4OWYA

Crystal structure of ahp1 from saccharomyces cerevisiae. investigating the electron transfers.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
174
structure length
169
Chain Sequence
DLVNKKFPAGDYKFQYIAISQSDCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin type-2
publication title Crystal Structure of Ahp1 from Saccharomyces cerevisiae. Investigating the electron transfers.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 45
structure length 169
sequence length 174
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4owyA00
3CYNA 4IW9A 2MZCA 1K0CA 4IKHA 4HZ2A 1XVQA 4TRXA 2CAIA 2CX3A 3IK9A 2OKAA 3A3TA 6GSYA 1QQ2A 1SU9A 4ECJA 5C04A 2GQKA 3CSIA 4KCEA 1JZWA 1ZMAA 1M2DA 2PVQA 5J3RA 3TKPA 4PQ1A 3TKQA 5CNWA 3KCMA 1V57A 1MDIA 3HVXA 2B3SA 2V6KA 2QSIA 3R2QA 5AGYA 3ZL5A 3ZFLA 1EV9A 3M9KA 2RLIA 2HT9A 5FHIA 2VCZA 5JWQB 2LNSA 2GSTA 5CREA 2RM6A 7GSSA 1X0RA 2GSRA 4MJAA 1EGRA 3UVHA 2DJ3A 1PL1A 3ZRDA 3DVWA 2OE1A 3KEBA 1I5GA 4ZIJA 3P90A 3GH6A 5CAXA 4XS4A 1WP0A 1RW1A 1JLWA 4GWRA 2LKUA 3KH9A 1R26A 1K0NA 1FVJA 1OE8A 3N9JA 2NTOA 2YZHA 1NHYA 3SWLA 1EOGA 4XHMA 1EWXA 5DAKB 3TKSC 2LRCA 5EY6A 4CW9A 4GCIA 2VD1A 1TOFA 4XIHA 4ID0A 1K0AA 2J9HA 5INYA 4NV5A 5JCUA 3QMXA 2JZSA 1DSBA 3I43A 2P0GA 1PD21 1B8XA 4KGIA 3BD2A 4XCSA 4K7OA 2RUFA 4BVYA 2YPMA 3TCOA 5ECSA 2VL2A 3OR5A 1E2YA 2B1KA 1XWGA 3VWWA 1OAZA 4PNGA 5DALB 3D4MA 1OC8A 4V1Ag 5B7CA 4Q5QA 2IFQA 1AW9A 2K18A 4V1Ap 3EINA 3IK7A 3ME7A 2QGVA 5G1LA 4KE3A 1S3CA 2CAQA 3GKMA 3L0HA 1OVNA 4XS6A 1O81A 3QAVA 4EL1A 1YEPA 1YKAA 1TK5B 5HR3A 3MAKA 5IO2A 2HRFA 4MZCA 3CSHA 1F37A 1TRWA 1EGOA 1N2AA 1G6YA 4NAXA 1SJ6A 3MSZA 1VF4A 3KMNA 4MPGA 3LORA 1U6TA 4BWQA 3VK9A 1UC7A 2ON7A 4ZBBA 4E8EA 2RUEA 4Z7XA 4DVCA 1ZL9A 5H5SA 5DQYA 1K0MA 4PQHA 4EDYA 1AXDA 4CDOA 3UVTA 2QC7A 5G5FA 4TR1A 3HZ8A 5LD0A 5ECOB 4V2LA 3APOA 4DSSB 1O8XA 4V2MA 1EEJA 1YZXA 2A2RA 5J9BA 4OD7A 3ED3A 2H30A 3RHBA 3TJFA 1YKCA 4F9ZA 3G7JA 3IC4A 4KSMA 1LJRA 3VWXA 17GSA 1H75A 1GSSA 1WPIA 4WEYA 2R6KA 4IP6A 3O76A 2FD3A 1YDKA 3TRXA 3KIJA 1O8WA 2HLSA 2LRTA 3IXRA 2VLTA 3LFLA 2GT6A 4OCEA 1O7UA 3ZLPA 5G31A 4HUAA 4ACSA 5IMFA 4GLTA 2H1GA 1OYJA 2MMZA 2H6XA 2MBTA 5IPGA 5G30A 4EVMA 3TJBA 1GTAA 1FB0A 1EZKA 1WOUA 2C4JA 3KTLA 2F51A 4QL9A 1XW6A 9GSSA 4ZB6A 3ZVJD 1WJKA 3GSSA 1UA5A 1GLPA 1A0RP 1R5AA 4MLYA 4YQUA 2GZPA 4I2UA 12GSA 3UBLA 5CRDA 1EEMA 1ILOA 2D2ZA 2P31A 3DRNA 1OC9A 3IHQA 4ZB9A 3UAPA 3DXBA 4F82A 2X64A 4KDUA 1PN9A 2F8AA 1XIYA 3J7Yk 3ZMLA 5KN3A 2XPEA 3DEXA 1TU8A 4IQ1A 3VI5A 2AV4A 3TRPA 2CT6A 2FLSA 3GH9A 2IN3A 1PX6A 2HXKA 3UOMA 1VF1A 3EMXA 1TP9A 3BCIA 22GSA 4ISDA 5D9TA 20GSA 2H1AA 4IP1A 3A2XA 2HSYA 1X9WB 2VL2C 4L5LA 4OO5A 3KJYA 4YQVA 2E0QA 5E59A 4ZBAA 5JCGA 3HVVA 2ON5A 1F2EA 3HKRA 1TRUA 1V40A 3HDCA 4D73A 3QAGA 2TIRA 4H86A 1A24A 2L59A 4OFNA 2P5QA 3LXTA 4RUVA 14GSA 1ERWA 3F4SA 1Z7PA 4NV2A 4O7HA 1VGLA 1ST9A 4MZWA 4IQAA 4Q5NA 1F6MC 4KB3A 2EC4A 3GTUB 1V2AA 4EKZA 5JWOB 3E3EA 2F8FA 1GULA 4WBRD 4F0BA 1JZRA 4EDZA 2FNOA 3VPTA 2VOCA 2H74A 19GSA 1FO5A 1BYEA 3LXZA 4L8EA 5J4UA 2HSHA 4ULXA 3FKFA 3KM6A 2VM2A 2N5AA 1GSYA 2AB6A 4MH2A 4MABA 5FWGA 5D9WA 11GSA 5ECNB 1GSFA 3KH7A 3TGZA 1T7PB 2R2JA 4TR0A 1TXXA 3D4TA 1S3AA 2GQLA 1PMTA 2YN1A 4KUNA 4WXTA 1SKRB 3P7XA 2O8VB 5G2ZA 3H93A 3MWHA 3CTGA 2V2GA 3E9JB 3TB2A 4FYCA 2PGTA 3TOUA 1OKTA 5KN0A 3A5WA 2H76A 4O32A 1YF0A 5DJLA 1PX7A 1V9WA 5ECIB 1XXUA 2FWHA 4N0ZA 2H0HA 4ZL9A 1SKWB 3F6FA 5ECHB 4N11A 1EP7A 1SL2B 3RPPA 4YAPA 3QDNA 4HJMA 5FT3A 3H4KA 13GSA 1GTIA 3F63A 3M9JA 2CVBA 2DMLA 2JU5A 4ML1A 4MJBA 2VUPA 1M2AA 2IJYA 3I9V2 1ZCPA 2FY6A 1V98A 2C0EA 3KGKA 5ABRA 1GSEA 3FR6A 3ERGA 1ERVA 2IIYA 4V2NA 4TOPA 2LJRA 2GSSA 3FEUA 4NXIA 4HU7A 4AJ7A 2Z9SA 2L5OA 1PGTA 1X5DA 1R4WA 5EPFA 2WJUA 3FY7A 5ECMB 2JADA 3ME8A 4ZXGA 2OA7A 1GL8A 5H5RA 4O92A 2OBIA 3IDVA 3GV1A 1SYRA 4WF4A 3QD9A 3A2WA 2PU9C 1QXHA 3F9UA 3AY8A 2HI7A 1HD2A 1DE1A 1Y25A 1U3IA 1AC1A 2YWNA 4NMUA 4QQ7A 2KLXA 2L5LA 2H0IA 1E6BA 2OADA 3ZMKA 3WGEA 3TOTA 3RAZA 5DAKA 3CSJA 1A23A 1YEXA 4MH3A 3IOSA 1T4ZA 3HJMA 2MMAA 2I3YA 1X5CA 2YJ7A 2XBIA 5IPHA 3WD6A 1Z3EA 1SD8A 2WCIA 3DD3A 1U87A 1XWBA 2B5YA 2GZYA 5IO0A 2O7KA 2B5EA 1GTUA 3RDWA 4BVXA 1PKZA 2WZ9A 4PXOA 4FIWA 3WGXA 3IRAA 1XFLA 1M7TA 1R7HA 1B9XC 4KH7A 5DALA 1X9SB 5ECKB 1AIUA 3JCML 1RK4A 4F2IA 2C0GA 2GSQA 4KDXA 3GSTA 5F07A 3K8NA 6GSTA 4I2TA 1FVKA 5GAPD 2DJJA 2DBCA 2OE3A 3QOUA 5AIXA 3GFKA 2YNXA 5EVOA 2VCQA 1XPVA 1WIKA 1F9MA 4PQIA 1OKDA 2O87A 1J08A 3HJOA 1K0BA 1M0UA 2DIZA 3GURA 4K0GA 3TKSE 2DMMA 3UL3A 2XPDA 4POLA 2LSTA 4IJIA 4IHUA 3KXOA 1PQNA 2R3XA 5KN1A 1SYXA 5KEJA 5H5QA 1ABAA 4G9HA 3GA4A 3EURA 1SL0B 3W8JA 3ZIVA 3NIVA 2L57A 4AGSA 4OFMA 1WRYA 1SK0A 1W89A 1AUCA 2XHFA 3EU4A 1SJZA 4MPFA 4ML6A 1QFNA 1GWCA 3KMOA 3MNGA 4G19A 4HQSA 2IFQB 4G2EA 5D9VA 3US3A 4DSSA 3UARA 3IAM2 4LL4B 5D9XA 2WULA 4DSRA 5DVBA 4HJ2A 1IYHA 1K3LA 1ML6A 2H71A 4EC0A 1ON4A 2ES7A 6GSWA 4GXZA 2YCDA 4TKYA 5GSTA 2GTUA 2H1BA 1GRXA 4RQRA 4TXOB 2ALBA 3APSA 1B9YC 3D21A 1NSWA 3MDKA 2G2QA 5CRHA 2LJKA 3QR6A 1JZOA 3Q74A 1BJXA 4WR5A 3RPNA 1K0DA 4GRFA 5ID2B 4J57E 2RM5A 4I97A 1THOA 1KTEA 5AN1A 4P3YB 4YAVA 2DLXA 4GSTA 3VPQA 2KP2A 2MBSA 3EC3A 2HYXA 4OFTA 4O5RA 3VLNA 4EE0A 3L9SA 4EXJA 1S3DA 3TUEA 2WDUA 1WMJA 2GDRA 2IMFA 3LG6A 3BBYA 2B7JA 1F3AA 3C71A 5A4UA 2TRCP 2ZUPA 2N5FA 2FHEA 1TDIA 3HZ4A 2FWGA 2N5BA 2LQQA 2LEGA 1A2JA 3ERWA 4TXVA 2IMDA 1JZDA 1ZYEA 4XRAA 1BQ7A 1GNWA 2YANA 3F4TA 5DJMA 2F9SA 2H73A 5IIZA 2K9FA 4TR3A 3EYTA 1FAAA 1TI1A 2RIIA 4JU5A 1GUHA 1JLVA 4IBPA 1QGVA 4WR4A 4L0WA 3FR9A 2NBSA 2HZEB 4PUFC 4EF0A 3WT1A 3FZAA 1PL2A 4G10A 3S9FA 2AAWA 4AF2A 1O73A 3QFAC 3KZQA 16GSA 3F3RA 3Q6OA 2L6DA 4FYUA 2AHEA 3D0ZA 3RHCA 3HY2A 2EIOA 3CRUA 3VWUA 2V1MA 3M3MA 1DE2A 3GYKA 3LYPA 1TRVA 8GSSA 2F3MA 1G7OA 4POKA 2IMEA 4K6XA 3U5RE 2R4VA 3EVIA 3L9UA 4WKWA 4IELA 3GTUA 5IMAA 5IMZA 1B4QA 2H8LA 4YQMA 5IQYA 3FHKA 4ECBA 4OMVA 3F0IA 4PX1A 2YZUA 2H75A 4N10A 4LLRA 1TU7A 5ECQB 2YOIA 1H4OA 2FUG2 1R5PA 3ZYWA 2FWFA 1M2BA 1ZOFA 5CRWA 4CHSA 2I4AA 4AJ8A 2L6CA 2GT5A 3ZVJA 2H19A 3HCZA 2DJKA 4ZILA 3Q18A 5GAND 1LU4A 4MJEA 2PPTA 3WT2A 4N0VA 2PERA 1J0FA 2E7PA 2YV9A 3HXSA 1WE0A 3FRCA 3UIWA 5A4VA 1JHBA 3LJRA 2H01A 3C1SA 1T3BA 4IGJA 4KCAA 3DWVA 1G7EA 1XWAA 1HNAA 3G9BA 4NHWA 3QFBC 3F6DA 2DIYA 4PNFA 3EU3A 4K7IA 2CX4A 2YWMA 3IPZA 1LBKA 4GSNA 2VCVA 3HD5A 3FK8A 5B8BA 1X9MB 2KUCA 1YF1A 3GKNA 2G0FA 2R5GA 2V41A 2C8UA 2H70A 4OCFA 2YV7A 2HE3A 1A8LA 1GSDA 2CV4A 3Q19A 4K9ZA 3UMAA 3LGCA 5ENUA 3V1WA 1M9AA 1UVZA 3VFIA 4BPYA 4TVEA 1MD3A 1WWJA 3ISOA 3KP9A 2PUKC 1MTCA 5D96A 1QUWA 4JBBA 4YH2A 4F03A 1YJ6A 2HFDA 3EE2A 1W4VA 2B1LA 5G5EA 2B5XA 1NW2A 2LJAA 4ILFA 3J7Yb 3PINA 2REMA 10GSA 3QPMA 4GF0A 1HYUA 3GKKA 5F8BA 1FW1A 4JE1A 4ZBDA 2C3NA 3HJPA 4MCUA 1J9BA 3GL3A 1TRSA 1MDKA 2WS2A 1GP1A 2LV3A 2JL4A 4K8MA 1G6WA 1SKSB 3G7IA 1XVWA 3LYKA 3ZIJA 2I1UA 1USBA 2VM1A 2LNTA 5DCHA 1FHEA 3L9VA 4MF5A 3WGDA 1PSQA 3TJKA 4TW5A 3GN3A 2QKEA 1XCCA 2WGRA 1TTZA 3APQA 1HNCA 3IE3A 1ERUA 4KAEA 3SBCA 2PN8A 4L0UA 1GLQA 2HNLA 1Q4JA 2L4CA 1URMA 2LTKA 1XW9A 5F05A 1AQXA 2BJXA 2XC2A 5HFGA 3UEMA 4HDEA 4GQFA 4JEDA 3C8EA 3F3QA 3F4RA 3M1GA 5A4WA 2AUVA 2M80A 6GSVA 4NHZA 5F06A 6GSUA 1V58A 3GKXA 4I5QA 2VL9A 3HVSA 1HQOA 4MMMA 4N30A 1EOHA 5IOXA 3UJ1A 2H0GA 1JFUA 1GUMA 1SK1A 5ECPB 2LUSA 1K3OA 3KTBA 3DKSA 3LSZA 1A2MA 2B7KA 1NHOA 1ACVA 4XRDA 2DJ1A 2VIMA 1IYIA 2C3TA 5HR2A 1KEBA 1SD9A 2LQOA 4BL7A 1DUGA 3GHAA 2GLRA 2VL3A 2J23A 2IMKA 18GSA 2FCHA 3FZ5A 2EIRA 1VF2A 5B6MA 2X8GA 2GVPA 1A8YA 3FZ4A 2TRXA 2LS5A 4IJ3A 4K2DA 2KP1A 2PVOC 3FR3A 3ZFBA 1RQMA 5E4WA 4EUYA 3RBTA 1AAZA 2H72A 2NVLA 1SL1B 4MP4A 1U88A 1QMVA 3TJJA 3UBKA 2K6VA 1I9DA 3VWVA 3C1RA 3GUSA 2VCXA 2C80A 5IM9A 1Z6NA 1KNGA 4XS4B 4POBA 2FGXA 1PKWA 2JZRA 2CZ3A 3DGQA 5HR1A 4XTSA 5AISA 1AQVA 3BJ5A 1GSUA 5DDLA 4KSOA 3WYWA 4I6XA 1THXA 1OC3A 1EV4A 3HA9A 2GQMA 2M46A 5L71A 1B4PA 1T1VA 1AQWA 1QK8A 2C0FA 1XW5A 2CQ9A 4MDCA 3M0FA 5LNKe 2IWTA 1SJIA 5CP1A 1FOVA 1PA3A 3O6TA 3FYGA 4HQZA 2OE0A 3ERFA 1DBYA 4WF5A 4HOJA 5KN2A 4HI7A 2O85A 2E2MA 5D73A 2E2GA 1BG5A 3C73A 4I8BA 4NWYA 4AJ6A 3I6AA 2V32A 5HFKA 2K8VA 2MMNA 3HHVA 2X8HA 1BEDA 4TXOA 3N5OA 4ZB8A 4PGTA 5D93A 3IBHA 1K3YA 2HZFA 1T4YA 1C72A 3GX8A 3DIEA 2LRNA 2IL3A 3P2AA 2VO4A 3GNJA 2DSAA 2X8CA 4OO4A 5A5KA 4J56E 3EWLA 5ID2A 2BMXA 2GZZA 4X0XA 5IMCA 4LL1B 4Q5RA 2JZTA 3D6IA 1PRXA 1XOBA 2A2SA 1TKDB 3ZREA 2K8SA 3LWAA 3HYPA 1TK8B 1BAYA 4JR4A 5IMDA 1M99A 3G7YA 5B6NA 4ECCA 1TW9A 2FWEA 4Q5FA 3W6GA 2X99A 5J9CA 5LCZA 1FB6A 1Z6MA 5IMVA 3D22A 1T8EB 3PGTA 5HFIA 4F0CA 3QAWA 1XOAA 2I9HA 5CO3A 2CZ2A 2PMTA 3TJGA 4KW6A 2H1DA 4PUAA 1M9BA 2NDOA 5ELAA 2GS3A 3VURA 4TR1B 2FA4A 4FYBA 2JACA 3DVXA 2C0DA 1T00A 3CTFA 4BA7A 5B8AA 4TR4A 4RI6A 4POMA 1TJDA 1Z7RA 2P5RA 4HZ4A 5COHA 2MMOA 4NPBA 1F3BA 1VRSD 2EIQA 4FH8A 2DJ2A 5D8IA 2GGTA 3IA1A 3I69A 2HZEA 4DSQA 2M72A 4KDYA 4MJCA 4WBJA 2DJ0A 4TN8A 1Z9HA 4X1UA 3LEFA 5C00A 5HQPA 1X5EA 1G0TA 1A0FA 2HRNA 4MZBA 5CYYA 5AIVA 5HR0A 2O89A 1VF3A 3A2VA 1ZZYA 1CQGA 1Y6EA 4LMVA 2R37A 5CRGA 1K0OA 3KD0A 1XBSA 2OJLA 2L4QA 2IPAA 3GRXA 2PWJA 3BOAA 1B48A 4E8HA 4BWSA 2ZNMA 3TRQA 3GMFA 4MA9A 1MEKA 3DMLA 5GZZB 2WFCA 2IMIA 1OE7A 5F0GA 2YWIA 3EMPA 4K0NA 1A2LA 4MK3A 1GUKA 3NOFA 1ZGNA 1Q98A 1OC9B 3FW2A 3CBUA 1XWKA 2AYTA 4JRRA 4K7NA 4J2FA 1FG4A 5DQSA 4KNDA 3TKRA 4KX4A 2B6MA 1MDJA 3D5JA 3O3TA 4HEA2 4JZQA 2I81A 5DCGA 3ZITA 3IV4A 4DEJA 2H66A 3M8NA 4GQCA 2KOKA 1U3AA 3PH9A 5EL8A 2V6OA 2YWOA 5DBQA 4IS0A 3TKSA 4LA1A 4ZL8A 3GX0A 4MF7A 5GSSA 5G1KA 3L4NA 1HNBA 4GTUA 1CQHA 3DYRA 3E0UA 3BCKA 2C1YA 3NZNA 1MD4A 3GIXA 2VLVA 1BX9A 4RI7A 4OWYA 3F8UA 4D73B 1TI3A 4FO5A 6GSSA 4IN0A 1SENA 4RQXA 2JSZA 2ZCTA 4ZL7A 4LMWA 1N8JA 3LQ7A 4GSSA 4JR6A 3GL5A 3H1NA 3QCPA 4PURA 2H6ZA 2MYGA 1EP8A 1ERTA 1GSQA 3L78A 2YP6A 4X43A 1UN2A 2A4VA 4KA0A 3VI7A 1KBNA 4QL7A 3KP8A 5ELGA 2VCWA 5JWRB 3TDGA 1GH2A 2OACA 5IOWA 3U6VA 5J5NA 4XS1A 4EO3A 2VAFA 2CVDA 4ECIA 4MF6A 1TK0B 1SK2A 2WB9A 3W8SA 2OBKA 3CMIA 4HU9A 2WRTA 4HS1A 4WETA 1GNEA 2VLUA 3ZTLA 3H79A 3ZZXA 3CXGA 2BTOT 3C7MA 2VD0A 5J41A 4IVFA 4K1FA 2AJQB 3CRTA 3IR4A 2DC5A 2VCTA 2H6YA 1NM3A 3IAS2 1XZOA 3PR8A 2FA8A 1YY7A 3H8QA 1XWCA 2CVKA 1Z5YE 1GTBA 2NPBA 4L5OA 3FZ9A 2PBJA 5ECLB 2CA8A 5JCWA 1O6JA 3P8WA 6GSXA 1YQ1A 2JSYA 2YJHA 2KHPA 2XBQA 1O85A 1ZYQB 2C3QA 5ECRB
