3KGKA

Crystal structure of arsd
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
92
Chain Sequence
MKTLMVFDPAQALVDFSTDVQWLKQSGVQIERFNLAQQPMSFVQNEKVKAFIEASGAEGLPLLLLDGETVMAGRYPKRAELARWFGIPLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Arsenical resistance operon trans-acting repressor arsD
publication title Crystal structure of ArsD
rcsb
source organism Escherichia coli
total genus 24
structure length 92
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kgkA00
4MABA 3GSTA 2V6OA 3FRCA 2VCWA 1OE8A 2AHEA 3TRXA 5ECRB 1QMVA 1TTZA 2FA8A 5CRHA 2LNSA 1GP1A 3APOA 2HT9A 5HFGA 1O6JA 2OE1A 2F51A 3Q19A 4Q5RA 4XTSA 2PBJA 1SL2B 5J3RA 4QL7A 1WIKA 3VFIA 3O76A 4FYUA 1AQXA 1B4QA 1WPIA 2VCQA 2XBIA 2IIYA 2J23A 3E3EA 1M7TA 1TRSA 1X5CA 3ZREA 5ID2B 2WJUA 2DJ2A 1FG4A 4IGJA 1SKWB 1JZWA 1SENA 1J0FA 4PQHA 5IMAA 1KNGA 2C0EA 5KN3A 2YWIA 2F9SA 4IS0A 5HR0A 1AXDA 4DSQA 4POLA 1YKCA 1VRSD 4OD7A 4KE3A 3TB2A 3ED3A 1PKWA 2HLSA 4GTUA 1A2JA 3ZLPA 2DJJA 5D93A 1M9AA 2YCDA 4MPGA 5ECMB 3CBUA 2CVKA 3L0HA 3VPQA 2HSYA 3IV4A 4EDYA 1VGLA 2A2SA 2VCVA 3M9KA 4YQUA 2O89A 5DVBA 3GN3A 4N0ZA 3FZAA 3HVVA 3RPPA 1AUCA 4DSSA 3IDVA 2R4VA 9GSSA 4GSNA 2FLSA 4K7NA 4K6XA 3A3TA 3TCOA 2CVBA 1TJDA 1F9MA 2PPTA 3TJJA 3KGKA 1S3AA 4KCAA 1SJZA 2FHEA 5F07A 4F03A 3TKQA 2VLVA 1G6WA 1M0UA 2VIMA 5JWQB 1O85A 1SL0B 2WRTA 2EIRA 4JRRA 5HR1A 4WBJA 3KM6A 1MEKA 2ES7A 2LRTA 7GSSA 2GZYA 4IHUA 1OAZA 1V2AA 3VWWA 1QXHA 2FNOA 2WS2A 2DJ1A 3Q74A 3DXBA 1WE0A 3QDNA 1I5GA 2IL3A 1JFUA 4MH2A 4TR1B 5C04A 1TI3A 4MJAA 5A5KA 3F3RA 4Z7XA 3NZNA 5LCZA 1PQNA 1FVKA 4HZ2A 4KDYA 3IC4A 4Q5FA 3EURA 2H1AA 1EGOA 4G19A 3C71A 3DIEA 1EP7A 4NV5A 1K0AA 5ECIB 3O6TA 1GUKA 4FIWA 4CHSA 5AISA 2VUPA 2I81A 2IWTA 4PURA 4L0UA 1O81A 4D73A 4ZXGA 3JCML 4LMVA 2VCXA 1FW1A 1ML6A 2PMTA 2YP6A 1ILOA 1E6BA 2LV3A 4TN8A 1YDKA 5G1KA 4O7HA 2B5EA 2X99A 3W6GA 4WETA 3GHAA 2PU9C 4ML6A 3VI5A 2A2RA 1FHEA 3CRTA 3FR9A 2M46A 2I1UA 1UA5A 1R7HA 2C0DA 1DSBA 3LGCA 1RQMA 4MDCA 2MMZA 4HJ2A 1NM3A 2JZTA 2H1DA 1R4WA 4JBBA 2GSQA 4K8MA 3QAGA 5EL8A 5DCGA 4RUVA 3SBCA 1AQVA 4KA0A 5ABRA 5J5NA 1HNBA 2K8SA 4K9ZA 3H4KA 3CSJA 5G1LA 3RBTA 4AGSA 1H75A 4PNGA 1XPVA 2FWHA 4O5RA 3IXRA 5G31A 5EVOA 5ECSA 5AGYA 4K0GA 1NHYA 2GLRA 4I5QA 1UC7A 3ZYWA 4TRXA 16GSA 5DDLA 1SD8A 4LA1A 3P90A 3VPTA 5HR3A 5J4UA 2LRNA 3I6AA 3TJBA 2JZSA 3ZIJA 2OBKA 3CXGA 3KTLA 3H93A 1A23A 2FD3A 2PERA 1AAZA 3KTBA 4HJMA 1X9SB 2E2MA 2H1BA 2LJKA 3KD0A 6GSSA 1G7EA 5IPGA 1SK1A 2IPAA 4ZB6A 1F3AA 3DGQA 1X5EA 4WF5A 2VCZA 3PH9A 4GXZA 1UVZA 6GSYA 2X8CA 5KEJA 4PUAA 3PR8A 4MCUA 1OKDA 1Z7PA 3M8NA 2H30A 1GSDA 1QUWA 4F2IA 1RW1A 4F82A 4F0CA 3IA1A 4K2DA 3BD2A 4KSMA 3DKSA 5L71A 2WB9A 3KXOA 4QL9A 1VF1A 1EV9A 2XC2A 3CTGA 2LSTA 2VOCA 5D9XA 20GSA 2V1MA 3VK9A 2ZCTA 2LQQA 5CRDA 2YJHA 1FAAA 3C8EA 4WBRD 2OACA 1XVWA 2VD0A 3APSA 1GWCA 5LNKe 2B1LA 4MZCA 2ZNMA 4V1Ag 3K8NA 3ZMLA 5CNWA 18GSA 1XWKA 1PD21 4GQCA 5G30A 5CAXA 3UBLA 5ECHB 3QOUA 3TKSC 4AJ7A 3DEXA 1ZL9A 1EV4A 4XRDA 3M1GA 2RUFA 1MD3A 1B4PA 1WJKA 1ZYQB 3CSIA 4N11A 2B5YA 1GSYA 1F2EA 4NPBA 4CW9A 4OFNA 5B8AA 1EEJA 1K0CA 1LJRA 4L5OA 3TOUA 4GQFA 1ERTA 2YZUA 2P31A 2R2JA 3MSZA 4O92A 2P5QA 3GIXA 1NSWA 2H74A 2VO4A 3KEBA 1GL8A 1DE2A 2VM2A 1OVNA 1GTAA 1URMA 1IYIA 3TKSA 4MH3A 4I2UA 1GSFA 1O8WA 4ILFA 1U3IA 5ECPB 2VM1A 3MDKA 4WKWA 2DJKA 1DBYA 1XOAA 2H8LA 4OMVA 5E59A 2F8FA 4NHZA 2VCTA 3HDCA 5B6MA 17GSA 3IAS2 2AB6A 1EWXA 2NVLA 3PINA 5A4VA 3N5OA 5JWRB 1TI1A 5F8BA 1XWCA 3ERFA 3FZ9A 4GRFA 4FO5A 3L9UA 4ZB9A 3F4SA 5JCGA 2FCHA 4LLRA 3QR6A 4HQZA 3C73A 5IO2A 2DBCA 3C1SA 2LRCA 2HXKA 1PKZA 3BCKA 2VL9A 1TP9A 1WRYA 3KMOA 3TKSE 3J7Yk 1EP8A 1ZYEA 5IMFA 4IN0A 3ZRDA 1XW6A 1EOGA 3IK9A 1XOBA 1TW9A 4ML1A 3L9VA 2H0GA 3EVIA 4TOPA 1OC9A 2LKUA 2H0HA 1GULA 1GTBA 5DJLA 4I8BA 2EIQA 3D22A 1EEMA 2F3MA 4X0XA 2R37A 1MDJA 2B1KA 5IQYA 4ID0A 3G7YA 4F9ZA 5J41A 4ECBA 2L4QA 2YWOA 3F6DA 3A2WA 1FVJA 2GGTA 5EPFA 3HHVA 2MBSA 1TU8A 3KJYA 2BTOT 4JZQA 2GS3A 3U6VA 1AIUA 2H0IA 2FGXA 5AN1A 1XFLA 3UAPA 2LTKA 2FA4A 3TKRA 1Z6NA 1NHOA 3V1WA 5KN0A 1Z6MA 2P0GA 3BOAA 3TRQA 1GTUA 2O87A 2RM5A 1XCCA 3OR5A 5GSSA 2K18A 2IJYA 1S3CA 3D4MA 3P7XA 2EC4A 4IP6A 3LFLA 1X9MB 2KOKA 3GTUA 3IK7A 5B7CA 1A0FA 3EMXA 1UN2A 3VI7A 2I4AA 4X43A 1B48A 1THXA 1JLVA 1PSQA 1T00A 4PQIA 2OE3A 3HA9A 5G5EA 2AYTA 3IBHA 1SL1B 4IELA 2M80A 3EINA 3QD9A 1Q4JA 1SKSB 2GQLA 2IMKA 2R6KA 4TXOB 2QSIA 1BYEA 6GSWA 1ON4A 2LEGA 3GA4A 4IJIA 3M0FA 3F4TA 5D9TA 1HYUA 1OC8A 2H72A 2VLTA 1B9XC 1SD9A 1YEXA 4MK3A 1TRWA 2C8UA 4GWRA 4POBA 2HZEA 1GSEA 4L0WA 