA 2JADA 1A8YA 5LNKe 5IPHA 4POMA 3APQA 1K0AA 2H6XA 2C3NA 2H76A 2B5EA 3US3A 4ML6A 1U88A 2H01A 3UL3A 4N0ZA 5D96A 2VCTA 5C00A 1M7TA 2HI7A 1TK8B 3H93A 2X64A 4KE3A 1HNAA 1ON4A 2FWFA 4KDUA 4AJ8A 1TOFA 4ZB9A 1WIKA 3KZQA 2E2MA 4WF4A 2YCDA 2LEGA 2H1BA 5FWGA 1X9WB 4YAVA 13GSA 2XPDA 4TR4A 1I9DA 3VK9A 3W6GA 4IJIA 1XOBA 6GSSA 2ZNMA 4DVCA 1XXUA 6GSUA 4AJ7A 1JFUA 1FAAA 3H1NA 3GNJA 3CTGA 3NZNA 4BPYA 4LL4B 5CREA 1PA3A 1YY7A 5HR1A 2MMZA 1ABAA 4JRRA 1C72A 4PGTA 3GX8A 2YZUA 5B6MA 2C3TA 2K9FA 3ZLPA 2AHEA 1XWBA 2VM2A 2MYGA 3LEFA 4CW9A 2M80A 2CVDA 2G2QA 4HQZA 1T3BA 5B8BA 5CNWA 3IA1A 2F8AA 4F0BA 4K0GA 2OBKA 3M1GA 1AQXA 3TKSC 4MH3A 4O92A 3DKSA 3APOA 3NOFA 2LQQA 2B6MA 2KP1A 2IMKA 2RIIA 2MMNA 2LQOA 2V41A 1MDKA 1G7OA 2I81A 2YJHA 2NTOA 2H73A 1ZCPA 1GSYA 1GRXA 1ZL9A 5CRWA 4BVYA 1LJRA 2H70A 2J23A 4ZIJA 3UBKA 1KNGA 4K2DA 2YPMA 4L0UA 3NIVA 4V1Ag 5G31A 2K8SA 2JZRA 5ECIB 2FLSA 2WCIA 1W89A 4HI7A 1I5GA 2NVLA 2YWMA 3GKNA 3ZTLA 1YDKA 3L9UA 3UOMA 5D8IA 1GP1A 2N5BA 3V1WA 4KSMA 3ERWA 2FWEA 1GNEA 2F3MA 2VL2A 1UA5A 1XWGA 3FY7A 5F0GA 3WT1A 3G7IA 5AISA 3A2WA 4I5QA 3KCMA 4AF2A 3K8NA 2LSTA 4XS6A 3GH9A 1XCCA 4DSSA 1GUKA 5HR0A 3GHAA 1K0BA 3FYGA 18GSA 1XPVA 4TXOA 3L78A 1DE1A 3TCOA 4ECIA 4IS0A 2VD1A 4X43A 4I2TA 3I9V2 1K0NA 5IMDA 4GSTA 4TW5A 1XBSA 4KCAA 2H6YA 4GSSA 3E3EA 4BL7A 5ENUA 5D9WA 5JCWA 2AUVA 2BMXA 3KH7A 3IDVA 2L6DA 1Z7PA 4EUYA 4LL1B 5LD0A 2ZCTA 2K6VA 2YV9A 5CRGA 3D21A 1B9YC 2L5LA 2LUSA 3HJOA 5J4UA 1OAZA 1PX6A 16GSA 5IQYA 3Q18A 4N11A 4MMMA 4N30A 3GKMA 3TKPA 1BYEA 2IIYA 1V98A 2C0DA 3FR6A 5A4WA 1OKDA 1RQMA 4ECBA 1ZZYA 4GQFA 4HQSA 5H5SA 2G0FA 1GSQA 5DQSA 2RM6A 3ERFA 2XBIA 3EINA 3IK9A 1A2JA 1EOGA 5CYYA 4AGSA 5KEJA 1T4YA 1XOAA 3L0HA 4GQCA 2MBSA 2L4CA 1SENA 2LKUA 1B4PA 4ZILA 3WT2A 5ECNB 2GZZA 2VCQA 2HFDA 1WWJA 4JZQA 3VPTA 2H0IA 2VO4A 2LNTA 1X5DA 5DVBA 5ECPB 2DSAA 3GV1A 1GUMA 1KBNA 1R26A 5IMVA 2RUEA 1AXDA 2PBJA 3R2QA 4GXZA 3F4RA 2QSIA 4EF0A 3C1SA 1J9BA 5ECQB 4BVXA 2X8GA 5IO2A 1HNCA 1GL8A 5J3RA 3DMLA 4NXIA 4EO3A 2PVQA 3IPZA 3SBCA 3LYPA 3F4SA 1YKCA 4NAXA 2H66A 3FRCA 3D5JA 2V6OA 2K8VA 5GAND 3GMFA 1VF4A 2DJKA 1XZOA 6GSTA 4PQHA 2ON7A 4N0VA 1TJDA 3FR9A 1A23A 2IMFA 3P90A 5KN2A 3VPQA 1OC8A 2PU9C 4LA1A 1WJKA 4IBPA 4OO5A 5AIXA 5H5RA 2HT9A 3VI7A 2C3QA 1TK5B 3RBTA 1GSDA 2A4VA 1GUHA 3GSSA 4F9ZA 1ACVA 3D6IA 1F2EA 3TRPA 2H74A 3DVXA 1PKZA 4GF0A 3L9SA 3ZIJA 3MAKA 4OFTA 3LYKA 3J7Yk 2O89A 2PWJA 1Z6MA 3IAS2 3VFIA 3GKXA 4O5RA 1G7EA 1GH2A 1IYIA 1JZOA 5JWOB 4ECCA 4K0NA 3RPNA 3EVIA 3VI5A 5F07A 2FY6A 2J9HA 4XRAA 3LG6A 3QOUA 4YAPA 3EYTA 2OJLA 1PL2A 3TKSE 3IAM2 3A2VA 4J2FA 1K3OA 4IW9A 2H71A 3FZAA 1BX9A 3GIXA 4HU9A 5G5EA 3ZZXA 2C0EA 1PN9A 3EE2A 4FH8A 1Q98A 3PGTA 2DJ0A 3TKSA 3DIEA 4EE0A 1Y25A 1XW5A 2VLVA 4MF5A 2FUG2 1JZRA 4K8MA 3TRQA 3ED3A 3UVTA 3RAZA 5C04A 3DXBA 4RI6A 1XW6A 4O32A 5KN0A 2OKAA 1T4ZA 4EL1A 2H0GA 3LGCA 4XHMA 4MF6A 3PH9A 2HLSA 1SK2A 1OKTA 3LJRA 1FW1A 4IKHA 1X5EA 4RI7A 3QMXA 2LJRA 3IBHA 4JE1A 4PUAA 2GLRA 3TJGA 3FZ4A 2LJKA 4F03A 2F8FA 1B9XC 3Q6OA 3ZYWA 4N10A 3TGZA 2MZCA 3FR3A 4EC0A 4WBRD 1U6TA 4JR4A 2LRTA 2H8LA 1R4WA 1E6BA 4NHZA 1J0FA 1SK1A 2A2SA 2DJ2A 4EDYA 2CX4A 3GH6A 4POLA 1O7UA 3ERGA 1PL1A 3LQ7A 2C8UA 1FOVA 3C7MA 3EC3A 3HVSA 1U3IA 2V1MA 4MH2A 1PKWA 2HRNA 5CAXA 2OE1A 3OR5A 3CSHA 2MMAA 2KHPA 1SYRA 3TOTA 2CQ9A 5A4UA 2B1KA 1QMVA 5FT3A 2X8HA 2E2GA 17GSA 2LRNA 4K9ZA 1VF3A 4TR1B 5DJMA 4EVMA 1TRUA 1F3AA 2H30A 1QK8A 1X0RA 2R6KA 1JLVA 4TN8A 3ZITA 3M8NA 4KDYA 1A0RP 3GL5A 4MZCA 4LLRA 1VGLA 3ISOA 4K7NA 5DDLA 3DD3A 1OYJA 2JSZA 4HUAA 3HCZA 3HYPA 1OC9B 4XRDA 2GSSA 1XVWA 4FIWA 3L9VA 1M2AA 2GQMA 2L57A 4Z7XA 4GSNA 2E0QA 2HRFA 4PXOA 3LORA 2IPAA 2VUPA 4K7OA 5CRDA 1TRSA 5G1LA 1JLWA 2IMEA 1FVKA 1RK4A 2X99A 4FO5A 4ZBDA 2WFCA 4ZL8A 5ECSA 5AN1A 2AB6A 5CRHA 5D9XA 2EIOA 1UVZA 5ECOB 3PINA 1TTZA 2H1GA 2KUCA 3GL3A 3IR4A 3KH9A 2IMDA 2B5YA 4GRFA 1EEMA 1TI1A 2N5AA 4WR4A 5J5NA 9GSSA 1O6JA 2LS5A 3DEXA 1TW9A 1GWCA 2Z9SA 3HHVA 4F0CA 1SJ6A 1PQNA 4OCFA 5IOWA 2DIYA 2GZPA 4RQRA 1K0OA 1NHYA 3TOUA 1AAZA 1K3YA 3CSJA 2ZUPA 2KP2A 3TUEA 1V57A 4ZB8A 5GSTA 5LCZA 1X5CA 1GTIA 2B7JA 2WB9A 3IXRA 5DCGA 5GAPD 1ZYQB 1XFLA 2RLIA 6GSYA 3J7Yb 5EL8A 4BA7A 2CAQA 1B48A 4KGIA 2VLUA 1M99A 3M9KA 4GCIA 1SU9A 4MP4A 2FNOA 3WGXA 5G2ZA
chains in the Genus database with same CATH superfamily
3GA4A 3FK8A 1DE2A 4MNNA 3MNGA 2O87A 3ME8A 1AQVA 5ID2B 1O8WA 3WGDA 5IO0A 4HDEA 4HOJA 4ICYA 5ELAA 1ERUA 2GSQA 4OWYA 1X9SB 1EEJA 2H0HA 4V2NA 4MDCA 3F6DA 3VURA 3TJJA 5IMAA 5DBQA 1WMJA 3F0IA 3KIJA 2YP6A 3ZL5A 2AV4A 5GZZB 5JWRB 4YQUA 1QQ2A 3IV4A 5H5QA 5ECMB 3S9FA 1NHOA 4PQIA 1M2DA 4MPGA 2IWTA 3E0UA 4FYUA 1TDIA 2XHFA 1PSQA 2OE3A 1Z5YE 20GSA 1GULA 5JCGA 3KTBA 7GSSA 2GS3A 4Z2TA 4NPBA 2IMIA 2R37A 2ES7A 5HFGA 2I1UA 6GSXA 2PUKC 3KXOA 3C1RA 1LU4A 2K18A 1PMTA 1MDIA 4FYCA 2LTKA 4TVEA 4WBJA 4KA0A 2LRCA 2HXKA 3FEUA 2HRAA 1F3BA 3O76A 2VL9A 3GYKA 2N5FA 3EURA 2GDRA 1LBKA 1T00A 2F51A 4KNDA 1FHEA 1XIYA 3KMOA 3U6VA 1JZDA 4CHSA 5CP1A 3C8EA 4I6XA 4NMUA 1GTUA 3UJ1A 3M0FA 5E4WA 2YWNA 2H72A 2FA8A 5KN1A 1V2AA 3QPMA 19GSA 2OACA 5DALB 1Z7RA 4JEDA 2H1AA 1XVQA 3GRXA 5F8BA 3P8WA 2V2GA 3KTLA 1TU8A 3BD2A 2XBQA 3F8UA 5G5FA 2L5OA 4I2UA 2TRXA 4XTSA 5AIVA 2OE0A 3F4TA 2DMLA 4ULXA 1R5AA 1BG5A 1ML6A 2HZFA 4QL7A 3DRNA 4J57E 4L5OA 5ECRB 1NW2A 3D4TA 3UVHA 3FZ5A 5B7CA 2CX3A 1FB0A 3ZREA 3CRTA 5HFIA 4K1FA 3G7YA 3VWUA 4AJ6A 1ZYNA 1AW9A 3F9UA 4XS4B 4IQ1A 1ZYEA 4K6XA 1M9BA 4TR1A 3KP9A 1SL2B 1THOA 4A5PA 2WZ9A 2VM1A 4O7HA 3UEMA 3MSZA 4Q5RA 1URMA 2B7KA 3MWHA 5IMZA 1NSWA 3FW2A 2HE3A 4E8EA 4V1Ap 4PUFC 4WR5A 1K0CA 2VOCA 5A4VA 1PGTA 4GLTA 4FYBA 1S3CA 3D22A 4DEJA 2O8VB 1EP7A 1GSSA 1O8XA 3M9JA 1OC9A 4HJ2A 4FQUA 2R2JA 5HQPA 5IIZA 2GTUA 1TRWA 1DSBA 2FD3A 2YV7A 3HD5A 2DJJA 2P0GA 1MTCA 4WEYA 3WYWA 2C4JA 2VCVA 5DAKB 1Z3EA 2QKEA 4OFMA 4OFNA 3FHKA 4GWRA 1ERTA 1ZOFA 5DCHA 4TKYA 2MBTA 1K0MA 6GSWA 2H19A 4G2EA 1WPIA 2CV4A 2XPEA 2GQLA 1M0UA 2L6CA 1OE7A 2VIMA 2C0GA 2FHEA 3DYRA 4HEA2 1E2YA 5HR2A 2WJUA 1OVNA 4IVFA 4IP6A 3EWLA 5D9VA 5B6NA 4G9HA 1B8XA 2YN1A 4KAEA 2EIQA 2YWIA 2O85A 2WRTA 5HR3A 3TDGA 3IOSA 1S3RA 1IYHA 5COHA 2CT6A 4ISDA 2I4AA 2PVOC 2VL3A 4IP1A 3LXTA 1M2BA 1S3DA 1F9MA 5FHIA 4JR6A 1GNWA 1M9AA 4TR0A 1A0FA 4LMWA 3VWVA 4K7IA 4HZ2A 5A5KA 1AQWA 5G30A 2X4AA 3UMAA 4PNGA 1HQOA 3D0ZA 3CYNA 1RW1A 2GGTA 4Q5QA 2H1DA 2HZEB 5ECLB 1GSEA 4EKZA 4DSQA 1SL1B 1M3JA 3O6TA 2B5XA 2NPBA 1SKRB 2IL3A 4Q5NA 1TKDB 4LMVA 4IHUA 4KH7A 2TIRA 3IE3A 5L71A 1N2AA 1T7PB 5ID2A 2GQKA 2A2RA 3BCIA 4NV5A 4WETA 2IFQB 4XIHA 1WRYA 4BWQA 3CMIA 5F06A 1A2LA 2GSRA 5JWQB 1EGOA 1R7HA 4J56E 1TP9A 2WGRA 1J08A 3DVWA 3QR6A 4KF9A 3APSA 2VCWA 3ZRDA 5E59A 2D2ZA 2WS2A 1XW9A 1ZMAA 2HRKA 1ST9A 2I3YA 4F2IA 4EXJA 1USBA 5J9BA 1JZWA 1UN2A 5D73A 4L8EA 2DMMA 1ERVA 1YKAA 2R0GA 1TI3A 3Q74A 1GLPA 3HJPA 4WKWA 14GSA 1AIUA 3L4NA 1G6YA 1F37A 2DJ3A 1T8EB 3TJKA 4KDXA 4MJCA 4EDZA 3DGQA 1SKSB 3DWVA 3N9JA 3SWLA 3WGEA 1SK0A 5ECHB 5IPGA 3CXGA 4KUNA 1GSFA 4TXVA 2M46A 5INYA 1SJIA 1XWKA 1K0DA 3KMNA 1SJZA 4IN0A 3W8JA 4XCSA 1U87A 4HZ4A 2C1YA 5KN3A 3CRUA 4F82A 3IHQA 3JCML 2R5GA 2R3XA 2VLTA 1EGRA 2HSHA 3E9JB 2REMA 3EMXA 3GTUB 4IGJA 1WP0A 1KEBA 1OE8A 5DALA 2NDOA 3TKRA 4TR3A 1BEDA 4POBA 2ALBA 3KP8A 4HS1A 2JACA 2CAIA 5J9CA 2DC5A 3U5RE 4MJBA 4BIKA 3AY8A 3RDWA 2PERA 2V32A 4MABA 1BQ7A 4G19A 2AYTA 1V9WA 1OC3A 2JL4A 4HU7A 4TRXA 5D9TA 3VWXA 2GSTA 3A5WA 1EZKA 3QDNA 2TRCP 5IMFA 2CZ3A 1O85A 2PGTA 3CBUA 2YWOA 4L0WA 4XS4A 5ABRA 3N5OA 2AAWA 2GT5A 2CVKA 3TKQA 3KEBA 3QFBC 2LJAA 3IC4A 2P5QA 1THXA 3G9BA 4V2MA 2RUFA 2L4QA 4ZL9A 5ECKB 2ON5A 4MF7A 4D73B 3F3QA 1K3LA 1WE0A 4JBBA 1HNBA 1DBYA 3R3EA 4USSA 1PRXA 4ZBAA 4CDOA 4KB3A 3C71A 3TB2A 3RPPA 1F6MC 1ERWA 4ACSA 1BAYA 1JHBA 3P2AA 2MMOA 3H4KA 4MZWA 2CA8A 3HZ8A 4X0XA 1FO5A 2QGVA 5DAKA 1SD9A 1S3AA 1XWCA 1G0TA 4ZB6A 1EV9A 2DJ1A 1V58A 4IQAA 3TJBA 3D4MA 4PX1A 3UBLA 2L59A 2XC2A 2GT6A 1G6WA 4PURA 1FOHA 1YF0A 1YQ1A 2C80A 3GX0A 3MDKA 5EPFA 4P3YB 1PD21 2KLXA 4MK3A 1YZXA 3A3TA 2YANA 4ZL7A 2JZTA 4JU5A 1H4OA 4EIPA 4MJEA 2WDUA 2VCXA 3HDCA 4NHWA 2VCZA 3FKFA 3EU3A 4NWYA 4RUVA 1CQHA 1QXHA 1H75A 1MEKA 4IJ3A 2EC4A 4WXTA 1ZGNA 3ZFLA 4BWSA 2AJQB 3GUSA 3MIXA 4MPFA 2FCHA 3GSTA 1VF1A 1QFNA 2X49A 1FVJA 2NBSA 3HKRA 2WULA 1TU7A 3W8SA 5IOXA 4IELA 3EU4A 1TK0B 2DBCA 4OO4A 2R4VA 4H86A 1EV4A 1GTAA 3F3RA 2HYXA 2HZEA 3QAGA 3KJYA 1Q4JA 3VWWA 3CSIA 2FWGA 3KGKA 5BMUA 3QD9A 4ML1A 1EWXA 2YOIA 10GSA 4MJAA 2GZYA 3C73A 1ILOA 5IMCA 1UC7A 1MD4A 4Q5FA 3ZMKA 2PPTA 5EY6A 2HNLA 5ELGA 3IK7A 4MLYA 8GSSA 5GSSA 1KTEA 2V6KA 2CVBA 3UIWA 2IFQA 3I69A 22GSA 4OD7A 4MZBA 5CO3A 1QUWA 6GSVA 2E7PA 2B1LA 3P7XA 1R5PA 1PX7A 1ZYPA 2H6ZA 3HJMA 4G0KA 2CZ2A 2JU5A 2IJYA 2H75A 5HFKA 3ZFBA 2YJ7A 3I43A 1CQGA 4ZBBA 1XWAA 4MA9A 