chains in the Genus database with same CATH superfamily
3CYNA 4IW9A 2MZCA 1K0CA 4IKHA 4HZ2A 1XVQA 4TRXA 2CAIA 2CX3A 3IK9A 2OKAA 3A3TA 6GSYA 1QQ2A 1SU9A 4ECJA 5C04A 2GQKA 3CSIA 4Z2TA 4KCEA 1JZWA 1ZMAA 1M2DA 2PVQA 5J3RA 3TKPA 4PQ1A 3TKQA 3A5IA 5CNWA 3KCMA 1V57A 1MDIA 3HVXA 2B3SA 2V6KA 2QSIA 3R2QA 5AGYA 3ZL5A 3ZFLA 1EV9A 3M9KA 2RLIA 2HT9A 5FHIA 2VCZA 5JWQB 2LNSA 2GSTA 5CREA 2RM6A 7GSSA 1X0RA 2GSRA 4MJAA 1EGRA 3UVHA 2DJ3A 1PL1A 3ZRDA 3DVWA 2OE1A 3KEBA 1I5GA 4ZIJA 3P90A 3GH6A 5CAXA 4XS4A 1WP0A 1RW1A 1JLWA 4GWRA 2LKUA 3KH9A 1R26A 1K0NA 1FVJA 1OE8A 3N9JA 2NTOA 2YZHA 1NHYA 3SWLA 1EOGA 4XHMA 1EWXA 5DAKB 3TKSC 2LRCA 5EY6A 4CW9A 4GCIA 2VD1A 1TOFA 4XIHA 4ID0A 1K0AA 2J9HA 5INYA 4NV5A 3HVNA 5JCUA 3QMXA 2JZSA 1DSBA 3I43A 2P0GA 1PD21 1B8XA 4KGIA 3BD2A 4XCSA 4K7OA 2RUFA 4BVYA 2YPMA 3TCOA 5ECSA 2VL2A 3OR5A 4BVXB 1E2YA 2B1KA 1XWGA 3VWWA 1OAZA 4PNGA 5DALB 3D4MA 1OC8A 4V1Ag 5B7CA 4Q5QA 2IFQA 1AW9A 2K18A 4V1Ap 3EINA 3IK7A 3ME7A 2QGVA 5G1LA 4KE3A 1S3CA 2CAQA 3GKMA 3L0HA 1OVNA 4XS6A 1O81A 3QAVA 4EL1A 1YEPA 1YKAA 1TK5B 5HR3A 3MAKA 5IO2A 2HRFA 4MZCA 3CSHA 1F37A 1TRWA 1EGOA 1N2AA 1G6YA 4NAXA 1SJ6A 3MSZA 1VF4A 3KMNA 4MPGA 3LORA 1U6TA 4BWQA 3VK9A 1UC7A 2ON7A 4ZBBA 4E8EA 2RUEA 4Z7XA 4DVCA 1ZL9A 5H5SA 5DQYA 1K0MA 4PQHA 4EDYA 2QA1A 1AXDA 4CDOA 3UVTA 2QC7A 5G5FA 4TR1A 3HZ8A 5LD0A 5ECOB 4V2LA 4CY6A 3APOA 4DSSB 1O8XA 4V2MA 1EEJA 1YZXA 2A2RA 5J9BA 4OD7A 3ED3A 2H30A 3RHBA 3TJFA 1YKCA 4F9ZA 3G7JA 3IC4A 4KSMA 1LJRA 3VWXA 17GSA 1H75A 1GSSA 1WPIA 4WEYA 2R6KA 4IP6A 3O76A 2FD3A 1YDKA 4EIQA 3TRXA 3KIJA 1O8WA 2HLSA 2LRTA 3IXRA 2HRKA 2VLTA 3LFLA 2GT6A 4OCEA 1O7UA 3ZLPA 5G31A 4HUAA 4ACSA 5IMFA 4GLTA 4PTSA 2H1GA 1OYJA 2MMZA 2H6XA 2MBTA 5IPGA 5G30A 4EVMA 3TJBA 1GTAA 1FB0A 1EZKA 1WOUA 2C4JA 3KTLA 2F51A 5ECRB 4QL9A 1XW6A 9GSSA 4ZB6A 3ZVJD 1WJKA 3GSSA 1UA5A 1GLPA 1A0RP 1R5AA 4MLYA 4YQUA 3MIXA 4G0IA 2GZPA 4I2UA 12GSA 3UBLA 3FMWA 5CRDA 1EEMA 1ILOA 2D2ZA 2P31A 3DRNA 1OC9A 3IHQA 4ZB9A 3UAPA 3DXBA 4F82A 2X64A 4KDUA 1PN9A 2F8AA 1XIYA 3J7Yk 3ZMLA 5KN3A 2XPEA 3DEXA 1TU8A 4IQ1A 3VI5A 2AV4A 3TRPA 2CT6A 2FLSA 3GH9A 2IN3A 5BMUA 1PX6A 2HXKA 3UOMA 1VF1A 1ZYPA 3EMXA 1TP9A 3BCIA 22GSA 4ISDA 5D9TA 20GSA 2H1AA 4IP1A 3A2XA 2HSYA 1X9WB 2VL2C 4L5LA 4OO5A 3KJYA 4YQVA 2E0QA 5E59A 4ZBAA 5JCGA 3HVVA 2ON5A 1F2EA 3HKRA 1TRUA 1V40A 3HDCA 4D73A 3QAGA 2TIRA 4H86A 1A24A 2L59A 4OFNA 2P5QA 3LXTA 4RUVA 14GSA 1ERWA 3F4SA 1Z7PA 4NV2A 4O7HA 1VGLA 1ST9A 4MZWA 4IQAA 4Q5NA 1F6MC 4KB3A 2EC4A 3GTUB 1V2AA 4EKZA 5JWOB 3E3EA 2F8FA 1GULA 4WBRD 4F0BA 1JZRA 4EDZA 2FNOA 3VPTA 2VOCA 2H74A 19GSA 1FO5A 1BYEA 3LXZA 4L8EA 5J4UA 2HSHA 4ULXA 3FKFA 3KM6A 2VM2A 2N5AA 1GSYA 2AB6A 4MH2A 4MABA 5FWGA 5D9WA 11GSA 5ECNB 1GSFA 3KH7A 3TGZA 1T7PB 2R2JA 4TR0A 1TXXA 3D4TA 1S3AA 2GQLA 1PMTA 2YN1A 4KF9A 4KUNA 4WXTA 4Z2RA 1SKRB 3P7XA 2O8VB 5G2ZA 3H93A 3MWHA 3CTGA 2V2GA 3E9JB 3TB2A 4FYCA 2PGTA 3TOUA 1OKTA 5KN0A 3A5WA 2H76A 4O32A 1YF0A 5DJLA 1PX7A 1V9WA 5ECIB 1XXUA 4CY8A 2FWHA 4N0ZA 2H0HA 4ZL9A 1SKWB 3F6FA 5ECHB 4N11A 1EP7A 1SL2B 3RPPA 4YAPA 3QDNA 4HJMA 5FT3A 3H4KA 13GSA 3IC8A 1GTIA 3F63A 3M9JA 2CVBA 2DMLA 2JU5A 4ML1A 4MJBA 2VUPA 1M2AA 2IJYA 2A4HA 3I9V2 1ZCPA 2FY6A 1V98A 2C0EA 3KGKA 5ABRA 1GSEA 3FR6A 3ERGA 1ERVA 2IIYA 4V2NA 4TOPA 2LJRA 2GSSA 3FEUA 4NXIA 4HU7A 4AJ7A 2Z9SA 2L5OA 1PGTA 1X5DA 1R4WA 5EPFA 2WJUA 3FY7A 5ECMB 2JADA 3ME8A 4ZXGA 2OA7A 1GL8A 5H5RA 4O92A 2OBIA 3IDVA 3GV1A 1SYRA 4YKFA 4WF4A 3PPUA 3QD9A 2DKHA 3A2WA 2PU9C 1QXHA 3F9UA 3AY8A 2HI7A 1HD2A 1DE1A 1Y25A 1U3IA 1AC1A 2YWNA 4NMUA 4QQ7A 2KLXA 2L5LA 2H0IA 1E6BA 2OADA 3ZMKA 3WGEA 3TOTA 3RAZA 5DAKA 3CSJA 1A23A 1YEXA 4MH3A 3IOSA 1T4ZA 3HJMA 2MMAA 2I3YA 1X5CA 2YJ7A 1XG8A 2XBIA 5IPHA 3WD6A 1Z3EA 1SD8A 2WCIA 3DD3A 1U87A 1XWBA 2B5YA 2GZYA 5IO0A 2UZ8A 2O7KA 2B5EA 1GTUA 3RDWA 4BVXA 1PKZA 2WZ9A 4PXOA 4FIWA 3WGXA 3IRAA 1XFLA 1M7TA 1R7HA 1B9XC 4KH7A 5DALA 1X9SB 5ECKB 1AIUA 3JCML 1RK4A 3EPTA 4F2IA 4BL7B 2GSQA 4KDXA 3GSTA 5F07A 3K8NA 6GSTA 4I2TA 1FVKA 5GAPD 2DJJA 2DBCA 2OE3A 3QOUA 5AIXA 3GFKA 2YNXA 5EVOA 2VCQA 1XPVA 1WIKA 1F9MA 4PQIA 1OKDA 2O87A 1J08A 3HJOA 1K0BA 1M0UA 2DIZA 3GURA 4K0GA 3TKSE 2DMMA 3UL3A 2XPDA 4POLA 2LSTA 4IJIA 4IHUA 2X49A 1PQNA 2R3XA 3KXOA 1SYXA 5KN1A 5KEJA 5H5QA 1ABAA 4G9HA 3GA4A 3EURA 1SL0B 2HSMA 3W8JA 3ZIVA 3NIVA 2L57A 4AGSA 4OFMA 1WRYA 1SK0A 1W89A 1AUCA 2XHFA 3EU4A 1SJZA 4MPFA 4ML6A 1QFNA 1GWCA 3KMOA 3MNGA 4G19A 4HQSA 2IFQB 4G2EA 5D9VA 3US3A 4DSSA 3UARA 3IAM2 4LL4B 5D9XA 2WULA 4DSRA 5DVBA 4HJ2A 1IYHA 1K3LA 1ML6A 2H71A 4EC0A 1ON4A 2ES7A 6GSWA 4GXZA 2YCDA 4TKYA 5GSTA 2GTUA 4ICYA 2H1BA 2HRAA 1GRXA 4RQRA 4TXOB 2ALBA 3APSA 1B9YC 3D21A 1NSWA 3MDKA 2G2QA 5CRHA 2LJKA 3QR6A 1JZOA 3Q74A 1BJXA 4WR5A 3RPNA 1K0DA 4GRFA 5ID2B 4J57E 4A5PA 2RM5A 4I97A 1THOA 1KTEA 4USSA 5AN1A 4P3YB 4YAVA 2DLXA 4GSTA 3VPQA 2KP2A 2MBSA 3EC3A 2HYXA 4OFTA 4O5RA 3VLNA 4EE0A 3L9SA 4EXJA 1S3DA 3TUEA 2WDUA 1WMJA 2GDRA 2IMFA 3LG6A 3BBYA 2B7JA 1F3AA 3C71A 5A4UA 2TRCP 2ZUPA 2N5FA 2FHEA 1TDIA 3HZ4A 2FWGA 2N5BA 2LQQA 2LEGA 1A2JA 3ERWA 3IHGA 4TXVA 2IMDA 1JZDA 1ZYEA 4XRAA 1BQ7A 1GNWA 2YANA 3F4TA 5DJMA 2F9SA 2H73A 5IIZA 2K9FA 4TR3A 3EYTA 1FAAA 1TI1A 2RIIA 4JU5A 1GUHA 1JLVA 4IBPA 1QGVA 4WR4A 4L0WA 3FR9A 2NBSA 2HZEB 4PUFC 4EF0A 4FQUA 3WT1A 3FZAA 1PL2A 4G10A 3S9FA 2AAWA 4AF2A 1O73A 3QFAC 3KZQA 16GSA 3F3RA 3Q6OA 2L6DA 4FYUA 2AHEA 3D0ZA 3RHCA 3HY2A 2EIOA 3CRUA 4X4JA 3VWUA 4EIPA 2V1MA 3M3MA 1DE2A 3GYKA 3LYPA 1TRVA 8GSSA 2F3MA 1G7OA 4POKA 2IMEA 1ZYNA 4K6XA 3U5RE 2R4VA 3EVIA 3L9UA 4WKWA 4IELA 3GTUA 5IMAA 5IMZA 1B4QA 2H8LA 4YQMA 5IQYA 3FHKA 4ECBA 4OMVA 3F0IA 4PX1A 1FOHA 2YZUA 2H75A 2X4AA 4N10A 4LLRA 1TU7A 5ECQB 2YOIA 1H4OA 2FUG2 1R5PA 3ZYWA 2FWFA 1M2BA 1ZOFA 5CRWA 4K5RA 4CHSA 2I4AA 4AJ8A 2L6CA 2GT5A 3ZVJA 2H19A 3HCZA 2DJKA 4ZILA 3Q18A 5GAND 1LU4A 4MJEA 2PPTA 3WT2A 4N0VA 2PERA 1J0FA 2E7PA 2YV9A 3HXSA 1PN0A 1WE0A 3FRCA 3UIWA 5A4VA 1JHBA 3LJRA 2H01A 3C1SA 1T3BA 4K2XA 4MNNA 4IGJA 4KCAA 3DWVA 1G7EA 1XWAA 1HNAA 3G9BA 4NHWA 3QFBC 3F6DA 2DIYA 4PNFA 3EU3A 4K7IA 2CX4A 2YWMA 3IPZA 1LBKA 4GSNA 2VCVA 3HD5A 5KOXA 3FK8A 5B8BA 1X9MB 2KUCA 1YF1A 3GKNA 2G0FA 2R5GA 2V41A 3CQFA 2C8UA 2H70A 4OCFA 2YV7A 2HE3A 1A8LA 1GSDA 2CV4A 3Q19A 4K9ZA 3UMAA 3LGCA 5ENUA 3V1WA 1M9AA 1UVZA 3VFIA 4BPYA 4TVEA 1MD3A 1WWJA 3ISOA 3LW9A 3KP9A 2PUKC 1MTCA 5D96A 1QUWA 4JBBA 4YH2A 4F03A 1YJ6A 2HFDA 3EE2A 1W4VA 2B1LA 5G5EA 2B5XA 1NW2A 2LJAA 4ILFA 3J7Yb 3PINA 2REMA 10GSA 3QPMA 4GF0A 1HYUA 3GKKA 5F8BA 1FW1A 4JE1A 4ZBDA 2C3NA 3HJPA 4MCUA 1PFOA 1J9BA 3GL3A 1TRSA 2A2PA 1MDKA 2WS2A 1GP1A 2LV3A 2JL4A 4K8MA 1G6WA 1SKSB 3G7IA 1XVWA 3LYKA 3ZIJA 2I1UA 1USBA 2VM1A 2LNTA 5DCHA 1FHEA 3L9VA 4MF5A 3WGDA 1PSQA 3TJKA 4TW5A 3GN3A 2QKEA 1XCCA 2WGRA 1TTZA 3APQA 1HNCA 3IE3A 1ERUA 4HSCX 4BIKA 4KAEA 3SBCA 2PN8A 4L0UA 4O5UA 1GLQA 2HNLA 1Q4JA 2L4CA 1URMA 2LTKA 1XW9A 5F05A 1AQXA 2BJXA 1M3IA 2XC2A 5HFGA 3UEMA 4HDEA 4GQFA 4JEDA 3C8EA 3F3QA 3F4RA 3M1GA 5A4WA 2AUVA 2M80A 6GSVA 4NHZA 5F06A 6GSUA 1V58A 3GKXA 4I5QA 2VL9A 3HVSA 1HQOA 4MMMA 4N30A 1EOHA 5IOXA 3UJ1A 2H0GA 1JFUA 1GUMA 1SK1A 5ECPB 2LUSA 1K3OA 2QA2A 3KTBA 3DKSA 3LSZA 1A2MA 2B7KA 1NHOA 1ACVA 4XRDA 2DJ1A 2VIMA 1IYIA 2C3TA 5HR2A 1KEBA 1SD9A 2DKIA 2LQOA 4BL7A 1DUGA 3GHAA 3R3EA 2GLRA 2VL3A 2J23A 2IMKA 18GSA 2FCHA 3FZ5A 2EIRA 1VF2A 5B6MA 2X8GA 2GVPA 1A8YA 3FZ4A 2TRXA 2LS5A 4IJ3A 4K2DA 2KP1A 2PVOC 3FR3A 3ZFBA 1RQMA 5E4WA 4EUYA 3RBTA 1AAZA 2H72A 2NVLA 1SL1B 4MP4A 1U88A 1QMVA 3TJJA 3UBKA 2K6VA 1I9DA 3VWVA 3C1RA 3GUSA 2VCXA 2C80A 5IM9A 1Z6NA 1S3RA 1KNGA 4XS4B 4POBA 2FGXA 1PKWA 2JZRA 2CZ3A 3DGQA 5HR1A 4XTSA 5AISA 1AQVA 3BJ5A 1GSUA 4KSOA 5DDLA 3WYWA 4I6XA 1THXA 1OC3A 1EV4A 3HA9A 2GQMA 2M46A 5L71A 1B4PA 1T1VA 1AQWA 1QK8A 2C0FA 1XW5A 2CQ9A 4MDCA 3M0FA 5LNKe 3MYDA 2IWTA 1SJIA 5CP1A 1FOVA 1PA3A 3O6TA 5BRTA 3FYGA 4HQZA 2OE0A 3ERFA 1DBYA 4WF5A 4HOJA 5KN2A 4BVYB 4HI7A 2O85A 2E2MA 5D73A 2E2GA 1BG5A 3C73A 4I8BA 4NWYA 4AJ6A 3I6AA 2V32A 5HFKA 2K8VA 2MMNA 3HHVA 2X8HA 1BEDA 4TXOA 3N5OA 4ZB8A 4PGTA 5D93A 3IBHA 1K3YA 2HZFA 1T4YA 1C72A 3GX8A 3DIEA 2LRNA 2IL3A 3P2AA 2VO4A 3GNJA 2DSAA 2X8CA 4OO4A 5A5KA 4J56E 3EWLA 5ID2A 2BMXA 2GZZA 4X0XA 5IMCA 4LL1B 4Q5RA 2JZTA 3D6IA 1PRXA 1XOBA 2A2SA 1TKDB 3ZREA 2K8SA 3LWAA 3HYPA 1TK8B 1BAYA 4JR4A 4YKGA 5IMDA 1M99A 3G7YA 5B6NA 4ECCA 1TW9A 2FWEA 4Q5FA 3W6GA 2X99A 5J9CA 5LCZA 1FB6A 1Z6MA 5IMVA 3D22A 1T8EB 3PGTA 5HFIA 4F0CA 3QAWA 1XOAA 2I9HA 5CO3A 2CZ2A 2PMTA 3TJGA 4KW6A 2H1DA 4PUAA 1M9BA 2NDOA 5ELAA 2GS3A 3VURA 4TR1B 2FA4A 4FYBA 2JACA 3DVXA 2C0DA 1T00A 3CTFA 4BA7A 5B8AA 4TR4A 4RI6A 4POMA 1TJDA 1Z7RA 2P5RA 4HZ4A 5COHA 2MMOA 4NPBA 1F3BA 1VRSD 2EIQA 4FH8A 