3CTFA 5DALB 4N0VA 3LYKA 3C7MA 3HD5A 2CA8A 2JSZA 5ECLB 4ZBDA 3WGXA 2TRCP 4EDZA 3FZ4A 1O7UA 1YQ1A 4MPFA 3D5JA 4IKHA 5HFKA 1SU9A 4WR5A 3QFAC 2B7KA 3Q18A 4NV2A 4XS4A 1V57A 3F0IA 3VLNA 5DAKB 3IAM2 3M3MA 4NWYA 2GSRA 3KMNA 3KP8A 2VD1A 1YZXA 3WGDA 2X8HA 1XBSA 3LSZA 2H01A 1R5PA 2CZ2A 2HSHA 4TW5A 3FR3A 5H5RA 1C72A 5IMVA 4WR4A 3WGEA 3EWLA 1YEPA 2GVPA 4KDXA 3IOSA 2FY6A 1WWJA 2DMLA 1VF4A 4JU5A 1U88A 4JEDA 3IPZA 4ZL8A 2C0GA 5D9VA 2CAQA 3GX0A 4BWSA 2DJ3A 2JACA 3TJFA 1XVQA 4OWYA 4YH2A 1K3OA 3GNJA 3D4TA 2TIRA 4JR6A 2OJLA 5IMZA 2YN1A 1V40A 1V9WA 5ECQB 4X1UA 5H5SA 3APQA 4ACSA 3GX8A 3DD3A 3LXZA 3ERWA 5KN1A 2PWJA 2YPMA 1J08A 2B3SA 2PUKC 1JHBA 2LS5A 3KH9A 4L8EA 1PRXA 5G2ZA 3Q6OA 2TRXA 1PA3A 1QGVA 4TR3A 3RDWA 2B5XA 4J57E 2DMMA 1S3DA 8GSSA 1ERWA 4DSSB 2IFQA 1G0TA 1QK8A 2CX4A 2H75A 1JZOA 4HOJA 2DC5A 1U87A 1TK0B 1FO5A 4BWQA 4K7OA 3LWAA 2DIZA 2H76A 4G10A 5A4WA 1W89A 1T1VA 2FWGA 2FWFA 2WFCA 3R2QA 4HU9A 2XHFA 1A8LA 1R5AA 2IMEA 3HZ4A 3GRXA 1Y25A 5GAND 2CX3A 1K0NA 3A2VA 2RLIA 1T3BA 2OE0A 14GSA 4MLYA 1YJ6A 4OFTA 4YQMA 3F9UA 2CAIA 3KZQA 3LG6A 3ME8A 4ZBAA 1MDIA 3EYTA 3GMFA 2V32A 1GNWA 3E0UA 4ECIA 3FZ5A 3CMIA 1W4VA 2KUCA 1Z9HA 5JWOB 1T8EB 3HJOA 2NDOA 2O85A 4MF6A 1FOVA 2R5GA 1OC3A 2N5BA 1A8YA 5H5QA 2L5OA 4KCEA 1VF2A 2HNLA 3FR6A 4BPYA 1TXXA 3FK8A 3ZL5A 3BBYA 4K0NA 1GSUA 3QPMA 3FYGA 4D73B 4KSOA 5F05A 5CO3A 2XPEA 2H66A 4NXIA 1XWGA 3F4RA 5FHIA 1WP0A 2O8VB 1M2AA 5ID2A 5D8IA 4POKA 5DBQA 1ERVA 2YZHA 3HCZA 1X5DA 4KNDA 1ABAA 2VL2C 3D0ZA 4KGIA 2H71A 2HE3A 1QFNA 2AJQB 3LORA 1XIYA 4ECJA 13GSA 11GSA 3IR4A 2H6YA 2LJRA 2XBQA 4E8EA 2K8VA 4WF4A 3L4NA 5FT3A 1TRVA 5B6NA 4KH7A 4HDEA 2H6ZA 3TDGA 3GSSA 1K0MA 5FWGA 1LU4A 4RQXA 3ZFBA 4N10A 2GSSA 3GL3A 1GRXA 3GV1A 1A2MA 5ECOB 2OA7A 3ZZXA 1JLWA 3TRPA 1N8JA 3QAWA 2GT6A 2DIYA 4LMWA 3U5RE 1A2LA 1DE1A 3GKKA 5LD0A 3VWXA 1PMTA 4V2NA 4FYCA 1XW5A 5G5FA 2N5AA 4K7IA 3KCMA 2VL2A 3UARA 5DQSA 3CSHA 3F6FA 4WEYA 5JCUA 12GSA 4EUYA 5CREA 2JSYA 1AC1A 4MJEA 1JZDA 4GSTA 1HNCA 3LXTA 4PQ1A 1PGTA 2FWEA 5J9BA 6GSTA 2YOIA 1YF1A 3UVTA 1XWBA 2I3YA 1A0RP 3DRNA 4DSRA 4Q5NA 4YQVA 3KIJA 5CYYA 5F0GA 2DLXA 4OCEA 3HXSA 1T7PB 1ZCPA 3DVWA 3RHBA 1XXUA 2FUG2 3G9BA 4EKZA 4XRAA 2YV9A 4TR1A 1F3BA 3LJRA 3D21A 2RUEA 3WT1A 1V58A 3LQ7A 2QKEA 2H73A 4MA9A 1K0DA 4PXOA 2QGVA 2BMXA 2PGTA 1LBKA 1V98A 4N30A 1GLPA 5DAKA 3ZVJA 4YAVA 1THOA 1TRUA 2L6CA 4IP1A 2KLXA 2Z9SA 3HVSA 4J2FA 4HEA2 1MTCA 4TVEA 4I97A 3N9JA 1ZZYA 2WCIA 3W8SA 2C4JA 3M9JA 4EC0A 4XIHA 1AW9A 1Q98A 2HZFA 4IVFA 2PVQA 4XCSA 4KUNA 1K3LA 2C1YA 3WYWA 1ZGNA 5DCHA 4BA7A 4MZBA 2NTOA 3UMAA 1OYJA 4L5LA 4FH8A 4BVXA 3US3A 5B8BA 2LUSA 1SK0A 2LQOA 3ZTLA 4GSSA 2ZUPA 1N2AA 3FW2A 2GDRA 4LL4B 2BJXA 3A2XA 4OO4A 1B9YC 2WGRA 5AIXA 4EXJA 3GFKA 5IIZA 5CRWA 4TXVA 1BAYA 3F63A 5HQPA 2DJ0A 5IO0A 3UBKA 3UEMA 2ON7A 3P8WA 2AAWA 2IMDA 2MYGA 3MWHA 2HRFA 2C80A 1U6TA 4POMA 1SKRB 2CZ3A 3HJPA 1U3AA 2PN8A 4EF0A 3E9JB 1JZRA 4HS1A 3UL3A 3A5WA 5KN2A 3GKMA 1T4ZA 5D73A 1E2YA 2GQMA 4MP4A 3HVXA 4ZIJA 2HI7A 4AJ8A 5DQYA 2EIOA 1YKAA 2V41A 19GSA 2OKAA 4QQ7A 10GSA 1CQGA 5GAPD 3GUSA 4KAEA 1F37A 3AY8A 1TOFA 3HZ8A 4FYBA 3S9FA 2JZRA 1GTIA 1R26A 2JL4A 1G7OA 3I69A 2MBTA 4KW6A 1SJIA 2IMFA 2VAFA 1OKTA 1BJXA 4HQSA 2E0QA 3WT2A 4DEJA 4IQAA 3H79A 1BG5A 1HNAA 1BEDA 3GH9A 4KB3A 1G6YA 3QFBC 3CRUA 4P3YB 3DWVA 1XW9A 5ELAA 1OE7A 4ULXA 4GF0A 5F06A 3TUEA 4ZL7A 2N5FA 4OFMA 3W8JA 3TKPA 1OC9B 2WZ9A 1ST9A 22GSA 1ERUA 2ON5A 4NMUA 1YF0A 2GQKA 1ACVA 2YWMA 3FKFA 5AIVA 1X9WB 1VF3A 3DMLA 2C0FA 2CV4A 4RI7A 1F6MC 2YJ7A 2MMAA 3QCPA 2C3QA 2MMOA 3H8QA 2G2QA 4BL7A 3ZIVA 1GSQA 4IW9A 3RPNA 2OBIA 3FY7A 2GT5A 2KHPA 2LJAA 3GKXA 4RQRA 5HR2A 3UJ1A 4ECCA 2NPBA 1TDIA 2P5RA 4PX1A 5JCWA 5D96A 3GH6A 4RI6A 2YV7A 3HYPA 4V1Ap 3KH7A 2F8AA 1MDKA 3P2AA 2DSAA 2L4CA 4JE1A 2RIIA 3EC3A 5ECNB 3D6IA 3GYKA 1QQ2A 2NBSA 1PL1A 1H4OA 3DVXA 5IMDA 4V2MA 3GTUB 1NW2A 2JADA 3CYNA 1PX7A 4PGTA 4TR4A 1SYXA 5ECKB 1WMJA 3LEFA 1XWAA 4YAPA 2H19A 2HYXA 4WXTA 4OCFA 3UIWA 1X0RA 4BVYA 3QAVA 2LNTA 1EZKA 4HUAA 4V2LA 1EGRA 4LL1B 1K3YA 3MNGA 4H86A 1TK8B 3VURA 4MF5A 4ZB8A 4EVMA 3IE3A 3WD6A 4O32A 2YANA 1HQOA 4MMMA 3TJKA 3RHCA 3G7IA 5ENUA 4MJCA 1M9BA 1T4YA 4EO3A 2QC7A 2AUVA 4KDUA 2YWNA 4HZ4A 2E7PA 1MD4A 3EE2A 2B6MA 3BCIA 2KP1A 2HZEB 2CT6A 3QMXA 4CDOA 1PX6A 4IJ3A 1Z7RA 5HFIA 4ZILA 4OO5A 4PNFA 2IMIA 2RM6A 3HKRA 1O8XA 2E2GA 1O73A 3F8UA 1TK5B 3ZMKA 3BJ5A 1M2DA 5EY6A 1FB0A 4F0BA 5INYA 4HU7A 1GH2A 4MZWA 3GURA 3EMPA 5DJMA 2GZZA 4AJ6A 3FHKA 4NAXA 1M2BA 2KP2A 4G2EA 4XS4B 1K0BA 3J7Yb 1XZOA 4AF2A 2IN3A 4ISDA 