4PNFA 2P31A 4ZXGA 3BBYA 4KCEA 3PPUA 1FG4A 3WD6A 4QL9A 3CTFA 4PQ1A 4L5LA 1A8LA 1O73A 5DJLA 5IM9A 2QA1A 3G7JA 2OA7A 5F05A 2VD0A 4MCUA 4CY8A 1U3AA 2A4HA 4POKA 3VLNA 2C0FA 3LXZA 4V2LA 2YNXA 2F9SA 1VF2A 4TOPA 4OMVA 3PR8A 1WOUA 1SD8A 5G1KA 3O3TA 4BVYB 3QAVA 4YKGA 4Z2RA 3I6AA 4YH2A 4G10A 11GSA 1AC1A 2VL2C 3QCPA 3ME7A 12GSA 3ZMLA 4ID0A 3HXSA 2FGXA 4YQMA 1EOHA 1A24A 1GTBA 3GFKA 2DIZA 4QQ7A 4PTSA 3HZ4A 3IRAA 2HSYA 1TRVA 3LWAA 4O5UA 4GTUA 3GTUA 4RQXA 1AUCA 4I97A 1W4VA 2GVPA 5J41A 1FB6A 4KSOA 2M72A 4X4JA 3ZIVA 4WF5A 3BOAA 1NM3A 3TRXA 3UARA 3TJFA 3GKKA 5AGYA 3FZ9A 2BJXA 1O81A 3GN3A 3Q19A 4E8HA 1QGVA 3EMPA 3UAPA 1MD3A 3HVXA 3KD0A 2X8CA 4DSSB 2FA4A 4I8BA 2EIRA 3F6FA 3QFAC 4TXOB 3RHCA 2OADA 4G0IA 2RM5A 3ZVJD 4K5SA 1V40A 1T1VA 4NV2A 3HY2A 3GURA 5EVOA 3ZVJA 1N8JA 1MDJA 2P5RA 3F63A 1X9MB 1SKWB 1Z9HA 4D73A 4HJMA 1HYUA 1YEXA 4BL7B 1DUGA 5B8AA 1YJ6A 5D93A 2BTOT 3LSZA 3HA9A 3BJ5A 4KW6A 2JSYA 3QAWA 2LV3A 1GSUA 1Z6NA 1A2MA 2IN3A 1TXXA 2O7KA 3A2XA 3H8QA 1XG8A 3H79A 2KOKA 2VAFA 4XS1A 2QC7A 1YF1A 1VRSD 3HVNA 3BCKA 4ILFA 1B4QA 4OCEA 1SYXA 2LNSA 3M3MA 2I9HA 2YZHA 2B3SA 1Y6EA 1SL0B 4YQVA 4X1UA 2JZSA 2PMTA 1HD2A 3KM6A 1YEPA 5DQYA 4DSRA 1GLQA 2PN8A 2OBIA 3LFLA 1BJXA 5JCUA 4KX4A 1EP8A 3HVVA 4ECJA 3RHBA 2DLXA 2FWHA 2JADA 1A8YA 5LNKe 5IPHA 4POMA 3APQA 1K0AA 2H6XA 4G0LA 2C3NA 2H76A 2B5EA 4K2XA 3US3A 4ML6A 1U88A 2H01A 3UL3A 4N0ZA 4BVXB 5D96A 2VCTA 5C00A 1M7TA 2HI7A 1TK8B 3H93A 2X64A 4KE3A 1HNAA 1ON4A 2FWFA 4KDUA 4AJ8A 1TOFA 4ZB9A 1WIKA 3KZQA 2E2MA 4WF4A 2YCDA 2LEGA 2H1BA 5FWGA 1X9WB 4YAVA 13GSA 2XPDA 4TR4A 1I9DA 3VK9A 3W6GA 4IJIA 1XOBA 6GSSA 2ZNMA 4DVCA 1XXUA 6GSUA 4AJ7A 1JFUA 1FAAA 3H1NA 3GNJA 3CTGA 3NZNA 4BPYA 4LL4B 2R0PA 5CREA 1PA3A 1YY7A 5HR1A 2MMZA 3CQFA 1ABAA 4JRRA 1C72A 4PGTA 3GX8A 2YZUA 5B6MA 2C3TA 2K9FA 3ZLPA 2AHEA 1XWBA 2VM2A 2MYGA 3LEFA 4CW9A 2M80A 2CVDA 2G2QA 4HQZA 1T3BA 5B8BA 5CNWA 3IA1A 2F8AA 2R0CA 4F0BA 4K0GA 2OBKA 3M1GA 1AQXA 3TKSC 4MH3A 4O92A 3DKSA 3APOA 3NOFA 2LQQA 2B6MA 2KP1A 2IMKA 2RIIA 2MMNA 2LQOA 2V41A 1MDKA 1G7OA 2I81A 2YJHA 2NTOA 2H73A 1ZCPA 1GSYA 1GRXA 1ZL9A 5CRWA 3EPTA 4BVYA 1LJRA 2H70A 2J23A 4ZIJA 3UBKA 1KNGA 4K2DA 2YPMA 4L0UA 3NIVA 4V1Ag 5G31A 2K8SA 2JZRA 5ECIB 2FLSA 2WCIA 1W89A 4HI7A 1I5GA 2NVLA 2YWMA 3GKNA 3ZTLA 1YDKA 3L9UA 3UOMA 5D8IA 1GP1A 2N5BA 3V1WA 4KSMA 3ERWA 2FWEA 4EIQA 1GNEA 2F3MA 2VL2A 1UA5A 1XWGA 3FY7A 5F0GA 3WT1A 3G7IA 5AISA 3A2WA 4I5QA 3KCMA 4YKFA 4AF2A 3K8NA 2LSTA 4XS6A 3GH9A 4HSCX 1XCCA 4DSSA 1GUKA 5HR0A 3GHAA 1K0BA 3FYGA 18GSA 1XPVA 4TXOA 3L78A 1DE1A 1PN0A 3TCOA 4ECIA 4IS0A 2VD1A 4X43A 4I2TA 3I9V2 1K0NA 5IMDA 3FMWA 4Z2UA 4GSTA 4TW5A 1XBSA 4KCAA 2H6YA 4GSSA 3E3EA 4BL7A 5ENUA 5D9WA 5JCWA 2AUVA 2BMXA 3KH7A 3IDVA 2L6DA 1Z7PA 4EUYA 4LL1B 5LD0A 2ZCTA 2K6VA 2YV9A 5CRGA 3D21A 1B9YC 2L5LA 2LUSA 3HJOA 5J4UA 1OAZA 1PX6A 16GSA 5IQYA 3Q18A 4N11A 4MMMA 4N30A 3GKMA 3TKPA 1BYEA 2IIYA 1V98A 4CY6A 2C0DA 3FR6A 5A4WA 1OKDA 1RQMA 4ECBA 1ZZYA 4GQFA 4HQSA 3MYDA 5H5SA 2G0FA 1GSQA 5DQSA 2RM6A 3ERFA 2XBIA 3EINA 3IK9A 1A2JA 1EOGA 5CYYA 4AGSA 5KEJA 1T4YA 1XOAA 3L0HA 4GQCA 2MBSA 2L4CA 1SENA 5BRTA 2LKUA 1B4PA 4ZILA 2QA2A 3WT2A 5ECNB 2GZZA 2VCQA 2HFDA 1WWJA 4JZQA 3VPTA 2H0IA 2VO4A 2LNTA 1X5DA 5DVBA 5ECPB 2DSAA 3GV1A 1GUMA 1KBNA 1R26A 5IMVA 2RUEA 1AXDA 2PBJA 3R2QA 4GXZA 3F4RA 2QSIA 4EF0A 3C1SA 1J9BA 5ECQB 4BVXA 2X8GA 5IO2A 1HNCA 1GL8A 5J3RA 3DMLA 4NXIA 4EO3A 2PVQA 3IPZA 3SBCA 3LYPA 3F4SA 1YKCA 4NAXA 2H66A 3FRCA 3D5JA 2V6OA 2K8VA 5GAND 3GMFA 1VF4A 2DJKA 1XZOA 6GSTA 4PQHA 2ON7A 4N0VA 1TJDA 3FR9A 1A23A 2IMFA 3P90A 5KN2A 3VPQA 1OC8A 2PU9C 4LA1A 1WJKA 4IBPA 4OO5A 5AIXA 5H5RA 3IHGA 2HT9A 3VI7A 2C3QA 1TK5B 3RBTA 1GSDA 2A4VA 1GUHA 3GSSA 4F9ZA 1ACVA 3D6IA 1F2EA 3TRPA 2H74A 2UZ8A 3DVXA 1PKZA 4GF0A 3L9SA 3ZIJA 3MAKA 4OFTA 3LYKA 3J7Yk 2O89A 2PWJA 1Z6MA 3IAS2 3VFIA 3GKXA 4O5RA 1G7EA 1GH2A 1IYIA 1JZOA 5JWOB 4ECCA 4K0NA 3RPNA 3EVIA 3VI5A 5F07A 2FY6A 2J9HA 4XRAA 3LG6A 3QOUA 4YAPA 3EYTA 2OJLA 1PL2A 3TKSE 3IAM2 3A2VA 4J2FA 1K3OA 4IW9A 2H71A 3FZAA 1BX9A 3GIXA 4HU9A 5G5EA 3ZZXA 2C0EA 1PN9A 3EE2A 4FH8A 1Q98A 3PGTA 2DJ0A 2A2PA 3TKSA 3DIEA 4EE0A 1Y25A 1XW5A 2VLVA 4MF5A 2FUG2 1JZRA 4K8MA 3TRQA 3ED3A 3UVTA 3RAZA 5C04A 3DXBA 4RI6A 1XW6A 4O32A 5KN0A 2OKAA 1T4ZA 4EL1A 2H0GA 3LGCA 4XHMA 4MF6A 3PH9A 2HLSA 1SK2A 2DKIA 1OKTA 1M3IA 3LJRA 1FW1A 4IKHA 1X5EA 4RI7A 3QMXA 2LJRA 3IBHA 4JE1A 4PUAA 2GLRA 3TJGA 3FZ4A 2LJKA 3LW9A 4F03A 2F8FA 1B9XC 3Q6OA 3ZYWA 4N10A 3TGZA 2MZCA 3FR3A 4EC0A 4WBRD 1U6TA 4JR4A 2LRTA 2H8LA 1R4WA 1E6BA 4NHZA 1J0FA 2HSMA 1SK1A 2A2SA 2DJ2A 4EDYA 2CX4A 3GH6A 4POLA 1O7UA 3ERGA 1PL1A 4O5QA 3LQ7A 2C8UA 1FOVA 3C7MA 3EC3A 3HVSA 1U3IA 2V1MA 4MH2A 1PKWA 2HRNA 5CAXA 2OE1A 3OR5A 3CSHA 2MMAA 2KHPA 1SYRA 3TOTA 2CQ9A 5A4UA 2B1KA 1QMVA 5FT3A 2X8HA 2E2GA 17GSA 2LRNA 4K9ZA 1VF3A 4TR1B 5DJMA 4EVMA 1TRUA 1F3AA 2H30A 1QK8A 1X0RA 2R6KA 1JLVA 4TN8A 3ZITA 3M8NA 4KDYA 1A0RP 3GL5A 4MZCA 4LLRA 1VGLA 3ISOA 4K7NA 5DDLA 3DD3A 1OYJA 2JSZA 4HUAA 3HCZA 3HYPA 1OC9B 4XRDA 2GSSA 1XVWA 4FIWA 3L9VA 1M2AA 2GQMA 2L57A 4Z7XA 4GSNA 2E0QA 5KOXA 2HRFA 4PXOA 3LORA 2IPAA 2VUPA 4K7OA 5CRDA 1TRSA 5G1LA 1JLWA 2IMEA 1FVKA 1RK4A 3IC8A 2X99A 4FO5A 4ZBDA 4K5RA 2WFCA 5KOWA 4ZL8A 5ECSA 5AN1A 2DKHA 2AB6A 5CRHA 5D9XA 2EIOA 1UVZA 5ECOB 3PINA 1TTZA 2H1GA 2KUCA 3GL3A 3IR4A 3KH9A 2IMDA 2B5YA 4GRFA 1EEMA 1TI1A 2N5AA 4WR4A 5J5NA 9GSSA 1O6JA 2LS5A 3DEXA 1TW9A 1GWCA 2Z9SA 3HHVA 4F0CA 1PFOA 1SJ6A 1PQNA 4OCFA 5IOWA 2DIYA 2GZPA 4RQRA 1K0OA 1NHYA 3TOUA 1AAZA 1K3YA 3CSJA 2ZUPA 2KP2A 3TUEA 1V57A 4ZB8A 5GSTA 5LCZA 1X5CA 1GTIA 2B7JA 2WB9A 3IXRA 5DCGA 5GAPD 1ZYQB 1XFLA 2RLIA 6GSYA 3J7Yb 5EL8A 4BA7A 2CAQA 1B48A 3A5IA 4KGIA 2VLUA 1M99A 3M9KA 4GCIA 1SU9A 4MP4A 2FNOA 3WGXA 5G2ZA
chains in the Genus database with same CATH topology
3GA4A 3FK8A 1DE2A 4MNNA 3MNGA 2O87A 3ME8A 1AQVA 5ID2B 1O8WA 3WGDA 5IO0A 4HDEA 4HOJA 4ICYA 5ELAA 1ERUA 2GSQA 4OWYA 1X9SB 1EEJA 2H0HA 4V2NA 4MDCA 3F6DA 3VURA 3TJJA 5IMAA 5DBQA 1WMJA 3F0IA 3KIJA 2YP6A 3ZL5A 2AV4A 5GZZB 5JWRB 4YQUA 1QQ2A 3IV4A 5H5QA 5ECMB 3S9FA 1NHOA 4PQIA 1M2DA 4MPGA 2IWTA 3E0UA 4FYUA 1TDIA 2XHFA 1PSQA 2OE3A 1Z5YE 20GSA 1GULA 5JCGA 3KTBA 7GSSA 2GS3A 4Z2TA 4NPBA 2IMIA 2R37A 2ES7A 5HFGA 2I1UA 6GSXA 2PUKC 3KXOA 3C1RA 1LU4A 2K18A 1PMTA 1MDIA 4FYCA 2LTKA 4TVEA 4WBJA 4KA0A 2LRCA 2HXKA 3FEUA 2HRAA 1F3BA 3O76A 2VL9A 3GYKA 2N5FA 3EURA 2GDRA 1LBKA 1T00A 2F51A 4KNDA 1FHEA 1XIYA 3KMOA 3U6VA 1JZDA 4CHSA 5CP1A 3C8EA 4I6XA 4NMUA 1GTUA 3UJ1A 3M0FA 5E4WA 2YWNA 2H72A 2FA8A 5KN1A 1V2AA 3QPMA 19GSA 2OACA 5DALB 1Z7RA 4JEDA 2H1AA 1XVQA 3GRXA 5F8BA 3P8WA 2V2GA 3KTLA 1TU8A 3BD2A 2XBQA 3F8UA 5G5FA 2L5OA 4I2UA 2TRXA 4XTSA 5AIVA 2OE0A 3F4TA 2DMLA 4ULXA 1R5AA 1BG5A 1ML6A 2HZFA 4QL7A 3DRNA 4J57E 4L5OA 5ECRB 1NW2A 3D4TA 3UVHA 3FZ5A 5B7CA 2CX3A 1FB0A 3ZREA 3CRTA 5HFIA 4K1FA 3G7YA 3VWUA 4AJ6A 1ZYNA 1AW9A 3F9UA 4XS4B 4IQ1A 1ZYEA 4K6XA 1M9BA 4TR1A 3KP9A 1SL2B 1THOA 4A5PA 2WZ9A 2VM1A 4O7HA 3UEMA 3MSZA 4Q5RA 1URMA 2B7KA 3MWHA 5IMZA 1NSWA 3FW2A 2HE3A 4E8EA 4V1Ap 4PUFC 4WR5A 1K0CA 2VOCA 5A4VA 1PGTA 4GLTA 4FYBA 1S3CA 3D22A 4DEJA 2O8VB 1EP7A 1GSSA 1O8XA 3M9JA 1OC9A 4HJ2A 4FQUA 2R2JA 5HQPA 5IIZA 2GTUA 1TRWA 1DSBA 2FD3A 2YV7A 3HD5A 2DJJA 2P0GA 1MTCA 4WEYA 3WYWA 2C4JA 2VCVA 5DAKB 1Z3EA 2QKEA 4OFMA 4OFNA 3FHKA 4GWRA 1ERTA 1ZOFA 5DCHA 4TKYA 2MBTA 1K0MA 6GSWA 2H19A 4G2EA 1WPIA 2CV4A 2XPEA 2GQLA 1M0UA 2L6CA 1OE7A 2VIMA 2C0GA 2FHEA 3DYRA 4HEA2 1E2YA 5HR2A 2WJUA 1OVNA 4IVFA 4IP6A 3EWLA 5D9VA 5B6NA 4G9HA 1B8XA 2YN1A 4KAEA 2EIQA 2YWIA 2O85A 2WRTA 5HR3A 3TDGA 3IOSA 1IYHA 5COHA 2CT6A 4ISDA 2I4AA 2PVOC 2VL3A 4IP1A 3LXTA 1M2BA 1S3DA 1F9MA 5FHIA 4JR6A 1GNWA 1M9AA 4TR0A 1A0FA 4LMWA 3VWVA 4K7IA 4HZ2A 5A5KA 1AQWA 5G30A 2X4AA 3UMAA 4PNGA 1HQOA 3D0ZA 3CYNA 1RW1A 2GGTA 4Q5QA 2H1DA 2HZEB 5ECLB 1GSEA 4EKZA 4DSQA 1SL1B 3O6TA 2B5XA 2NPBA 1SKRB 2IL3A 4Q5NA 1TKDB 4LMVA 4IHUA 4KH7A 2TIRA 3IE3A 5L71A 1N2AA 1T7PB 5ID2A 2GQKA 2A2RA 3BCIA 4NV5A 4WETA 2IFQB 4XIHA 1WRYA 4BWQA 3CMIA 5F06A 1A2LA 2GSRA 5JWQB 1EGOA 1R7HA 4J56E 1TP9A 2WGRA 1J08A 3DVWA 3QR6A 4KF9A 3APSA 2VCWA 3ZRDA 5E59A 2D2ZA 2WS2A 1XW9A 1ZMAA 2HRKA 1ST9A 2I3YA 4F2IA 4EXJA 1USBA 5J9BA 1JZWA 1UN2A 5D73A 4L8EA 2DMMA 1ERVA 1YKAA 2R0GA 1TI3A 3Q74A 1GLPA 3HJPA 4WKWA 14GSA 1AIUA 3L4NA 1G6YA 1F37A 2DJ3A 1T8EB 3TJKA 4KDXA 4MJCA 4EDZA 3DGQA 1SKSB 3DWVA 3N9JA 3SWLA 3WGEA 1SK0A 5ECHB 5IPGA 3CXGA 4KUNA 1GSFA 4TXVA 2M46A 5INYA 1SJIA 1XWKA 1K0DA 3KMNA 1SJZA 4IN0A 3W8JA 4XCSA 1U87A 4HZ4A 2C1YA 5KN3A 3CRUA 4F82A 3IHQA 3JCML 2R5GA 2R3XA 2VLTA 1EGRA 2HSHA 3E9JB 2REMA 3EMXA 3GTUB 4IGJA 1WP0A 1KEBA 1OE8A 5DALA 2NDOA 3TKRA 4TR3A 1BEDA 4POBA 2ALBA 3KP8A 4HS1A 2JACA 2CAIA 5J9CA 2DC5A 3U5RE 