2DJ2A 5D8IA 2GGTA 3IA1A 3I69A 2HZEA 4DSQA 2M72A 4KDYA 4MJCA 4WBJA 2DJ0A 4TN8A 1Z9HA 4X1UA 3LEFA 5C00A 5HQPA 1X5EA 1G0TA 1A0FA 2HRNA 4MZBA 5CYYA 5AIVA 5HR0A 2O89A 1VF3A 3A2VA 1ZZYA 1CQGA 1Y6EA 4LMVA 2R37A 5CRGA 1K0OA 3KD0A 4O5QA 1XBSA 2OJLA 2L4QA 2IPAA 3GRXA 2PWJA 3BOAA 1B48A 4E8HA 4K5SA 4BWSA 2ZNMA 3TRQA 3GMFA 4MA9A 1MEKA 3DMLA 5GZZB 2WFCA 2IMIA 1OE7A 5F0GA 2YWIA 3EMPA 4K0NA 1A2LA 4MK3A 1GUKA 3NOFA 1ZGNA 1Q98A 1OC9B 3FW2A 3CBUA 1XWKA 2AYTA 4JRRA 4K7NA 4J2FA 1FG4A 5DQSA 4KNDA 3TKRA 4KX4A 2B6MA 1MDJA 3D5JA 3O3TA 4HEA2 4JZQA 2I81A 5DCGA 3ZITA 4Z2UA 3IV4A 4DEJA 2H66A 3M8NA 4GQCA 4G0KA 2KOKA 1U3AA 3PH9A 5EL8A 2V6OA 2YWOA 5DBQA 4IS0A 3TKSA 4LA1A 4ZL8A 3GX0A 4MF7A 5GSSA 5G1KA 3L4NA 1HNBA 4GTUA 1CQHA 3DYRA 3E0UA 3BCKA 2C1YA 3NZNA 1MD4A 3GIXA 2VLVA 1BX9A 4RI7A 4OWYA 3F8UA 4D73B 1TI3A 4FO5A 6GSSA 4IN0A 1SENA 4RQXA 2JSZA 2ZCTA 4ZL7A 4LMWA 1N8JA 3LQ7A 4GSSA 4JR6A 4G0LA 3GL5A 3H1NA 3QCPA 4PURA 2R0PA 2H6ZA 2MYGA 1EP8A 1ERTA 1GSQA 3L78A 2YP6A 4X43A 1UN2A 2A4VA 4KA0A 3VI7A 1KBNA 4QL7A 3KP8A 5ELGA 2VCWA 5JWRB 3TDGA 1GH2A 2OACA 5IOWA 3U6VA 5J5NA 4XS1A 5KOWA 4EO3A 2VAFA 2CVDA 4ECIA 4MF6A 1TK0B 1SK2A 2WB9A 3W8SA 2OBKA 3CMIA 4HU9A 2WRTA 4HS1A 4WETA 1GNEA 2VLUA 3ZTLA 3H79A 3ZZXA 3CXGA 2BTOT 2R0GA 3C7MA 2VD0A 5J41A 4IVFA 1M3JA 4K1FA 2AJQB 3CRTA 3IR4A 2DC5A 2VCTA 2H6YA 1NM3A 3IAS2 2R0CA 1XZOA 3PR8A 2FA8A 1YY7A 3H8QA 1XWCA 2CVKA 1Z5YE 1GTBA 2NPBA 4L5OA 3FZ9A 2PBJA 5ECLB 2CA8A 5JCWA 1O6JA 3P8WA 6GSXA 1YQ1A 2JSYA 2YJHA 2KHPA 2XBQA 1O85A 1ZYQB 2C3QA 2C0GA
chains in the Genus database with same CATH topology
3CYNA 4IW9A 2MZCA 1K0CA 4IKHA 4HZ2A 1XVQA 4TRXA 2CAIA 2CX3A 3IK9A 2OKAA 3A3TA 6GSYA 1QQ2A 1SU9A 4ECJA 5C04A 2GQKA 3CSIA 4Z2TA 4KCEA 1JZWA 1ZMAA 1M2DA 2PVQA 5J3RA 3TKPA 4PQ1A 3TKQA 3A5IA 5CNWA 3KCMA 1V57A 1MDIA 3HVXA 2B3SA 2V6KA 2QSIA 3R2QA 5AGYA 3ZL5A 3ZFLA 1EV9A 3M9KA 2RLIA 2HT9A 5FHIA 2VCZA 5JWQB 2LNSA 2GSTA 5CREA 2RM6A 7GSSA 1X0RA 2GSRA 4MJAA 1EGRA 3UVHA 2DJ3A 1PL1A 3ZRDA 3DVWA 2OE1A 3KEBA 1I5GA 4ZIJA 3P90A 3GH6A 5CAXA 4XS4A 1WP0A 1RW1A 1JLWA 4GWRA 2LKUA 3KH9A 1R26A 1K0NA 1FVJA 1OE8A 3N9JA 2NTOA 2YZHA 1NHYA 3SWLA 1EOGA 4XHMA 1EWXA 5DAKB 3TKSC 2LRCA 5EY6A 4CW9A 4GCIA 2VD1A 1TOFA 4XIHA 4ID0A 1K0AA 2J9HA 5INYA 4NV5A 5JCUA 3QMXA 2JZSA 1DSBA 3I43A 2P0GA 1PD21 1B8XA 4KGIA 3BD2A 4XCSA 4K7OA 2RUFA 4BVYA 2YPMA 3TCOA 5ECSA 2VL2A 3OR5A 4BVXB 1E2YA 2B1KA 1XWGA 3VWWA 1OAZA 4PNGA 5DALB 3D4MA 1OC8A 4V1Ag 5B7CA 4Q5QA 2IFQA 1AW9A 2K18A 4V1Ap 3EINA 3IK7A 3ME7A 2QGVA 5G1LA 4KE3A 1S3CA 2CAQA 3GKMA 3L0HA 1OVNA 4XS6A 1O81A 3QAVA 4EL1A 1YEPA 1YKAA 1TK5B 5HR3A 3MAKA 5IO2A 2HRFA 4MZCA 3CSHA 1F37A 1TRWA 1EGOA 1N2AA 1G6YA 4NAXA 1SJ6A 3MSZA 1VF4A 3KMNA 4MPGA 3LORA 1U6TA 4BWQA 3VK9A 1UC7A 2ON7A 4ZBBA 4E8EA 2RUEA 4Z7XA 4DVCA 1ZL9A 5H5SA 5DQYA 1K0MA 4PQHA 4EDYA 2QA1A 1AXDA 4CDOA 3UVTA 2QC7A 5G5FA 4TR1A 3HZ8A 5LD0A 5ECOB 4V2LA 4CY6A 3APOA 4DSSB 1O8XA 4V2MA 1EEJA 1YZXA 2A2RA 5J9BA 4OD7A 3ED3A 2H30A 3RHBA 3TJFA 1YKCA 4F9ZA 3G7JA 3IC4A 4KSMA 1LJRA 3VWXA 17GSA 1H75A 1GSSA 1WPIA 4WEYA 2R6KA 4IP6A 3O76A 2FD3A 1YDKA 4EIQA 3TRXA 3KIJA 1O8WA 2HLSA 2LRTA 3IXRA 2HRKA 2VLTA 3LFLA 2GT6A 4OCEA 1O7UA 3ZLPA 5G31A 4HUAA 4ACSA 5IMFA 4GLTA 4PTSA 2H1GA 1OYJA 2MMZA 2H6XA 2MBTA 5IPGA 5G30A 4EVMA 3TJBA 1GTAA 1FB0A 1EZKA 1WOUA 2C4JA 3KTLA 2F51A 5ECRB 4QL9A 1XW6A 9GSSA 4ZB6A 3ZVJD 1WJKA 3GSSA 1UA5A 1GLPA 1A0RP 1R5AA 4MLYA 4YQUA 3MIXA 4G0IA 2GZPA 4I2UA 12GSA 3UBLA 3FMWA 5CRDA 1EEMA 1ILOA 2D2ZA 2P31A 3DRNA 1OC9A 3IHQA 4ZB9A 3UAPA 3DXBA 4F82A 2X64A 4KDUA 1PN9A 2F8AA 1XIYA 3J7Yk 3ZMLA 5KN3A 2XPEA 3DEXA 1TU8A 4IQ1A 3VI5A 2AV4A 3TRPA 2CT6A 2FLSA 3GH9A 2IN3A 5BMUA 1PX6A 2HXKA 3UOMA 1VF1A 1ZYPA 3EMXA 1TP9A 3BCIA 22GSA 4ISDA 5D9TA 20GSA 2H1AA 4IP1A 3A2XA 2HSYA 1X9WB 2VL2C 4L5LA 4OO5A 3KJYA 4YQVA 2E0QA 5E59A 4ZBAA 5JCGA 3HVVA 2ON5A 1F2EA 3HKRA 1TRUA 1V40A 3HDCA 4D73A 3QAGA 2TIRA 4H86A 1A24A 2L59A 4OFNA 2P5QA 3LXTA 4RUVA 14GSA 1ERWA 3F4SA 1Z7PA 4NV2A 4O7HA 1VGLA 1ST9A 4MZWA 4IQAA 4Q5NA 1F6MC 4KB3A 2EC4A 3GTUB 1V2AA 4EKZA 5JWOB 3E3EA 2F8FA 1GULA 4WBRD 4F0BA 1JZRA 4EDZA 2FNOA 3VPTA 2VOCA 2H74A 19GSA 1FO5A 1BYEA 3LXZA 4L8EA 5J4UA 2HSHA 4ULXA 3FKFA 3KM6A 2VM2A 2N5AA 1GSYA 2AB6A 4MH2A 4MABA 5FWGA 5D9WA 11GSA 5ECNB 1GSFA 3KH7A 3TGZA 1T7PB 2R2JA 4TR0A 1TXXA 3D4TA 1S3AA 2GQLA 1PMTA 2YN1A 4KF9A 4KUNA 4WXTA 4Z2RA 1SKRB 3P7XA 2O8VB 5G2ZA 3H93A 3MWHA 3CTGA 2V2GA 3E9JB 3TB2A 4FYCA 2PGTA 3TOUA 1OKTA 5KN0A 3A5WA 2H76A 4O32A 1YF0A 5DJLA 1PX7A 1V9WA 5ECIB 1XXUA 4CY8A 2FWHA 4N0ZA 2H0HA 4ZL9A 1SKWB 3F6FA 5ECHB 4N11A 1EP7A 1SL2B 3RPPA 4YAPA 3QDNA 4HJMA 5FT3A 3H4KA 13GSA 3IC8A 1GTIA 3F63A 3M9JA 2CVBA 2DMLA 2JU5A 4ML1A 4MJBA 2VUPA 1M2AA 2IJYA 2A4HA 3I9V2 1ZCPA 2FY6A 1V98A 2C0EA 3KGKA 5ABRA 1GSEA 3FR6A 3ERGA 1ERVA 2IIYA 4V2NA 4TOPA 2LJRA 2GSSA 3FEUA 4NXIA 4HU7A 4AJ7A 2Z9SA 2L5OA 1PGTA 1X5DA 1R4WA 5EPFA 2WJUA 3FY7A 5ECMB 2JADA 3ME8A 4ZXGA 2OA7A 1GL8A 5H5RA 4O92A 2OBIA 3IDVA 3GV1A 1SYRA 4YKFA 4WF4A 3PPUA 3QD9A 2DKHA 3A2WA 2PU9C 1QXHA 3F9UA 3AY8A 2HI7A 1HD2A 1DE1A 1Y25A 1U3IA 1AC1A 2YWNA 4NMUA 4QQ7A 2KLXA 2L5LA 2H0IA 1E6BA 2OADA 3ZMKA 3WGEA 3TOTA 3RAZA 5DAKA 3CSJA 1A23A 1YEXA 4MH3A 3IOSA 1T4ZA 3HJMA 2MMAA 2I3YA 1X5CA 2YJ7A 2XBIA 5IPHA 3WD6A 1Z3EA 1SD8A 2WCIA 3DD3A 1U87A 1XWBA 2B5YA 2GZYA 5IO0A 2UZ8A 2O7KA 2B5EA 1GTUA 3RDWA 4BVXA 1PKZA 2WZ9A 4PXOA 4FIWA 3WGXA 3IRAA 1XFLA 1M7TA 1R7HA 1B9XC 4KH7A 5DALA 1X9SB 5ECKB 1AIUA 3JCML 1RK4A 3EPTA 4F2IA 4BL7B 2GSQA 4KDXA 3GSTA 5F07A 3K8NA 6GSTA 4I2TA 1FVKA 5GAPD 2DJJA 2DBCA 2OE3A 3QOUA 5AIXA 3GFKA 2YNXA 5EVOA 2VCQA 1XPVA 1WIKA 1F9MA 4PQIA 1OKDA 2O87A 1J08A 3HJOA 1K0BA 1M0UA 2DIZA 3GURA 4K0GA 3TKSE 2DMMA 3UL3A 2XPDA 4POLA 2LSTA 4IJIA 4IHUA 2X49A 1PQNA 2R3XA 3KXOA 1SYXA 5KN1A 5KEJA 5H5QA 1ABAA 4G9HA 3GA4A 3EURA 1SL0B 2HSMA 3W8JA 3ZIVA 3NIVA 2L57A 4AGSA 4OFMA 1WRYA 1SK0A 1W89A 1AUCA 2XHFA 3EU4A 1SJZA 4MPFA 4ML6A 1QFNA 1GWCA 3KMOA 3MNGA 4G19A 4HQSA 2IFQB 4G2EA 5D9VA 3US3A 4DSSA 3UARA 3IAM2 4LL4B 5D9XA 2WULA 4DSRA 5DVBA 4HJ2A 1IYHA 1K3LA 1ML6A 2H71A 4EC0A 1ON4A 2ES7A 6GSWA 4GXZA 2YCDA 4TKYA 5GSTA 2GTUA 4ICYA 2H1BA 2HRAA 1GRXA 4RQRA 4TXOB 2ALBA 3APSA 1B9YC 3D21A 1NSWA 3MDKA 2G2QA 5CRHA 2LJKA 3QR6A 1JZOA 3Q74A 1BJXA 4WR5A 3RPNA 1K0DA 4GRFA 5ID2B 4J57E 4A5PA 2RM5A 4I97A 1THOA 1KTEA 4USSA 5AN1A 4P3YB 4YAVA 2DLXA 4GSTA 3VPQA 2KP2A 2MBSA 3EC3A 2HYXA 4OFTA 4O5RA 3VLNA 4EE0A 3L9SA 4EXJA 1S3DA 3TUEA 2WDUA 1WMJA 2GDRA 2IMFA 3LG6A 3BBYA 2B7JA 1F3AA 3C71A 5A4UA 2TRCP 2ZUPA 2N5FA 2FHEA 1TDIA 3HZ4A 2FWGA 2N5BA 2LQQA 2LEGA 1A2JA 3ERWA 3IHGA 4TXVA 2IMDA 1JZDA 1ZYEA 4XRAA 1BQ7A 1GNWA 2YANA 3F4TA 5DJMA 2F9SA 2H73A 5IIZA 2K9FA 4TR3A 3EYTA 1FAAA 1TI1A 2RIIA 4JU5A 1GUHA 1JLVA 4IBPA 1QGVA 4WR4A 4L0WA 3FR9A 2NBSA 2HZEB 4PUFC 4EF0A 4FQUA 3WT1A 3FZAA 1PL2A 4G10A 3S9FA 2AAWA 4AF2A 1O73A 3QFAC 3KZQA 16GSA 3F3RA 3Q6OA 2L6DA 4FYUA 2AHEA 3D0ZA 3RHCA 3HY2A 2EIOA 3CRUA 4X4JA 3VWUA 4EIPA 2V1MA 3M3MA 1DE2A 3GYKA 3LYPA 1TRVA 8GSSA 2F3MA 1G7OA 4POKA 2IMEA 1ZYNA 4K6XA 3U5RE 2R4VA 3EVIA 3L9UA 4WKWA 4IELA 3GTUA 5IMAA 5IMZA 1B4QA 2H8LA 4YQMA 5IQYA 3FHKA 4ECBA 4OMVA 3F0IA 4PX1A 1FOHA 2YZUA 2H75A 2X4AA 4N10A 4LLRA 1TU7A 5ECQB 2YOIA 1H4OA 2FUG2 1R5PA 3ZYWA 2FWFA 1M2BA 1ZOFA 5CRWA 4K5RA 4CHSA 2I4AA 4AJ8A 2L6CA 2GT5A 3ZVJA 2H19A 3HCZA 2DJKA 4ZILA 3Q18A 5GAND 1LU4A 4MJEA 2PPTA 3WT2A 4N0VA 2PERA 1J0FA 2E7PA 2YV9A 3HXSA 1PN0A 1WE0A 3FRCA 3UIWA 5A4VA 1JHBA 3LJRA 2H01A 3C1SA 1T3BA 4K2XA 4MNNA 4IGJA 4KCAA 3DWVA 1G7EA 1XWAA 1HNAA 3G9BA 4NHWA 3QFBC 3F6DA 2DIYA 4PNFA 3EU3A 4K7IA 2CX4A 2YWMA 3IPZA 1LBKA 4GSNA 2VCVA 3HD5A 5KOXA 3FK8A 5B8BA 1X9MB 2KUCA 1YF1A 3GKNA 2G0FA 2R5GA 2V41A 2C8UA 2H70A 4OCFA 2YV7A 2HE3A 1A8LA 1GSDA 2CV4A 3Q19A 4K9ZA 3UMAA 3LGCA 5ENUA 3V1WA 1M9AA 1UVZA 3VFIA 4BPYA 4TVEA 1MD3A 1WWJA 3ISOA 3LW9A 3KP9A 2PUKC 1MTCA 5D96A 1QUWA 4JBBA 4YH2A 4F03A 1YJ6A 2HFDA 3EE2A 1W4VA 2B1LA 5G5EA 2B5XA 1NW2A 2LJAA 4ILFA 3J7Yb 3PINA 2REMA 10GSA 3QPMA 4GF0A 1HYUA 3GKKA 5F8BA 1FW1A 4JE1A 4ZBDA 2C3NA 3HJPA 4MCUA 1J9BA 3GL3A 1TRSA 2A2PA 1MDKA 2WS2A 1GP1A 2LV3A 2JL4A 4K8MA 1G6WA 1SKSB 3G7IA 1XVWA 3LYKA 3ZIJA 2I1UA 1USBA 2VM1A 2LNTA 5DCHA 1FHEA 3L9VA 4MF5A 3WGDA 1PSQA 3TJKA 4TW5A 3GN3A 2QKEA 1XCCA 2WGRA 1TTZA 3APQA 1HNCA 3IE3A 1ERUA 4KAEA 3SBCA 2PN8A 4L0UA 4O5UA 1GLQA 2HNLA 1Q4JA 2L4CA 1URMA 2LTKA 1XW9A 5F05A 1AQXA 2BJXA 2XC2A 5HFGA 3UEMA 4HDEA 4GQFA 4JEDA 3C8EA 3F3QA 3F4RA 3M1GA 5A4WA 2AUVA 2M80A 6GSVA 4NHZA 5F06A 6GSUA 1V58A 3GKXA 4I5QA 2VL9A 3HVSA 1HQOA 4MMMA 4N30A 1EOHA 5IOXA 3UJ1A 2H0GA 1JFUA 1GUMA 1SK1A 5ECPB 2LUSA 1K3OA 2QA2A 3KTBA 3DKSA 3LSZA 1A2MA 2B7KA 1NHOA 1ACVA 4XRDA 2DJ1A 2VIMA 1IYIA 2C3TA 5HR2A 1KEBA 1SD9A 2DKIA 2LQOA 4BL7A 1DUGA 3GHAA 3R3EA 2GLRA 2VL3A 2J23A 2IMKA 18GSA 2FCHA 3FZ5A 2EIRA 1VF2A 5B6MA 2X8GA 2GVPA 1A8YA 3FZ4A 2TRXA 2LS5A 4IJ3A 4K2DA 2KP1A 2PVOC 3FR3A 3ZFBA 1RQMA 5E4WA 4EUYA 3RBTA 1AAZA 2H72A 2NVLA 1SL1B 4MP4A 1U88A 1QMVA 3TJJA 3UBKA 2K6VA 1I9DA 3VWVA 3C1RA 3GUSA 2VCXA 2C80A 5IM9A 1Z6NA 1KNGA 4XS4B 4POBA 2FGXA 1PKWA 2JZRA 2CZ3A 3DGQA 5HR1A 4XTSA 5AISA 1AQVA 3BJ5A 1GSUA 4KSOA 5DDLA 3WYWA 4I6XA 1THXA 1OC3A 1EV4A 3HA9A 2GQMA 2M46A 5L71A 1B4PA 1T1VA 1AQWA 1QK8A 2C0FA 1XW5A 2CQ9A 4MDCA 3M0FA 5LNKe 3MYDA 2IWTA 1SJIA 5CP1A 1FOVA 1PA3A 3O6TA 5BRTA 3FYGA 4HQZA 2OE0A 3ERFA 1DBYA 4WF5A 4HOJA 5KN2A 4BVYB 4HI7A 2O85A 2E2MA 5D73A 2E2GA 1BG5A 3C73A 4I8BA 4NWYA 4AJ6A 3I6AA 2V32A 5HFKA 2K8VA 2MMNA 