2D2ZA 3O3TA 1USBA 2X64A 2WULA 5IPHA 3L78A 4XHMA 6GSVA 1KBNA 3DYRA 4XS6A 2PVOC 3UOMA 4G9HA 3L9SA 3EU3A 4DVCA 3G7JA 5E4WA 3I9V2 2ALBA 4NHWA 2HFDA 2K9FA 4K1FA 1RK4A 3TOTA 4ZL9A 3ZITA 3GKNA 3NIVA 2I9HA 2MZCA 1M99A 2XPDA 4EE0A 4XS1A 4E8HA 5IM9A 1TU7A 5J9CA 3PGTA 2GZPA 1BQ7A 5CRGA 2M72A 4MF7A 4I2TA 2VL3A 6GSUA 2L5LA 3ZFLA 1EOHA 5GSTA 3IHQA 1YY7A 1WOUA 4KX4A 5IOWA 3SWLA 3HJMA 4HI7A 4JR4A 3ERGA 2AV4A 2H1GA 5ELGA 3UVHA 4GCIA 2C3NA 1BX9A 1IYHA 5IOXA 1SJ6A 5GZZB 1GUHA 1Y6EA 2H70A 3ISOA 4EL1A 4TKYA 1K0OA 1PN9A 2K6VA 2H6XA 4J56E 6GSXA 1GLQA 1Z5YE 1SYRA 4PUFC 4IBPA 5C00A 3LYPA 2JU5A 3C1RA 2IFQB 2MMNA 4TXOA 2B7JA 3KP9A 2GTUA 1GUMA 5IMCA 2L59A 3VWUA 2HRNA 2CQ9A 3RAZA 1KTEA 4TR0A 1J9BA 2V2GA 4MJBA 3I43A 1AQWA 2CVDA 2OADA 2X8GA 2G0FA 1Z3EA 1CQHA 4GLTA 3GL5A 1A24A 1I9DA 5COHA 3NOFA 2GSTA 3ZVJD 2REMA 2L6DA 5DALA 3H1NA 2A4VA 3TJGA 1ZOFA 1FB6A 3EU4A 2J9HA 1B8XA 1TKDB 2C3TA 1GNEA 3IRAA 1SK2A 5CP1A 2VLUA 2R3XA 2V6KA 2WDUA 1PL2A 1GSSA 4IQ1A 5D9WA 1ZMAA 3MAKA 2O7KA 2YNXA 3VWVA 1DUGA 1KEBA 5A4UA 3HY2A 3TGZA 3FEUA 4Q5QA 2L57A 4ZBBA 3F3QA 3ME7A 1HD2A 4I6XA
chains in the Genus database with same CATH superfamily
4MABA 3GSTA 2V6OA 3FRCA 2VCWA 1OE8A 2AHEA 3TRXA 5ECRB 1QMVA 1TTZA 2FA8A 5CRHA 2LNSA 1GP1A 3APOA 2HT9A 5HFGA 1O6JA 2OE1A 2F51A 3Q19A 4Q5RA 4XTSA 2PBJA 1SL2B 5J3RA 4QL7A 1WIKA 3VFIA 3O76A 4FYUA 1AQXA 1B4QA 1WPIA 2VCQA 2XBIA 2IIYA 2J23A 3E3EA 1M7TA 1TRSA 1X5CA 3ZREA 5ID2B 2WJUA 2DJ2A 1FG4A 4IGJA 1SKWB 1JZWA 1SENA 1J0FA 4PQHA 5IMAA 1KNGA 2C0EA 5KN3A 2YWIA 2F9SA 4IS0A 5HR0A 1AXDA 2HRKA 4DSQA 4POLA 1YKCA 1VRSD 4OD7A 4KE3A 3TB2A 3ED3A 1PKWA 2HLSA 4GTUA 1A2JA 3ZLPA 2DJJA 5D93A 1M9AA 4MNNA 2YCDA 4MPGA 5ECMB 3CBUA 2CVKA 3L0HA 3VPQA 2HSYA 3IV4A 4EDYA 1VGLA 2A2SA 2VCVA 3M9KA 4YQUA 2O89A 5DVBA 3GN3A 4N0ZA 3FZAA 3HVVA 3RPPA 1AUCA 4DSSA 3IDVA 2R4VA 9GSSA 4GSNA 2FLSA 4K7NA 4K6XA 3A3TA 3TCOA 2CVBA 1TJDA 1F9MA 2PPTA 3TJJA 3KGKA 1S3AA 4KCAA 1SJZA 2FHEA 5F07A 4F03A 3TKQA 2VLVA 1G6WA 1M0UA 2VIMA 5JWQB 1O85A 1SL0B 2WRTA 2EIRA 4JRRA 5HR1A 4WBJA 3KM6A 1MEKA 2ES7A 2LRTA 7GSSA 2GZYA 4IHUA 1OAZA 1V2AA 3VWWA 1QXHA 2FNOA 2WS2A 2DJ1A 3Q74A 3DXBA 1WE0A 3QDNA 1I5GA 2IL3A 1JFUA 4MH2A 4TR1B 5C04A 1TI3A 4MJAA 5A5KA 3F3RA 4Z7XA 3NZNA 5LCZA 1PQNA 1FVKA 4HZ2A 4KDYA 3IC4A 4Q5FA 3EURA 2H1AA 1EGOA 4G19A 3C71A 3DIEA 1EP7A 4NV5A 1K0AA 5ECIB 3O6TA 1GUKA 4FIWA 4CHSA 5AISA 2VUPA 2I81A 2IWTA 4PURA 4L0UA 1O81A 4D73A 4ZXGA 3JCML 4LMVA 2VCXA 1FW1A 1ML6A 2PMTA 2YP6A 1ILOA 2R0PA 1E6BA 2LV3A 4TN8A 1YDKA 5G1KA 4O7HA 2B5EA 2X99A 3W6GA 4WETA 3GHAA 2PU9C 4ML6A 3VI5A 2A2RA 1FHEA 3CRTA 3FR9A 2M46A 2I1UA 4BVXB 1UA5A 1R7HA 2C0DA 1DSBA 3LGCA 1RQMA 4MDCA 2MMZA 4HJ2A 1NM3A 2JZTA 2UZ8A 2H1DA 1R4WA 4JBBA 2GSQA 4PTSA 4K8MA 3QAGA 5EL8A 5DCGA 4RUVA 3SBCA 1AQVA 4KA0A 5ABRA 5J5NA 1HNBA 2K8SA 4K9ZA 3H4KA 3CSJA 5G1LA 3RBTA 4AGSA 1H75A 4PNGA 1XPVA 2FWHA 2HSMA 4O5RA 3IXRA 5G31A 5EVOA 5ECSA 5AGYA 4K0GA 1NHYA 2GLRA 4I5QA 1UC7A 3ZYWA 4TRXA 16GSA 5DDLA 1SD8A 4LA1A 3P90A 2A2PA 3VPTA 5HR3A 5J4UA 2LRNA 3I6AA 3TJBA 2JZSA 3ZIJA 2OBKA 3CXGA 3KTLA 3H93A 1A23A 2FD3A 2PERA 1AAZA 3KTBA 4HJMA 1X9SB 2E2MA 2H1BA 2LJKA 3KD0A 6GSSA 1G7EA 5IPGA 1SK1A 2IPAA 4ZB6A 1F3AA 3DGQA 1X5EA 3MIXA 4WF5A 2VCZA 3PH9A 4GXZA 1UVZA 6GSYA 2X8CA 5KEJA 4PUAA 3PR8A 4K5RA 4MCUA 1ZYNA 1OKDA 1Z7PA 3M8NA 2H30A 1GSDA 1QUWA 4F2IA 1RW1A 4F82A 4F0CA 3IA1A 4K2DA 3BD2A 4KSMA 3DKSA 5L71A 2WB9A 3KXOA 4QL9A 1VF1A 1EV9A 2XC2A 3CTGA 2LSTA 2VOCA 5D9XA 20GSA 2V1MA 3VK9A 2ZCTA 2LQQA 5CRDA 2YJHA 1FAAA 3C8EA 4WBRD 2OACA 1XVWA 2VD0A 3APSA 1GWCA 5LNKe 2B1LA 4MZCA 2ZNMA 4V1Ag 3K8NA 3ZMLA 5CNWA 18GSA 1XWKA 1PD21 4GQCA 5G30A 3MYDA 5CAXA 3UBLA 5ECHB 3QOUA 3TKSC 4AJ7A 4BL7B 3DEXA 1ZL9A 1EV4A 4XRDA 3R3EA 3M1GA 2RUFA 1MD3A 1B4PA 1WJKA 1ZYQB 3CSIA 5BRTA 4N11A 2B5YA 1GSYA 4Z2UA 1F2EA 4NPBA 4CW9A 4OFNA 5B8AA 1EEJA 1K0CA 4Z2RA 1LJRA 4O5UA 4L5OA 3TOUA 4GQFA 1ERTA 2YZUA 2P31A 2R2JA 3MSZA 4O92A 2P5QA 3GIXA 1NSWA 2H74A 2VO4A 3KEBA 4HSCX 1GL8A 1DE2A 2VM2A 1OVNA 4BVYB 1GTAA 1URMA 1IYIA 3TKSA 4MH3A 4I2UA 1GSFA 1O8WA 4ILFA 1U3IA 5ECPB 2VM1A 3MDKA 4WKWA 2DJKA 1DBYA 1XOAA 2H8LA 4OMVA 5E59A 2F8FA 4NHZA 2VCTA 3HDCA 5B6MA 17GSA 3IAS2 2AB6A 1EWXA 2NVLA 3PINA 5A4VA 3N5OA 5JWRB 1TI1A 5F8BA 1XWCA 3ERFA 3FZ9A 4GRFA 4FO5A 3L9UA 4ZB9A 3F4SA 5JCGA 2FCHA 4LLRA 3QR6A 4HQZA 3C73A 5IO2A 2DBCA 3C1SA 2LRCA 2HXKA 1PKZA 3BCKA 2VL9A 1TP9A 1WRYA 3KMOA 3TKSE 3J7Yk 1EP8A 4CY6A 1ZYEA 5IMFA 4IN0A 3ZRDA 1XW6A 1EOGA 3IK9A 1XOBA 1TW9A 2A4HA 5KOXA 4ML1A 3L9VA 2H0GA 3EVIA 