4MJBA 3AY8A 3RDWA 2PERA 2V32A 4MABA 1BQ7A 4G19A 2AYTA 1V9WA 1OC3A 2JL4A 4HU7A 4TRXA 5D9TA 3VWXA 2GSTA 3A5WA 1EZKA 3QDNA 2TRCP 5IMFA 2CZ3A 1O85A 2PGTA 3CBUA 2YWOA 4L0WA 4XS4A 5ABRA 3N5OA 2AAWA 2GT5A 2CVKA 3TKQA 3KEBA 3QFBC 2LJAA 3IC4A 2P5QA 1THXA 3G9BA 4V2MA 2RUFA 2L4QA 4ZL9A 5ECKB 2ON5A 4MF7A 4D73B 3F3QA 1K3LA 1WE0A 4JBBA 1HNBA 1DBYA 3R3EA 4USSA 1PRXA 4ZBAA 4CDOA 4KB3A 3C71A 3TB2A 3RPPA 1F6MC 1ERWA 4ACSA 1BAYA 1JHBA 3P2AA 2MMOA 3H4KA 4MZWA 2CA8A 3HZ8A 4X0XA 1FO5A 2QGVA 5DAKA 1SD9A 1S3AA 1XWCA 1G0TA 4ZB6A 1EV9A 2DJ1A 1V58A 4IQAA 3TJBA 3D4MA 4PX1A 3UBLA 2L59A 2XC2A 2GT6A 1G6WA 4PURA 1FOHA 1YF0A 1YQ1A 2C80A 3GX0A 3MDKA 5EPFA 4P3YB 1PD21 2KLXA 4MK3A 1YZXA 3A3TA 2YANA 4ZL7A 2JZTA 4JU5A 1H4OA 4EIPA 4MJEA 2WDUA 2VCXA 3HDCA 4NHWA 2VCZA 3FKFA 3EU3A 4NWYA 4RUVA 1CQHA 1QXHA 1H75A 1MEKA 4IJ3A 2EC4A 4WXTA 1ZGNA 3ZFLA 4BWSA 2AJQB 3GUSA 3MIXA 4MPFA 2FCHA 3GSTA 1VF1A 1QFNA 2X49A 1FVJA 2NBSA 3HKRA 2WULA 1TU7A 3W8SA 5IOXA 4IELA 3EU4A 1TK0B 2DBCA 4OO4A 2R4VA 4H86A 1EV4A 1GTAA 3F3RA 2HYXA 2HZEA 3QAGA 3KJYA 1Q4JA 3VWWA 3CSIA 2FWGA 3KGKA 5BMUA 3QD9A 4ML1A 1EWXA 2YOIA 10GSA 4MJAA 2GZYA 3C73A 1ILOA 5IMCA 1UC7A 1MD4A 4Q5FA 3ZMKA 2PPTA 5EY6A 2HNLA 5ELGA 3IK7A 4MLYA 8GSSA 5GSSA 1KTEA 2V6KA 2CVBA 3UIWA 2IFQA 3I69A 22GSA 4OD7A 4MZBA 5CO3A 1QUWA 6GSVA 2E7PA 2B1LA 3P7XA 1R5PA 1PX7A 1ZYPA 2H6ZA 3HJMA 4G0KA 2CZ2A 2JU5A 2IJYA 2H75A 5HFKA 3ZFBA 2YJ7A 3I43A 1CQGA 4ZBBA 1XWAA 4MA9A 4PNFA 2P31A 4ZXGA 3BBYA 4KCEA 3PPUA 1FG4A 3WD6A 4QL9A 3CTFA 4PQ1A 4L5LA 1A8LA 1O73A 5DJLA 5IM9A 2QA1A 3G7JA 2OA7A 5F05A 2VD0A 4MCUA 4CY8A 1U3AA 2A4HA 4POKA 3VLNA 2C0FA 3LXZA 4V2LA 2YNXA 2F9SA 1VF2A 4TOPA 4OMVA 3PR8A 1WOUA 1SD8A 5G1KA 3O3TA 4BVYB 3QAVA 4YKGA 4Z2RA 3I6AA 4YH2A 4G10A 11GSA 1AC1A 2VL2C 3QCPA 3ME7A 12GSA 3ZMLA 4ID0A 3HXSA 2FGXA 4YQMA 1EOHA 1A24A 1GTBA 3GFKA 2DIZA 4QQ7A 4PTSA 3HZ4A 3IRAA 2HSYA 1TRVA 3LWAA 4O5UA 4GTUA 3GTUA 4RQXA 1AUCA 4I97A 1W4VA 2GVPA 5J41A 1FB6A 4KSOA 2M72A 4X4JA 3ZIVA 4WF5A 3BOAA 1NM3A 3TRXA 3UARA 3TJFA 3GKKA 5AGYA 3FZ9A 2BJXA 1O81A 3GN3A 3Q19A 4E8HA 1QGVA 3EMPA 3UAPA 1MD3A 3HVXA 3KD0A 2X8CA 4DSSB 2FA4A 4I8BA 2EIRA 3F6FA 3QFAC 4TXOB 3RHCA 2OADA 4G0IA 2RM5A 3ZVJD 4K5SA 1V40A 1T1VA 4NV2A 3HY2A 3GURA 5EVOA 3ZVJA 1N8JA 1MDJA 2P5RA 3F63A 1X9MB 1SKWB 1Z9HA 4D73A 4HJMA 1HYUA 1YEXA 4BL7B 1DUGA 5B8AA 1YJ6A 5D93A 2BTOT 3LSZA 3HA9A 3BJ5A 4KW6A 2JSYA 3QAWA 2LV3A 1GSUA 1Z6NA 1A2MA 2IN3A 1TXXA 2O7KA 3A2XA 3H8QA 3H79A 2KOKA 2VAFA 4XS1A 2QC7A 1YF1A 1VRSD 3BCKA 4ILFA 1B4QA 4OCEA 1SYXA 2LNSA 3M3MA 2I9HA 2YZHA 2B3SA 1Y6EA 1SL0B 4YQVA 4X1UA 2JZSA 2PMTA 1HD2A 3KM6A 1YEPA 5DQYA 4DSRA 1GLQA 2PN8A 2OBIA 3LFLA 1BJXA 5JCUA 4KX4A 1EP8A 3HVVA 4ECJA 3RHBA 2DLXA 2FWHA 2JADA 1A8YA 5LNKe 5IPHA 4POMA 3APQA 1K0AA 2H6XA 4G0LA 2C3NA 2H76A 2B5EA 4K2XA 3US3A 4ML6A 1U88A 2H01A 3UL3A 4N0ZA 4BVXB 5D96A 2VCTA 5C00A 1M7TA 2HI7A 1TK8B 3H93A 2X64A 4KE3A 1HNAA 1ON4A 2FWFA 4KDUA 4AJ8A 1TOFA 4ZB9A 1WIKA 3KZQA 2E2MA 4WF4A 2YCDA 2LEGA 2H1BA 5FWGA 1X9WB 4YAVA 13GSA 2XPDA 4TR4A 1I9DA 3VK9A 3W6GA 4IJIA 1XOBA 6GSSA 2ZNMA 4DVCA 1XXUA 6GSUA 4AJ7A 1JFUA 1FAAA 3H1NA 3GNJA 3CTGA 3NZNA 4BPYA 4LL4B 2R0PA 5CREA 1PA3A 1YY7A 5HR1A 2MMZA 1ABAA 4JRRA 1C72A 4PGTA 3GX8A 2YZUA 5B6MA 2C3TA 2K9FA 3ZLPA 2AHEA 1XWBA 2VM2A 2MYGA 3LEFA 4CW9A 2M80A 2CVDA 2G2QA 4HQZA 1T3BA 5B8BA 5CNWA 3IA1A 2F8AA 2R0CA 4F0BA 4K0GA 2OBKA 3M1GA 1AQXA 3TKSC 4MH3A 4O92A 3DKSA 3APOA 3NOFA 2LQQA 2B6MA 2KP1A 2IMKA 2RIIA 2MMNA 2LQOA 2V41A 1MDKA 1G7OA 2I81A 2YJHA 2NTOA 2H73A 1ZCPA 1GSYA 1GRXA 1ZL9A 5CRWA 3EPTA 4BVYA 1LJRA 2H70A 2J23A 4ZIJA 3UBKA 1KNGA 4K2DA 2YPMA 4L0UA 3NIVA 4V1Ag 5G31A 2K8SA 2JZRA 5ECIB 2FLSA 2WCIA 1W89A 4HI7A 1I5GA 2NVLA 2YWMA 3GKNA 3ZTLA 1YDKA 3L9UA 3UOMA 5D8IA 1GP1A 2N5BA 3V1WA 4KSMA 3ERWA 2FWEA 4EIQA 1GNEA 2F3MA 2VL2A 1UA5A 1XWGA 3FY7A 5F0GA 3WT1A 3G7IA 5AISA 3A2WA 4I5QA 3KCMA 4YKFA 4AF2A 3K8NA 2LSTA 4XS6A 3GH9A 1XCCA 4DSSA 1GUKA 5HR0A 3GHAA 1K0BA 3FYGA 18GSA 1XPVA 4TXOA 3L78A 1DE1A 1PN0A 3TCOA 4ECIA 4IS0A 2VD1A 4X43A 4I2TA 3I9V2 1K0NA 5IMDA 3FMWA 4Z2UA 4GSTA 4TW5A 1XBSA 4KCAA 2H6YA 4GSSA 3E3EA 4BL7A 5ENUA 5D9WA 5JCWA 2AUVA 2BMXA 3KH7A 3IDVA 2L6DA 1Z7PA 4EUYA 4LL1B 5LD0A 2ZCTA 2K6VA 2YV9A 5CRGA 3D21A 1B9YC 2L5LA 2LUSA 3HJOA 5J4UA 1OAZA 1PX6A 16GSA 5IQYA 3Q18A 4N11A 4MMMA 4N30A 3GKMA 3TKPA 1BYEA 2IIYA 1V98A 4CY6A 2C0DA 3FR6A 5A4WA 1OKDA 1RQMA 4ECBA 1ZZYA 4GQFA 4HQSA 3MYDA 5H5SA 2G0FA 1GSQA 5DQSA 2RM6A 3ERFA 2XBIA 3EINA 3IK9A 1A2JA 1EOGA 5CYYA 4AGSA 5KEJA 1T4YA 1XOAA 3L0HA 4GQCA 2MBSA 2L4CA 1SENA 5BRTA 2LKUA 1B4PA 4ZILA 2QA2A 3WT2A 5ECNB 2GZZA 2VCQA 2HFDA 1WWJA 4JZQA 3VPTA 2H0IA 2VO4A 2LNTA 1X5DA 5DVBA 5ECPB 2DSAA 3GV1A 1GUMA 1KBNA 1R26A 5IMVA 2RUEA 1AXDA 2PBJA 3R2QA 4GXZA 3F4RA 2QSIA 4EF0A 3C1SA 1J9BA 5ECQB 4BVXA 2X8GA 5IO2A 1HNCA 1GL8A 5J3RA 3DMLA 4NXIA 4EO3A 2PVQA 3IPZA 3SBCA 3LYPA 3F4SA 1YKCA 4NAXA 2H66A 3FRCA 3D5JA 2V6OA 2K8VA 5GAND 3GMFA 1VF4A 2DJKA 1XZOA 6GSTA 4PQHA 2ON7A 4N0VA 1TJDA 3FR9A 1A23A 2IMFA 3P90A 5KN2A 3VPQA 1OC8A 2PU9C 4LA1A 1WJKA 4IBPA 4OO5A 5AIXA 5H5RA 3IHGA 2HT9A 3VI7A 2C3QA 1TK5B 3RBTA 1GSDA 2A4VA 1GUHA 3GSSA 4F9ZA 1ACVA 3D6IA 1F2EA 3TRPA 2H74A 2UZ8A 3DVXA 1PKZA 4GF0A 3L9SA 3ZIJA 3MAKA 4OFTA 3LYKA 3J7Yk 2O89A 2PWJA 1Z6MA 3IAS2 3VFIA 3GKXA 4O5RA 1G7EA 1GH2A 1IYIA 1JZOA 5JWOB 4ECCA 4K0NA 3RPNA 3EVIA 3VI5A 5F07A 2FY6A 2J9HA 4XRAA 3LG6A 3QOUA 4YAPA 3EYTA 2OJLA 1PL2A 3TKSE 3IAM2 3A2VA 4J2FA 1K3OA 4IW9A 2H71A 3FZAA 1BX9A 3GIXA 4HU9A 5G5EA 3ZZXA 2C0EA 1PN9A 3EE2A 4FH8A 1Q98A 3PGTA 2DJ0A 2A2PA 3TKSA 3DIEA 4EE0A 1Y25A 1XW5A 2VLVA 4MF5A 2FUG2 1JZRA 4K8MA 3TRQA 3ED3A 3UVTA 3RAZA 5C04A 3DXBA 4RI6A 1XW6A 4O32A 5KN0A 2OKAA 1T4ZA 4EL1A 2H0GA 3LGCA 4XHMA 4MF6A 3PH9A 2HLSA 1SK2A 2DKIA 1OKTA 3LJRA 1FW1A 4IKHA 1X5EA 4RI7A 3QMXA 2LJRA 3IBHA 4JE1A 4PUAA 2GLRA 3TJGA 3FZ4A 2LJKA 3LW9A 4F03A 2F8FA 1B9XC 3Q6OA 3ZYWA 4N10A 3TGZA 2MZCA 3FR3A 4EC0A 4WBRD 1U6TA 4JR4A 2LRTA 2H8LA 1R4WA 1E6BA 4NHZA 1J0FA 2HSMA 1SK1A 2A2SA 2DJ2A 4EDYA 2CX4A 3GH6A 4POLA 1O7UA 3ERGA 1PL1A 4O5QA 3LQ7A 2C8UA 1FOVA 3C7MA 3EC3A 3HVSA 1U3IA 2V1MA 4MH2A 1PKWA 2HRNA 5CAXA 2OE1A 3OR5A 3CSHA 2MMAA 2KHPA 1SYRA 3TOTA 2CQ9A 5A4UA 2B1KA 1QMVA 5FT3A 2X8HA 2E2GA 17GSA 2LRNA 4K9ZA 1VF3A 4TR1B 5DJMA 4EVMA 1TRUA 1F3AA 2H30A 1QK8A 1X0RA 2R6KA 1JLVA 4TN8A 3ZITA 3M8NA 4KDYA 1A0RP 3GL5A 4MZCA 4LLRA 1VGLA 3ISOA 4K7NA 5DDLA 3DD3A 1OYJA 2JSZA 4HUAA 3HCZA 3HYPA 1OC9B 4XRDA 2GSSA 1XVWA 4FIWA 3L9VA 1M2AA 2GQMA 2L57A 4Z7XA 4GSNA 2E0QA 5KOXA 2HRFA 4PXOA 3LORA 2IPAA 2VUPA 4K7OA 5CRDA 1TRSA 5G1LA 1JLWA 2IMEA 1FVKA 1RK4A 3IC8A 2X99A 4FO5A 4ZBDA 4K5RA 2WFCA 5KOWA 4ZL8A 5ECSA 5AN1A 2DKHA 2AB6A 5CRHA 5D9XA 2EIOA 1UVZA 5ECOB 3PINA 1TTZA 2H1GA 2KUCA 3GL3A 3IR4A 3KH9A 2IMDA 2B5YA 4GRFA 1EEMA 1TI1A 2N5AA 4WR4A 5J5NA 9GSSA 1O6JA 2LS5A 3DEXA 1TW9A 1GWCA 2Z9SA 3HHVA 4F0CA 1SJ6A 1PQNA 4OCFA 5IOWA 2DIYA 2GZPA 4RQRA 1K0OA 1NHYA 3TOUA 1AAZA 1K3YA 3CSJA 2ZUPA 2KP2A 3TUEA 1V57A 4ZB8A 5GSTA 5LCZA 1X5CA 1GTIA 2B7JA 2WB9A 3IXRA 5DCGA 5GAPD 1ZYQB 1XFLA 2RLIA 6GSYA 3J7Yb 5EL8A 4BA7A 2CAQA 1B48A 3A5IA 4KGIA 2VLUA 1M99A 3M9KA 4GCIA 1SU9A 4MP4A 2FNOA 3WGXA 5G2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GA4 A;  3FK8 A;  1DE2 A;  3MNG A;  2O87 A;  3ME8 A;  1AQV A;  5ID2 B;  1O8W A;  3WGD A;  5IO0 A;  4HDE A;  4HOJ A;  5ELA A;  1ERU A;  2GSQ A;  4OWY A;  1X9S B;  1EEJ A;  2H0H A;  4V2N A;  4MDC A;  3F6D A;  3VUR A;  3TJJ A;  5IMA A;  5DBQ A;  1WMJ A;  3F0I A;  3KIJ A;  2YP6 A;  3ZL5 A;  2AV4 A;  5GZZ B;  5JWR B;  4YQU A;  1QQ2 A;  3IV4 A;  5H5Q A;  5ECM B;  3S9F A;  1NHO A;  4PQI A;  1M2D A;  4MPG A;  2IWT A;  3E0U A;  4FYU A;  1TDI A;  2XHF A;  1PSQ A;  2OE3 A;  1Z5Y E;  20GS A;  1GUL A;  5JCG A;  3KTB A;  7GSS A;  2GS3 A;  4NPB A;  2IMI A;  2R37 A;  2ES7 A;  5HFG A;  2I1U A;  6GSX A;  2PUK C;  3KXO A;  3C1R A;  1LU4 A;  2K18 A;  1PMT A;  1MDI A;  4FYC A;  2LTK A;  4TVE A;  4WBJ A;  4KA0 A;  2LRC A;  2HXK A;  3FEU A;  1F3B A;  3O76 A;  2VL9 A;  3GYK A;  2N5F A;  3EUR A;  2GDR A;  1LBK A;  1T00 A;  2F51 A;  4KND A;  1FHE A;  1XIY A;  3KMO A;  3U6V A;  1JZD A;  4CHS A;  5CP1 A;  3C8E A;  4I6X A;  4NMU A;  1GTU A;  3UJ1 A;  3M0F A;  5E4W A;  2YWN A;  2H72 A;  2FA8 A;  5KN1 A;  1V2A A;  3QPM A;  19GS A;  2OAC A;  5DAL B;  1Z7R A;  4JED A;  2H1A A;  1XVQ A;  3GRX A;  5F8B A;  3P8W A;  2V2G A;  3KTL A;  1TU8 A;  3BD2 A;  2XBQ A;  3F8U A;  5G5F A;  2L5O A;  4I2U A;  2TRX A;  4XTS A;  5AIV A;  2OE0 A;  3F4T A;  2DML A;  4ULX A;  1R5A A;  1BG5 A;  1ML6 A;  2HZF A;  4QL7 A;  3DRN A;  4J57 E;  4L5O A;  5ECR B;  1NW2 A;  3D4T A;  3UVH A;  3FZ5 A;  5B7C A;  2CX3 A;  1FB0 A;  