3HHVA 2X8HA 1BEDA 4TXOA 3N5OA 4ZB8A 4PGTA 5D93A 3IBHA 1K3YA 2HZFA 1T4YA 1C72A 3GX8A 3DIEA 2LRNA 2IL3A 3P2AA 2VO4A 3GNJA 2DSAA 2X8CA 4OO4A 5A5KA 4J56E 3EWLA 5ID2A 2BMXA 2GZZA 4X0XA 5IMCA 4LL1B 4Q5RA 2JZTA 3D6IA 1PRXA 1XOBA 2A2SA 1TKDB 3ZREA 2K8SA 3LWAA 3HYPA 1TK8B 1BAYA 4JR4A 4YKGA 5IMDA 1M99A 3G7YA 5B6NA 4ECCA 1TW9A 2FWEA 4Q5FA 3W6GA 2X99A 5J9CA 5LCZA 1FB6A 1Z6MA 5IMVA 3D22A 1T8EB 3PGTA 5HFIA 4F0CA 3QAWA 1XOAA 2I9HA 5CO3A 2CZ2A 2PMTA 3TJGA 4KW6A 2H1DA 4PUAA 1M9BA 2NDOA 5ELAA 2GS3A 3VURA 4TR1B 2FA4A 4FYBA 2JACA 3DVXA 2C0DA 1T00A 3CTFA 4BA7A 5B8AA 4TR4A 4RI6A 4POMA 1TJDA 1Z7RA 2P5RA 4HZ4A 5COHA 2MMOA 4NPBA 1F3BA 1VRSD 2EIQA 4FH8A 2DJ2A 5D8IA 2GGTA 3IA1A 3I69A 2HZEA 4DSQA 2M72A 4KDYA 4MJCA 4WBJA 2DJ0A 4TN8A 1Z9HA 4X1UA 3LEFA 5C00A 5HQPA 1X5EA 1G0TA 1A0FA 2HRNA 4MZBA 5CYYA 5AIVA 5HR0A 2O89A 1VF3A 3A2VA 1ZZYA 1CQGA 1Y6EA 4LMVA 2R37A 5CRGA 1K0OA 3KD0A 4O5QA 1XBSA 2OJLA 2L4QA 2IPAA 3GRXA 2PWJA 3BOAA 1B48A 4E8HA 4K5SA 4BWSA 2ZNMA 3TRQA 3GMFA 4MA9A 1MEKA 3DMLA 5GZZB 2WFCA 2IMIA 1OE7A 5F0GA 2YWIA 3EMPA 4K0NA 1A2LA 4MK3A 1GUKA 3NOFA 1ZGNA 1Q98A 1OC9B 3FW2A 3CBUA 1XWKA 2AYTA 4JRRA 4K7NA 4J2FA 1FG4A 5DQSA 4KNDA 3TKRA 4KX4A 2B6MA 1MDJA 3D5JA 3O3TA 4HEA2 4JZQA 2I81A 5DCGA 3ZITA 4Z2UA 3IV4A 4DEJA 2H66A 3M8NA 4GQCA 4G0KA 2KOKA 1U3AA 3PH9A 5EL8A 2V6OA 2YWOA 5DBQA 4IS0A 3TKSA 4LA1A 4ZL8A 3GX0A 4MF7A 5GSSA 5G1KA 3L4NA 1HNBA 4GTUA 1CQHA 3DYRA 3E0UA 3BCKA 2C1YA 3NZNA 1MD4A 3GIXA 2VLVA 1BX9A 4RI7A 4OWYA 3F8UA 4D73B 1TI3A 4FO5A 6GSSA 4IN0A 1SENA 4RQXA 2JSZA 2ZCTA 4ZL7A 4LMWA 1N8JA 3LQ7A 4GSSA 4JR6A 4G0LA 3GL5A 3H1NA 3QCPA 4PURA 2R0PA 2H6ZA 2MYGA 1EP8A 1ERTA 1GSQA 3L78A 2YP6A 4X43A 1UN2A 2A4VA 4KA0A 3VI7A 1KBNA 4QL7A 3KP8A 5ELGA 2VCWA 5JWRB 3TDGA 1GH2A 2OACA 5IOWA 3U6VA 5J5NA 4XS1A 5KOWA 4EO3A 2VAFA 2CVDA 4ECIA 4MF6A 1TK0B 1SK2A 2WB9A 3W8SA 2OBKA 3CMIA 4HU9A 2WRTA 4HS1A 4WETA 1GNEA 2VLUA 3ZTLA 3H79A 3ZZXA 3CXGA 2BTOT 2R0GA 3C7MA 2VD0A 5J41A 4IVFA 4K1FA 2AJQB 3CRTA 3IR4A 2DC5A 2VCTA 2H6YA 1NM3A 3IAS2 2R0CA 1XZOA 3PR8A 2FA8A 1YY7A 3H8QA 1XWCA 2CVKA 1Z5YE 1GTBA 2NPBA 4L5OA 3FZ9A 2PBJA 5ECLB 2CA8A 5JCWA 1O6JA 3P8WA 6GSXA 1YQ1A 2JSYA 2YJHA 2KHPA 2XBQA 1O85A 1ZYQB 2C3QA 2C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYN A;  4IW9 A;  2MZC A;  1K0C A;  4IKH A;  4HZ2 A;  1XVQ A;  4TRX A;  2CAI A;  2CX3 A;  3IK9 A;  2OKA A;  3A3T A;  6GSY A;  1QQ2 A;  1SU9 A;  4ECJ A;  5C04 A;  2GQK A;  3CSI A;  4KCE A;  1JZW A;  1ZMA A;  1M2D A;  2PVQ A;  5J3R A;  3TKP A;  4PQ1 A;  3TKQ A;  5CNW A;  3KCM A;  1V57 A;  1MDI A;  3HVX A;  2B3S A;  2V6K A;  2QSI A;  3R2Q A;  5AGY A;  3ZL5 A;  3ZFL A;  1EV9 A;  3M9K A;  2RLI A;  2HT9 A;  5FHI A;  2VCZ A;  5JWQ B;  2LNS A;  2GST A;  5CRE A;  2RM6 A;  7GSS A;  1X0R A;  2GSR A;  4MJA A;  1EGR A;  3UVH A;  2DJ3 A;  1PL1 A;  3ZRD A;  3DVW A;  2OE1 A;  3KEB A;  1I5G A;  4ZIJ A;  3P90 A;  3GH6 A;  5CAX A;  4XS4 A;  1WP0 A;  1RW1 A;  1JLW A;  4GWR A;  2LKU A;  3KH9 A;  1R26 A;  1K0N A;  1FVJ A;  1OE8 A;  3N9J A;  2NTO A;  2YZH A;  1NHY A;  3SWL A;  1EOG A;  4XHM A;  1EWX A;  5DAK B;  3TKS C;  2LRC A;  5EY6 A;  4CW9 A;  4GCI A;  2VD1 A;  1TOF A;  4XIH A;  4ID0 A;  1K0A A;  2J9H A;  5INY A;  4NV5 A;  5JCU A;  3QMX A;  2JZS A;  1DSB A;  3I43 A;  2P0G A;  1PD2 1;  1B8X A;  4KGI A;  3BD2 A;  4XCS A;  4K7O A;  2RUF A;  4BVY A;  2YPM A;  3TCO A;  5ECS A;  2VL2 A;  3OR5 A;  1E2Y A;  2B1K A;  1XWG A;  3VWW A;  1OAZ A;  4PNG A;  5DAL B;  3D4M A;  1OC8 A;  4V1A g;  5B7C A;  4Q5Q A;  2IFQ A;  1AW9 A;  2K18 A;  4V1A p;  3EIN A;  3IK7 A;  3ME7 A;  2QGV A;  5G1L A;  4KE3 A;  1S3C A;  2CAQ A;  3GKM A;  3L0H A;  1OVN A;  4XS6 A;  1O81 A;  3QAV A;  4EL1 A;  1YEP A;  1YKA A;  1TK5 B;  5HR3 A;  3MAK A;  5IO2 A;  2HRF A;  4MZC A;  3CSH A;  1F37 A;  1TRW A;  1EGO A;  1N2A A;  1G6Y A;  4NAX A;  1SJ6 A;  3MSZ A;  1VF4 A;  3KMN A;  4MPG A;  3LOR A;  1U6T A;  4BWQ A;  3VK9 A;  1UC7 A;  2ON7 A;  4ZBB A;  4E8E A;  2RUE A;  4Z7X A;  4DVC A;  1ZL9 A;  5H5S A;  5DQY A;  1K0M A;  4PQH A;  4EDY A;  1AXD A;  4CDO A;  3UVT A;  2QC7 A;  5G5F A;  4TR1 A;  3HZ8 A;  5LD0 A;  5ECO B;  4V2L A;  3APO A;  4DSS B;  1O8X A;  4V2M A;  1EEJ A;  1YZX A;  2A2R A;  5J9B A;  4OD7 A;  3ED3 A;  2H30 A;  3RHB A;  3TJF A;  1YKC A;  4F9Z A;  3G7J A;  3IC4 A;  4KSM A;  1LJR A;  3VWX A;  17GS A;  1H75 A;  1GSS A;  1WPI A;  4WEY A;  2R6K A;  4IP6 A;  3O76 A;  2FD3 A;  1YDK A;  3TRX A;  3KIJ A;  1O8W A;  2HLS A;  2LRT A;  3IXR A;  2VLT A;  3LFL A;  2GT6 A;  4OCE A;  1O7U A;  3ZLP A;  5G31 A;  4HUA A;  4ACS A;  5IMF A;  4GLT A;  2H1G A;  1OYJ A;  2MMZ A;  2H6X A;  2MBT A;  5IPG A;  5G30 A;  4EVM A;  3TJB A;  1GTA A;  1FB0 A;  1EZK A;  1WOU A;  2C4J A;  3KTL A;  2F51 A;  4QL9 A;  1XW6 A;  9GSS A;  4ZB6 A;  3ZVJ D;  1WJK A;  3GSS A;  1UA5 A;  1GLP A;  1A0R P;  1R5A A;  4MLY A;  4YQU A;  2GZP A;  4I2U A;  12GS A;  3UBL A;  5CRD A;  1EEM A;  1ILO A;  2D2Z A;  2P31 A;  3DRN A;  1OC9 A;  3IHQ A;  4ZB9 A;  3UAP A;  3DXB A;  4F82 A;  2X64 A;  4KDU A;  1PN9 A;  2F8A A;  1XIY A;  3J7Y k;  3ZML A;  5KN3 A;  2XPE A;  3DEX A;  1TU8 A;  4IQ1 A;  3VI5 A;  2AV4 A;  3TRP A;  2CT6 A;  2FLS A;  3GH9 A;  2IN3 A;  1PX6 A;  2HXK A;  3UOM A;  1VF1 A;  3EMX A;  1TP9 A;  3BCI A;  22GS A;  4ISD A;  5D9T A;  20GS A;  2H1A A;  4IP1 A;  3A2X A;  2HSY A;  1X9W B;  2VL2 C;  4L5L A;  4OO5 A;  3KJY A;  4YQV A;  2E0Q A;  5E59 A;  4ZBA A;  5JCG A;  3HVV A;  2ON5 A;  1F2E A;  3HKR A;  1TRU A;  1V40 A;  3HDC A;  4D73 A;  3QAG A;  2TIR A;  4H86 A;  1A24 A;  2L59 A;  4OFN A;  2P5Q A;  3LXT A;  4RUV A;  14GS A;  1ERW A;  3F4S A;  1Z7P A;  4NV2 A;  4O7H A;  1VGL A;  1ST9 A;  4MZW A;  4IQA A;  4Q5N A;  1F6M C;  4KB3 A;  2EC4 A;  3GTU B;  1V2A A;  4EKZ A;  5JWO B;  3E3E A;  2F8F A;  1GUL A;  4WBR D;  4F0B A;  1JZR A;  4EDZ A;  2FNO A;  3VPT A;  2VOC A;  2H74 A;  19GS A;  1FO5 A;  1BYE A;  3LXZ A;  4L8E A;  5J4U A;  2HSH A;  4ULX A;  3FKF A;  3KM6 A;  2VM2 A;  2N5A A;  1GSY A;  2AB6 A;  4MH2 A;  4MAB A;  5FWG A;  5D9W A;  11GS A;  5ECN B;  1GSF A;  3KH7 A;  3TGZ A;  1T7P B;  2R2J A;  4TR0 A;  1TXX A;  3D4T A;  1S3A A;  2GQL A;  1PMT A;  2YN1 A;  4KUN A;  4WXT A;  1SKR B;  3P7X A;  2O8V B;  5G2Z A;  3H93 A;  3MWH A;  3CTG A;  2V2G A;  3E9J B;  3TB2 A;  4FYC A;  2PGT A;  3TOU A;  1OKT A;  5KN0 A;  3A5W A;  2H76 A;  4O32 A;  1YF0 A;  5DJL A;  1PX7 A;  1V9W A;  5ECI B;  1XXU A;  2FWH A;  4N0Z A;  2H0H A;  4ZL9 A;  1SKW B;  3F6F A;  5ECH B;  4N11 A;  1EP7 A;  1SL2 B;  3RPP A;  4YAP A;  3QDN A;  4HJM A;  5FT3 A;  3H4K A;  13GS A;  1GTI A;  3F63 A;  3M9J A;  2CVB A;  2DML A;  2JU5 A;  4ML1 A;  4MJB A;  2VUP A;  1M2A A;  2IJY A;  3I9V 2;  1ZCP A;  2FY6 A;  1V98 A;  2C0E A;  3KGK A;  5ABR A;  1GSE A;  3FR6 A;  3ERG A;  1ERV A;  2IIY A;  4V2N A;  4TOP A;  2LJR A;  2GSS A;  3FEU A;  4NXI A;  4HU7 A;  4AJ7 A;  2Z9S A;  2L5O A;  1PGT A;  1X5D A;  1R4W A;  5EPF A;  2WJU A;  3FY7 A;  5ECM B;  2JAD A;  3ME8 A;  4ZXG A;  2OA7 A;  1GL8 A;  5H5R A;  4O92 A;  2OBI A;  3IDV A;  3GV1 A;  1SYR A;  4WF4 A;  3QD9 A;  3A2W A;  2PU9 C;  1QXH A;  3F9U A;  3AY8 A;  2HI7 A;  1HD2 A;  1DE1 A;  1Y25 A;  1U3I A;  1AC1 A;  2YWN A;  4NMU A;  4QQ7 A;  2KLX A;  2L5L A;  2H0I A;  1E6B A;  2OAD A;  3ZMK A;  3WGE A;  3TOT A;  3RAZ A;  5DAK A;  3CSJ A;  1A23 A;  1YEX A;  4MH3 A;  3IOS A;  1T4Z A;  3HJM A;  2MMA A;  2I3Y A;  1X5C A;  2YJ7 A;  2XBI A;  5IPH A;  3WD6 A;  1Z3E A;  1SD8 A;  2WCI A;  3DD3 A;  1U87 A;  1XWB A;  2B5Y A;  2GZY A;  5IO0 A;  2O7K A;  2B5E A;  1GTU A;  3RDW A;  4BVX A;  1PKZ A;  2WZ9 A;  4PXO A;  4FIW A;  3WGX A;  3IRA A;  1XFL A;  1M7T A;  1R7H A;  1B9X C;  4KH7 A;  5DAL A;  1X9S B;  5ECK B;  1AIU A;  3JCM L;  1RK4 A;  4F2I A;  2C0G A;  2GSQ A;  4KDX A;  3GST A;  5F07 A;  3K8N A;  6GST A;  4I2T A;  1FVK A;  5GAP D;  2DJJ A;  2DBC A;  2OE3 A;  3QOU A;  5AIX A;  3GFK A;  2YNX A;  5EVO A;  2VCQ A;  1XPV A;  1WIK A;  1F9M A;  4PQI A;  1OKD A;  2O87 A;  1J08 A;  3HJO A;  1K0B A;  1M0U A;  2DIZ A;  3GUR A;  4K0G A;  3TKS E;  2DMM A;  3UL3 A;  2XPD A;  4POL A;  2LST A;  4IJI A;  4IHU A;  3KXO A;  1PQN A;  2R3X A;  5KN1 A;  1SYX A;  5KEJ A;  5H5Q A;  1ABA A;  4G9H A;  3GA4 A;  3EUR A;  1SL0 B;  3W8J A;  3ZIV A;  3NIV A;  2L57 A;  4AGS A;  4OFM A;  1WRY A;  1SK0 A;  1W89 A;  1AUC A;  2XHF A;  3EU4 A;  1SJZ A;  4MPF A;  4ML6 A;  1QFN A;  1GWC A;  3KMO A;  3MNG A;  4G19 A;  4HQS A;  2IFQ B;  4G2E A;  5D9V A;  3US3 A;  4DSS A;  3UAR A;  3IAM 2;  4LL4 B;  5D9X A;  2WUL A;  4DSR A;  5DVB A;  4HJ2 A;  1IYH A;  1K3L A;  1ML6 A;  2H71 A;  4EC0 A;  1ON4 A;  2ES7 A;  6GSW A;  4GXZ A;  2YCD A;  4TKY A;  5GST A;  2GTU A;  2H1B A;  1GRX A;  4RQR A;  4TXO B;  2ALB A;  3APS A;  1B9Y C;  3D21 A;  1NSW A;  3MDK A;  2G2Q A;  5CRH A;  2LJK A;  3QR6 A;  1JZO A;  3Q74 A;  1BJX A;  4WR5 A;  3RPN A;  1K0D A;  4GRF A;  5ID2 B;  4J57 E;  2RM5 A;  4I97 A;  1THO A;  1KTE A;  5AN1 A;  4P3Y B;  4YAV A;  2DLX A;  4GST A;  3VPQ A;  2KP2 A;  2MBS A;  3EC3 A;  2HYX A;  4OFT A;  4O5R A;  3VLN A;  4EE0 A;  3L9S A;  4EXJ A;  1S3D A;  3TUE A;  2WDU A;  1WMJ A;  2GDR A;  2IMF A;  3LG6 A;  3BBY A;  2B7J A;  1F3A A;  3C71 A;  5A4U A;  2TRC P;  2ZUP A;  2N5F A;  2FHE A;  1TDI A;  3HZ4 A;  2FWG A;  2N5B A;  2LQQ A;  2LEG A;  1A2J A;  3ERW A;  