4TOPA 1OC9A 2LKUA 2H0HA 1GULA 1GTBA 5DJLA 4I8BA 2EIQA 3D22A 1EEMA 2F3MA 4X0XA 2R37A 1MDJA 2B1KA 5IQYA 4ID0A 3G7YA 4F9ZA 5J41A 4ECBA 2L4QA 2YWOA 3F6DA 3A2WA 4YKFA 1FVJA 2GGTA 2QA1A 5EPFA 3HHVA 2MBSA 1TU8A 3KJYA 2BTOT 4JZQA 2GS3A 3U6VA 2DKIA 1AIUA 2H0IA 2FGXA 5AN1A 1XFLA 3UAPA 2LTKA 2FA4A 2HRAA 3TKRA 1Z6NA 1NHOA 3V1WA 4EIQA 3PPUA 5KN0A 1Z6MA 2P0GA 3BOAA 3TRQA 1GTUA 2O87A 2RM5A 1XCCA 3OR5A 5GSSA 2K18A 2IJYA 1S3CA 3D4MA 3P7XA 2EC4A 4IP6A 3LFLA 1X9MB 2KOKA 3GTUA 3IK7A 5B7CA 1A0FA 3EMXA 1UN2A 3VI7A 2I4AA 4X43A 1B48A 1THXA 1JLVA 1PSQA 1T00A 4PQIA 3CQFA 2OE3A 3HA9A 5G5EA 2AYTA 3IBHA 1SL1B 4IELA 2M80A 3EINA 3QD9A 1Q4JA 1SKSB 2GQLA 4G0IA 2IMKA 2R6KA 4TXOB 2QSIA 1BYEA 6GSWA 1ON4A 2LEGA 3GA4A 4IJIA 3M0FA 3F4TA 5D9TA 1HYUA 1OC8A 2H72A 2VLTA 1B9XC 1SD9A 1YEXA 4MK3A 1TRWA 2C8UA 4GWRA 4POBA 2HZEA 1GSEA 4L0WA 3CTFA 5DALB 4N0VA 3LYKA 3C7MA 3HD5A 2CA8A 2JSZA 5ECLB 4ZBDA 3WGXA 2TRCP 4EDZA 3FZ4A 5KOWA 1O7UA 1YQ1A 4MPFA 3D5JA 4IKHA 5HFKA 1SU9A 4WR5A 3QFAC 2B7KA 3Q18A 4ICYA 4NV2A 4XS4A 1V57A 3F0IA 3VLNA 5DAKB 3IAM2 3M3MA 4NWYA 2GSRA 3KMNA 3KP8A 2VD1A 1YZXA 3WGDA 2X8HA 1XBSA 3LSZA 2H01A 1R5PA 2CZ2A 2HSHA 4TW5A 3FR3A 5H5RA 1C72A 4BIKA 5IMVA 4WR4A 3WGEA 3EWLA 1YEPA 2GVPA 4KDXA 3IOSA 2FY6A 1WWJA 2DMLA 1VF4A 4JU5A 1U88A 4JEDA 3IPZA 4ZL8A 2C0GA 5D9VA 2CAQA 3GX0A 4BWSA 2DJ3A 2JACA 3TJFA 5BMUA 1XVQA 4OWYA 4YH2A 1XG8A 4K5SA 1K3OA 3GNJA 3D4TA 2TIRA 4JR6A 2OJLA 5IMZA 2YN1A 1V40A 1V9WA 5ECQB 4X1UA 5H5SA 3APQA 4ACSA 3GX8A 3DD3A 3LXZA 3ERWA 5KN1A 2PWJA 2YPMA 1J08A 2B3SA 2PUKC 1JHBA 2LS5A 3KH9A 4L8EA 1PRXA 5G2ZA 3Q6OA 2TRXA 1PA3A 1QGVA 4TR3A 3RDWA 2B5XA 4J57E 2DMMA 1S3DA 8GSSA 1ERWA 4DSSB 2IFQA 1G0TA 1QK8A 2CX4A 2H75A 1JZOA 4HOJA 2DC5A 1U87A 1TK0B 1FO5A 4BWQA 4K7OA 3LWAA 2DIZA 2H76A 4G10A 5A4WA 1W89A 1T1VA 2FWGA 2FWFA 2WFCA 3R2QA 4HU9A 2XHFA 1A8LA 1R5AA 2IMEA 3HZ4A 3GRXA 1Y25A 5GAND 2CX3A 1K0NA 3A2VA 2RLIA 1T3BA 2OE0A 14GSA 1S3RA 4MLYA 1YJ6A 4OFTA 4YQMA 3F9UA 2CAIA 3KZQA 3LG6A 3ME8A 4ZBAA 1MDIA 2QA2A 3EYTA 4G0LA 3GMFA 2V32A 1GNWA 3E0UA 4ECIA 3FZ5A 3CMIA 1W4VA 2KUCA 1Z9HA 5JWOB 1T8EB 3HJOA 2NDOA 2O85A 4MF6A 1FOVA 2R5GA 1PFOA 1OC3A 2N5BA 1ZYPA 1A8YA 5H5QA 2L5OA 4KCEA 1VF2A 2HNLA 3FR6A 4BPYA 1TXXA 2X4AA 3FK8A 3ZL5A 3BBYA 4K0NA 1GSUA 3QPMA 3FYGA 4D73B 4KSOA 5F05A 1FOHA 5CO3A 2XPEA 2H66A 4NXIA 1XWGA 3F4RA 5FHIA 1WP0A 2O8VB 1M2AA 5ID2A 5D8IA 4POKA 5DBQA 1ERVA 2YZHA 3HCZA 1X5DA 4KNDA 1ABAA 2VL2C 3D0ZA 4KGIA 2H71A 2HE3A 1QFNA 2AJQB 3LORA 1XIYA 4ECJA 1PN0A 13GSA 11GSA 3IR4A 2H6YA 2LJRA 2XBQA 3EPTA 4E8EA 2K8VA 4WF4A 3L4NA 5FT3A 1TRVA 5B6NA 4KH7A 4HDEA 2H6ZA 3TDGA 3GSSA 1K0MA 5FWGA 1LU4A 4RQXA 3ZFBA 4N10A 3IC8A 2GSSA 3GL3A 1GRXA 3GV1A 1A2MA 5ECOB 2OA7A 3ZZXA 1JLWA 3TRPA 1N8JA 3QAWA 2GT6A 2DIYA 4LMWA 3U5RE 1A2LA 1DE1A 3GKKA 5LD0A 3VWXA 1PMTA 4V2NA 4FYCA 1XW5A 5G5FA 2N5AA 4K7IA 3KCMA 2VL2A 3UARA 5DQSA 3CSHA 3F6FA 4WEYA 5JCUA 12GSA 4EUYA 5CREA 2JSYA 1AC1A 4MJEA 1JZDA 4GSTA 1HNCA 3LXTA 4PQ1A 1PGTA 2FWEA 5J9BA 6GSTA 2YOIA 1YF1A 3UVTA 1XWBA 2I3YA 1A0RP 3DRNA 4DSRA 4Q5NA 4YQVA 3KIJA 5CYYA 5F0GA 2DLXA 4OCEA 3HXSA 1T7PB 1ZCPA 3DVWA 3RHBA 1XXUA 2FUG2 3G9BA 4EKZA 4XRAA 2YV9A 4TR1A 1F3BA 3LJRA 3D21A 2RUEA 3WT1A 1V58A 3LQ7A 2QKEA 2H73A 4MA9A 1K0DA 4PXOA 2QGVA 2BMXA 2PGTA 1LBKA 1V98A 4N30A 1GLPA 5DAKA 2X49A 3ZVJA 4YAVA 1THOA 1TRUA 2L6CA 4IP1A 2KLXA 2Z9SA 3HVSA 4J2FA 1M3IA 4HEA2 1MTCA 4TVEA 4I97A 3N9JA 1ZZYA 2WCIA 3W8SA 2C4JA 3M9JA 4EC0A 4XIHA 1AW9A 1Q98A 2HZFA 4IVFA 2PVQA 4XCSA 4KUNA 1K3LA 2C1YA 3WYWA 1ZGNA 4O5QA 5DCHA 4BA7A 4MZBA 2NTOA 3UMAA 1OYJA 4L5LA 4FH8A 4BVXA 3US3A 3A5IA 5B8BA 2LUSA 1SK0A 2LQOA 3ZTLA 4GSSA 2ZUPA 1N2AA 3FW2A 2GDRA 4LL4B 2BJXA 3A2XA 4OO4A 1B9YC 2WGRA 5AIXA 4EXJA 3GFKA 5IIZA 5CRWA 4TXVA 1BAYA 3F63A 5HQPA 2DJ0A 5IO0A 3UBKA 3UEMA 4K2XA 2ON7A 3P8WA 2AAWA 2IMDA 2MYGA 3MWHA 4YKGA 2HRFA 2C80A 1U6TA 4POMA 1SKRB 2CZ3A 3HJPA 1U3AA 2PN8A 4EF0A 3E9JB 4Z2TA 1JZRA 4HS1A 3UL3A 3A5WA 5KN2A 3GKMA 1T4ZA 5D73A 1E2YA 2GQMA 4MP4A 3HVXA 4ZIJA 4G0KA 2HI7A 4AJ8A 5DQYA 2EIOA 1YKAA 2V41A 19GSA 2OKAA 4QQ7A 10GSA 1CQGA 5GAPD 3GUSA 4KAEA 1F37A 3AY8A 3LW9A 1TOFA 3HZ8A 4FYBA 3S9FA 2JZRA 1GTIA 1R26A 2JL4A 1G7OA 3I69A 2MBTA 4KW6A 1SJIA 2IMFA 2VAFA 1OKTA 1BJXA 4HQSA 2E0QA 3WT2A 4DEJA 4IQAA 3H79A 1BG5A 1HNAA 1BEDA 3GH9A 4KB3A 1G6YA 3QFBC 3CRUA 4P3YB 3DWVA 1XW9A 5ELAA 1OE7A 4ULXA 4GF0A 5F06A 3TUEA 4ZL7A 2N5FA 4OFMA 3W8JA 3TKPA 1OC9B 2WZ9A 1ST9A 22GSA 1ERUA 2ON5A 4NMUA 1YF0A 2GQKA 1ACVA 2YWMA 3FKFA 5AIVA 1X9WB 1VF3A 3DMLA 2C0FA 2CV4A 4RI7A 