3ZRE A;  3CRT A;  5HFI A;  4K1F A;  3G7Y A;  3VWU A;  4AJ6 A;  1AW9 A;  3F9U A;  4XS4 B;  4IQ1 A;  1ZYE A;  4K6X A;  1M9B A;  4TR1 A;  3KP9 A;  1SL2 B;  1THO A;  2WZ9 A;  2VM1 A;  4O7H A;  3UEM A;  3MSZ A;  4Q5R A;  1URM A;  2B7K A;  3MWH A;  5IMZ A;  1NSW A;  3FW2 A;  2HE3 A;  4E8E A;  4V1A p;  4PUF C;  4WR5 A;  1K0C A;  2VOC A;  5A4V A;  1PGT A;  4GLT A;  4FYB A;  1S3C A;  3D22 A;  4DEJ A;  2O8V B;  1EP7 A;  1GSS A;  1O8X A;  3M9J A;  1OC9 A;  4HJ2 A;  2R2J A;  5HQP A;  5IIZ A;  2GTU A;  1TRW A;  1DSB A;  2FD3 A;  2YV7 A;  3HD5 A;  2DJJ A;  2P0G A;  1MTC A;  4WEY A;  3WYW A;  2C4J A;  2VCV A;  5DAK B;  1Z3E A;  2QKE A;  4OFM A;  4OFN A;  3FHK A;  4GWR A;  1ERT A;  1ZOF A;  5DCH A;  4TKY A;  2MBT A;  1K0M A;  6GSW A;  2H19 A;  4G2E A;  1WPI A;  2CV4 A;  2XPE A;  2GQL A;  1M0U A;  2L6C A;  1OE7 A;  2VIM A;  2C0G A;  2FHE A;  3DYR A;  4HEA 2;  1E2Y A;  5HR2 A;  2WJU A;  1OVN A;  4IVF A;  4IP6 A;  3EWL A;  5D9V A;  5B6N A;  4G9H A;  1B8X A;  2YN1 A;  4KAE A;  2EIQ A;  2YWI A;  2O85 A;  2WRT A;  5HR3 A;  3TDG A;  3IOS A;  1IYH A;  5COH A;  2CT6 A;  4ISD A;  2I4A A;  2PVO C;  2VL3 A;  4IP1 A;  3LXT A;  1M2B A;  1S3D A;  1F9M A;  5FHI A;  4JR6 A;  1GNW A;  1M9A A;  4TR0 A;  1A0F A;  4LMW A;  3VWV A;  4K7I A;  4HZ2 A;  5A5K A;  1AQW A;  5G30 A;  3UMA A;  4PNG A;  1HQO A;  3D0Z A;  3CYN A;  1RW1 A;  2GGT A;  4Q5Q A;  2H1D A;  2HZE B;  5ECL B;  1GSE A;  4EKZ A;  4DSQ A;  1SL1 B;  3O6T A;  2B5X A;  2NPB A;  1SKR B;  2IL3 A;  4Q5N A;  1TKD B;  4LMV A;  4IHU A;  4KH7 A;  2TIR A;  3IE3 A;  5L71 A;  1N2A A;  1T7P B;  5ID2 A;  2GQK A;  2A2R A;  3BCI A;  4NV5 A;  4WET A;  2IFQ B;  4XIH A;  1WRY A;  4BWQ A;  3CMI A;  5F06 A;  1A2L A;  2GSR A;  5JWQ B;  1EGO A;  1R7H A;  4J56 E;  1TP9 A;  2WGR A;  1J08 A;  3DVW A;  3QR6 A;  3APS A;  2VCW A;  3ZRD A;  5E59 A;  2D2Z A;  2WS2 A;  1XW9 A;  1ZMA A;  1ST9 A;  2I3Y A;  4F2I A;  4EXJ A;  1USB A;  5J9B A;  1JZW A;  1UN2 A;  5D73 A;  4L8E A;  2DMM A;  1ERV A;  1YKA A;  1TI3 A;  3Q74 A;  1GLP A;  3HJP A;  4WKW A;  14GS A;  1AIU A;  3L4N A;  1G6Y A;  1F37 A;  2DJ3 A;  1T8E B;  3TJK A;  4KDX A;  4MJC A;  4EDZ A;  3DGQ A;  1SKS B;  3DWV A;  3N9J A;  3SWL A;  3WGE A;  1SK0 A;  5ECH B;  5IPG A;  3CXG A;  4KUN A;  1GSF A;  4TXV A;  2M46 A;  5INY A;  1SJI A;  1XWK A;  1K0D A;  3KMN A;  1SJZ A;  4IN0 A;  3W8J A;  4XCS A;  1U87 A;  4HZ4 A;  2C1Y A;  5KN3 A;  3CRU A;  4F82 A;  3IHQ A;  3JCM L;  2R5G A;  2R3X A;  2VLT A;  1EGR A;  2HSH A;  3E9J B;  2REM A;  3EMX A;  3GTU B;  4IGJ A;  1WP0 A;  1KEB A;  1OE8 A;  5DAL A;  2NDO A;  3TKR A;  4TR3 A;  1BED A;  4POB A;  2ALB A;  3KP8 A;  4HS1 A;  2JAC A;  2CAI A;  5J9C A;  2DC5 A;  3U5R E;  4MJB A;  3AY8 A;  3RDW A;  2PER A;  2V32 A;  4MAB A;  1BQ7 A;  4G19 A;  2AYT A;  1V9W A;  1OC3 A;  2JL4 A;  4HU7 A;  4TRX A;  5D9T A;  3VWX A;  2GST A;  3A5W A;  1EZK A;  3QDN A;  2TRC P;  5IMF A;  2CZ3 A;  1O85 A;  2PGT A;  3CBU A;  2YWO A;  4L0W A;  4XS4 A;  5ABR A;  3N5O A;  2AAW A;  2GT5 A;  2CVK A;  3TKQ A;  3KEB A;  3QFB C;  2LJA A;  3IC4 A;  2P5Q A;  1THX A;  3G9B A;  4V2M A;  2RUF A;  2L4Q A;  4ZL9 A;  5ECK B;  2ON5 A;  4MF7 A;  4D73 B;  3F3Q A;  1K3L A;  1WE0 A;  4JBB A;  1HNB A;  1DBY A;  1PRX A;  4ZBA A;  4CDO A;  4KB3 A;  3C71 A;  3TB2 A;  3RPP A;  1F6M C;  1ERW A;  4ACS A;  1BAY A;  1JHB A;  3P2A A;  2MMO A;  3H4K A;  4MZW A;  2CA8 A;  3HZ8 A;  4X0X A;  1FO5 A;  2QGV A;  5DAK A;  1SD9 A;  1S3A A;  1XWC A;  1G0T A;  4ZB6 A;  1EV9 A;  2DJ1 A;  1V58 A;  4IQA A;  3TJB A;  3D4M A;  4PX1 A;  3UBL A;  2L59 A;  2XC2 A;  2GT6 A;  1G6W A;  4PUR A;  1YQ1 A;  1YF0 A;  2C80 A;  3GX0 A;  3MDK A;  5EPF A;  4P3Y B;  1PD2 1;  2KLX A;  4MK3 A;  1YZX A;  3A3T A;  2YAN A;  4ZL7 A;  2JZT A;  4JU5 A;  1H4O A;  4MJE A;  2WDU A;  2VCX A;  3HDC A;  4NHW A;  2VCZ A;  3FKF A;  3EU3 A;  4NWY A;  4RUV A;  1CQH A;  1QXH A;  1H75 A;  1MEK A;  4IJ3 A;  2EC4 A;  4WXT A;  1ZGN A;  3ZFL A;  4BWS A;  2AJQ B;  3GUS A;  4MPF A;  2FCH A;  3GST A;  1VF1 A;  1QFN A;  1FVJ A;  2NBS A;  3HKR A;  2WUL A;  1TU7 A;  3W8S A;  5IOX A;  4IEL A;  3EU4 A;  1TK0 B;  2DBC A;  4OO4 A;  2R4V A;  4H86 A;  1EV4 A;  1GTA A;  3F3R A;  2HYX A;  2HZE A;  3QAG A;  3KJY A;  1Q4J A;  3VWW A;  3CSI A;  2FWG A;  3KGK A;  3QD9 A;  4ML1 A;  1EWX A;  2YOI A;  10GS A;  4MJA A;  2GZY A;  3C73 A;  1ILO A;  5IMC A;  1UC7 A;  1MD4 A;  4Q5F A;  3ZMK A;  2PPT A;  5EY6 A;  2HNL A;  5ELG A;  3IK7 A;  4MLY A;  8GSS A;  5GSS A;  1KTE A;  2V6K A;  2CVB A;  3UIW A;  2IFQ A;  3I69 A;  22GS A;  4OD7 A;  4MZB A;  5CO3 A;  1QUW A;  6GSV A;  2E7P A;  2B1L A;  3P7X A;  1R5P A;  1PX7 A;  2H6Z A;  3HJM A;  2CZ2 A;  2JU5 A;  2IJY A;  2H75 A;  5HFK A;  3ZFB A;  2YJ7 A;  3I43 A;  1CQG A;  4ZBB A;  1XWA A;  4MA9 A;  4PNF A;  2P31 A;  4ZXG A;  3BBY A;  4KCE A;  1FG4 A;  3WD6 A;  4QL9 A;  3CTF A;  4PQ1 A;  4L5L A;  1A8L A;  1O73 A;  5DJL A;  5IM9 A;  3G7J A;  2OA7 A;  5F05 A;  2VD0 A;  4MCU A;  1U3A A;  4POK A;  3VLN A;  2C0F A;  3LXZ A;  4V2L A;  2YNX A;  2F9S A;  1VF2 A;  4TOP A;  4OMV A;  3PR8 A;  1WOU A;  1SD8 A;  5G1K A;  3O3T A;  3QAV A;  3I6A A;  4YH2 A;  4G10 A;  11GS A;  1AC1 A;  2VL2 C;  3QCP A;  3ME7 A;  12GS A;  3ZML A;  4ID0 A;  3HXS A;  2FGX A;  4YQM A;  1EOH A;  1A24 A;  1GTB A;  3GFK A;  2DIZ A;  4QQ7 A;  3HZ4 A;  3IRA A;  2HSY A;  1TRV A;  3LWA A;  4GTU A;  3GTU A;  4RQX A;  1AUC A;  4I97 A;  1W4V A;  2GVP A;  5J41 A;  1FB6 A;  4KSO A;  2M72 A;  3ZIV A;  4WF5 A;  3BOA A;  1NM3 A;  3TRX A;  3UAR A;  3TJF A;  3GKK A;  5AGY A;  3FZ9 A;  2BJX A;  1O81 A;  3GN3 A;  3Q19 A;  4E8H A;  1QGV A;  3EMP A;  3UAP A;  1MD3 A;  3HVX A;  3KD0 A;  2X8C A;  4DSS B;  2FA4 A;  4I8B A;  2EIR A;  3F6F A;  3QFA C;  4TXO B;  3RHC A;  2OAD A;  2RM5 A;  3ZVJ D;  1V40 A;  1T1V A;  4NV2 A;  3HY2 A;  3GUR A;  5EVO A;  3ZVJ A;  1N8J A;  1MDJ A;  2P5R A;  3F63 A;  1X9M B;  1SKW B;  1Z9H A;  4D73 A;  4HJM A;  1HYU A;  1YEX A;  5B8A A;  1DUG A;  1YJ6 A;  5D93 A;  2BTO T;  3LSZ A;  3HA9 A;  3BJ5 A;  4KW6 A;  2JSY A;  3QAW A;  2LV3 A;  1GSU A;  1Z6N A;  1A2M A;  2IN3 A;  1TXX A;  2O7K A;  3A2X A;  3H8Q A;  3H79 A;  2KOK A;  2VAF A;  4XS1 A;  2QC7 A;  1YF1 A;  1VRS D;  3BCK A;  4ILF A;  1B4Q A;  4OCE A;  1SYX A;  2LNS A;  3M3M A;  2I9H A;  2YZH A;  2B3S A;  1Y6E A;  1SL0 B;  4YQV A;  4X1U A;  2JZS A;  2PMT A;  1HD2 A;  3KM6 A;  1YEP A;  5DQY A;  4DSR A;  1GLQ A;  2PN8 A;  2OBI A;  3LFL A;  1BJX A;  5JCU A;  4KX4 A;  1EP8 A;  3HVV A;  4ECJ A;  3RHB A;  2DLX A;  2FWH A;  2JAD A;  1A8Y A;  5LNK e;  5IPH A;  4POM A;  3APQ A;  1K0A A;  2H6X A;  2C3N A;  2H76 A;  2B5E A;  3US3 A;  4ML6 A;  1U88 A;  2H01 A;  3UL3 A;  4N0Z A;  5D96 A;  2VCT A;  5C00 A;  1M7T A;  2HI7 A;  1TK8 B;  3H93 A;  2X64 A;  4KE3 A;  1HNA A;  1ON4 A;  2FWF A;  4KDU A;  4AJ8 A;  1TOF A;  4ZB9 A;  1WIK A;  3KZQ A;  2E2M A;  4WF4 A;  2YCD A;  2LEG A;  2H1B A;  5FWG A;  1X9W B;  4YAV A;  13GS A;  2XPD A;  4TR4 A;  1I9D A;  3VK9 A;  3W6G A;  4IJI A;  1XOB A;  6GSS A;  2ZNM A;  4DVC A;  1XXU A;  6GSU A;  4AJ7 A;  1JFU A;  1FAA A;  3H1N A;  3GNJ A;  3CTG A;  3NZN A;  4BPY A;  4LL4 B;  5CRE A;  1PA3 A;  1YY7 A;  5HR1 A;  2MMZ A;  1ABA A;  4JRR A;  1C72 A;  4PGT A;  3GX8 A;  2YZU A;  5B6M A;  2C3T A;  2K9F A;  3ZLP A;  2AHE A;  1XWB A;  2VM2 A;  2MYG A;  3LEF A;  4CW9 A;  2M80 A;  2CVD A;  2G2Q A;  4HQZ A;  1T3B A;  5B8B A;  5CNW A;  3IA1 A;  2F8A A;  4F0B A;  4K0G A;  2OBK A;  3M1G A;  1AQX A;  3TKS C;  4MH3 A;  4O92 A;  3DKS A;  3APO A;  3NOF A;  2LQQ A;  2B6M A;  2KP1 A;  2IMK A;  2RII A;  2MMN A;  2LQO A;  2V41 A;  1MDK A;  1G7O A;  2I81 A;  2YJH A;  2NTO A;  2H73 A;  1ZCP A;  1GSY A;  1GRX A;  1ZL9 A;  5CRW A;  4BVY A;  1LJR A;  2H70 A;  2J23 A;  4ZIJ A;  3UBK A;  1KNG A;  4K2D A;  2YPM A;  4L0U A;  3NIV A;  4V1A g;  5G31 A;  2K8S A;  2JZR A;  5ECI B;  2FLS A;  2WCI A;  1W89 A;  4HI7 A;  1I5G A;  2NVL A;  2YWM A;  3GKN A;  3ZTL A;  1YDK A;  3L9U A;  3UOM A;  5D8I A;  1GP1 A;  2N5B A;  3V1W A;  4KSM A;  3ERW A;  2FWE A;  1GNE A;  2F3M A;  2VL2 A;  1UA5 A;  1XWG A;  3FY7 A;  5F0G A;  3WT1 A;  3G7I A;  5AIS A;  3A2W A;  4I5Q A;  3KCM A;  4AF2 A;  3K8N A;  2LST A;  4XS6 A;  3GH9 A;  1XCC A;  4DSS A;  1GUK A;  5HR0 A;  3GHA A;  1K0B A;  3FYG A;  18GS A;  1XPV A;  4TXO A;  3L78 A;  1DE1 A;  3TCO A;  4ECI A;  4IS0 A;  2VD1 A;  4X43 A;  4I2T A;  3I9V 2;  1K0N A;  5IMD A;  4GST A;  4TW5 A;  1XBS A;  4KCA A;  2H6Y A;  4GSS A;  3E3E A;  4BL7 A;  5ENU A;  5D9W A;  5JCW A;  2AUV A;  2BMX A;  