4TXV A;  2IMD A;  1JZD A;  1ZYE A;  4XRA A;  1BQ7 A;  1GNW A;  2YAN A;  3F4T A;  5DJM A;  2F9S A;  2H73 A;  5IIZ A;  2K9F A;  4TR3 A;  3EYT A;  1FAA A;  1TI1 A;  2RII A;  4JU5 A;  1GUH A;  1JLV A;  4IBP A;  1QGV A;  4WR4 A;  4L0W A;  3FR9 A;  2NBS A;  2HZE B;  4PUF C;  4EF0 A;  3WT1 A;  3FZA A;  1PL2 A;  4G10 A;  3S9F A;  2AAW A;  4AF2 A;  1O73 A;  3QFA C;  3KZQ A;  16GS A;  3F3R A;  3Q6O A;  2L6D A;  4FYU A;  2AHE A;  3D0Z A;  3RHC A;  3HY2 A;  2EIO A;  3CRU A;  3VWU A;  2V1M A;  3M3M A;  1DE2 A;  3GYK A;  3LYP A;  1TRV A;  8GSS A;  2F3M A;  1G7O A;  4POK A;  2IME A;  4K6X A;  3U5R E;  2R4V A;  3EVI A;  3L9U A;  4WKW A;  4IEL A;  3GTU A;  5IMA A;  5IMZ A;  1B4Q A;  2H8L A;  4YQM A;  5IQY A;  3FHK A;  4ECB A;  4OMV A;  3F0I A;  4PX1 A;  2YZU A;  2H75 A;  4N10 A;  4LLR A;  1TU7 A;  5ECQ B;  2YOI A;  1H4O A;  2FUG 2;  1R5P A;  3ZYW A;  2FWF A;  1M2B A;  1ZOF A;  5CRW A;  4CHS A;  2I4A A;  4AJ8 A;  2L6C A;  2GT5 A;  3ZVJ A;  2H19 A;  3HCZ A;  2DJK A;  4ZIL A;  3Q18 A;  5GAN D;  1LU4 A;  4MJE A;  2PPT A;  3WT2 A;  4N0V A;  2PER A;  1J0F A;  2E7P A;  2YV9 A;  3HXS A;  1WE0 A;  3FRC A;  3UIW A;  5A4V A;  1JHB A;  3LJR A;  2H01 A;  3C1S A;  1T3B A;  4IGJ A;  4KCA A;  3DWV A;  1G7E A;  1XWA A;  1HNA A;  3G9B A;  4NHW A;  3QFB C;  3F6D A;  2DIY A;  4PNF A;  3EU3 A;  4K7I A;  2CX4 A;  2YWM A;  3IPZ A;  1LBK A;  4GSN A;  2VCV A;  3HD5 A;  3FK8 A;  5B8B A;  1X9M B;  2KUC A;  1YF1 A;  3GKN A;  2G0F A;  2R5G A;  2V41 A;  2C8U A;  2H70 A;  4OCF A;  2YV7 A;  2HE3 A;  1A8L A;  1GSD A;  2CV4 A;  3Q19 A;  4K9Z A;  3UMA A;  3LGC A;  5ENU A;  3V1W A;  1M9A A;  1UVZ A;  3VFI A;  4BPY A;  4TVE A;  1MD3 A;  1WWJ A;  3ISO A;  3KP9 A;  2PUK C;  1MTC A;  5D96 A;  1QUW A;  4JBB A;  4YH2 A;  4F03 A;  1YJ6 A;  2HFD A;  3EE2 A;  1W4V A;  2B1L A;  5G5E A;  2B5X A;  1NW2 A;  2LJA A;  4ILF A;  3J7Y b;  3PIN A;  2REM A;  10GS A;  3QPM A;  4GF0 A;  1HYU A;  3GKK A;  5F8B A;  1FW1 A;  4JE1 A;  4ZBD A;  2C3N A;  3HJP A;  4MCU A;  1J9B A;  3GL3 A;  1TRS A;  1MDK A;  2WS2 A;  1GP1 A;  2LV3 A;  2JL4 A;  4K8M A;  1G6W A;  1SKS B;  3G7I A;  1XVW A;  3LYK A;  3ZIJ A;  2I1U A;  1USB A;  2VM1 A;  2LNT A;  5DCH A;  1FHE A;  3L9V A;  4MF5 A;  3WGD A;  1PSQ A;  3TJK A;  4TW5 A;  3GN3 A;  2QKE A;  1XCC A;  2WGR A;  1TTZ A;  3APQ A;  1HNC A;  3IE3 A;  1ERU A;  4KAE A;  3SBC A;  2PN8 A;  4L0U A;  1GLQ A;  2HNL A;  1Q4J A;  2L4C A;  1URM A;  2LTK A;  1XW9 A;  5F05 A;  1AQX A;  2BJX A;  2XC2 A;  5HFG A;  3UEM A;  4HDE A;  4GQF A;  4JED A;  3C8E A;  3F3Q A;  3F4R A;  3M1G A;  5A4W A;  2AUV A;  2M80 A;  6GSV A;  4NHZ A;  5F06 A;  6GSU A;  1V58 A;  3GKX A;  4I5Q A;  2VL9 A;  3HVS A;  1HQO A;  4MMM A;  4N30 A;  1EOH A;  5IOX A;  3UJ1 A;  2H0G A;  1JFU A;  1GUM A;  1SK1 A;  5ECP B;  2LUS A;  1K3O A;  3KTB A;  3DKS A;  3LSZ A;  1A2M A;  2B7K A;  1NHO A;  1ACV A;  4XRD A;  2DJ1 A;  2VIM A;  1IYI A;  2C3T A;  5HR2 A;  1KEB A;  1SD9 A;  2LQO A;  4BL7 A;  1DUG A;  3GHA A;  2GLR A;  2VL3 A;  2J23 A;  2IMK A;  18GS A;  2FCH A;  3FZ5 A;  2EIR A;  1VF2 A;  5B6M A;  2X8G A;  2GVP A;  1A8Y A;  3FZ4 A;  2TRX A;  2LS5 A;  4IJ3 A;  4K2D A;  2KP1 A;  2PVO C;  3FR3 A;  3ZFB A;  1RQM A;  5E4W A;  4EUY A;  3RBT A;  1AAZ A;  2H72 A;  2NVL A;  1SL1 B;  4MP4 A;  1U88 A;  1QMV A;  3TJJ A;  3UBK A;  2K6V A;  1I9D A;  3VWV A;  3C1R A;  3GUS A;  2VCX A;  2C80 A;  5IM9 A;  1Z6N A;  1KNG A;  4XS4 B;  4POB A;  2FGX A;  1PKW A;  2JZR A;  2CZ3 A;  3DGQ A;  5HR1 A;  4XTS A;  5AIS A;  1AQV A;  3BJ5 A;  1GSU A;  5DDL A;  4KSO A;  3WYW A;  4I6X A;  1THX A;  1OC3 A;  1EV4 A;  3HA9 A;  2GQM A;  2M46 A;  5L71 A;  1B4P A;  1T1V A;  1AQW A;  1QK8 A;  2C0F A;  1XW5 A;  2CQ9 A;  4MDC A;  3M0F A;  5LNK e;  2IWT A;  1SJI A;  5CP1 A;  1FOV A;  1PA3 A;  3O6T A;  3FYG A;  4HQZ A;  2OE0 A;  3ERF A;  1DBY A;  4WF5 A;  4HOJ A;  5KN2 A;  4HI7 A;  2O85 A;  2E2M A;  5D73 A;  2E2G A;  1BG5 A;  3C73 A;  4I8B A;  4NWY A;  4AJ6 A;  3I6A A;  2V32 A;  5HFK A;  2K8V A;  2MMN A;  3HHV A;  2X8H A;  1BED A;  4TXO A;  3N5O A;  4ZB8 A;  4PGT A;  5D93 A;  3IBH A;  1K3Y A;  2HZF A;  1T4Y A;  1C72 A;  3GX8 A;  3DIE A;  2LRN A;  2IL3 A;  3P2A A;  2VO4 A;  3GNJ A;  2DSA A;  2X8C A;  4OO4 A;  5A5K A;  4J56 E;  3EWL A;  5ID2 A;  2BMX A;  2GZZ A;  4X0X A;  5IMC A;  4LL1 B;  4Q5R A;  2JZT A;  3D6I A;  1PRX A;  1XOB A;  2A2S A;  1TKD B;  3ZRE A;  2K8S A;  3LWA A;  3HYP A;  1TK8 B;  1BAY A;  4JR4 A;  5IMD A;  1M99 A;  3G7Y A;  5B6N A;  4ECC A;  1TW9 A;  2FWE A;  4Q5F A;  3W6G A;  2X99 A;  5J9C A;  5LCZ A;  1FB6 A;  1Z6M A;  5IMV A;  3D22 A;  1T8E B;  3PGT A;  5HFI A;  4F0C A;  3QAW A;  1XOA A;  2I9H A;  5CO3 A;  2CZ2 A;  2PMT A;  3TJG A;  4KW6 A;  2H1D A;  4PUA A;  1M9B A;  2NDO A;  5ELA A;  2GS3 A;  3VUR A;  4TR1 B;  2FA4 A;  4FYB A;  2JAC A;  3DVX A;  2C0D A;  1T00 A;  3CTF A;  4BA7 A;  5B8A A;  4TR4 A;  4RI6 A;  4POM A;  1TJD A;  1Z7R A;  2P5R A;  4HZ4 A;  5COH A;  2MMO A;  4NPB A;  1F3B A;  1VRS D;  2EIQ A;  4FH8 A;  2DJ2 A;  5D8I A;  2GGT A;  3IA1 A;  3I69 A;  2HZE A;  4DSQ A;  2M72 A;  4KDY A;  4MJC A;  4WBJ A;  2DJ0 A;  4TN8 A;  1Z9H A;  4X1U A;  3LEF A;  5C00 A;  5HQP A;  1X5E A;  1G0T A;  1A0F A;  2HRN A;  4MZB A;  5CYY A;  5AIV A;  5HR0 A;  2O89 A;  1VF3 A;  3A2V A;  1ZZY A;  1CQG A;  1Y6E A;  4LMV A;  2R37 A;  5CRG A;  1K0O A;  3KD0 A;  1XBS A;  2OJL A;  2L4Q A;  2IPA A;  3GRX A;  2PWJ A;  3BOA A;  1B48 A;  4E8H A;  4BWS A;  2ZNM A;  3TRQ A;  3GMF A;  4MA9 A;  1MEK A;  3DML A;  5GZZ B;  2WFC A;  2IMI A;  1OE7 A;  5F0G A;  2YWI A;  3EMP A;  4K0N A;  1A2L A;  4MK3 A;  1GUK A;  3NOF A;  1ZGN A;  1Q98 A;  1OC9 B;  3FW2 A;  3CBU A;  1XWK A;  2AYT A;  4JRR A;  4K7N A;  4J2F A;  1FG4 A;  5DQS A;  4KND A;  3TKR A;  4KX4 A;  2B6M A;  1MDJ A;  3D5J A;  3O3T A;  4HEA 2;  4JZQ A;  2I81 A;  5DCG A;  3ZIT A;  3IV4 A;  4DEJ A;  2H66 A;  3M8N A;  4GQC A;  2KOK A;  1U3A A;  3PH9 A;  5EL8 A;  2V6O A;  2YWO A;  5DBQ A;  4IS0 A;  3TKS A;  4LA1 A;  4ZL8 A;  3GX0 A;  4MF7 A;  5GSS A;  5G1K A;  3L4N A;  1HNB A;  4GTU A;  1CQH A;  3DYR A;  3E0U A;  3BCK A;  2C1Y A;  3NZN A;  1MD4 A;  3GIX A;  2VLV A;  1BX9 A;  4RI7 A;  4OWY A;  3F8U A;  4D73 B;  1TI3 A;  4FO5 A;  6GSS A;  4IN0 A;  1SEN A;  4RQX A;  2JSZ A;  2ZCT A;  4ZL7 A;  4LMW A;  1N8J A;  3LQ7 A;  4GSS A;  4JR6 A;  3GL5 A;  3H1N A;  3QCP A;  4PUR A;  2H6Z A;  2MYG A;  1EP8 A;  1ERT A;  1GSQ A;  3L78 A;  2YP6 A;  4X43 A;  1UN2 A;  2A4V A;  4KA0 A;  3VI7 A;  1KBN A;  4QL7 A;  3KP8 A;  5ELG A;  2VCW A;  5JWR B;  3TDG A;  1GH2 A;  2OAC A;  5IOW A;  3U6V A;  5J5N A;  4XS1 A;  4EO3 A;  2VAF A;  2CVD A;  4ECI A;  4MF6 A;  1TK0 B;  1SK2 A;  2WB9 A;  3W8S A;  2OBK A;  3CMI A;  4HU9 A;  2WRT A;  4HS1 A;  4WET A;  1GNE A;  2VLU A;  3ZTL A;  3H79 A;  3ZZX A;  3CXG A;  2BTO T;  3C7M A;  2VD0 A;  5J41 A;  4IVF A;  4K1F A;  2AJQ B;  3CRT A;  3IR4 A;  2DC5 A;  2VCT A;  2H6Y A;  1NM3 A;  3IAS 2;  1XZO A;  3PR8 A;  2FA8 A;  1YY7 A;  3H8Q A;  1XWC A;  2CVK A;  1Z5Y E;  1GTB A;  2NPB A;  4L5O A;  3FZ9 A;  2PBJ A;  5ECL B;  2CA8 A;  5JCW A;  1O6J A;  3P8W A;  6GSX A;  1YQ1 A;  2JSY A;  2YJH A;  2KHP A;  2XBQ A;  1O85 A;  1ZYQ B;  2C3Q A;  5ECR B; 
#chains in the Genus database with same CATH topology
 3CYN A;  4IW9 A;  2MZC A;  1K0C A;  4IKH A;  4HZ2 A;  1XVQ A;  4TRX A;  2CAI A;  2CX3 A;  3IK9 A;  2OKA A;  3A3T A;  6GSY A;  1QQ2 A;  1SU9 A;  4ECJ A;  5C04 A;  2GQK A;  3CSI A;  4Z2T A;  4KCE A;  1JZW A;  1ZMA A;  1M2D A;  2PVQ A;  5J3R A;  3TKP A;  4PQ1 A;  3TKQ A;  3A5I A;  5CNW A;  3KCM A;  1V57 A;  1MDI A;  3HVX A;  2B3S A;  2V6K A;  2QSI A;  3R2Q A;  5AGY A;  3ZL5 A;  3ZFL A;  1EV9 A;  3M9K A;  2RLI A;  2HT9 A;  5FHI A;  2VCZ A;  5JWQ B;  2LNS A;  2GST A;  5CRE A;  2RM6 A;  7GSS A;  1X0R A;  2GSR A;  4MJA A;  1EGR A;  3UVH A;  2DJ3 A;  1PL1 A;  3ZRD A;  3DVW A;  2OE1 A;  3KEB A;  1I5G A;  4ZIJ A;  3P90 A;  3GH6 A;  5CAX A;  4XS4 A;  1WP0 A;  1RW1 A;  1JLW A;  4GWR A;  2LKU A;  3KH9 A;  1R26 A;  1K0N A;  1FVJ A;  1OE8 A;  3N9J A;  2NTO A;  2YZH A;  1NHY A;  3SWL A;  1EOG A;  4XHM A;  1EWX A;  5DAK B;  3TKS C;  2LRC A;  5EY6 A;  4CW9 A;  4GCI A;  2VD1 A;  1TOF A;  4XIH A;  4ID0 A;  1K0A A;  2J9H A;  5INY A;  4NV5 A;  3HVN A;  5JCU A;  3QMX A;  2JZS A;  1DSB A;  3I43 A;  2P0G A;  1PD2 1;  1B8X A;  4KGI A;  3BD2 A;  4XCS A;  4K7O A;  2RUF A;  4BVY A;  2YPM A;  3TCO A;  5ECS A;  2VL2 A;  3OR5 A;  4BVX B;  1E2Y A;  2B1K A;  1XWG A;  3VWW A;  1OAZ A;  4PNG A;  5DAL B;  3D4M A;  1OC8 A;  4V1A g;  5B7C A;  4Q5Q A;  2IFQ A;  1AW9 A;  2K18 A;  4V1A p;  3EIN A;  3IK7 A;  3ME7 A;  2QGV A;  5G1L A;  4KE3 A;  1S3C A;  2CAQ A;  3GKM A;  3L0H A;  1OVN A;  4XS6 A;  1O81 A;  3QAV A;  4EL1 A;  1YEP A;  1YKA A;  1TK5 B;  5HR3 A;  3MAK A;  5IO2 A;  2HRF A;  4MZC A;  3CSH A;  1F37 A;  1TRW A;  1EGO A;  1N2A A;  1G6Y A;  4NAX A;  1SJ6 A;  3MSZ A;  1VF4 A;  3KMN A;  4MPG A;  3LOR A;  1U6T A;  4BWQ A;  3VK9 A;  1UC7 A;  2ON7 A;  4ZBB A;  4E8E A;  2RUE A;  4Z7X A;  4DVC A;  1ZL9 A;  5H5S A;  5DQY A;  1K0M A;  4PQH A;  4EDY A;  2QA1 A;  1AXD A;  4CDO A;  3UVT A;  2QC7 A;  5G5F A;  4TR1 A;  3HZ8 A;  5LD0 A;  5ECO B;  4V2L A;  4CY6 A;  3APO A;  4DSS B;  1O8X A;  4V2M A;  1EEJ A;  1YZX A;  2A2R A;  5J9B A;  