1F6MC 2YJ7A 2MMAA 3QCPA 2C3QA 2MMOA 3H8QA 2G2QA 4BL7A 3ZIVA 1GSQA 4IW9A 3RPNA 2OBIA 3FY7A 2GT5A 2KHPA 2LJAA 3GKXA 4RQRA 5HR2A 3UJ1A 4ECCA 2NPBA 1TDIA 2P5RA 4PX1A 5JCWA 5D96A 3GH6A 4RI6A 2YV7A 3HYPA 4V1Ap 3KH7A 2F8AA 1MDKA 3P2AA 2DSAA 2L4CA 4JE1A 2RIIA 3EC3A 5ECNB 3D6IA 3GYKA 1QQ2A 2NBSA 1PL1A 1H4OA 3DVXA 5IMDA 4V2MA 2DKHA 3GTUB 1NW2A 2JADA 3CYNA 1PX7A 4PGTA 4TR4A 1SYXA 3HVNA 5ECKB 2R0CA 1WMJA 3LEFA 1XWAA 4YAPA 2H19A 2HYXA 4WXTA 4OCFA 3UIWA 1X0RA 4BVYA 3QAVA 2LNTA 1EZKA 4HUAA 4V2LA 1EGRA 4LL1B 1K3YA 3MNGA 4H86A 1TK8B 3VURA 4MF5A 4ZB8A 4EVMA 3IE3A 3WD6A 4O32A 2YANA 1HQOA 4MMMA 3TJKA 3RHCA 3G7IA 5ENUA 4MJCA 1M9BA 1T4YA 4EO3A 2R0GA 2QC7A 2AUVA 4KDUA 4EIPA 4X4JA 2YWNA 4HZ4A 2E7PA 1MD4A 3EE2A 2B6MA 3BCIA 2KP1A 2HZEB 2CT6A 3QMXA 4CDOA 1PX6A 4IJ3A 1Z7RA 5HFIA 4ZILA 4OO5A 4PNFA 2IMIA 4CY8A 2RM6A 3HKRA 1O8XA 2E2GA 1O73A 3F8UA 1TK5B 3ZMKA 3BJ5A 1M2DA 5EY6A 1FB0A 4F0BA 5INYA 4HU7A 1GH2A 4MZWA 3GURA 3EMPA 5DJMA 2GZZA 4AJ6A 3FHKA 4NAXA 1M2BA 2KP2A 4G2EA 4XS4B 1K0BA 3J7Yb 1XZOA 4AF2A 2IN3A 4ISDA 2D2ZA 3O3TA 1USBA 2X64A 2WULA 5IPHA 3L78A 4XHMA 6GSVA 1KBNA 3DYRA 4XS6A 2PVOC 3UOMA 4G9HA 3L9SA 3EU3A 4DVCA 3G7JA 5E4WA 3I9V2 2ALBA 4NHWA 2HFDA 2K9FA 4K1FA 1RK4A 3TOTA 4ZL9A 3ZITA 3GKNA 3NIVA 2I9HA 2MZCA 1M99A 2XPDA 4EE0A 4XS1A 4E8HA 5IM9A 1TU7A 5J9CA 3PGTA 2GZPA 1BQ7A 5CRGA 2M72A 4MF7A 4I2TA 2VL3A 6GSUA 2L5LA 3ZFLA 1EOHA 5GSTA 3IHQA 1YY7A 4FQUA 1WOUA 4KX4A 5IOWA 3SWLA 3HJMA 4HI7A 4JR4A 3ERGA 2AV4A 4A5PA 2H1GA 5ELGA 3UVHA 4GCIA 2C3NA 1BX9A 1IYHA 5IOXA 1SJ6A 5GZZB 1GUHA 1Y6EA 2H70A 3ISOA 4EL1A 4TKYA 1K0OA 1PN9A 2K6VA 4USSA 2H6XA 4J56E 6GSXA 1GLQA 1Z5YE 1SYRA 4PUFC 4IBPA 5C00A 3LYPA 2JU5A 3C1RA 2IFQB 2MMNA 4TXOA 2B7JA 3KP9A 2GTUA 1GUMA 5IMCA 2L59A 3VWUA 2HRNA 2CQ9A 3RAZA 3IHGA 1KTEA 4TR0A 1J9BA 2V2GA 4MJBA 3I43A 1AQWA 2CVDA 2OADA 2X8GA 2G0FA 1Z3EA 1CQHA 4GLTA 3GL5A 1M3JA 1A24A 1I9DA 5COHA 3NOFA 2GSTA 3ZVJD 2REMA 2L6DA 5DALA 3H1NA 2A4VA 3TJGA 1ZOFA 1FB6A 3EU4A 2J9HA 1B8XA 1TKDB 2C3TA 1GNEA 3IRAA 1SK2A 5CP1A 2VLUA 2R3XA 2V6KA 2WDUA 1PL2A 1GSSA 4IQ1A 5D9WA 1ZMAA 3MAKA 2O7KA 2YNXA 4KF9A 3VWVA 1DUGA 1KEBA 3FMWA 5A4UA 3HY2A 3TGZA 3FEUA 4Q5QA 2L57A 4ZBBA 3F3QA 3ME7A 1HD2A 4I6XA
chains in the Genus database with same CATH topology
4MABA 3GSTA 2V6OA 3FRCA 2VCWA 1OE8A 2AHEA 3TRXA 5ECRB 1QMVA 1TTZA 2FA8A 5CRHA 2LNSA 1GP1A 3APOA 2HT9A 5HFGA 1O6JA 2OE1A 2F51A 3Q19A 4Q5RA 4XTSA 2PBJA 1SL2B 5J3RA 4QL7A 1WIKA 3VFIA 3O76A 4FYUA 1AQXA 1B4QA 1WPIA 2VCQA 2XBIA 2IIYA 2J23A 3E3EA 1M7TA 1TRSA 1X5CA 3ZREA 5ID2B 2WJUA 2DJ2A 1FG4A 4IGJA 1SKWB 1JZWA 1SENA 1J0FA 4PQHA 5IMAA 1KNGA 2C0EA 5KN3A 2YWIA 2F9SA 4IS0A 5HR0A 1AXDA 2HRKA 4DSQA 4POLA 1YKCA 1VRSD 4OD7A 4KE3A 3TB2A 3ED3A 1PKWA 2HLSA 4GTUA 1A2JA 3ZLPA 2DJJA 5D93A 1M9AA 4MNNA 2YCDA 4MPGA 5ECMB 3CBUA 2CVKA 3L0HA 3VPQA 2HSYA 3IV4A 4EDYA 1VGLA 2A2SA 2VCVA 3M9KA 4YQUA 2O89A 5DVBA 3GN3A 4N0ZA 3FZAA 3HVVA 3RPPA 1AUCA 4DSSA 3IDVA 2R4VA 9GSSA 4GSNA 2FLSA 4K7NA 4K6XA 3A3TA 3TCOA 2CVBA 1TJDA 1F9MA 2PPTA 3TJJA 3KGKA 1S3AA 4KCAA 1SJZA 2FHEA 5F07A 4F03A 3TKQA 2VLVA 1G6WA 1M0UA 2VIMA 5JWQB 1O85A 1SL0B 2WRTA 2EIRA 4JRRA 5HR1A 4WBJA 3KM6A 1MEKA 2ES7A 2LRTA 7GSSA 2GZYA 4IHUA 1OAZA 1V2AA 3VWWA 1QXHA 2FNOA 2WS2A 2DJ1A 3Q74A 3DXBA 1WE0A 3QDNA 1I5GA 2IL3A 1JFUA 4MH2A 4TR1B 5C04A 1TI3A 4MJAA 5A5KA 3F3RA 4Z7XA 3NZNA 5LCZA 1PQNA 1FVKA 4HZ2A 4KDYA 3IC4A 4Q5FA 3EURA 2H1AA 1EGOA 4G19A 3C71A 3DIEA 1EP7A 4NV5A 1K0AA 5ECIB 3O6TA 1GUKA 4FIWA 4CHSA 5AISA 2VUPA 2I81A 2IWTA 4PURA 4L0UA 1O81A 4D73A 4ZXGA 3JCML 4LMVA 2VCXA 1FW1A 1ML6A 2PMTA 2YP6A 1ILOA 2R0PA 1E6BA 2LV3A 4TN8A 1YDKA 5G1KA 4O7HA 2B5EA 2X99A 3W6GA 4WETA 3GHAA 2PU9C 4ML6A 3VI5A 2A2RA 1FHEA 3CRTA 3FR9A 2M46A 2I1UA 4BVXB 1UA5A 1R7HA 2C0DA 1DSBA 3LGCA 1RQMA 4MDCA 2MMZA 4HJ2A 1NM3A 2JZTA 2UZ8A 2H1DA 1R4WA 4JBBA 2GSQA 4PTSA 4K8MA 3QAGA 5EL8A 5DCGA 4RUVA 3SBCA 1AQVA 4KA0A 5ABRA 5J5NA 1HNBA 2K8SA 4K9ZA 3H4KA 3CSJA 5G1LA 3RBTA 4AGSA 1H75A 4PNGA 1XPVA 2FWHA 2HSMA 4O5RA 3IXRA 5G31A 5EVOA 5ECSA 5AGYA 4K0GA 1NHYA 2GLRA 4I5QA 1UC7A 3ZYWA 4TRXA 16GSA 5DDLA 1SD8A 4LA1A 3P90A 2A2PA 3VPTA 5HR3A 5J4UA 2LRNA 3I6AA 3TJBA 2JZSA 3ZIJA 2OBKA 3CXGA 3KTLA 3H93A 1A23A 2FD3A 2PERA 1AAZA 3KTBA 4HJMA 1X9SB 2E2MA 2H1BA 2LJKA 3KD0A 6GSSA 1G7EA 5IPGA 1SK1A 2IPAA 4ZB6A 1F3AA 3DGQA 1X5EA 3MIXA 4WF5A 2VCZA 3PH9A 4GXZA 1UVZA 6GSYA 2X8CA 5KEJA 4PUAA 3PR8A 4K5RA 4MCUA 1ZYNA 1OKDA 1Z7PA 3M8NA 2H30A 1GSDA 1QUWA 4F2IA 1RW1A 4F82A 4F0CA 3IA1A 4K2DA 3BD2A 4KSMA 3DKSA 5L71A 2WB9A 3KXOA 