3KH7 A;  3IDV A;  2L6D A;  1Z7P A;  4EUY A;  4LL1 B;  5LD0 A;  2ZCT A;  2K6V A;  2YV9 A;  5CRG A;  3D21 A;  1B9Y C;  2L5L A;  2LUS A;  3HJO A;  5J4U A;  1OAZ A;  1PX6 A;  16GS A;  5IQY A;  3Q18 A;  4N11 A;  4MMM A;  4N30 A;  3GKM A;  3TKP A;  1BYE A;  2IIY A;  1V98 A;  2C0D A;  3FR6 A;  5A4W A;  1OKD A;  1RQM A;  4ECB A;  1ZZY A;  4GQF A;  4HQS A;  5H5S A;  2G0F A;  1GSQ A;  5DQS A;  2RM6 A;  3ERF A;  2XBI A;  3EIN A;  3IK9 A;  1A2J A;  1EOG A;  5CYY A;  4AGS A;  5KEJ A;  1T4Y A;  1XOA A;  3L0H A;  4GQC A;  2MBS A;  2L4C A;  1SEN A;  2LKU A;  1B4P A;  4ZIL A;  3WT2 A;  5ECN B;  2GZZ A;  2VCQ A;  2HFD A;  1WWJ A;  4JZQ A;  3VPT A;  2H0I A;  2VO4 A;  2LNT A;  1X5D A;  5DVB A;  5ECP B;  2DSA A;  3GV1 A;  1GUM A;  1KBN A;  1R26 A;  5IMV A;  2RUE A;  1AXD A;  2PBJ A;  3R2Q A;  4GXZ A;  3F4R A;  2QSI A;  4EF0 A;  3C1S A;  1J9B A;  5ECQ B;  4BVX A;  2X8G A;  5IO2 A;  1HNC A;  1GL8 A;  5J3R A;  3DML A;  4NXI A;  4EO3 A;  2PVQ A;  3IPZ A;  3SBC A;  3LYP A;  3F4S A;  1YKC A;  4NAX A;  2H66 A;  3FRC A;  3D5J A;  2V6O A;  2K8V A;  5GAN D;  3GMF A;  1VF4 A;  2DJK A;  1XZO A;  6GST A;  4PQH A;  2ON7 A;  4N0V A;  1TJD A;  3FR9 A;  1A23 A;  2IMF A;  3P90 A;  5KN2 A;  3VPQ A;  1OC8 A;  2PU9 C;  4LA1 A;  1WJK A;  4IBP A;  4OO5 A;  5AIX A;  5H5R A;  2HT9 A;  3VI7 A;  2C3Q A;  1TK5 B;  3RBT A;  1GSD A;  2A4V A;  1GUH A;  3GSS A;  4F9Z A;  1ACV A;  3D6I A;  1F2E A;  3TRP A;  2H74 A;  3DVX A;  1PKZ A;  4GF0 A;  3L9S A;  3ZIJ A;  3MAK A;  4OFT A;  3LYK A;  3J7Y k;  2O89 A;  2PWJ A;  1Z6M A;  3IAS 2;  3VFI A;  3GKX A;  4O5R A;  1G7E A;  1GH2 A;  1IYI A;  1JZO A;  5JWO B;  4ECC A;  4K0N A;  3RPN A;  3EVI A;  3VI5 A;  5F07 A;  2FY6 A;  2J9H A;  4XRA A;  3LG6 A;  3QOU A;  4YAP A;  3EYT A;  2OJL A;  1PL2 A;  3TKS E;  3IAM 2;  3A2V A;  4J2F A;  1K3O A;  4IW9 A;  2H71 A;  3FZA A;  1BX9 A;  3GIX A;  4HU9 A;  5G5E A;  3ZZX A;  2C0E A;  1PN9 A;  3EE2 A;  4FH8 A;  1Q98 A;  3PGT A;  2DJ0 A;  3TKS A;  3DIE A;  4EE0 A;  1Y25 A;  1XW5 A;  2VLV A;  4MF5 A;  2FUG 2;  1JZR A;  4K8M A;  3TRQ A;  3ED3 A;  3UVT A;  3RAZ A;  5C04 A;  3DXB A;  4RI6 A;  1XW6 A;  4O32 A;  5KN0 A;  2OKA A;  1T4Z A;  4EL1 A;  2H0G A;  3LGC A;  4XHM A;  4MF6 A;  3PH9 A;  2HLS A;  1SK2 A;  1OKT A;  3LJR A;  1FW1 A;  4IKH A;  1X5E A;  4RI7 A;  3QMX A;  2LJR A;  3IBH A;  4JE1 A;  4PUA A;  2GLR A;  3TJG A;  3FZ4 A;  2LJK A;  4F03 A;  2F8F A;  1B9X C;  3Q6O A;  3ZYW A;  4N10 A;  3TGZ A;  2MZC A;  3FR3 A;  4EC0 A;  4WBR D;  1U6T A;  4JR4 A;  2LRT A;  2H8L A;  1R4W A;  1E6B A;  4NHZ A;  1J0F A;  1SK1 A;  2A2S A;  2DJ2 A;  4EDY A;  2CX4 A;  3GH6 A;  4POL A;  1O7U A;  3ERG A;  1PL1 A;  3LQ7 A;  2C8U A;  1FOV A;  3C7M A;  3EC3 A;  3HVS A;  1U3I A;  2V1M A;  4MH2 A;  1PKW A;  2HRN A;  5CAX A;  2OE1 A;  3OR5 A;  3CSH A;  2MMA A;  2KHP A;  1SYR A;  3TOT A;  2CQ9 A;  5A4U A;  2B1K A;  1QMV A;  5FT3 A;  2X8H A;  2E2G A;  17GS A;  2LRN A;  4K9Z A;  1VF3 A;  4TR1 B;  5DJM A;  4EVM A;  1TRU A;  1F3A A;  2H30 A;  1QK8 A;  1X0R A;  2R6K A;  1JLV A;  4TN8 A;  3ZIT A;  3M8N A;  4KDY A;  1A0R P;  3GL5 A;  4MZC A;  4LLR A;  1VGL A;  3ISO A;  4K7N A;  5DDL A;  3DD3 A;  1OYJ A;  2JSZ A;  4HUA A;  3HCZ A;  3HYP A;  1OC9 B;  4XRD A;  2GSS A;  1XVW A;  4FIW A;  3L9V A;  1M2A A;  2GQM A;  2L57 A;  4Z7X A;  4GSN A;  2E0Q A;  2HRF A;  4PXO A;  3LOR A;  2IPA A;  2VUP A;  4K7O A;  5CRD A;  1TRS A;  5G1L A;  1JLW A;  2IME A;  1FVK A;  1RK4 A;  2X99 A;  4FO5 A;  4ZBD A;  2WFC A;  4ZL8 A;  5ECS A;  5AN1 A;  2AB6 A;  5CRH A;  5D9X A;  2EIO A;  1UVZ A;  5ECO B;  3PIN A;  1TTZ A;  2H1G A;  2KUC A;  3GL3 A;  3IR4 A;  3KH9 A;  2IMD A;  2B5Y A;  4GRF A;  1EEM A;  1TI1 A;  2N5A A;  4WR4 A;  5J5N A;  9GSS A;  1O6J A;  2LS5 A;  3DEX A;  1TW9 A;  1GWC A;  2Z9S A;  3HHV A;  4F0C A;  1SJ6 A;  1PQN A;  4OCF A;  5IOW A;  2DIY A;  2GZP A;  4RQR A;  1K0O A;  1NHY A;  3TOU A;  1AAZ A;  1K3Y A;  3CSJ A;  2ZUP A;  2KP2 A;  3TUE A;  1V57 A;  4ZB8 A;  5GST A;  5LCZ A;  1X5C A;  1GTI A;  2B7J A;  2WB9 A;  3IXR A;  5DCG A;  5GAP D;  1ZYQ B;  1XFL A;  2RLI A;  6GSY A;  3J7Y b;  5EL8 A;  4BA7 A;  2CAQ A;  1B48 A;  4KGI A;  2VLU A;  1M99 A;  3M9K A;  4GCI A;  1SU9 A;  4MP4 A;  2FNO A;  3WGX A;  5G2Z A; 
#chains in the Genus database with same CATH topology
 3GA4 A;  3FK8 A;  1DE2 A;  4MNN A;  3MNG A;  2O87 A;  3ME8 A;  1AQV A;  5ID2 B;  1O8W A;  3WGD A;  5IO0 A;  4HDE A;  4HOJ A;  4ICY A;  5ELA A;  1ERU A;  2GSQ A;  4OWY A;  1X9S B;  1EEJ A;  2H0H A;  4V2N A;  4MDC A;  3F6D A;  3VUR A;  3TJJ A;  5IMA A;  5DBQ A;  1WMJ A;  3F0I A;  3KIJ A;  2YP6 A;  3ZL5 A;  2AV4 A;  5GZZ B;  5JWR B;  4YQU A;  1QQ2 A;  3IV4 A;  5H5Q A;  5ECM B;  3S9F A;  1NHO A;  4PQI A;  1M2D A;  4MPG A;  2IWT A;  3E0U A;  4FYU A;  1TDI A;  2XHF A;  1PSQ A;  2OE3 A;  1Z5Y E;  20GS A;  1GUL A;  5JCG A;  3KTB A;  7GSS A;  2GS3 A;  4Z2T A;  4NPB A;  2IMI A;  2R37 A;  2ES7 A;  5HFG A;  2I1U A;  6GSX A;  2PUK C;  3KXO A;  3C1R A;  1LU4 A;  2K18 A;  1PMT A;  1MDI A;  4FYC A;  2LTK A;  4TVE A;  4WBJ A;  4KA0 A;  2LRC A;  2HXK A;  3FEU A;  2HRA A;  1F3B A;  3O76 A;  2VL9 A;  3GYK A;  2N5F A;  3EUR A;  2GDR A;  1LBK A;  1T00 A;  2F51 A;  4KND A;  1FHE A;  1XIY A;  3KMO A;  3U6V A;  1JZD A;  4CHS A;  5CP1 A;  3C8E A;  4I6X A;  4NMU A;  1GTU A;  3UJ1 A;  3M0F A;  5E4W A;  2YWN A;  2H72 A;  2FA8 A;  5KN1 A;  1V2A A;  3QPM A;  19GS A;  2OAC A;  5DAL B;  1Z7R A;  4JED A;  2H1A A;  1XVQ A;  3GRX A;  5F8B A;  3P8W A;  2V2G A;  3KTL A;  1TU8 A;  3BD2 A;  2XBQ A;  3F8U A;  5G5F A;  2L5O A;  4I2U A;  2TRX A;  4XTS A;  5AIV A;  2OE0 A;  3F4T A;  2DML A;  4ULX A;  1R5A A;  1BG5 A;  1ML6 A;  2HZF A;  4QL7 A;  3DRN A;  4J57 E;  4L5O A;  5ECR B;  1NW2 A;  3D4T A;  3UVH A;  3FZ5 A;  5B7C A;  2CX3 A;  1FB0 A;  3ZRE A;  3CRT A;  5HFI A;  4K1F A;  3G7Y A;  3VWU A;  4AJ6 A;  1ZYN A;  1AW9 A;  3F9U A;  4XS4 B;  4IQ1 A;  1ZYE A;  4K6X A;  1M9B A;  4TR1 A;  3KP9 A;  1SL2 B;  1THO A;  4A5P A;  2WZ9 A;  2VM1 A;  4O7H A;  3UEM A;  3MSZ A;  4Q5R A;  1URM A;  2B7K A;  3MWH A;  5IMZ A;  1NSW A;  3FW2 A;  2HE3 A;  4E8E A;  4V1A p;  4PUF C;  4WR5 A;  1K0C A;  2VOC A;  5A4V A;  1PGT A;  4GLT A;  4FYB A;  1S3C A;  3D22 A;  4DEJ A;  2O8V B;  1EP7 A;  1GSS A;  1O8X A;  3M9J A;  1OC9 A;  4HJ2 A;  4FQU A;  2R2J A;  5HQP A;  5IIZ A;  2GTU A;  1TRW A;  1DSB A;  2FD3 A;  2YV7 A;  3HD5 A;  2DJJ A;  2P0G A;  1MTC A;  4WEY A;  3WYW A;  2C4J A;  2VCV A;  5DAK B;  1Z3E A;  2QKE A;  4OFM A;  4OFN A;  3FHK A;  4GWR A;  1ERT A;  1ZOF A;  5DCH A;  4TKY A;  2MBT A;  1K0M A;  6GSW A;  2H19 A;  4G2E A;  1WPI A;  2CV4 A;  2XPE A;  2GQL A;  1M0U A;  2L6C A;  1OE7 A;  2VIM A;  2C0G A;  2FHE A;  3DYR A;  4HEA 2;  1E2Y A;  5HR2 A;  2WJU A;  1OVN A;  4IVF A;  4IP6 A;  3EWL A;  5D9V A;  5B6N A;  4G9H A;  1B8X A;  2YN1 A;  4KAE A;  2EIQ A;  2YWI A;  2O85 A;  2WRT A;  5HR3 A;  3TDG A;  3IOS A;  1S3R A;  1IYH A;  5COH A;  2CT6 A;  4ISD A;  2I4A A;  2PVO C;  2VL3 A;  4IP1 A;  3LXT A;  1M2B A;  1S3D A;  1F9M A;  5FHI A;  4JR6 A;  1GNW A;  1M9A A;  4TR0 A;  1A0F A;  4LMW A;  3VWV A;  4K7I A;  4HZ2 A;  5A5K A;  1AQW A;  5G30 A;  2X4A A;  3UMA A;  4PNG A;  1HQO A;  3D0Z A;  3CYN A;  1RW1 A;  2GGT A;  4Q5Q A;  2H1D A;  2HZE B;  5ECL B;  1GSE A;  4EKZ A;  4DSQ A;  1SL1 B;  1M3J A;  3O6T A;  2B5X A;  2NPB A;  1SKR B;  2IL3 A;  4Q5N A;  1TKD B;  4LMV A;  4IHU A;  4KH7 A;  2TIR A;  3IE3 A;  5L71 A;  1N2A A;  1T7P B;  5ID2 A;  2GQK A;  2A2R A;  3BCI A;  4NV5 A;  4WET A;  2IFQ B;  4XIH A;  1WRY A;  4BWQ A;  3CMI A;  5F06 A;  1A2L A;  2GSR A;  5JWQ B;  1EGO A;  1R7H A;  4J56 E;  1TP9 A;  2WGR A;  1J08 A;  3DVW A;  3QR6 A;  4KF9 A;  3APS A;  2VCW A;  3ZRD A;  5E59 A;  2D2Z A;  2WS2 A;  1XW9 A;  1ZMA A;  2HRK A;  1ST9 A;  2I3Y A;  4F2I A;  4EXJ A;  1USB A;  5J9B A;  1JZW A;  1UN2 A;  5D73 A;  4L8E A;  2DMM A;  1ERV A;  1YKA A;  2R0G A;  1TI3 A;  3Q74 A;  1GLP A;  3HJP A;  4WKW A;  14GS A;  1AIU A;  3L4N A;  1G6Y A;  1F37 A;  2DJ3 A;  1T8E B;  3TJK A;  4KDX A;  4MJC A;  4EDZ A;  3DGQ A;  1SKS B;  3DWV A;  3N9J A;  3SWL A;  3WGE A;  1SK0 A;  5ECH B;  5IPG A;  3CXG A;  4KUN A;  1GSF A;  4TXV A;  2M46 A;  5INY A;  1SJI A;  1XWK A;  1K0D A;  3KMN A;  1SJZ A;  4IN0 A;  3W8J A;  4XCS A;  1U87 A;  4HZ4 A;  2C1Y A;  5KN3 A;  3CRU A;  4F82 A;  3IHQ A;  3JCM L;  2R5G A;  2R3X A;  2VLT A;  1EGR A;  2HSH A;  3E9J B;  2REM A;  3EMX A;  3GTU B;  4IGJ A;  1WP0 A;  1KEB A;  1OE8 A;  5DAL A;  2NDO A;  3TKR A;  4TR3 A;  1BED A;  4POB A;  2ALB