4OD7 A;  3ED3 A;  2H30 A;  3RHB A;  3TJF A;  1YKC A;  4F9Z A;  3G7J A;  3IC4 A;  4KSM A;  1LJR A;  3VWX A;  17GS A;  1H75 A;  1GSS A;  1WPI A;  4WEY A;  2R6K A;  4IP6 A;  3O76 A;  2FD3 A;  1YDK A;  4EIQ A;  3TRX A;  3KIJ A;  1O8W A;  2HLS A;  2LRT A;  3IXR A;  2HRK A;  2VLT A;  3LFL A;  2GT6 A;  4OCE A;  1O7U A;  3ZLP A;  5G31 A;  4HUA A;  4ACS A;  5IMF A;  4GLT A;  4PTS A;  2H1G A;  1OYJ A;  2MMZ A;  2H6X A;  2MBT A;  5IPG A;  5G30 A;  4EVM A;  3TJB A;  1GTA A;  1FB0 A;  1EZK A;  1WOU A;  2C4J A;  3KTL A;  2F51 A;  5ECR B;  4QL9 A;  1XW6 A;  9GSS A;  4ZB6 A;  3ZVJ D;  1WJK A;  3GSS A;  1UA5 A;  1GLP A;  1A0R P;  1R5A A;  4MLY A;  4YQU A;  3MIX A;  4G0I A;  2GZP A;  4I2U A;  12GS A;  3UBL A;  3FMW A;  5CRD A;  1EEM A;  1ILO A;  2D2Z A;  2P31 A;  3DRN A;  1OC9 A;  3IHQ A;  4ZB9 A;  3UAP A;  3DXB A;  4F82 A;  2X64 A;  4KDU A;  1PN9 A;  2F8A A;  1XIY A;  3J7Y k;  3ZML A;  5KN3 A;  2XPE A;  3DEX A;  1TU8 A;  4IQ1 A;  3VI5 A;  2AV4 A;  3TRP A;  2CT6 A;  2FLS A;  3GH9 A;  2IN3 A;  5BMU A;  1PX6 A;  2HXK A;  3UOM A;  1VF1 A;  1ZYP A;  3EMX A;  1TP9 A;  3BCI A;  22GS A;  4ISD A;  5D9T A;  20GS A;  2H1A A;  4IP1 A;  3A2X A;  2HSY A;  1X9W B;  2VL2 C;  4L5L A;  4OO5 A;  3KJY A;  4YQV A;  2E0Q A;  5E59 A;  4ZBA A;  5JCG A;  3HVV A;  2ON5 A;  1F2E A;  3HKR A;  1TRU A;  1V40 A;  3HDC A;  4D73 A;  3QAG A;  2TIR A;  4H86 A;  1A24 A;  2L59 A;  4OFN A;  2P5Q A;  3LXT A;  4RUV A;  14GS A;  1ERW A;  3F4S A;  1Z7P A;  4NV2 A;  4O7H A;  1VGL A;  1ST9 A;  4MZW A;  4IQA A;  4Q5N A;  1F6M C;  4KB3 A;  2EC4 A;  3GTU B;  1V2A A;  4EKZ A;  5JWO B;  3E3E A;  2F8F A;  1GUL A;  4WBR D;  4F0B A;  1JZR A;  4EDZ A;  2FNO A;  3VPT A;  2VOC A;  2H74 A;  19GS A;  1FO5 A;  1BYE A;  3LXZ A;  4L8E A;  5J4U A;  2HSH A;  4ULX A;  3FKF A;  3KM6 A;  2VM2 A;  2N5A A;  1GSY A;  2AB6 A;  4MH2 A;  4MAB A;  5FWG A;  5D9W A;  11GS A;  5ECN B;  1GSF A;  3KH7 A;  3TGZ A;  1T7P B;  2R2J A;  4TR0 A;  1TXX A;  3D4T A;  1S3A A;  2GQL A;  1PMT A;  2YN1 A;  4KF9 A;  4KUN A;  4WXT A;  4Z2R A;  1SKR B;  3P7X A;  2O8V B;  5G2Z A;  3H93 A;  3MWH A;  3CTG A;  2V2G A;  3E9J B;  3TB2 A;  4FYC A;  2PGT A;  3TOU A;  1OKT A;  5KN0 A;  3A5W A;  2H76 A;  4O32 A;  1YF0 A;  5DJL A;  1PX7 A;  1V9W A;  5ECI B;  1XXU A;  4CY8 A;  2FWH A;  4N0Z A;  2H0H A;  4ZL9 A;  1SKW B;  3F6F A;  5ECH B;  4N11 A;  1EP7 A;  1SL2 B;  3RPP A;  4YAP A;  3QDN A;  4HJM A;  5FT3 A;  3H4K A;  13GS A;  3IC8 A;  1GTI A;  3F63 A;  3M9J A;  2CVB A;  2DML A;  2JU5 A;  4ML1 A;  4MJB A;  2VUP A;  1M2A A;  2IJY A;  2A4H A;  3I9V 2;  1ZCP A;  2FY6 A;  1V98 A;  2C0E A;  3KGK A;  5ABR A;  1GSE A;  3FR6 A;  3ERG A;  1ERV A;  2IIY A;  4V2N A;  4TOP A;  2LJR A;  2GSS A;  3FEU A;  4NXI A;  4HU7 A;  4AJ7 A;  2Z9S A;  2L5O A;  1PGT A;  1X5D A;  1R4W A;  5EPF A;  2WJU A;  3FY7 A;  5ECM B;  2JAD A;  3ME8 A;  4ZXG A;  2OA7 A;  1GL8 A;  5H5R A;  4O92 A;  2OBI A;  3IDV A;  3GV1 A;  1SYR A;  4YKF A;  4WF4 A;  3PPU A;  3QD9 A;  2DKH A;  3A2W A;  2PU9 C;  1QXH A;  3F9U A;  3AY8 A;  2HI7 A;  1HD2 A;  1DE1 A;  1Y25 A;  1U3I A;  1AC1 A;  2YWN A;  4NMU A;  4QQ7 A;  2KLX A;  2L5L A;  2H0I A;  1E6B A;  2OAD A;  3ZMK A;  3WGE A;  3TOT A;  3RAZ A;  5DAK A;  3CSJ A;  1A23 A;  1YEX A;  4MH3 A;  3IOS A;  1T4Z A;  3HJM A;  2MMA A;  2I3Y A;  1X5C A;  2YJ7 A;  1XG8 A;  2XBI A;  5IPH A;  3WD6 A;  1Z3E A;  1SD8 A;  2WCI A;  3DD3 A;  1U87 A;  1XWB A;  2B5Y A;  2GZY A;  5IO0 A;  2UZ8 A;  2O7K A;  2B5E A;  1GTU A;  3RDW A;  4BVX A;  1PKZ A;  2WZ9 A;  4PXO A;  4FIW A;  3WGX A;  3IRA A;  1XFL A;  1M7T A;  1R7H A;  1B9X C;  4KH7 A;  5DAL A;  1X9S B;  5ECK B;  1AIU A;  3JCM L;  1RK4 A;  3EPT A;  4F2I A;  4BL7 B;  2GSQ A;  4KDX A;  3GST A;  5F07 A;  3K8N A;  6GST A;  4I2T A;  1FVK A;  5GAP D;  2DJJ A;  2DBC A;  2OE3 A;  3QOU A;  5AIX A;  3GFK A;  2YNX A;  5EVO A;  2VCQ A;  1XPV A;  1WIK A;  1F9M A;  4PQI A;  1OKD A;  2O87 A;  1J08 A;  3HJO A;  1K0B A;  1M0U A;  2DIZ A;  3GUR A;  4K0G A;  3TKS E;  2DMM A;  3UL3 A;  2XPD A;  4POL A;  2LST A;  4IJI A;  4IHU A;  2X49 A;  1PQN A;  2R3X A;  3KXO A;  1SYX A;  5KN1 A;  5KEJ A;  5H5Q A;  1ABA A;  4G9H A;  3GA4 A;  3EUR A;  1SL0 B;  2HSM A;  3W8J A;  3ZIV A;  3NIV A;  2L57 A;  4AGS A;  4OFM A;  1WRY A;  1SK0 A;  1W89 A;  1AUC A;  2XHF A;  3EU4 A;  1SJZ A;  4MPF A;  4ML6 A;  1QFN A;  1GWC A;  3KMO A;  3MNG A;  4G19 A;  4HQS A;  2IFQ B;  4G2E A;  5D9V A;  3US3 A;  4DSS A;  3UAR A;  3IAM 2;  4LL4 B;  5D9X A;  2WUL A;  4DSR A;  5DVB A;  4HJ2 A;  1IYH A;  1K3L A;  1ML6 A;  2H71 A;  4EC0 A;  1ON4 A;  2ES7 A;  6GSW A;  4GXZ A;  2YCD A;  4TKY A;  5GST A;  2GTU A;  4ICY A;  2H1B A;  2HRA A;  1GRX A;  4RQR A;  4TXO B;  2ALB A;  3APS A;  1B9Y C;  3D21 A;  1NSW A;  3MDK A;  2G2Q A;  5CRH A;  2LJK A;  3QR6 A;  1JZO A;  3Q74 A;  1BJX A;  4WR5 A;  3RPN A;  1K0D A;  4GRF A;  5ID2 B;  4J57 E;  4A5P A;  2RM5 A;  4I97 A;  1THO A;  1KTE A;  4USS A;  5AN1 A;  4P3Y B;  4YAV A;  2DLX A;  4GST A;  3VPQ A;  2KP2 A;  2MBS A;  3EC3 A;  2HYX A;  4OFT A;  4O5R A;  3VLN A;  4EE0 A;  3L9S A;  4EXJ A;  1S3D A;  3TUE A;  2WDU A;  1WMJ A;  2GDR A;  2IMF A;  3LG6 A;  3BBY A;  2B7J A;  1F3A A;  3C71 A;  5A4U A;  2TRC P;  2ZUP A;  2N5F A;  2FHE A;  1TDI A;  3HZ4 A;  2FWG A;  2N5B A;  2LQQ A;  2LEG A;  1A2J A;  3ERW A;  3IHG A;  4TXV A;  2IMD A;  1JZD A;  1ZYE A;  4XRA A;  1BQ7 A;  1GNW A;  2YAN A;  3F4T A;  5DJM A;  2F9S A;  2H73 A;  5IIZ A;  2K9F A;  4TR3 A;  3EYT A;  1FAA A;  1TI1 A;  2RII A;  4JU5 A;  1GUH A;  1JLV A;  4IBP A;  1QGV A;  4WR4 A;  4L0W A;  3FR9 A;  2NBS A;  2HZE B;  4PUF C;  4EF0 A;  4FQU A;  3WT1 A;  3FZA A;  1PL2 A;  4G10 A;  3S9F A;  2AAW A;  4AF2 A;  1O73 A;  3QFA C;  3KZQ A;  16GS A;  3F3R A;  3Q6O A;  2L6D A;  4FYU A;  2AHE A;  3D0Z A;  3RHC A;  3HY2 A;  2EIO A;  3CRU A;  4X4J A;  3VWU A;  4EIP A;  2V1M A;  3M3M A;  1DE2 A;  3GYK A;  3LYP A;  1TRV A;  8GSS A;  2F3M A;  1G7O A;  4POK A;  2IME A;  1ZYN A;  4K6X A;  3U5R E;  2R4V A;  3EVI A;  3L9U A;  4WKW A;  4IEL A;  3GTU A;  5IMA A;  5IMZ A;  1B4Q A;  2H8L A;  4YQM A;  5IQY A;  3FHK A;  4ECB A;  4OMV A;  3F0I A;  4PX1 A;  1FOH A;  2YZU A;  2H75 A;  2X4A A;  4N10 A;  4LLR A;  1TU7 A;  5ECQ B;  2YOI A;  1H4O A;  2FUG 2;  1R5P A;  3ZYW A;  2FWF A;  1M2B A;  1ZOF A;  5CRW A;  4K5R A;  4CHS A;  2I4A A;  4AJ8 A;  2L6C A;  2GT5 A;  3ZVJ A;  2H19 A;  3HCZ A;  2DJK A;  4ZIL A;  3Q18 A;  5GAN D;  1LU4 A;  4MJE A;  2PPT A;  3WT2 A;  4N0V A;  2PER A;  1J0F A;  2E7P A;  2YV9 A;  3HXS A;  1PN0 A;  1WE0 A;  3FRC A;  3UIW A;  5A4V A;  1JHB A;  3LJR A;  2H01 A;  3C1S A;  1T3B A;  4K2X A;  4MNN A;  4IGJ A;  4KCA A;  3DWV A;  1G7E A;  1XWA A;  1HNA A;  3G9B A;  4NHW A;  3QFB C;  3F6D A;  2DIY A;  4PNF A;  3EU3 A;  4K7I A;  2CX4 A;  2YWM A;  3IPZ A;  1LBK A;  4GSN A;  2VCV A;  3HD5 A;  5KOX A;  3FK8 A;  5B8B A;  1X9M B;  2KUC A;  1YF1 A;  3GKN A;  2G0F A;  2R5G A;  2V41 A;  3CQF A;  2C8U A;  2H70 A;  4OCF A;  2YV7 A;  2HE3 A;  1A8L A;  1GSD A;  2CV4 A;  3Q19 A;  4K9Z A;  3UMA A;  3LGC A;  5ENU A;  3V1W A;  1M9A A;  1UVZ A;  3VFI A;  4BPY A;  4TVE A;  1MD3 A;  1WWJ A;  3ISO A;  3LW9 A;  3KP9 A;  2PUK C;  1MTC A;  5D96 A;  1QUW A;  4JBB A;  4YH2 A;  4F03 A;  1YJ6 A;  2HFD A;  3EE2 A;  1W4V A;  2B1L A;  5G5E A;  2B5X A;  1NW2 A;  2LJA A;  4ILF A;  3J7Y b;  3PIN A;  2REM A;  10GS A;  3QPM A;  4GF0 A;  1HYU A;  3GKK A;  5F8B A;  1FW1 A;  4JE1 A;  4ZBD A;  2C3N A;  3HJP A;  4MCU A;  1PFO A;  1J9B A;  3GL3 A;  1TRS A;  2A2P A;  1MDK A;  2WS2 A;  1GP1 A;  2LV3 A;  2JL4 A;  4K8M A;  1G6W A;  1SKS B;  3G7I A;  1XVW A;  3LYK A;  3ZIJ A;  2I1U A;  1USB A;  2VM1 A;  2LNT A;  5DCH A;  1FHE A;  3L9V A;  4MF5 A;  3WGD A;  1PSQ A;  3TJK A;  4TW5 A;  3GN3 A;  2QKE A;  1XCC A;  2WGR A;  1TTZ A;  3APQ A;  1HNC A;  3IE3 A;  1ERU A;  4HSC X;  4BIK A;  4KAE A;  3SBC A;  2PN8 A;  4L0U A;  4O5U A;  1GLQ A;  2HNL A;  1Q4J A;  2L4C A;  1URM A;  2LTK A;  1XW9 A;  5F05 A;  1AQX A;  2BJX A;  1M3I A;  2XC2 A;  5HFG A;  3UEM A;  4HDE A;  4GQF A;  4JED A;  3C8E A;  3F3Q A;  3F4R A;  3M1G A;  5A4W A;  2AUV A;  2M80 A;  6GSV A;  4NHZ A;  5F06 A;  6GSU A;  1V58 A;  3GKX A;  4I5Q A;  2VL9 A;  3HVS A;  1HQO A;  4MMM A;  4N30 A;  1EOH A;  5IOX A;  3UJ1 A;  2H0G A;  1JFU A;  1GUM A;  1SK1 A;  5ECP B;  2LUS A;  1K3O A;  2QA2 A;  3KTB A;  3DKS A;  3LSZ A;  1A2M A;  2B7K A;  1NHO A;  1ACV A;  4XRD A;  2DJ1 A;  2VIM A;  1IYI A;  2C3T A;  5HR2 A;  1KEB A;  1SD9 A;  2DKI A;  2LQO A;  4BL7 A;  1DUG A;  3GHA A;  3R3E A;  2GLR A;  2VL3 A;  2J23 A;  2IMK A;  18GS A;  2FCH A;  3FZ5 A;  2EIR A;  1VF2 A;  5B6M A;  2X8G A;  2GVP A;  1A8Y A;  3FZ4 A;  2TRX A;  2LS5 A;  4IJ3 A;  4K2D A;  2KP1 A;  2PVO C;  3FR3 A;  3ZFB A;  1RQM A;  5E4W A;  4EUY A;  3RBT A;  1AAZ A;  2H72 A;  2NVL A;  1SL1 B;  4MP4 A;  1U88 A;  1QMV A;  3TJJ A;  3UBK A;  2K6V A;  1I9D A;  3VWV A;  3C1R A;  3GUS A;  2VCX A;  2C80 A;  5IM9 A;  1Z6N A;  1S3R A;  1KNG A;  4XS4 B;  4POB A;  2FGX A;  1PKW A;  2JZR A;  2CZ3 A;  3DGQ A;  5HR1 A;  4XTS A;  5AIS A;  1AQV A;  3BJ5 A;  1GSU A;  4KSO A;  5DDL A;  3WYW A;  4I6X A;  1THX A;  1OC3 A;  1EV4 A;  3HA9 A;  2GQM A;  2M46 A;  5L71 A;  1B4P A;  1T1V A;  1AQW A;  1QK8 A;  2C0F A;  1XW5 A;  2CQ9 A;  