4QL9A 1VF1A 1EV9A 2XC2A 3CTGA 2LSTA 2VOCA 5D9XA 20GSA 2V1MA 3VK9A 2ZCTA 2LQQA 5CRDA 2YJHA 1FAAA 3C8EA 4WBRD 2OACA 1XVWA 2VD0A 3APSA 1GWCA 5LNKe 2B1LA 4MZCA 2ZNMA 4V1Ag 3K8NA 3ZMLA 5CNWA 18GSA 1XWKA 1PD21 4GQCA 5G30A 3MYDA 5CAXA 3UBLA 5ECHB 3QOUA 3TKSC 4AJ7A 4BL7B 3DEXA 1ZL9A 1EV4A 4XRDA 3R3EA 3M1GA 2RUFA 1MD3A 1B4PA 1WJKA 1ZYQB 3CSIA 5BRTA 4N11A 2B5YA 1GSYA 4Z2UA 1F2EA 4NPBA 4CW9A 4OFNA 5B8AA 1EEJA 1K0CA 4Z2RA 1LJRA 4O5UA 4L5OA 3TOUA 4GQFA 1ERTA 2YZUA 2P31A 2R2JA 3MSZA 4O92A 2P5QA 3GIXA 1NSWA 2H74A 2VO4A 3KEBA 1GL8A 1DE2A 2VM2A 1OVNA 4BVYB 1GTAA 1URMA 1IYIA 3TKSA 4MH3A 4I2UA 1GSFA 1O8WA 4ILFA 1U3IA 5ECPB 2VM1A 3MDKA 4WKWA 2DJKA 1DBYA 1XOAA 2H8LA 4OMVA 5E59A 2F8FA 4NHZA 2VCTA 3HDCA 5B6MA 17GSA 3IAS2 2AB6A 1EWXA 2NVLA 3PINA 5A4VA 3N5OA 5JWRB 1TI1A 5F8BA 1XWCA 3ERFA 3FZ9A 4GRFA 4FO5A 3L9UA 4ZB9A 3F4SA 5JCGA 2FCHA 4LLRA 3QR6A 4HQZA 3C73A 5IO2A 2DBCA 3C1SA 2LRCA 2HXKA 1PKZA 3BCKA 2VL9A 1TP9A 1WRYA 3KMOA 3TKSE 3J7Yk 1EP8A 4CY6A 1ZYEA 5IMFA 4IN0A 3ZRDA 1XW6A 1EOGA 3IK9A 1XOBA 1TW9A 2A4HA 5KOXA 4ML1A 3L9VA 2H0GA 3EVIA 4TOPA 1OC9A 2LKUA 2H0HA 1GULA 1GTBA 5DJLA 4I8BA 2EIQA 3D22A 1EEMA 2F3MA 4X0XA 2R37A 1MDJA 2B1KA 5IQYA 4ID0A 3G7YA 4F9ZA 5J41A 4ECBA 2L4QA 2YWOA 3F6DA 3A2WA 4YKFA 1FVJA 2GGTA 2QA1A 5EPFA 3HHVA 2MBSA 1TU8A 3KJYA 2BTOT 4JZQA 2GS3A 3U6VA 2DKIA 1AIUA 2H0IA 2FGXA 5AN1A 1XFLA 3UAPA 2LTKA 2FA4A 2HRAA 3TKRA 1Z6NA 1NHOA 3V1WA 4EIQA 3PPUA 5KN0A 1Z6MA 2P0GA 3BOAA 3TRQA 1GTUA 2O87A 2RM5A 1XCCA 3OR5A 5GSSA 2K18A 2IJYA 1S3CA 3D4MA 3P7XA 2EC4A 4IP6A 3LFLA 1X9MB 2KOKA 3GTUA 3IK7A 5B7CA 1A0FA 3EMXA 1UN2A 3VI7A 2I4AA 4X43A 1B48A 1THXA 1JLVA 1PSQA 1T00A 4PQIA 2OE3A 3HA9A 5G5EA 2AYTA 3IBHA 1SL1B 4IELA 2M80A 3EINA 3QD9A 1Q4JA 1SKSB 2GQLA 4G0IA 2IMKA 2R6KA 4TXOB 2QSIA 1BYEA 6GSWA 1ON4A 2LEGA 3GA4A 4IJIA 3M0FA 3F4TA 5D9TA 1HYUA 1OC8A 2H72A 2VLTA 1B9XC 1SD9A 1YEXA 4MK3A 1TRWA 2C8UA 4GWRA 4POBA 2HZEA 1GSEA 4L0WA 3CTFA 5DALB 4N0VA 3LYKA 3C7MA 3HD5A 2CA8A 2JSZA 5ECLB 4ZBDA 3WGXA 2TRCP 4EDZA 3FZ4A 5KOWA 1O7UA 1YQ1A 4MPFA 3D5JA 4IKHA 5HFKA 1SU9A 4WR5A 3QFAC 2B7KA 3Q18A 4ICYA 4NV2A 4XS4A 1V57A 3F0IA 3VLNA 5DAKB 3IAM2 3M3MA 4NWYA 2GSRA 3KMNA 3KP8A 2VD1A 1YZXA 3WGDA 2X8HA 1XBSA 3LSZA 2H01A 1R5PA 2CZ2A 2HSHA 4TW5A 3FR3A 5H5RA 1C72A 5IMVA 4WR4A 3WGEA 3EWLA 1YEPA 2GVPA 4KDXA 3IOSA 2FY6A 1WWJA 2DMLA 1VF4A 4JU5A 1U88A 4JEDA 3IPZA 4ZL8A 2C0GA 5D9VA 2CAQA 3GX0A 4BWSA 2DJ3A 2JACA 3TJFA 5BMUA 1XVQA 4OWYA 4YH2A 4K5SA 1K3OA 3GNJA 3D4TA 2TIRA 4JR6A 2OJLA 5IMZA 2YN1A 1V40A 1V9WA 5ECQB 4X1UA 5H5SA 3APQA 4ACSA 3GX8A 3DD3A 3LXZA 3ERWA 5KN1A 2PWJA 2YPMA 1J08A 2B3SA 2PUKC 1JHBA 2LS5A 3KH9A 4L8EA 1PRXA 5G2ZA 3Q6OA 2TRXA 1PA3A 1QGVA 4TR3A 3RDWA 2B5XA 4J57E 2DMMA 1S3DA 8GSSA 1ERWA 4DSSB 2IFQA 1G0TA 1QK8A 2CX4A 2H75A 1JZOA 4HOJA 2DC5A 1U87A 1TK0B 1FO5A 4BWQA 4K7OA 3LWAA 2DIZA 2H76A 4G10A 5A4WA 1W89A 1T1VA 2FWGA 2FWFA 2WFCA 3R2QA 4HU9A 2XHFA 1A8LA 1R5AA 2IMEA 3HZ4A 3GRXA 1Y25A 5GAND 2CX3A 1K0NA 3A2VA 2RLIA 1T3BA 2OE0A 14GSA 4MLYA 1YJ6A 4OFTA 4YQMA 3F9UA 2CAIA 3KZQA 3LG6A 3ME8A 4ZBAA 1MDIA 2QA2A 3EYTA 4G0LA 3GMFA 2V32A 1GNWA 3E0UA 4ECIA 3FZ5A 3CMIA 1W4VA 2KUCA 1Z9HA 5JWOB 1T8EB 3HJOA 2NDOA 2O85A 4MF6A 1FOVA 2R5GA 1OC3A 2N5BA 1ZYPA 1A8YA 5H5QA 2L5OA 4KCEA 1VF2A 2HNLA 3FR6A 4BPYA 1TXXA 2X4AA 3FK8A 3ZL5A 3BBYA 4K0NA 1GSUA 3QPMA 3FYGA 4D73B 4KSOA 5F05A 1FOHA 5CO3A 2XPEA 2H66A 4NXIA 1XWGA 3F4RA 5FHIA 1WP0A 2O8VB 1M2AA 5ID2A 5D8IA 4POKA 5DBQA 1ERVA 2YZHA 3HCZA 1X5DA 4KNDA 1ABAA 2VL2C 3D0ZA 4KGIA 2H71A 2HE3A 1QFNA 2AJQB 3LORA 1XIYA 4ECJA 1PN0A 13GSA 11GSA 3IR4A 2H6YA 2LJRA 2XBQA 3EPTA 4E8EA 2K8VA 4WF4A 3L4NA 5FT3A 1TRVA 5B6NA 4KH7A 4HDEA 2H6ZA 3TDGA 3GSSA 1K0MA 5FWGA 1LU4A 4RQXA 3ZFBA 4N10A 3IC8A 2GSSA 3GL3A 1GRXA 3GV1A 1A2MA 5ECOB 2OA7A 3ZZXA 1JLWA 3TRPA 1N8JA 3QAWA 2GT6A 2DIYA 4LMWA 3U5RE 1A2LA 1DE1A 3GKKA 5LD0A 3VWXA 1PMTA 4V2NA 4FYCA 1XW5A 5G5FA 2N5AA 4K7IA 3KCMA 2VL2A 3UARA 5DQSA 3CSHA 3F6FA 4WEYA 5JCUA 12GSA 4EUYA 5CREA 2JSYA 1AC1A 4MJEA 1JZDA 4GSTA 1HNCA 3LXTA 4PQ1A 1PGTA 2FWEA 5J9BA 6GSTA 2YOIA 1YF1A 3UVTA 1XWBA 2I3YA 1A0RP 3DRNA 4DSRA 4Q5NA 4YQVA 3KIJA 5CYYA 5F0GA 2DLXA 4OCEA 3HXSA 1T7PB 1ZCPA 3DVWA 3RHBA 1XXUA 2FUG2 3G9BA 4EKZA 4XRAA 2YV9A 4TR1A 1F3BA 3LJRA 3D21A 2RUEA 3WT1A 1V58A 3LQ7A 2QKEA 2H73A 4MA9A 1K0DA 4PXOA 2QGVA 2BMXA 2PGTA 1LBKA 1V98A 4N30A 1GLPA 5DAKA 2X49A 3ZVJA 4YAVA 1THOA 1TRUA 2L6CA 4IP1A 2KLXA 2Z9SA 3HVSA 4J2FA 4HEA2 1MTCA 4TVEA 4I97A 3N9JA 1ZZYA 2WCIA 3W8SA 2C4JA 3M9JA 4EC0A 4XIHA 1AW9A 1Q98A 