A;  3KP8 A;  4HS1 A;  2JAC A;  2CAI A;  5J9C A;  2DC5 A;  3U5R E;  4MJB A;  4BIK A;  3AY8 A;  3RDW A;  2PER A;  2V32 A;  4MAB A;  1BQ7 A;  4G19 A;  2AYT A;  1V9W A;  1OC3 A;  2JL4 A;  4HU7 A;  4TRX A;  5D9T A;  3VWX A;  2GST A;  3A5W A;  1EZK A;  3QDN A;  2TRC P;  5IMF A;  2CZ3 A;  1O85 A;  2PGT A;  3CBU A;  2YWO A;  4L0W A;  4XS4 A;  5ABR A;  3N5O A;  2AAW A;  2GT5 A;  2CVK A;  3TKQ A;  3KEB A;  3QFB C;  2LJA A;  3IC4 A;  2P5Q A;  1THX A;  3G9B A;  4V2M A;  2RUF A;  2L4Q A;  4ZL9 A;  5ECK B;  2ON5 A;  4MF7 A;  4D73 B;  3F3Q A;  1K3L A;  1WE0 A;  4JBB A;  1HNB A;  1DBY A;  3R3E A;  4USS A;  1PRX A;  4ZBA A;  4CDO A;  4KB3 A;  3C71 A;  3TB2 A;  3RPP A;  1F6M C;  1ERW A;  4ACS A;  1BAY A;  1JHB A;  3P2A A;  2MMO A;  3H4K A;  4MZW A;  2CA8 A;  3HZ8 A;  4X0X A;  1FO5 A;  2QGV A;  5DAK A;  1SD9 A;  1S3A A;  1XWC A;  1G0T A;  4ZB6 A;  1EV9 A;  2DJ1 A;  1V58 A;  4IQA A;  3TJB A;  3D4M A;  4PX1 A;  3UBL A;  2L59 A;  2XC2 A;  2GT6 A;  1G6W A;  4PUR A;  1FOH A;  1YF0 A;  1YQ1 A;  2C80 A;  3GX0 A;  3MDK A;  5EPF A;  4P3Y B;  1PD2 1;  2KLX A;  4MK3 A;  1YZX A;  3A3T A;  2YAN A;  4ZL7 A;  2JZT A;  4JU5 A;  1H4O A;  4EIP A;  4MJE A;  2WDU A;  2VCX A;  3HDC A;  4NHW A;  2VCZ A;  3FKF A;  3EU3 A;  4NWY A;  4RUV A;  1CQH A;  1QXH A;  1H75 A;  1MEK A;  4IJ3 A;  2EC4 A;  4WXT A;  1ZGN A;  3ZFL A;  4BWS A;  2AJQ B;  3GUS A;  3MIX A;  4MPF A;  2FCH A;  3GST A;  1VF1 A;  1QFN A;  2X49 A;  1FVJ A;  2NBS A;  3HKR A;  2WUL A;  1TU7 A;  3W8S A;  5IOX A;  4IEL A;  3EU4 A;  1TK0 B;  2DBC A;  4OO4 A;  2R4V A;  4H86 A;  1EV4 A;  1GTA A;  3F3R A;  2HYX A;  2HZE A;  3QAG A;  3KJY A;  1Q4J A;  3VWW A;  3CSI A;  2FWG A;  3KGK A;  5BMU A;  3QD9 A;  4ML1 A;  1EWX A;  2YOI A;  10GS A;  4MJA A;  2GZY A;  3C73 A;  1ILO A;  5IMC A;  1UC7 A;  1MD4 A;  4Q5F A;  3ZMK A;  2PPT A;  5EY6 A;  2HNL A;  5ELG A;  3IK7 A;  4MLY A;  8GSS A;  5GSS A;  1KTE A;  2V6K A;  2CVB A;  3UIW A;  2IFQ A;  3I69 A;  22GS A;  4OD7 A;  4MZB A;  5CO3 A;  1QUW A;  6GSV A;  2E7P A;  2B1L A;  3P7X A;  1R5P A;  1PX7 A;  1ZYP A;  2H6Z A;  3HJM A;  4G0K A;  2CZ2 A;  2JU5 A;  2IJY A;  2H75 A;  5HFK A;  3ZFB A;  2YJ7 A;  3I43 A;  1CQG A;  4ZBB A;  1XWA A;  4MA9 A;  4PNF A;  2P31 A;  4ZXG A;  3BBY A;  4KCE A;  3PPU A;  1FG4 A;  3WD6 A;  4QL9 A;  3CTF A;  4PQ1 A;  4L5L A;  1A8L A;  1O73 A;  5DJL A;  5IM9 A;  2QA1 A;  3G7J A;  2OA7 A;  5F05 A;  2VD0 A;  4MCU A;  4CY8 A;  1U3A A;  2A4H A;  4POK A;  3VLN A;  2C0F A;  3LXZ A;  4V2L A;  2YNX A;  2F9S A;  1VF2 A;  4TOP A;  4OMV A;  3PR8 A;  1WOU A;  1SD8 A;  5G1K A;  3O3T A;  4BVY B;  3QAV A;  4YKG A;  4Z2R A;  3I6A A;  4YH2 A;  4G10 A;  11GS A;  1AC1 A;  2VL2 C;  3QCP A;  3ME7 A;  12GS A;  3ZML A;  4ID0 A;  3HXS A;  2FGX A;  4YQM A;  1EOH A;  1A24 A;  1GTB A;  3GFK A;  2DIZ A;  4QQ7 A;  4PTS A;  3HZ4 A;  3IRA A;  2HSY A;  1TRV A;  3LWA A;  4O5U A;  4GTU A;  3GTU A;  4RQX A;  1AUC A;  4I97 A;  1W4V A;  2GVP A;  5J41 A;  1FB6 A;  4KSO A;  2M72 A;  4X4J A;  3ZIV A;  4WF5 A;  3BOA A;  1NM3 A;  3TRX A;  3UAR A;  3TJF A;  3GKK A;  5AGY A;  3FZ9 A;  2BJX A;  1O81 A;  3GN3 A;  3Q19 A;  4E8H A;  1QGV A;  3EMP A;  3UAP A;  1MD3 A;  3HVX A;  3KD0 A;  2X8C A;  4DSS B;  2FA4 A;  4I8B A;  2EIR A;  3F6F A;  3QFA C;  4TXO B;  3RHC A;  2OAD A;  4G0I A;  2RM5 A;  3ZVJ D;  4K5S A;  1V40 A;  1T1V A;  4NV2 A;  3HY2 A;  3GUR A;  5EVO A;  3ZVJ A;  1N8J A;  1MDJ A;  2P5R A;  3F63 A;  1X9M B;  1SKW B;  1Z9H A;  4D73 A;  4HJM A;  1HYU A;  1YEX A;  4BL7 B;  1DUG A;  5B8A A;  1YJ6 A;  5D93 A;  2BTO T;  3LSZ A;  3HA9 A;  3BJ5 A;  4KW6 A;  2JSY A;  3QAW A;  2LV3 A;  1GSU A;  1Z6N A;  1A2M A;  2IN3 A;  1TXX A;  2O7K A;  3A2X A;  3H8Q A;  1XG8 A;  3H79 A;  2KOK A;  2VAF A;  4XS1 A;  2QC7 A;  1YF1 A;  1VRS D;  3HVN A;  3BCK A;  4ILF A;  1B4Q A;  4OCE A;  1SYX A;  2LNS A;  3M3M A;  2I9H A;  2YZH A;  2B3S A;  1Y6E A;  1SL0 B;  4YQV A;  4X1U A;  2JZS A;  2PMT A;  1HD2 A;  3KM6 A;  1YEP A;  5DQY A;  4DSR A;  1GLQ A;  2PN8 A;  2OBI A;  3LFL A;  1BJX A;  5JCU A;  4KX4 A;  1EP8 A;  3HVV A;  4ECJ A;  3RHB A;  2DLX A;  2FWH A;  2JAD A;  1A8Y A;  5LNK e;  5IPH A;  4POM A;  3APQ A;  1K0A A;  2H6X A;  4G0L A;  2C3N A;  2H76 A;  2B5E A;  4K2X A;  3US3 A;  4ML6 A;  1U88 A;  2H01 A;  3UL3 A;  4N0Z A;  4BVX B;  5D96 A;  2VCT A;  5C00 A;  1M7T A;  2HI7 A;  1TK8 B;  3H93 A;  2X64 A;  4KE3 A;  1HNA A;  1ON4 A;  2FWF A;  4KDU A;  4AJ8 A;  1TOF A;  4ZB9 A;  1WIK A;  3KZQ A;  2E2M A;  4WF4 A;  2YCD A;  2LEG A;  2H1B A;  5FWG A;  1X9W B;  4YAV A;  13GS A;  2XPD A;  4TR4 A;  1I9D A;  3VK9 A;  3W6G A;  4IJI A;  1XOB A;  6GSS A;  2ZNM A;  4DVC A;  1XXU A;  6GSU A;  4AJ7 A;  1JFU A;  1FAA A;  3H1N A;  3GNJ A;  3CTG A;  3NZN A;  4BPY A;  4LL4 B;  2R0P A;  5CRE A;  1PA3 A;  1YY7 A;  5HR1 A;  2MMZ A;  3CQF A;  1ABA A;  4JRR A;  1C72 A;  4PGT A;  3GX8 A;  2YZU A;  5B6M A;  2C3T A;  2K9F A;  3ZLP A;  2AHE A;  1XWB A;  2VM2 A;  2MYG A;  3LEF A;  4CW9 A;  2M80 A;  2CVD A;  2G2Q A;  4HQZ A;  1T3B A;  5B8B A;  5CNW A;  3IA1 A;  2F8A A;  2R0C A;  4F0B A;  4K0G A;  2OBK A;  3M1G A;  1AQX A;  3TKS C;  4MH3 A;  4O92 A;  3DKS A;  3APO A;  3NOF A;  2LQQ A;  2B6M A;  2KP1 A;  2IMK A;  2RII A;  2MMN A;  2LQO A;  2V41 A;  1MDK A;  1G7O A;  2I81 A;  2YJH A;  2NTO A;  2H73 A;  1ZCP A;  1GSY A;  1GRX A;  1ZL9 A;  5CRW A;  3EPT A;  4BVY A;  1LJR A;  2H70 A;  2J23 A;  4ZIJ A;  3UBK A;  1KNG A;  4K2D A;  2YPM A;  4L0U A;  3NIV A;  4V1A g;  5G31 A;  2K8S A;  2JZR A;  5ECI B;  2FLS A;  2WCI A;  1W89 A;  4HI7 A;  1I5G A;  2NVL A;  2YWM A;  3GKN A;  3ZTL A;  1YDK A;  3L9U A;  3UOM A;  5D8I A;  1GP1 A;  2N5B A;  3V1W A;  4KSM A;  3ERW A;  2FWE A;  4EIQ A;  1GNE A;  2F3M A;  2VL2 A;  1UA5 A;  1XWG A;  3FY7 A;  5F0G A;  3WT1 A;  3G7I A;  5AIS A;  3A2W A;  4I5Q A;  3KCM A;  4YKF A;  4AF2 A;  3K8N A;  2LST A;  4XS6 A;  3GH9 A;  4HSC X;  1XCC A;  4DSS A;  1GUK A;  5HR0 A;  3GHA A;  1K0B A;  3FYG A;  18GS A;  1XPV A;  4TXO A;  3L78 A;  1DE1 A;  1PN0 A;  3TCO A;  4ECI A;  4IS0 A;  2VD1 A;  4X43 A;  4I2T A;  3I9V 2;  1K0N A;  5IMD A;  3FMW A;  4Z2U A;  4GST A;  4TW5 A;  1XBS A;  4KCA A;  2H6Y A;  4GSS A;  3E3E A;  4BL7 A;  5ENU A;  5D9W A;  5JCW A;  2AUV A;  2BMX A;  3KH7 A;  3IDV A;  2L6D A;  1Z7P A;  4EUY A;  4LL1 B;  5LD0 A;  2ZCT A;  2K6V A;  2YV9 A;  5CRG A;  3D21 A;  1B9Y C;  2L5L A;  2LUS A;  3HJO A;  5J4U A;  1OAZ A;  1PX6 A;  16GS A;  5IQY A;  3Q18 A;  4N11 A;  4MMM A;  4N30 A;  3GKM A;  3TKP A;  1BYE A;  2IIY A;  1V98 A;  4CY6 A;  2C0D A;  3FR6 A;  5A4W A;  1OKD A;  1RQM A;  4ECB A;  1ZZY A;  4GQF A;  4HQS A;  3MYD A;  5H5S A;  2G0F A;  1GSQ A;  5DQS A;  2RM6 A;  3ERF A;  2XBI A;  3EIN A;  3IK9 A;  1A2J A;  1EOG A;  5CYY A;  4AGS A;  5KEJ A;  1T4Y A;  1XOA A;  3L0H A;  4GQC A;  2MBS A;  2L4C A;  1SEN A;  5BRT A;  2LKU A;  1B4P A;  4ZIL A;  2QA2 A;  3WT2 A;  5ECN B;  2GZZ A;  2VCQ A;  2HFD A;  1WWJ A;  4JZQ A;  3VPT A;  2H0I A;  2VO4 A;  2LNT A;  1X5D A;  5DVB A;  5ECP B;  2DSA A;  3GV1 A;  1GUM A;  1KBN A;  1R26 A;  5IMV A;  2RUE A;  1AXD A;  2PBJ A;  3R2Q A;  4GXZ A;  3F4R A;  2QSI A;  4EF0 A;  3C1S A;  1J9B A;  5ECQ B;  4BVX A;  2X8G A;  5IO2 A;  1HNC A;  1GL8 A;  5J3R A;  3DML A;  4NXI A;  4EO3 A;  2PVQ A;  3IPZ A;  3SBC A;  3LYP A;  3F4S A;  1YKC A;  4NAX A;  2H66 A;  3FRC A;  3D5J A;  2V6O A;  2K8V A;  5GAN D;  3GMF A;  1VF4 A;  2DJK A;  1XZO A;  6GST A;  4PQH A;  2ON7 A;  4N0V A;  1TJD A;  3FR9 A;  1A23 A;  2IMF A;  3P90 A;  5KN2 A;  3VPQ A;  1OC8 A;  2PU9 C;  4LA1 A;  1WJK A;  4IBP A;  4OO5 A;  5AIX A;  5H5R A;  3IHG A;  2HT9 A;  3VI7 A;  2C3Q A;  1TK5 B;  3RBT A;  1GSD A;  2A4V A;  1GUH A;  3GSS A;  4F9Z A;  1ACV A;  3D6I A;  1F2E A;  3TRP A;  2H74 A;  2UZ8 A;  3DVX A;  1PKZ A;  4GF0 A;  3L9S A;  3ZIJ A;  3MAK A;  4OFT A;  3LYK A;  3J7Y k;  2O89 A;  2PWJ A;  1Z6M A;  3IAS 2;  3VFI A;  3GKX A;  4O5R A;  1G7E A;  1GH2 A;  1IYI A;  1JZO A;  5JWO B;  4ECC A;  4K0N A;  3RPN A;  3EVI A;  3VI5 A;  5F07 A;  2FY6 A;  2J9H A;  4XRA A;  3LG6 A;  3QOU A;  4YAP A;  3EYT A;  2OJL A;  1PL2 A;  3TKS E;  3IAM 2;  3A2V A;  4J2F A;  1K3O A;  4IW9 A;  2H71 A;  3FZA A;  1BX9 A;  3GIX A;  4HU9 A;  5G5E A;  3ZZX A;  2C0E A;  1PN9 A;  3EE2 A;  4FH8 A;  1Q98 A;  3PGT A;  2DJ0 A;  2A2P A;  3TKS A;  3DIE A;  4EE0 A;  1Y25 A;  1XW5 A;  2VLV A;  4MF5 A;  2FUG 2;  1JZR A;  4K8M A;  3TRQ A;  3ED3 A;  3UVT A;  3RAZ A;  5C04 A;  3DXB A;  4RI6 A;  1XW6 A;  4O32 A;  5KN0 A;  2OKA A;  1T4Z A;  4EL1 A;  2H0G A;  3LGC A;  