4MDC A;  3M0F A;  5LNK e;  3MYD A;  2IWT A;  1SJI A;  5CP1 A;  1FOV A;  1PA3 A;  3O6T A;  5BRT A;  3FYG A;  4HQZ A;  2OE0 A;  3ERF A;  1DBY A;  4WF5 A;  4HOJ A;  5KN2 A;  4BVY B;  4HI7 A;  2O85 A;  2E2M A;  5D73 A;  2E2G A;  1BG5 A;  3C73 A;  4I8B A;  4NWY A;  4AJ6 A;  3I6A A;  2V32 A;  5HFK A;  2K8V A;  2MMN A;  3HHV A;  2X8H A;  1BED A;  4TXO A;  3N5O A;  4ZB8 A;  4PGT A;  5D93 A;  3IBH A;  1K3Y A;  2HZF A;  1T4Y A;  1C72 A;  3GX8 A;  3DIE A;  2LRN A;  2IL3 A;  3P2A A;  2VO4 A;  3GNJ A;  2DSA A;  2X8C A;  4OO4 A;  5A5K A;  4J56 E;  3EWL A;  5ID2 A;  2BMX A;  2GZZ A;  4X0X A;  5IMC A;  4LL1 B;  4Q5R A;  2JZT A;  3D6I A;  1PRX A;  1XOB A;  2A2S A;  1TKD B;  3ZRE A;  2K8S A;  3LWA A;  3HYP A;  1TK8 B;  1BAY A;  4JR4 A;  4YKG A;  5IMD A;  1M99 A;  3G7Y A;  5B6N A;  4ECC A;  1TW9 A;  2FWE A;  4Q5F A;  3W6G A;  2X99 A;  5J9C A;  5LCZ A;  1FB6 A;  1Z6M A;  5IMV A;  3D22 A;  1T8E B;  3PGT A;  5HFI A;  4F0C A;  3QAW A;  1XOA A;  2I9H A;  5CO3 A;  2CZ2 A;  2PMT A;  3TJG A;  4KW6 A;  2H1D A;  4PUA A;  1M9B A;  2NDO A;  5ELA A;  2GS3 A;  3VUR A;  4TR1 B;  2FA4 A;  4FYB A;  2JAC A;  3DVX A;  2C0D A;  1T00 A;  3CTF A;  4BA7 A;  5B8A A;  4TR4 A;  4RI6 A;  4POM A;  1TJD A;  1Z7R A;  2P5R A;  4HZ4 A;  5COH A;  2MMO A;  4NPB A;  1F3B A;  1VRS D;  2EIQ A;  4FH8 A;  2DJ2 A;  5D8I A;  2GGT A;  3IA1 A;  3I69 A;  2HZE A;  4DSQ A;  2M72 A;  4KDY A;  4MJC A;  4WBJ A;  2DJ0 A;  4TN8 A;  1Z9H A;  4X1U A;  3LEF A;  5C00 A;  5HQP A;  1X5E A;  1G0T A;  1A0F A;  2HRN A;  4MZB A;  5CYY A;  5AIV A;  5HR0 A;  2O89 A;  1VF3 A;  3A2V A;  1ZZY A;  1CQG A;  1Y6E A;  4LMV A;  2R37 A;  5CRG A;  1K0O A;  3KD0 A;  4O5Q A;  1XBS A;  2OJL A;  2L4Q A;  2IPA A;  3GRX A;  2PWJ A;  3BOA A;  1B48 A;  4E8H A;  4K5S A;  4BWS A;  2ZNM A;  3TRQ A;  3GMF A;  4MA9 A;  1MEK A;  3DML A;  5GZZ B;  2WFC A;  2IMI A;  1OE7 A;  5F0G A;  2YWI A;  3EMP A;  4K0N A;  1A2L A;  4MK3 A;  1GUK A;  3NOF A;  1ZGN A;  1Q98 A;  1OC9 B;  3FW2 A;  3CBU A;  1XWK A;  2AYT A;  4JRR A;  4K7N A;  4J2F A;  1FG4 A;  5DQS A;  4KND A;  3TKR A;  4KX4 A;  2B6M A;  1MDJ A;  3D5J A;  3O3T A;  4HEA 2;  4JZQ A;  2I81 A;  5DCG A;  3ZIT A;  4Z2U A;  3IV4 A;  4DEJ A;  2H66 A;  3M8N A;  4GQC A;  4G0K A;  2KOK A;  1U3A A;  3PH9 A;  5EL8 A;  2V6O A;  2YWO A;  5DBQ A;  4IS0 A;  3TKS A;  4LA1 A;  4ZL8 A;  3GX0 A;  4MF7 A;  5GSS A;  5G1K A;  3L4N A;  1HNB A;  4GTU A;  1CQH A;  3DYR A;  3E0U A;  3BCK A;  2C1Y A;  3NZN A;  1MD4 A;  3GIX A;  2VLV A;  1BX9 A;  4RI7 A;  4OWY A;  3F8U A;  4D73 B;  1TI3 A;  4FO5 A;  6GSS A;  4IN0 A;  1SEN A;  4RQX A;  2JSZ A;  2ZCT A;  4ZL7 A;  4LMW A;  1N8J A;  3LQ7 A;  4GSS A;  4JR6 A;  4G0L A;  3GL5 A;  3H1N A;  3QCP A;  4PUR A;  2R0P A;  2H6Z A;  2MYG A;  1EP8 A;  1ERT A;  1GSQ A;  3L78 A;  2YP6 A;  4X43 A;  1UN2 A;  2A4V A;  4KA0 A;  3VI7 A;  1KBN A;  4QL7 A;  3KP8 A;  5ELG A;  2VCW A;  5JWR B;  3TDG A;  1GH2 A;  2OAC A;  5IOW A;  3U6V A;  5J5N A;  4XS1 A;  5KOW A;  4EO3 A;  2VAF A;  2CVD A;  4ECI A;  4MF6 A;  1TK0 B;  1SK2 A;  2WB9 A;  3W8S A;  2OBK A;  3CMI A;  4HU9 A;  2WRT A;  4HS1 A;  4WET A;  1GNE A;  2VLU A;  3ZTL A;  3H79 A;  3ZZX A;  3CXG A;  2BTO T;  2R0G A;  3C7M A;  2VD0 A;  5J41 A;  4IVF A;  1M3J A;  4K1F A;  2AJQ B;  3CRT A;  3IR4 A;  2DC5 A;  2VCT A;  2H6Y A;  1NM3 A;  3IAS 2;  2R0C A;  1XZO A;  3PR8 A;  2FA8 A;  1YY7 A;  3H8Q A;  1XWC A;  2CVK A;  1Z5Y E;  1GTB A;  2NPB A;  4L5O A;  3FZ9 A;  2PBJ A;  5ECL B;  2CA8 A;  5JCW A;  1O6J A;  3P8W A;  6GSX A;  1YQ1 A;  2JSY A;  2YJH A;  2KHP A;  2XBQ A;  1O85 A;  1ZYQ B;  2C3Q A;  2C0G A; 
#chains in the Genus database with same CATH homology
 3CYN A;  4IW9 A;  2MZC A;  1K0C A;  4IKH A;  4HZ2 A;  1XVQ A;  4TRX A;  2CAI A;  2CX3 A;  3IK9 A;  2OKA A;  3A3T A;  6GSY A;  1QQ2 A;  1SU9 A;  4ECJ A;  5C04 A;  2GQK A;  3CSI A;  4Z2T A;  4KCE A;  1JZW A;  1ZMA A;  1M2D A;  2PVQ A;  5J3R A;  3TKP A;  4PQ1 A;  3TKQ A;  3A5I A;  5CNW A;  3KCM A;  1V57 A;  1MDI A;  3HVX A;  2B3S A;  2V6K A;  2QSI A;  3R2Q A;  5AGY A;  3ZL5 A;  3ZFL A;  1EV9 A;  3M9K A;  2RLI A;  2HT9 A;  5FHI A;  2VCZ A;  5JWQ B;  2LNS A;  2GST A;  5CRE A;  2RM6 A;  7GSS A;  1X0R A;  2GSR A;  4MJA A;  1EGR A;  3UVH A;  2DJ3 A;  1PL1 A;  3ZRD A;  3DVW A;  2OE1 A;  3KEB A;  1I5G A;  4ZIJ A;  3P90 A;  3GH6 A;  5CAX A;  4XS4 A;  1WP0 A;  1RW1 A;  1JLW A;  4GWR A;  2LKU A;  3KH9 A;  1R26 A;  1K0N A;  1FVJ A;  1OE8 A;  3N9J A;  2NTO A;  2YZH A;  1NHY A;  3SWL A;  1EOG A;  4XHM A;  1EWX A;  5DAK B;  3TKS C;  2LRC A;  5EY6 A;  4CW9 A;  4GCI A;  2VD1 A;  1TOF A;  4XIH A;  4ID0 A;  1K0A A;  2J9H A;  5INY A;  4NV5 A;  5JCU A;  3QMX A;  2JZS A;  1DSB A;  3I43 A;  2P0G A;  1PD2 1;  1B8X A;  4KGI A;  3BD2 A;  4XCS A;  4K7O A;  2RUF A;  4BVY A;  2YPM A;  3TCO A;  5ECS A;  2VL2 A;  3OR5 A;  4BVX B;  1E2Y A;  2B1K A;  1XWG A;  3VWW A;  1OAZ A;  4PNG A;  5DAL B;  3D4M A;  1OC8 A;  4V1A g;  5B7C A;  4Q5Q A;  2IFQ A;  1AW9 A;  2K18 A;  4V1A p;  3EIN A;  3IK7 A;  3ME7 A;  2QGV A;  5G1L A;  4KE3 A;  1S3C A;  2CAQ A;  3GKM A;  3L0H A;  1OVN A;  4XS6 A;  1O81 A;  3QAV A;  4EL1 A;  1YEP A;  1YKA A;  1TK5 B;  5HR3 A;  3MAK A;  5IO2 A;  2HRF A;  4MZC A;  3CSH A;  1F37 A;  1TRW A;  1EGO A;  1N2A A;  1G6Y A;  4NAX A;  1SJ6 A;  3MSZ A;  1VF4 A;  3KMN A;  4MPG A;  3LOR A;  1U6T A;  4BWQ A;  3VK9 A;  1UC7 A;  2ON7 A;  4ZBB A;  4E8E A;  2RUE A;  4Z7X A;  4DVC A;  1ZL9 A;  5H5S A;  5DQY A;  1K0M A;  4PQH A;  4EDY A;  2QA1 A;  1AXD A;  4CDO A;  3UVT A;  2QC7 A;  5G5F A;  4TR1 A;  3HZ8 A;  5LD0 A;  5ECO B;  4V2L A;  4CY6 A;  3APO A;  4DSS B;  1O8X A;  4V2M A;  1EEJ A;  1YZX A;  2A2R A;  5J9B A;  4OD7 A;  3ED3 A;  2H30 A;  3RHB A;  3TJF A;  1YKC A;  4F9Z A;  3G7J A;  3IC4 A;  4KSM A;  1LJR A;  3VWX A;  17GS A;  1H75 A;  1GSS A;  1WPI A;  4WEY A;  2R6K A;  4IP6 A;  3O76 A;  2FD3 A;  1YDK A;  4EIQ A;  3TRX A;  3KIJ A;  1O8W A;  2HLS A;  2LRT A;  3IXR A;  2HRK A;  2VLT A;  3LFL A;  2GT6 A;  4OCE A;  1O7U A;  3ZLP A;  5G31 A;  4HUA A;  4ACS A;  5IMF A;  4GLT A;  4PTS A;  2H1G A;  1OYJ A;  2MMZ A;  2H6X A;  2MBT A;  5IPG A;  5G30 A;  4EVM A;  3TJB A;  1GTA A;  1FB0 A;  1EZK A;  1WOU A;  2C4J A;  3KTL A;  2F51 A;  5ECR B;  4QL9 A;  1XW6 A;  9GSS A;  4ZB6 A;  3ZVJ D;  1WJK A;  3GSS A;  1UA5 A;  1GLP A;  1A0R P;  1R5A A;  4MLY A;  4YQU A;  3MIX A;  4G0I A;  2GZP A;  4I2U A;  12GS A;  3UBL A;  3FMW A;  5CRD A;  1EEM A;  1ILO A;  2D2Z A;  2P31 A;  3DRN A;  1OC9 A;  3IHQ A;  4ZB9 A;  3UAP A;  3DXB A;  4F82 A;  2X64 A;  4KDU A;  1PN9 A;  2F8A A;  1XIY A;  3J7Y k;  3ZML A;  5KN3 A;  2XPE A;  3DEX A;  1TU8 A;  4IQ1 A;  3VI5 A;  2AV4 A;  3TRP A;  2CT6 A;  2FLS A;  3GH9 A;  2IN3 A;  5BMU A;  1PX6 A;  2HXK A;  3UOM A;  1VF1 A;  1ZYP A;  3EMX A;  1TP9 A;  3BCI A;  22GS A;  4ISD A;  5D9T A;  20GS A;  2H1A A;  4IP1 A;  3A2X A;  2HSY A;  1X9W B;  2VL2 C;  4L5L A;  4OO5 A;  3KJY A;  4YQV A;  2E0Q A;  5E59 A;  4ZBA A;  5JCG A;  3HVV A;  2ON5 A;  1F2E A;  3HKR A;  1TRU A;  1V40 A;  3HDC A;  4D73 A;  3QAG A;  2TIR A;  4H86 A;  1A24 A;  2L59 A;  4OFN A;  2P5Q A;  3LXT A;  4RUV A;  14GS A;  1ERW A;  3F4S A;  1Z7P A;  4NV2 A;  4O7H A;  1VGL A;  1ST9 A;  4MZW A;  4IQA A;  4Q5N A;  1F6M C;  4KB3 A;  2EC4 A;  3GTU B;  1V2A A;  4EKZ A;  5JWO B;  3E3E A;  2F8F A;  1GUL A;  4WBR D;  4F0B A;  1JZR A;  4EDZ A;  2FNO A;  3VPT A;  2VOC A;  2H74 A;  19GS A;  1FO5 A;  1BYE A;  3LXZ A;  4L8E A;  5J4U A;  2HSH A;  4ULX A;  3FKF A;  3KM6 A;  2VM2 A;  2N5A A;  1GSY A;  2AB6 A;  4MH2 A;  4MAB A;  5FWG A;  5D9W A;  11GS A;  5ECN B;  1GSF A;  3KH7 A;  3TGZ A;  1T7P B;  2R2J A;  4TR0 A;  1TXX A;  3D4T A;  1S3A A;  2GQL A;  1PMT A;  2YN1 A;  4KF9 A;  4KUN A;  4WXT A;  4Z2R A;  1SKR B;  3P7X A;  2O8V B;  5G2Z A;  3H93 A;  3MWH A;  3CTG A;  2V2G A;  3E9J B;  3TB2 A;  4FYC A;  2PGT A;  3TOU A;  1OKT A;  5KN0 A;  3A5W A;  2H76 A;  4O32 A;  1YF0 A;  5DJL A;  1PX7 A;  1V9W A;  5ECI B;  1XXU A;  4CY8 A;  2FWH A;  4N0Z A;  2H0H A;  4ZL9 A;  1SKW B;  3F6F A;  5ECH B;  4N11 A;  1EP7 A;  1SL2 B;  3RPP A;  4YAP A;  3QDN A;  4HJM A;  5FT3 A;  3H4K A;  13GS A;  3IC8 A;  1GTI A;  3F63 A;  3M9J A;  2CVB A;  2DML A;  2JU5 A;  4ML1 A;  4MJB A;  2VUP A;  1M2A A;  2IJY A;  2A4H A;  3I9V 2;  1ZCP A;  2FY6 A;  1V98 A;  2C0E A;  3KGK A;  5ABR A;  1GSE A;  3FR6 A;  3ERG A;  1ERV A;  2IIY A;  4V2N A;  4TOP A;  2LJR A;  2GSS A;  3FEU A;  4NXI A;  4HU7 A;  4AJ7 A;  2Z9S A;  2L5O A;  1PGT A;  1X5D A;  1R4W A;  5EPF A;  2WJU A;  3FY7 A;  5ECM B;  2JAD A;  3ME8 A;  4ZXG A;  2OA7 A;  1GL8 A;  5H5R A;  4O92 A;  2OBI A;  3IDV A;  3GV1 A;  1SYR A;  4YKF A;  4WF4 A;  3PPU A;  3QD9 A;  2DKH A;  3A2W A;  2PU9 C;  1QXH A;  3F9U A;  3AY8 A;  2HI7 A;  1HD2 A;  1DE1 A;  1Y25 A;  1U3I A;  1AC1 A;  2YWN A;  4NMU A;  4QQ7 A;  2KLX A;  2L5L A;  2H0I A;  1E6B A;  2OAD A;  3ZMK A;  3WGE A;  3TOT A;  3RAZ A;  5DAK A;  3CSJ A;  1A23 A;  1YEX A;  4MH3 A;  3IOS A;  1T4Z A;  3HJM A;  2MMA A;  2I3Y A;  1X5C A;  2YJ7 A;  2XBI A;  5IPH A;  3WD6 A;  1Z3E A;  1SD8 A;  2WCI A;  3DD3 A;  1U87 A;  1XWB A;  2B5Y A;  2GZY A;  5IO0 A;  2UZ8 A;  2O7K A;  2B5E A;  1GTU A;  3RDW A;  4BVX A;  1PKZ A;  2WZ9 A;  4PXO A;  4FIW A;  3WGX A;  3IRA A;  1XFL A;  1M7T A;  1R7H