2HZFA 4IVFA 2PVQA 4XCSA 4KUNA 1K3LA 2C1YA 3WYWA 1ZGNA 4O5QA 5DCHA 4BA7A 4MZBA 2NTOA 3UMAA 1OYJA 4L5LA 4FH8A 4BVXA 3US3A 3A5IA 5B8BA 2LUSA 1SK0A 2LQOA 3ZTLA 4GSSA 2ZUPA 1N2AA 3FW2A 2GDRA 4LL4B 2BJXA 3A2XA 4OO4A 1B9YC 2WGRA 5AIXA 4EXJA 3GFKA 5IIZA 5CRWA 4TXVA 1BAYA 3F63A 5HQPA 2DJ0A 5IO0A 3UBKA 3UEMA 4K2XA 2ON7A 3P8WA 2AAWA 2IMDA 2MYGA 3MWHA 4YKGA 2HRFA 2C80A 1U6TA 4POMA 1SKRB 2CZ3A 3HJPA 1U3AA 2PN8A 4EF0A 3E9JB 4Z2TA 1JZRA 4HS1A 3UL3A 3A5WA 5KN2A 3GKMA 1T4ZA 5D73A 1E2YA 2GQMA 4MP4A 3HVXA 4ZIJA 4G0KA 2HI7A 4AJ8A 5DQYA 2EIOA 1YKAA 2V41A 19GSA 2OKAA 4QQ7A 10GSA 1CQGA 5GAPD 3GUSA 4KAEA 1F37A 3AY8A 3LW9A 1TOFA 3HZ8A 4FYBA 3S9FA 2JZRA 1GTIA 1R26A 2JL4A 1G7OA 3I69A 2MBTA 4KW6A 1SJIA 2IMFA 2VAFA 1OKTA 1BJXA 4HQSA 2E0QA 3WT2A 4DEJA 4IQAA 3H79A 1BG5A 1HNAA 1BEDA 3GH9A 4KB3A 1G6YA 3QFBC 3CRUA 4P3YB 3DWVA 1XW9A 5ELAA 1OE7A 4ULXA 4GF0A 5F06A 3TUEA 4ZL7A 2N5FA 4OFMA 3W8JA 3TKPA 1OC9B 2WZ9A 1ST9A 22GSA 1ERUA 2ON5A 4NMUA 1YF0A 2GQKA 1ACVA 2YWMA 3FKFA 5AIVA 1X9WB 1VF3A 3DMLA 2C0FA 2CV4A 4RI7A 1F6MC 2YJ7A 2MMAA 3QCPA 2C3QA 2MMOA 3H8QA 2G2QA 4BL7A 3ZIVA 1GSQA 4IW9A 3RPNA 2OBIA 3FY7A 2GT5A 2KHPA 2LJAA 3GKXA 4RQRA 5HR2A 3UJ1A 4ECCA 2NPBA 1TDIA 2P5RA 4PX1A 5JCWA 5D96A 3GH6A 4RI6A 2YV7A 3HYPA 4V1Ap 3KH7A 2F8AA 1MDKA 3P2AA 2DSAA 2L4CA 4JE1A 2RIIA 3EC3A 5ECNB 3D6IA 3GYKA 1QQ2A 2NBSA 1PL1A 1H4OA 3DVXA 5IMDA 4V2MA 2DKHA 3GTUB 1NW2A 2JADA 3CYNA 1PX7A 4PGTA 4TR4A 1SYXA 5ECKB 2R0CA 1WMJA 3LEFA 1XWAA 4YAPA 2H19A 2HYXA 4WXTA 4OCFA 3UIWA 1X0RA 4BVYA 3QAVA 2LNTA 1EZKA 4HUAA 4V2LA 1EGRA 4LL1B 1K3YA 3MNGA 4H86A 1TK8B 3VURA 4MF5A 4ZB8A 4EVMA 3IE3A 3WD6A 4O32A 2YANA 1HQOA 4MMMA 3TJKA 3RHCA 3G7IA 5ENUA 4MJCA 1M9BA 1T4YA 4EO3A 2R0GA 2QC7A 2AUVA 4KDUA 4EIPA 4X4JA 2YWNA 4HZ4A 2E7PA 1MD4A 3EE2A 2B6MA 3BCIA 2KP1A 2HZEB 2CT6A 3QMXA 4CDOA 1PX6A 4IJ3A 1Z7RA 5HFIA 4ZILA 4OO5A 4PNFA 2IMIA 4CY8A 2RM6A 3HKRA 1O8XA 2E2GA 1O73A 3F8UA 1TK5B 3ZMKA 3BJ5A 1M2DA 5EY6A 1FB0A 4F0BA 5INYA 4HU7A 1GH2A 4MZWA 3GURA 3EMPA 5DJMA 2GZZA 4AJ6A 3FHKA 4NAXA 1M2BA 2KP2A 4G2EA 4XS4B 1K0BA 3J7Yb 1XZOA 4AF2A 2IN3A 4ISDA 2D2ZA 3O3TA 1USBA 2X64A 2WULA 5IPHA 3L78A 4XHMA 6GSVA 1KBNA 3DYRA 4XS6A 2PVOC 3UOMA 4G9HA 3L9SA 3EU3A 4DVCA 3G7JA 5E4WA 3I9V2 2ALBA 4NHWA 2HFDA 2K9FA 4K1FA 1RK4A 3TOTA 4ZL9A 3ZITA 3GKNA 3NIVA 2I9HA 2MZCA 1M99A 2XPDA 4EE0A 4XS1A 4E8HA 5IM9A 1TU7A 5J9CA 3PGTA 2GZPA 1BQ7A 5CRGA 2M72A 4MF7A 4I2TA 2VL3A 6GSUA 2L5LA 3ZFLA 1EOHA 5GSTA 3IHQA 1YY7A 4FQUA 1WOUA 4KX4A 5IOWA 3SWLA 3HJMA 4HI7A 4JR4A 3ERGA 2AV4A 4A5PA 2H1GA 5ELGA 3UVHA 4GCIA 2C3NA 1BX9A 1IYHA 5IOXA 1SJ6A 5GZZB 1GUHA 1Y6EA 2H70A 3ISOA 4EL1A 4TKYA 1K0OA 1PN9A 2K6VA 4USSA 2H6XA 4J56E 6GSXA 1GLQA 1Z5YE 1SYRA 4PUFC 4IBPA 5C00A 3LYPA 2JU5A 3C1RA 2IFQB 2MMNA 4TXOA 2B7JA 3KP9A 2GTUA 1GUMA 5IMCA 2L59A 3VWUA 2HRNA 2CQ9A 3RAZA 3IHGA 1KTEA 4TR0A 1J9BA 2V2GA 4MJBA 3I43A 1AQWA 2CVDA 2OADA 2X8GA 2G0FA 1Z3EA 1CQHA 4GLTA 3GL5A 1A24A 1I9DA 5COHA 3NOFA 2GSTA 3ZVJD 2REMA 2L6DA 5DALA 3H1NA 2A4VA 3TJGA 1ZOFA 1FB6A 3EU4A 2J9HA 1B8XA 1TKDB 2C3TA 1GNEA 3IRAA 1SK2A 5CP1A 2VLUA 2R3XA 2V6KA 2WDUA 1PL2A 1GSSA 4IQ1A 5D9WA 1ZMAA 3MAKA 2O7KA 2YNXA 4KF9A 3VWVA 1DUGA 1KEBA 3FMWA 5A4UA 3HY2A 3TGZA 3FEUA 4Q5QA 2L57A 4ZBBA 3F3QA 3ME7A 1HD2A 4I6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAB A;  3GST A;  2V6O A;  3FRC A;  2VCW A;  1OE8 A;  2AHE A;  3TRX A;  5ECR B;  1QMV A;  1TTZ A;  2FA8 A;  5CRH A;  2LNS A;  1GP1 A;  3APO A;  2HT9 A;  5HFG A;  1O6J A;  2OE1 A;  2F51 A;  3Q19 A;  4Q5R A;  4XTS A;  2PBJ A;  1SL2 B;  5J3R A;  4QL7 A;  1WIK A;  3VFI A;  3O76 A;  4FYU A;  1AQX A;  1B4Q A;  1WPI A;  2VCQ A;  2XBI A;  2IIY A;  2J23 A;  3E3E A;  1M7T A;  1TRS A;  1X5C A;  3ZRE A;  5ID2 B;  2WJU A;  2DJ2 A;  1FG4 A;  4IGJ A;  1SKW B;  1JZW A;  1SEN A;  1J0F A;  4PQH A;  5IMA A;  1KNG A;  2C0E A;  5KN3 A;  2YWI A;  2F9S A;  4IS0 A;  5HR0 A;  1AXD A;  4DSQ A;  4POL A;  1YKC A;  1VRS D;  4OD7 A;  4KE3 A;  3TB2 A;  3ED3 A;  1PKW A;  2HLS A;  4GTU A;  1A2J A;  3ZLP A;  2DJJ A;  5D93 A;  1M9A A;  2YCD A;  4MPG A;  5ECM B;  3CBU A;  2CVK A;  3L0H A;  3VPQ A;  2HSY A;  3IV4 A;  4EDY A;  1VGL A;  2A2S A;  2VCV A;  3M9K A;  4YQU A;  2O89 A;  5DVB A;  3GN3 A;  4N0Z A;  3FZA A;  3HVV A;  3RPP A;  1AUC A;  4DSS A;  3IDV A;  2R4V A;  9GSS A;  4GSN A;  2FLS A;  4K7N A;  4K6X A;  3A3T A;  3TCO A;  2CVB A;  1TJD A;  1F9M A;  2PPT A;  3TJJ A;  3KGK A;  1S3A A;  4KCA A;  1SJZ A;  2FHE A;  5F07 A;  4F03 A;  3TKQ A;  2VLV A;  