4XHM A;  4MF6 A;  3PH9 A;  2HLS A;  1SK2 A;  2DKI A;  1OKT A;  1M3I A;  3LJR A;  1FW1 A;  4IKH A;  1X5E A;  4RI7 A;  3QMX A;  2LJR A;  3IBH A;  4JE1 A;  4PUA A;  2GLR A;  3TJG A;  3FZ4 A;  2LJK A;  3LW9 A;  4F03 A;  2F8F A;  1B9X C;  3Q6O A;  3ZYW A;  4N10 A;  3TGZ A;  2MZC A;  3FR3 A;  4EC0 A;  4WBR D;  1U6T A;  4JR4 A;  2LRT A;  2H8L A;  1R4W A;  1E6B A;  4NHZ A;  1J0F A;  2HSM A;  1SK1 A;  2A2S A;  2DJ2 A;  4EDY A;  2CX4 A;  3GH6 A;  4POL A;  1O7U A;  3ERG A;  1PL1 A;  4O5Q A;  3LQ7 A;  2C8U A;  1FOV A;  3C7M A;  3EC3 A;  3HVS A;  1U3I A;  2V1M A;  4MH2 A;  1PKW A;  2HRN A;  5CAX A;  2OE1 A;  3OR5 A;  3CSH A;  2MMA A;  2KHP A;  1SYR A;  3TOT A;  2CQ9 A;  5A4U A;  2B1K A;  1QMV A;  5FT3 A;  2X8H A;  2E2G A;  17GS A;  2LRN A;  4K9Z A;  1VF3 A;  4TR1 B;  5DJM A;  4EVM A;  1TRU A;  1F3A A;  2H30 A;  1QK8 A;  1X0R A;  2R6K A;  1JLV A;  4TN8 A;  3ZIT A;  3M8N A;  4KDY A;  1A0R P;  3GL5 A;  4MZC A;  4LLR A;  1VGL A;  3ISO A;  4K7N A;  5DDL A;  3DD3 A;  1OYJ A;  2JSZ A;  4HUA A;  3HCZ A;  3HYP A;  1OC9 B;  4XRD A;  2GSS A;  1XVW A;  4FIW A;  3L9V A;  1M2A A;  2GQM A;  2L57 A;  4Z7X A;  4GSN A;  2E0Q A;  5KOX A;  2HRF A;  4PXO A;  3LOR A;  2IPA A;  2VUP A;  4K7O A;  5CRD A;  1TRS A;  5G1L A;  1JLW A;  2IME A;  1FVK A;  1RK4 A;  3IC8 A;  2X99 A;  4FO5 A;  4ZBD A;  4K5R A;  2WFC A;  5KOW A;  4ZL8 A;  5ECS A;  5AN1 A;  2DKH A;  2AB6 A;  5CRH A;  5D9X A;  2EIO A;  1UVZ A;  5ECO B;  3PIN A;  1TTZ A;  2H1G A;  2KUC A;  3GL3 A;  3IR4 A;  3KH9 A;  2IMD A;  2B5Y A;  4GRF A;  1EEM A;  1TI1 A;  2N5A A;  4WR4 A;  5J5N A;  9GSS A;  1O6J A;  2LS5 A;  3DEX A;  1TW9 A;  1GWC A;  2Z9S A;  3HHV A;  4F0C A;  1PFO A;  1SJ6 A;  1PQN A;  4OCF A;  5IOW A;  2DIY A;  2GZP A;  4RQR A;  1K0O A;  1NHY A;  3TOU A;  1AAZ A;  1K3Y A;  3CSJ A;  2ZUP A;  2KP2 A;  3TUE A;  1V57 A;  4ZB8 A;  5GST A;  5LCZ A;  1X5C A;  1GTI A;  2B7J A;  2WB9 A;  3IXR A;  5DCG A;  5GAP D;  1ZYQ B;  1XFL A;  2RLI A;  6GSY A;  3J7Y b;  5EL8 A;  4BA7 A;  2CAQ A;  1B48 A;  3A5I A;  4KGI A;  2VLU A;  1M99 A;  3M9K A;  4GCI A;  1SU9 A;  4MP4 A;  2FNO A;  3WGX A;  5G2Z A; 
#chains in the Genus database with same CATH homology
 3GA4 A;  3FK8 A;  1DE2 A;  4MNN A;  3MNG A;  2O87 A;  3ME8 A;  1AQV A;  5ID2 B;  1O8W A;  3WGD A;  5IO0 A;  4HDE A;  4HOJ A;  4ICY A;  5ELA A;  1ERU A;  2GSQ A;  4OWY A;  1X9S B;  1EEJ A;  2H0H A;  4V2N A;  4MDC A;  3F6D A;  3VUR A;  3TJJ A;  5IMA A;  5DBQ A;  1WMJ A;  3F0I A;  3KIJ A;  2YP6 A;  3ZL5 A;  2AV4 A;  5GZZ B;  5JWR B;  4YQU A;  1QQ2 A;  3IV4 A;  5H5Q A;  5ECM B;  3S9F A;  1NHO A;  4PQI A;  1M2D A;  4MPG A;  2IWT A;  3E0U A;  4FYU A;  1TDI A;  2XHF A;  1PSQ A;  2OE3 A;  1Z5Y E;  20GS A;  1GUL A;  5JCG A;  3KTB A;  7GSS A;  2GS3 A;  4Z2T A;  4NPB A;  2IMI A;  2R37 A;  2ES7 A;  5HFG A;  2I1U A;  6GSX A;  2PUK C;  3KXO A;  3C1R A;  1LU4 A;  2K18 A;  1PMT A;  1MDI A;  4FYC A;  2LTK A;  4TVE A;  4WBJ A;  4KA0 A;  2LRC A;  2HXK A;  3FEU A;  2HRA A;  1F3B A;  3O76 A;  2VL9 A;  3GYK A;  2N5F A;  3EUR A;  2GDR A;  1LBK A;  1T00 A;  2F51 A;  4KND A;  1FHE A;  1XIY A;  3KMO A;  3U6V A;  1JZD A;  4CHS A;  5CP1 A;  3C8E A;  4I6X A;  4NMU A;  1GTU A;  3UJ1 A;  3M0F A;  5E4W A;  2YWN A;  2H72 A;  2FA8 A;  5KN1 A;  1V2A A;  3QPM A;  19GS A;  2OAC A;  5DAL B;  1Z7R A;  4JED A;  2H1A A;  1XVQ A;  3GRX A;  5F8B A;  3P8W A;  2V2G A;  3KTL A;  1TU8 A;  3BD2 A;  2XBQ A;  3F8U A;  5G5F A;  2L5O A;  4I2U A;  2TRX A;  4XTS A;  5AIV A;  2OE0 A;  3F4T A;  2DML A;  4ULX A;  1R5A A;  1BG5 A;  1ML6 A;  2HZF A;  4QL7 A;  3DRN A;  4J57 E;  4L5O A;  5ECR B;  1NW2 A;  3D4T A;  3UVH A;  3FZ5 A;  5B7C A;  2CX3 A;  1FB0 A;  3ZRE A;  3CRT A;  5HFI A;  4K1F A;  3G7Y A;  3VWU A;  4AJ6 A;  1ZYN A;  1AW9 A;  3F9U A;  4XS4 B;  4IQ1 A;  1ZYE A;  4K6X A;  1M9B A;  4TR1 A;  3KP9 A;  1SL2 B;  1THO A;  4A5P A;  2WZ9 A;  2VM1 A;  4O7H A;  3UEM A;  3MSZ A;  4Q5R A;  1URM A;  2B7K A;  3MWH A;  5IMZ A;  1NSW A;  3FW2 A;  2HE3 A;  4E8E A;  4V1A p;  4PUF C;  4WR5 A;  1K0C A;  2VOC A;  5A4V A;  1PGT A;  4GLT A;  4FYB A;  1S3C A;  3D22 A;  4DEJ A;  2O8V B;  1EP7 A;  1GSS A;  1O8X A;  3M9J A;  1OC9 A;  4HJ2 A;  4FQU A;  2R2J A;  5HQP A;  5IIZ A;  2GTU A;  1TRW A;  1DSB A;  2FD3 A;  2YV7 A;  3HD5 A;  2DJJ A;  2P0G A;  1MTC A;  4WEY A;  3WYW A;  2C4J A;  2VCV A;  5DAK B;  1Z3E A;  2QKE A;  4OFM A;  4OFN A;  3FHK A;  4GWR A;  1ERT A;  1ZOF A;  5DCH A;  4TKY A;  2MBT A;  1K0M A;  6GSW A;  2H19 A;  4G2E A;  1WPI A;  2CV4 A;  2XPE A;  2GQL A;  1M0U A;  2L6C A;  1OE7 A;  2VIM A;  2C0G A;  2FHE A;  3DYR A;  4HEA 2;  1E2Y A;  5HR2 A;  2WJU A;  1OVN A;  4IVF A;  4IP6 A;  3EWL A;  5D9V A;  5B6N A;  4G9H A;  1B8X A;  2YN1 A;  4KAE A;  2EIQ A;  2YWI A;  2O85 A;  2WRT A;  5HR3 A;  3TDG A;  3IOS A;  1IYH A;  5COH A;  2CT6 A;  4ISD A;  2I4A A;  2PVO C;  2VL3 A;  4IP1 A;  3LXT A;  1M2B A;  1S3D A;  1F9M A;  5FHI A;  4JR6 A;  1GNW A;  1M9A A;  4TR0 A;  1A0F A;  4LMW A;  3VWV A;  4K7I A;  4HZ2 A;  5A5K A;  1AQW A;  5G30 A;  2X4A A;  3UMA A;  4PNG A;  1HQO A;  3D0Z A;  3CYN A;  1RW1 A;  2GGT A;  4Q5Q A;  2H1D A;  2HZE B;  5ECL B;  1GSE A;  4EKZ A;  4DSQ A;  1SL1 B;  3O6T A;  2B5X A;  2NPB A;  1SKR B;  2IL3 A;  4Q5N A;  1TKD B;  4LMV A;  4IHU A;  4KH7 A;  2TIR A;  3IE3 A;  5L71 A;  1N2A A;  1T7P B;  5ID2 A;  2GQK A;  2A2R A;  3BCI A;  4NV5 A;  4WET A;  2IFQ B;  4XIH A;  1WRY A;  4BWQ A;  3CMI A;  5F06 A;  1A2L A;  2GSR A;  5JWQ B;  1EGO A;  1R7H A;  4J56 E;  1TP9 A;  2WGR A;  1J08 A;  3DVW A;  3QR6 A;  4KF9 A;  3APS A;  2VCW A;  3ZRD A;  5E59 A;  2D2Z A;  2WS2 A;  1XW9 A;  1ZMA A;  2HRK A;  1ST9 A;  2I3Y A;  4F2I A;  4EXJ A;  1USB A;  5J9B A;  1JZW A;  1UN2 A;  5D73 A;  4L8E A;  2DMM A;  1ERV A;  1YKA A;  2R0G A;  1TI3 A;  3Q74 A;  1GLP A;  3HJP A;  4WKW A;  14GS A;  1AIU A;  3L4N A;  1G6Y A;  1F37 A;  2DJ3 A;  1T8E B;  3TJK A;  4KDX A;  4MJC A;  4EDZ A;  3DGQ A;  1SKS B;  3DWV A;  3N9J A;  3SWL A;  3WGE A;  1SK0 A;  5ECH B;  5IPG A;  3CXG A;  4KUN A;  1GSF A;  4TXV A;  2M46 A;  5INY A;  1SJI A;  1XWK A;  1K0D A;  3KMN A;  1SJZ A;  4IN0 A;  3W8J A;  4XCS A;  1U87 A;  4HZ4 A;  2C1Y A;  5KN3 A;  3CRU A;  4F82 A;  3IHQ A;  3JCM L;  2R5G A;  2R3X A;  2VLT A;  1EGR A;  2HSH A;  3E9J B;  2REM A;  3EMX A;  3GTU B;  4IGJ A;  1WP0 A;  1KEB A;  1OE8 A;  5DAL A;  2NDO A;  3TKR A;  4TR3 A;  1BED A;  4POB A;  2ALB A;  3KP8 A;  4HS1 A;  2JAC A;  2CAI A;  5J9C A;  2DC5 A;  3U5R E;  4MJB A;  3AY8 A;  3RDW A;  2PER A;  2V32 A;  4MAB A;  1BQ7 A;  4G19 A;  2AYT A;  1V9W A;  1OC3 A;  2JL4 A;  4HU7 A;  4TRX A;  5D9T A;  3VWX A;  2GST A;  3A5W A;  1EZK A;  3QDN A;  2TRC P;  5IMF A;  2CZ3 A;  1O85 A;  2PGT A;  3CBU A;  2YWO A;  4L0W A;  4XS4 A;  5ABR A;  3N5O A;  2AAW A;  2GT5 A;  2CVK A;  3TKQ A;  3KEB A;  3QFB C;  2LJA A;  3IC4 A;  2P5Q A;  1THX A;  3G9B A;  4V2M A;  2RUF A;  2L4Q A;  4ZL9 A;  5ECK B;  2ON5 A;  4MF7 A;  4D73 B;  3F3Q A;  1K3L A;  1WE0 A;  4JBB A;  1HNB A;  1DBY A;  3R3E A;  4USS A;  1PRX A;  4ZBA A;  4CDO A;  4KB3 A;  3C71 A;  3TB2 A;  3RPP A;  1F6M C;  1ERW A;  4ACS A;  1BAY A;  1JHB A;  3P2A A;  2MMO A;  3H4K A;  4MZW A;  2CA8 A;  3HZ8 A;  4X0X A;  1FO5 A;  2QGV A;  5DAK A;  1SD9 A;  1S3A A;  1XWC A;  1G0T A;  4ZB6 A;  1EV9 A;  2DJ1 A;  1V58 A;  4IQA A;  3TJB A;  3D4M A;  4PX1 A;  3UBL A;  2L59 A;  2XC2 A;  2GT6 A;  1G6W A;  4PUR A;  1FOH A;  1YF0 A;  1YQ1 A;  2C80 A;  3GX0 A;  3MDK A;  5EPF A;  4P3Y B;  1PD2 1;  2KLX A;  4MK3 A;  1YZX A;  3A3T A;  2YAN A;  4ZL7 A;  2JZT A;  4JU5 A;  1H4O A;  4EIP A;  4MJE A;  2WDU A;  2VCX A;  3HDC A;  4NHW A;  2VCZ A;  3FKF A;  3EU3 A;  4NWY A;  4RUV A;  1CQH A;  1QXH A;  1H75 A;  1MEK A;  4IJ3 A;  2EC4 A;  4WXT A;  1ZGN A;  3ZFL A;  4BWS A;  2AJQ B;  3GUS A;  3MIX A;  4MPF A;  2FCH A;  3GST A;  1VF1 A;  1QFN A;  2X49 A;  1FVJ A;  2NBS A;  3HKR A;  2WUL A;  1TU7 A;  3W8S A;  5IOX A;  4IEL A;  3EU4 A;  1TK0 B;  2DBC A;  4OO4 A;  2R4V A;  4H86 A;  1EV4 A;  1GTA A;  3F3R A;  2HYX A;  2HZE A;  3QAG A;  3KJY A;  1Q4J A;  3VWW A;  3CSI A;  2FWG A;  3KGK A;  5BMU A;  3QD9 A;  4ML1 A;  1EWX A;  2YOI A;  10GS A;  4MJA A;  2GZY A;  3C73 A;  1ILO A;  5IMC A;  1UC7 A;  1MD4 A;  4Q5F A;  3ZMK A;  2PPT A;  5EY6 A;  2HNL A;  5ELG A;  3IK7 A;  4MLY A;  8GSS A;  5GSS A;  1KTE A;  2V6K A;  2CVB A;  3UIW A;  2IFQ A;  3I69 A;  22GS A;  4OD7 A;  4MZB A;  5CO3 A;  1QUW A;  6GSV A;  2E7P A;  2B1L A;  3P7X A;  1R5P A;  1PX7 A;  1ZYP A;  2H6Z A;  3HJM A;  4G0K A;  2CZ2 A;  2JU5 A;  