A;  1B9X C;  4KH7 A;  5DAL A;  1X9S B;  5ECK B;  1AIU A;  3JCM L;  1RK4 A;  3EPT A;  4F2I A;  4BL7 B;  2GSQ A;  4KDX A;  3GST A;  5F07 A;  3K8N A;  6GST A;  4I2T A;  1FVK A;  5GAP D;  2DJJ A;  2DBC A;  2OE3 A;  3QOU A;  5AIX A;  3GFK A;  2YNX A;  5EVO A;  2VCQ A;  1XPV A;  1WIK A;  1F9M A;  4PQI A;  1OKD A;  2O87 A;  1J08 A;  3HJO A;  1K0B A;  1M0U A;  2DIZ A;  3GUR A;  4K0G A;  3TKS E;  2DMM A;  3UL3 A;  2XPD A;  4POL A;  2LST A;  4IJI A;  4IHU A;  2X49 A;  1PQN A;  2R3X A;  3KXO A;  1SYX A;  5KN1 A;  5KEJ A;  5H5Q A;  1ABA A;  4G9H A;  3GA4 A;  3EUR A;  1SL0 B;  2HSM A;  3W8J A;  3ZIV A;  3NIV A;  2L57 A;  4AGS A;  4OFM A;  1WRY A;  1SK0 A;  1W89 A;  1AUC A;  2XHF A;  3EU4 A;  1SJZ A;  4MPF A;  4ML6 A;  1QFN A;  1GWC A;  3KMO A;  3MNG A;  4G19 A;  4HQS A;  2IFQ B;  4G2E A;  5D9V A;  3US3 A;  4DSS A;  3UAR A;  3IAM 2;  4LL4 B;  5D9X A;  2WUL A;  4DSR A;  5DVB A;  4HJ2 A;  1IYH A;  1K3L A;  1ML6 A;  2H71 A;  4EC0 A;  1ON4 A;  2ES7 A;  6GSW A;  4GXZ A;  2YCD A;  4TKY A;  5GST A;  2GTU A;  4ICY A;  2H1B A;  2HRA A;  1GRX A;  4RQR A;  4TXO B;  2ALB A;  3APS A;  1B9Y C;  3D21 A;  1NSW A;  3MDK A;  2G2Q A;  5CRH A;  2LJK A;  3QR6 A;  1JZO A;  3Q74 A;  1BJX A;  4WR5 A;  3RPN A;  1K0D A;  4GRF A;  5ID2 B;  4J57 E;  4A5P A;  2RM5 A;  4I97 A;  1THO A;  1KTE A;  4USS A;  5AN1 A;  4P3Y B;  4YAV A;  2DLX A;  4GST A;  3VPQ A;  2KP2 A;  2MBS A;  3EC3 A;  2HYX A;  4OFT A;  4O5R A;  3VLN A;  4EE0 A;  3L9S A;  4EXJ A;  1S3D A;  3TUE A;  2WDU A;  1WMJ A;  2GDR A;  2IMF A;  3LG6 A;  3BBY A;  2B7J A;  1F3A A;  3C71 A;  5A4U A;  2TRC P;  2ZUP A;  2N5F A;  2FHE A;  1TDI A;  3HZ4 A;  2FWG A;  2N5B A;  2LQQ A;  2LEG A;  1A2J A;  3ERW A;  3IHG A;  4TXV A;  2IMD A;  1JZD A;  1ZYE A;  4XRA A;  1BQ7 A;  1GNW A;  2YAN A;  3F4T A;  5DJM A;  2F9S A;  2H73 A;  5IIZ A;  2K9F A;  4TR3 A;  3EYT A;  1FAA A;  1TI1 A;  2RII A;  4JU5 A;  1GUH A;  1JLV A;  4IBP A;  1QGV A;  4WR4 A;  4L0W A;  3FR9 A;  2NBS A;  2HZE B;  4PUF C;  4EF0 A;  4FQU A;  3WT1 A;  3FZA A;  1PL2 A;  4G10 A;  3S9F A;  2AAW A;  4AF2 A;  1O73 A;  3QFA C;  3KZQ A;  16GS A;  3F3R A;  3Q6O A;  2L6D A;  4FYU A;  2AHE A;  3D0Z A;  3RHC A;  3HY2 A;  2EIO A;  3CRU A;  4X4J A;  3VWU A;  4EIP A;  2V1M A;  3M3M A;  1DE2 A;  3GYK A;  3LYP A;  1TRV A;  8GSS A;  2F3M A;  1G7O A;  4POK A;  2IME A;  1ZYN A;  4K6X A;  3U5R E;  2R4V A;  3EVI A;  3L9U A;  4WKW A;  4IEL A;  3GTU A;  5IMA A;  5IMZ A;  1B4Q A;  2H8L A;  4YQM A;  5IQY A;  3FHK A;  4ECB A;  4OMV A;  3F0I A;  4PX1 A;  1FOH A;  2YZU A;  2H75 A;  2X4A A;  4N10 A;  4LLR A;  1TU7 A;  5ECQ B;  2YOI A;  1H4O A;  2FUG 2;  1R5P A;  3ZYW A;  2FWF A;  1M2B A;  1ZOF A;  5CRW A;  4K5R A;  4CHS A;  2I4A A;  4AJ8 A;  2L6C A;  2GT5 A;  3ZVJ A;  2H19 A;  3HCZ A;  2DJK A;  4ZIL A;  3Q18 A;  5GAN D;  1LU4 A;  4MJE A;  2PPT A;  3WT2 A;  4N0V A;  2PER A;  1J0F A;  2E7P A;  2YV9 A;  3HXS A;  1PN0 A;  1WE0 A;  3FRC A;  3UIW A;  5A4V A;  1JHB A;  3LJR A;  2H01 A;  3C1S A;  1T3B A;  4K2X A;  4MNN A;  4IGJ A;  4KCA A;  3DWV A;  1G7E A;  1XWA A;  1HNA A;  3G9B A;  4NHW A;  3QFB C;  3F6D A;  2DIY A;  4PNF A;  3EU3 A;  4K7I A;  2CX4 A;  2YWM A;  3IPZ A;  1LBK A;  4GSN A;  2VCV A;  3HD5 A;  5KOX A;  3FK8 A;  5B8B A;  1X9M B;  2KUC A;  1YF1 A;  3GKN A;  2G0F A;  2R5G A;  2V41 A;  2C8U A;  2H70 A;  4OCF A;  2YV7 A;  2HE3 A;  1A8L A;  1GSD A;  2CV4 A;  3Q19 A;  4K9Z A;  3UMA A;  3LGC A;  5ENU A;  3V1W A;  1M9A A;  1UVZ A;  3VFI A;  4BPY A;  4TVE A;  1MD3 A;  1WWJ A;  3ISO A;  3LW9 A;  3KP9 A;  2PUK C;  1MTC A;  5D96 A;  1QUW A;  4JBB A;  4YH2 A;  4F03 A;  1YJ6 A;  2HFD A;  3EE2 A;  1W4V A;  2B1L A;  5G5E A;  2B5X A;  1NW2 A;  2LJA A;  4ILF A;  3J7Y b;  3PIN A;  2REM A;  10GS A;  3QPM A;  4GF0 A;  1HYU A;  3GKK A;  5F8B A;  1FW1 A;  4JE1 A;  4ZBD A;  2C3N A;  3HJP A;  4MCU A;  1J9B A;  3GL3 A;  1TRS A;  2A2P A;  1MDK A;  2WS2 A;  1GP1 A;  2LV3 A;  2JL4 A;  4K8M A;  1G6W A;  1SKS B;  3G7I A;  1XVW A;  3LYK A;  3ZIJ A;  2I1U A;  1USB A;  2VM1 A;  2LNT A;  5DCH A;  1FHE A;  3L9V A;  4MF5 A;  3WGD A;  1PSQ A;  3TJK A;  4TW5 A;  3GN3 A;  2QKE A;  1XCC A;  2WGR A;  1TTZ A;  3APQ A;  1HNC A;  3IE3 A;  1ERU A;  4KAE A;  3SBC A;  2PN8 A;  4L0U A;  4O5U A;  1GLQ A;  2HNL A;  1Q4J A;  2L4C A;  1URM A;  2LTK A;  1XW9 A;  5F05 A;  1AQX A;  2BJX A;  2XC2 A;  5HFG A;  3UEM A;  4HDE A;  4GQF A;  4JED A;  3C8E A;  3F3Q A;  3F4R A;  3M1G A;  5A4W A;  2AUV A;  2M80 A;  6GSV A;  4NHZ A;  5F06 A;  6GSU A;  1V58 A;  3GKX A;  4I5Q A;  2VL9 A;  3HVS A;  1HQO A;  4MMM A;  4N30 A;  1EOH A;  5IOX A;  3UJ1 A;  2H0G A;  1JFU A;  1GUM A;  1SK1 A;  5ECP B;  2LUS A;  1K3O A;  2QA2 A;  3KTB A;  3DKS A;  3LSZ A;  1A2M A;  2B7K A;  1NHO A;  1ACV A;  4XRD A;  2DJ1 A;  2VIM A;  1IYI A;  2C3T A;  5HR2 A;  1KEB A;  1SD9 A;  2DKI A;  2LQO A;  4BL7 A;  1DUG A;  3GHA A;  3R3E A;  2GLR A;  2VL3 A;  2J23 A;  2IMK A;  18GS A;  2FCH A;  3FZ5 A;  2EIR A;  1VF2 A;  5B6M A;  2X8G A;  2GVP A;  1A8Y A;  3FZ4 A;  2TRX A;  2LS5 A;  4IJ3 A;  4K2D A;  2KP1 A;  2PVO C;  3FR3 A;  3ZFB A;  1RQM A;  5E4W A;  4EUY A;  3RBT A;  1AAZ A;  2H72 A;  2NVL A;  1SL1 B;  4MP4 A;  1U88 A;  1QMV A;  3TJJ A;  3UBK A;  2K6V A;  1I9D A;  3VWV A;  3C1R A;  3GUS A;  2VCX A;  2C80 A;  5IM9 A;  1Z6N A;  1KNG A;  4XS4 B;  4POB A;  2FGX A;  1PKW A;  2JZR A;  2CZ3 A;  3DGQ A;  5HR1 A;  4XTS A;  5AIS A;  1AQV A;  3BJ5 A;  1GSU A;  4KSO A;  5DDL A;  3WYW A;  4I6X A;  1THX A;  1OC3 A;  1EV4 A;  3HA9 A;  2GQM A;  2M46 A;  5L71 A;  1B4P A;  1T1V A;  1AQW A;  1QK8 A;  2C0F A;  1XW5 A;  2CQ9 A;  4MDC A;  3M0F A;  5LNK e;  3MYD A;  2IWT A;  1SJI A;  5CP1 A;  1FOV A;  1PA3 A;  3O6T A;  5BRT A;  3FYG A;  4HQZ A;  2OE0 A;  3ERF A;  1DBY A;  4WF5 A;  4HOJ A;  5KN2 A;  4BVY B;  4HI7 A;  2O85 A;  2E2M A;  5D73 A;  2E2G A;  1BG5 A;  3C73 A;  4I8B A;  4NWY A;  4AJ6 A;  3I6A A;  2V32 A;  5HFK A;  2K8V A;  2MMN A;  3HHV A;  2X8H A;  1BED A;  4TXO A;  3N5O A;  4ZB8 A;  4PGT A;  5D93 A;  3IBH A;  1K3Y A;  2HZF A;  1T4Y A;  1C72 A;  3GX8 A;  3DIE A;  2LRN A;  2IL3 A;  3P2A A;  2VO4 A;  3GNJ A;  2DSA A;  2X8C A;  4OO4 A;  5A5K A;  4J56 E;  3EWL A;  5ID2 A;  2BMX A;  2GZZ A;  4X0X A;  5IMC A;  4LL1 B;  4Q5R A;  2JZT A;  3D6I A;  1PRX A;  1XOB A;  2A2S A;  1TKD B;  3ZRE A;  2K8S A;  3LWA A;  3HYP A;  1TK8 B;  1BAY A;  4JR4 A;  4YKG A;  5IMD A;  1M99 A;  3G7Y A;  5B6N A;  4ECC A;  1TW9 A;  2FWE A;  4Q5F A;  3W6G A;  2X99 A;  5J9C A;  5LCZ A;  1FB6 A;  1Z6M A;  5IMV A;  3D22 A;  1T8E B;  3PGT A;  5HFI A;  4F0C A;  3QAW A;  1XOA A;  2I9H A;  5CO3 A;  2CZ2 A;  2PMT A;  3TJG A;  4KW6 A;  2H1D A;  4PUA A;  1M9B A;  2NDO A;  5ELA A;  2GS3 A;  3VUR A;  4TR1 B;  2FA4 A;  4FYB A;  2JAC A;  3DVX A;  2C0D A;  1T00 A;  3CTF A;  4BA7 A;  5B8A A;  4TR4 A;  4RI6 A;  4POM A;  1TJD A;  1Z7R A;  2P5R A;  4HZ4 A;  5COH A;  2MMO A;  4NPB A;  1F3B A;  1VRS D;  2EIQ A;  4FH8 A;  2DJ2 A;  5D8I A;  2GGT A;  3IA1 A;  3I69 A;  2HZE A;  4DSQ A;  2M72 A;  4KDY A;  4MJC A;  4WBJ A;  2DJ0 A;  4TN8 A;  1Z9H A;  4X1U A;  3LEF A;  5C00 A;  5HQP A;  1X5E A;  1G0T A;  1A0F A;  2HRN A;  4MZB A;  5CYY A;  5AIV A;  5HR0 A;  2O89 A;  1VF3 A;  3A2V A;  1ZZY A;  1CQG A;  1Y6E A;  4LMV A;  2R37 A;  5CRG A;  1K0O A;  3KD0 A;  4O5Q A;  1XBS A;  2OJL A;  2L4Q A;  2IPA A;  3GRX A;  2PWJ A;  3BOA A;  1B48 A;  4E8H A;  4K5S A;  4BWS A;  2ZNM A;  3TRQ A;  3GMF A;  4MA9 A;  1MEK A;  3DML A;  5GZZ B;  2WFC A;  2IMI A;  1OE7 A;  5F0G A;  2YWI A;  3EMP A;  4K0N A;  1A2L A;  4MK3 A;  1GUK A;  3NOF A;  1ZGN A;  1Q98 A;  1OC9 B;  3FW2 A;  3CBU A;  1XWK A;  2AYT A;  4JRR A;  4K7N A;  4J2F A;  1FG4 A;  5DQS A;  4KND A;  3TKR A;  4KX4 A;  2B6M A;  1MDJ A;  3D5J A;  3O3T A;  4HEA 2;  4JZQ A;  2I81 A;  5DCG A;  3ZIT A;  4Z2U A;  3IV4 A;  4DEJ A;  2H66 A;  3M8N A;  4GQC A;  4G0K A;  2KOK A;  1U3A A;  3PH9 A;  5EL8 A;  2V6O A;  2YWO A;  5DBQ A;  4IS0 A;  3TKS A;  4LA1 A;  4ZL8 A;  3GX0 A;  4MF7 A;  5GSS A;  5G1K A;  3L4N A;  1HNB A;  4GTU A;  1CQH A;  3DYR A;  3E0U A;  3BCK A;  2C1Y A;  3NZN A;  1MD4 A;  3GIX A;  2VLV A;  1BX9 A;  4RI7 A;  4OWY A;  3F8U A;  4D73 B;  1TI3 A;  4FO5 A;  6GSS A;  4IN0 A;  1SEN A;  4RQX A;  2JSZ A;  2ZCT A;  4ZL7 A;  4LMW A;  1N8J A;  3LQ7 A;  4GSS A;  4JR6 A;  4G0L A;  3GL5 A;  3H1N A;  3QCP A;  4PUR A;  2R0P A;  2H6Z A;  2MYG A;  1EP8 A;  1ERT A;  1GSQ A;  3L78 A;  2YP6 A;  4X43 A;  1UN2 A;  2A4V A;  4KA0 A;  3VI7 A;  1KBN A;  4QL7 A;  3KP8 A;  5ELG A;  2VCW A;  5JWR B;  3TDG A;  1GH2 A;  2OAC A;  5IOW A;  3U6V A;  5J5N A;  4XS1 A;  5KOW A;  4EO3 A;  2VAF A;  2CVD A;  4ECI A;  4MF6 A;  1TK0 B;  1SK2 A;  2WB9 A;  3W8S A;  2OBK A;  3CMI A;  4HU9 A;  2WRT A;  4HS1 A;  4WET A;  1GNE A;  2VLU A;  3ZTL A;  3H79 A;  3ZZX A;  3CXG A;  2BTO T;  2R0G A;  3C7M A;  2VD0 A;  5J41 A;  4IVF A;  4K1F A;  2AJQ B;  3CRT A;  3IR4 A;  2DC5 A;  2VCT A;  2H6Y A;  1NM3 A;  3IAS 2;  2R0C A;  1XZO A;  3PR8 A;  2FA8 A;  1YY7 A;  3H8Q A;  1XWC A;  2CVK A;  1Z5Y E;  1GTB A;  2NPB A;  4L5O A;  3FZ9 A;  2PBJ A;  5ECL B;  2CA8 A;  5JCW A;  1O6J A;  3P8W A;  6GSX A;  1YQ1 A;  2JSY A;  2YJH A;  2KHP A;  2XBQ A;  1O85 A;  1ZYQ B;  2C3Q A;  2C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...