2IJY A;  2H75 A;  5HFK A;  3ZFB A;  2YJ7 A;  3I43 A;  1CQG A;  4ZBB A;  1XWA A;  4MA9 A;  4PNF A;  2P31 A;  4ZXG A;  3BBY A;  4KCE A;  3PPU A;  1FG4 A;  3WD6 A;  4QL9 A;  3CTF A;  4PQ1 A;  4L5L A;  1A8L A;  1O73 A;  5DJL A;  5IM9 A;  2QA1 A;  3G7J A;  2OA7 A;  5F05 A;  2VD0 A;  4MCU A;  4CY8 A;  1U3A A;  2A4H A;  4POK A;  3VLN A;  2C0F A;  3LXZ A;  4V2L A;  2YNX A;  2F9S A;  1VF2 A;  4TOP A;  4OMV A;  3PR8 A;  1WOU A;  1SD8 A;  5G1K A;  3O3T A;  4BVY B;  3QAV A;  4YKG A;  4Z2R A;  3I6A A;  4YH2 A;  4G10 A;  11GS A;  1AC1 A;  2VL2 C;  3QCP A;  3ME7 A;  12GS A;  3ZML A;  4ID0 A;  3HXS A;  2FGX A;  4YQM A;  1EOH A;  1A24 A;  1GTB A;  3GFK A;  2DIZ A;  4QQ7 A;  4PTS A;  3HZ4 A;  3IRA A;  2HSY A;  1TRV A;  3LWA A;  4O5U A;  4GTU A;  3GTU A;  4RQX A;  1AUC A;  4I97 A;  1W4V A;  2GVP A;  5J41 A;  1FB6 A;  4KSO A;  2M72 A;  4X4J A;  3ZIV A;  4WF5 A;  3BOA A;  1NM3 A;  3TRX A;  3UAR A;  3TJF A;  3GKK A;  5AGY A;  3FZ9 A;  2BJX A;  1O81 A;  3GN3 A;  3Q19 A;  4E8H A;  1QGV A;  3EMP A;  3UAP A;  1MD3 A;  3HVX A;  3KD0 A;  2X8C A;  4DSS B;  2FA4 A;  4I8B A;  2EIR A;  3F6F A;  3QFA C;  4TXO B;  3RHC A;  2OAD A;  4G0I A;  2RM5 A;  3ZVJ D;  4K5S A;  1V40 A;  1T1V A;  4NV2 A;  3HY2 A;  3GUR A;  5EVO A;  3ZVJ A;  1N8J A;  1MDJ A;  2P5R A;  3F63 A;  1X9M B;  1SKW B;  1Z9H A;  4D73 A;  4HJM A;  1HYU A;  1YEX A;  4BL7 B;  1DUG A;  5B8A A;  1YJ6 A;  5D93 A;  2BTO T;  3LSZ A;  3HA9 A;  3BJ5 A;  4KW6 A;  2JSY A;  3QAW A;  2LV3 A;  1GSU A;  1Z6N A;  1A2M A;  2IN3 A;  1TXX A;  2O7K A;  3A2X A;  3H8Q A;  3H79 A;  2KOK A;  2VAF A;  4XS1 A;  2QC7 A;  1YF1 A;  1VRS D;  3BCK A;  4ILF A;  1B4Q A;  4OCE A;  1SYX A;  2LNS A;  3M3M A;  2I9H A;  2YZH A;  2B3S A;  1Y6E A;  1SL0 B;  4YQV A;  4X1U A;  2JZS A;  2PMT A;  1HD2 A;  3KM6 A;  1YEP A;  5DQY A;  4DSR A;  1GLQ A;  2PN8 A;  2OBI A;  3LFL A;  1BJX A;  5JCU A;  4KX4 A;  1EP8 A;  3HVV A;  4ECJ A;  3RHB A;  2DLX A;  2FWH A;  2JAD A;  1A8Y A;  5LNK e;  5IPH A;  4POM A;  3APQ A;  1K0A A;  2H6X A;  4G0L A;  2C3N A;  2H76 A;  2B5E A;  4K2X A;  3US3 A;  4ML6 A;  1U88 A;  2H01 A;  3UL3 A;  4N0Z A;  4BVX B;  5D96 A;  2VCT A;  5C00 A;  1M7T A;  2HI7 A;  1TK8 B;  3H93 A;  2X64 A;  4KE3 A;  1HNA A;  1ON4 A;  2FWF A;  4KDU A;  4AJ8 A;  1TOF A;  4ZB9 A;  1WIK A;  3KZQ A;  2E2M A;  4WF4 A;  2YCD A;  2LEG A;  2H1B A;  5FWG A;  1X9W B;  4YAV A;  13GS A;  2XPD A;  4TR4 A;  1I9D A;  3VK9 A;  3W6G A;  4IJI A;  1XOB A;  6GSS A;  2ZNM A;  4DVC A;  1XXU A;  6GSU A;  4AJ7 A;  1JFU A;  1FAA A;  3H1N A;  3GNJ A;  3CTG A;  3NZN A;  4BPY A;  4LL4 B;  2R0P A;  5CRE A;  1PA3 A;  1YY7 A;  5HR1 A;  2MMZ A;  1ABA A;  4JRR A;  1C72 A;  4PGT A;  3GX8 A;  2YZU A;  5B6M A;  2C3T A;  2K9F A;  3ZLP A;  2AHE A;  1XWB A;  2VM2 A;  2MYG A;  3LEF A;  4CW9 A;  2M80 A;  2CVD A;  2G2Q A;  4HQZ A;  1T3B A;  5B8B A;  5CNW A;  3IA1 A;  2F8A A;  2R0C A;  4F0B A;  4K0G A;  2OBK A;  3M1G A;  1AQX A;  3TKS C;  4MH3 A;  4O92 A;  3DKS A;  3APO A;  3NOF A;  2LQQ A;  2B6M A;  2KP1 A;  2IMK A;  2RII A;  2MMN A;  2LQO A;  2V41 A;  1MDK A;  1G7O A;  2I81 A;  2YJH A;  2NTO A;  2H73 A;  1ZCP A;  1GSY A;  1GRX A;  1ZL9 A;  5CRW A;  3EPT A;  4BVY A;  1LJR A;  2H70 A;  2J23 A;  4ZIJ A;  3UBK A;  1KNG A;  4K2D A;  2YPM A;  4L0U A;  3NIV A;  4V1A g;  5G31 A;  2K8S A;  2JZR A;  5ECI B;  2FLS A;  2WCI A;  1W89 A;  4HI7 A;  1I5G A;  2NVL A;  2YWM A;  3GKN A;  3ZTL A;  1YDK A;  3L9U A;  3UOM A;  5D8I A;  1GP1 A;  2N5B A;  3V1W A;  4KSM A;  3ERW A;  2FWE A;  4EIQ A;  1GNE A;  2F3M A;  2VL2 A;  1UA5 A;  1XWG A;  3FY7 A;  5F0G A;  3WT1 A;  3G7I A;  5AIS A;  3A2W A;  4I5Q A;  3KCM A;  4YKF A;  4AF2 A;  3K8N A;  2LST A;  4XS6 A;  3GH9 A;  1XCC A;  4DSS A;  1GUK A;  5HR0 A;  3GHA A;  1K0B A;  3FYG A;  18GS A;  1XPV A;  4TXO A;  3L78 A;  1DE1 A;  1PN0 A;  3TCO A;  4ECI A;  4IS0 A;  2VD1 A;  4X43 A;  4I2T A;  3I9V 2;  1K0N A;  5IMD A;  3FMW A;  4Z2U A;  4GST A;  4TW5 A;  1XBS A;  4KCA A;  2H6Y A;  4GSS A;  3E3E A;  4BL7 A;  5ENU A;  5D9W A;  5JCW A;  2AUV A;  2BMX A;  3KH7 A;  3IDV A;  2L6D A;  1Z7P A;  4EUY A;  4LL1 B;  5LD0 A;  2ZCT A;  2K6V A;  2YV9 A;  5CRG A;  3D21 A;  1B9Y C;  2L5L A;  2LUS A;  3HJO A;  5J4U A;  1OAZ A;  1PX6 A;  16GS A;  5IQY A;  3Q18 A;  4N11 A;  4MMM A;  4N30 A;  3GKM A;  3TKP A;  1BYE A;  2IIY A;  1V98 A;  4CY6 A;  2C0D A;  3FR6 A;  5A4W A;  1OKD A;  1RQM A;  4ECB A;  1ZZY A;  4GQF A;  4HQS A;  3MYD A;  5H5S A;  2G0F A;  1GSQ A;  5DQS A;  2RM6 A;  3ERF A;  2XBI A;  3EIN A;  3IK9 A;  1A2J A;  1EOG A;  5CYY A;  4AGS A;  5KEJ A;  1T4Y A;  1XOA A;  3L0H A;  4GQC A;  2MBS A;  2L4C A;  1SEN A;  5BRT A;  2LKU A;  1B4P A;  4ZIL A;  2QA2 A;  3WT2 A;  5ECN B;  2GZZ A;  2VCQ A;  2HFD A;  1WWJ A;  4JZQ A;  3VPT A;  2H0I A;  2VO4 A;  2LNT A;  1X5D A;  5DVB A;  5ECP B;  2DSA A;  3GV1 A;  1GUM A;  1KBN A;  1R26 A;  5IMV A;  2RUE A;  1AXD A;  2PBJ A;  3R2Q A;  4GXZ A;  3F4R A;  2QSI A;  4EF0 A;  3C1S A;  1J9B A;  5ECQ B;  4BVX A;  2X8G A;  5IO2 A;  1HNC A;  1GL8 A;  5J3R A;  3DML A;  4NXI A;  4EO3 A;  2PVQ A;  3IPZ A;  3SBC A;  3LYP A;  3F4S A;  1YKC A;  4NAX A;  2H66 A;  3FRC A;  3D5J A;  2V6O A;  2K8V A;  5GAN D;  3GMF A;  1VF4 A;  2DJK A;  1XZO A;  6GST A;  4PQH A;  2ON7 A;  4N0V A;  1TJD A;  3FR9 A;  1A23 A;  2IMF A;  3P90 A;  5KN2 A;  3VPQ A;  1OC8 A;  2PU9 C;  4LA1 A;  1WJK A;  4IBP A;  4OO5 A;  5AIX A;  5H5R A;  3IHG A;  2HT9 A;  3VI7 A;  2C3Q A;  1TK5 B;  3RBT A;  1GSD A;  2A4V A;  1GUH A;  3GSS A;  4F9Z A;  1ACV A;  3D6I A;  1F2E A;  3TRP A;  2H74 A;  2UZ8 A;  3DVX A;  1PKZ A;  4GF0 A;  3L9S A;  3ZIJ A;  3MAK A;  4OFT A;  3LYK A;  3J7Y k;  2O89 A;  2PWJ A;  1Z6M A;  3IAS 2;  3VFI A;  3GKX A;  4O5R A;  1G7E A;  1GH2 A;  1IYI A;  1JZO A;  5JWO B;  4ECC A;  4K0N A;  3RPN A;  3EVI A;  3VI5 A;  5F07 A;  2FY6 A;  2J9H A;  4XRA A;  3LG6 A;  3QOU A;  4YAP A;  3EYT A;  2OJL A;  1PL2 A;  3TKS E;  3IAM 2;  3A2V A;  4J2F A;  1K3O A;  4IW9 A;  2H71 A;  3FZA A;  1BX9 A;  3GIX A;  4HU9 A;  5G5E A;  3ZZX A;  2C0E A;  1PN9 A;  3EE2 A;  4FH8 A;  1Q98 A;  3PGT A;  2DJ0 A;  2A2P A;  3TKS A;  3DIE A;  4EE0 A;  1Y25 A;  1XW5 A;  2VLV A;  4MF5 A;  2FUG 2;  1JZR A;  4K8M A;  3TRQ A;  3ED3 A;  3UVT A;  3RAZ A;  5C04 A;  3DXB A;  4RI6 A;  1XW6 A;  4O32 A;  5KN0 A;  2OKA A;  1T4Z A;  4EL1 A;  2H0G A;  3LGC A;  4XHM A;  4MF6 A;  3PH9 A;  2HLS A;  1SK2 A;  2DKI A;  1OKT A;  3LJR A;  1FW1 A;  4IKH A;  1X5E A;  4RI7 A;  3QMX A;  2LJR A;  3IBH A;  4JE1 A;  4PUA A;  2GLR A;  3TJG A;  3FZ4 A;  2LJK A;  3LW9 A;  4F03 A;  2F8F A;  1B9X C;  3Q6O A;  3ZYW A;  4N10 A;  3TGZ A;  2MZC A;  3FR3 A;  4EC0 A;  4WBR D;  1U6T A;  4JR4 A;  2LRT A;  2H8L A;  1R4W A;  1E6B A;  4NHZ A;  1J0F A;  2HSM A;  1SK1 A;  2A2S A;  2DJ2 A;  4EDY A;  2CX4 A;  3GH6 A;  4POL A;  1O7U A;  3ERG A;  1PL1 A;  4O5Q A;  3LQ7 A;  2C8U A;  1FOV A;  3C7M A;  3EC3 A;  3HVS A;  1U3I A;  2V1M A;  4MH2 A;  1PKW A;  2HRN A;  5CAX A;  2OE1 A;  3OR5 A;  3CSH A;  2MMA A;  2KHP A;  1SYR A;  3TOT A;  2CQ9 A;  5A4U A;  2B1K A;  1QMV A;  5FT3 A;  2X8H A;  2E2G A;  17GS A;  2LRN A;  4K9Z A;  1VF3 A;  4TR1 B;  5DJM A;  4EVM A;  1TRU A;  1F3A A;  2H30 A;  1QK8 A;  1X0R A;  2R6K A;  1JLV A;  4TN8 A;  3ZIT A;  3M8N A;  4KDY A;  1A0R P;  3GL5 A;  4MZC A;  4LLR A;  1VGL A;  3ISO A;  4K7N A;  5DDL A;  3DD3 A;  1OYJ A;  2JSZ A;  4HUA A;  3HCZ A;  3HYP A;  1OC9 B;  4XRD A;  2GSS A;  1XVW A;  4FIW A;  3L9V A;  1M2A A;  2GQM A;  2L57 A;  4Z7X A;  4GSN A;  2E0Q A;  5KOX A;  2HRF A;  4PXO A;  3LOR A;  2IPA A;  2VUP A;  4K7O A;  5CRD A;  1TRS A;  5G1L A;  1JLW A;  2IME A;  1FVK A;  1RK4 A;  3IC8 A;  2X99 A;  4FO5 A;  4ZBD A;  4K5R A;  2WFC A;  5KOW A;  4ZL8 A;  5ECS A;  5AN1 A;  2DKH A;  2AB6 A;  5CRH A;  5D9X A;  2EIO A;  1UVZ A;  5ECO B;  3PIN A;  1TTZ A;  2H1G A;  2KUC A;  3GL3 A;  3IR4 A;  3KH9 A;  2IMD A;  2B5Y A;  4GRF A;  1EEM A;  1TI1 A;  2N5A A;  4WR4 A;  5J5N A;  9GSS A;  1O6J A;  2LS5 A;  3DEX A;  1TW9 A;  1GWC A;  2Z9S A;  3HHV A;  4F0C A;  1SJ6 A;  1PQN A;  4OCF A;  5IOW A;  2DIY A;  2GZP A;  4RQR A;  1K0O A;  1NHY A;  3TOU A;  1AAZ A;  1K3Y A;  3CSJ A;  2ZUP A;  2KP2 A;  3TUE A;  1V57 A;  4ZB8 A;  5GST A;  5LCZ A;  1X5C A;  1GTI A;  2B7J A;  2WB9 A;  3IXR A;  5DCG A;  5GAP D;  1ZYQ B;  1XFL A;  2RLI A;  6GSY A;  3J7Y b;  5EL8 A;  4BA7 A;  2CAQ A;  1B48 A;  3A5I A;  4KGI A;  2VLU A;  1M99 A;  3M9K A;  4GCI A;  1SU9 A;  4MP4 A;  2FNO A;  3WGX A;  5G2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...