1G6W A;  1M0U A;  2VIM A;  5JWQ B;  1O85 A;  1SL0 B;  2WRT A;  2EIR A;  4JRR A;  5HR1 A;  4WBJ A;  3KM6 A;  1MEK A;  2ES7 A;  2LRT A;  7GSS A;  2GZY A;  4IHU A;  1OAZ A;  1V2A A;  3VWW A;  1QXH A;  2FNO A;  2WS2 A;  2DJ1 A;  3Q74 A;  3DXB A;  1WE0 A;  3QDN A;  1I5G A;  2IL3 A;  1JFU A;  4MH2 A;  4TR1 B;  5C04 A;  1TI3 A;  4MJA A;  5A5K A;  3F3R A;  4Z7X A;  3NZN A;  5LCZ A;  1PQN A;  1FVK A;  4HZ2 A;  4KDY A;  3IC4 A;  4Q5F A;  3EUR A;  2H1A A;  1EGO A;  4G19 A;  3C71 A;  3DIE A;  1EP7 A;  4NV5 A;  1K0A A;  5ECI B;  3O6T A;  1GUK A;  4FIW A;  4CHS A;  5AIS A;  2VUP A;  2I81 A;  2IWT A;  4PUR A;  4L0U A;  1O81 A;  4D73 A;  4ZXG A;  3JCM L;  4LMV A;  2VCX A;  1FW1 A;  1ML6 A;  2PMT A;  2YP6 A;  1ILO A;  1E6B A;  2LV3 A;  4TN8 A;  1YDK A;  5G1K A;  4O7H A;  2B5E A;  2X99 A;  3W6G A;  4WET A;  3GHA A;  2PU9 C;  4ML6 A;  3VI5 A;  2A2R A;  1FHE A;  3CRT A;  3FR9 A;  2M46 A;  2I1U A;  1UA5 A;  1R7H A;  2C0D A;  1DSB A;  3LGC A;  1RQM A;  4MDC A;  2MMZ A;  4HJ2 A;  1NM3 A;  2JZT A;  2H1D A;  1R4W A;  4JBB A;  2GSQ A;  4K8M A;  3QAG A;  5EL8 A;  5DCG A;  4RUV A;  3SBC A;  1AQV A;  4KA0 A;  5ABR A;  5J5N A;  1HNB A;  2K8S A;  4K9Z A;  3H4K A;  3CSJ A;  5G1L A;  3RBT A;  4AGS A;  1H75 A;  4PNG A;  1XPV A;  2FWH A;  4O5R A;  3IXR A;  5G31 A;  5EVO A;  5ECS A;  5AGY A;  4K0G A;  1NHY A;  2GLR A;  4I5Q A;  1UC7 A;  3ZYW A;  4TRX A;  16GS A;  5DDL A;  1SD8 A;  4LA1 A;  3P90 A;  3VPT A;  5HR3 A;  5J4U A;  2LRN A;  3I6A A;  3TJB A;  2JZS A;  3ZIJ A;  2OBK A;  3CXG A;  3KTL A;  3H93 A;  1A23 A;  2FD3 A;  2PER A;  1AAZ A;  3KTB A;  4HJM A;  1X9S B;  2E2M A;  2H1B A;  2LJK A;  3KD0 A;  6GSS A;  1G7E A;  5IPG A;  1SK1 A;  2IPA A;  4ZB6 A;  1F3A A;  3DGQ A;  1X5E A;  4WF5 A;  2VCZ A;  3PH9 A;  4GXZ A;  1UVZ A;  6GSY A;  2X8C A;  5KEJ A;  4PUA A;  3PR8 A;  4MCU A;  1OKD A;  1Z7P A;  3M8N A;  2H30 A;  1GSD A;  1QUW A;  4F2I A;  1RW1 A;  4F82 A;  4F0C A;  3IA1 A;  4K2D A;  3BD2 A;  4KSM A;  3DKS A;  5L71 A;  2WB9 A;  3KXO A;  4QL9 A;  1VF1 A;  1EV9 A;  2XC2 A;  3CTG A;  2LST A;  2VOC A;  5D9X A;  20GS A;  2V1M A;  3VK9 A;  2ZCT A;  2LQQ A;  5CRD A;  2YJH A;  1FAA A;  3C8E A;  4WBR D;  2OAC A;  1XVW A;  2VD0 A;  3APS A;  1GWC A;  5LNK e;  2B1L A;  4MZC A;  2ZNM A;  4V1A g;  3K8N A;  3ZML A;  5CNW A;  18GS A;  1XWK A;  1PD2 1;  4GQC A;  5G30 A;  5CAX A;  3UBL A;  5ECH B;  3QOU A;  3TKS C;  4AJ7 A;  3DEX A;  1ZL9 A;  1EV4 A;  4XRD A;  3M1G A;  2RUF A;  1MD3 A;  1B4P A;  1WJK A;  1ZYQ B;  3CSI A;  4N11 A;  2B5Y A;  1GSY A;  1F2E A;  4NPB A;  4CW9 A;  4OFN A;  5B8A A;  1EEJ A;  1K0C A;  1LJR A;  4L5O A;  3TOU A;  4GQF A;  1ERT A;  2YZU A;  2P31 A;  2R2J A;  3MSZ A;  4O92 A;  2P5Q A;  3GIX A;  1NSW A;  2H74 A;  2VO4 A;  3KEB A;  1GL8 A;  1DE2 A;  2VM2 A;  1OVN A;  1GTA A;  1URM A;  1IYI A;  3TKS A;  4MH3 A;  4I2U A;  1GSF A;  1O8W A;  4ILF A;  1U3I A;  5ECP B;  2VM1 A;  3MDK A;  4WKW A;  2DJK A;  1DBY A;  1XOA A;  2H8L A;  4OMV A;  5E59 A;  2F8F A;  4NHZ A;  2VCT A;  3HDC A;  5B6M A;  17GS A;  3IAS 2;  2AB6 A;  1EWX A;  2NVL A;  3PIN A;  5A4V A;  3N5O A;  5JWR B;  1TI1 A;  5F8B A;  1XWC A;  3ERF A;  3FZ9 A;  4GRF A;  4FO5 A;  3L9U A;  4ZB9 A;  3F4S A;  5JCG A;  2FCH A;  4LLR A;  3QR6 A;  4HQZ A;  3C73 A;  5IO2 A;  2DBC A;  3C1S A;  2LRC A;  2HXK A;  1PKZ A;  3BCK A;  2VL9 A;  1TP9 A;  1WRY A;  3KMO A;  3TKS E;  3J7Y k;  1EP8 A;  1ZYE A;  5IMF A;  4IN0 A;  3ZRD A;  1XW6 A;  1EOG A;  3IK9 A;  1XOB A;  1TW9 A;  4ML1 A;  3L9V A;  2H0G A;  3EVI A;  4TOP A;  1OC9 A;  2LKU A;  2H0H A;  1GUL A;  1GTB A;  5DJL A;  4I8B A;  2EIQ A;  3D22 A;  1EEM A;  2F3M A;  4X0X A;  2R37 A;  1MDJ A;  2B1K A;  5IQY A;  4ID0 A;  3G7Y A;  4F9Z A;  5J41 A;  4ECB A;  2L4Q A;  2YWO A;  3F6D A;  3A2W A;  1FVJ A;  2GGT A;  5EPF A;  3HHV A;  2MBS A;  1TU8 A;  3KJY A;  2BTO T;  4JZQ A;  2GS3 A;  3U6V A;  1AIU A;  2H0I A;  2FGX A;  5AN1 A;  1XFL A;  3UAP A;  2LTK A;  2FA4 A;  3TKR A;  1Z6N A;  1NHO A;  3V1W A;  5KN0 A;  1Z6M A;  2P0G A;  3BOA A;  3TRQ A;  1GTU A;  2O87 A;  2RM5 A;  1XCC A;  3OR5 A;  5GSS A;  2K18 A;  2IJY A;  1S3C A;  3D4M A;  3P7X A;  2EC4 A;  4IP6 A;  3LFL A;  1X9M B;  2KOK A;  3GTU A;  3IK7 A;  5B7C A;  1A0F A;  3EMX A;  1UN2 A;  3VI7 A;  2I4A A;  4X43 A;  1B48 A;  1THX A;  1JLV A;  1PSQ A;  1T00 A;  4PQI A;  2OE3 A;  3HA9 A;  5G5E A;  2AYT A;  3IBH A;  1SL1 B;  4IEL A;  2M80 A;  3EIN A;  3QD9 A;  1Q4J A;  1SKS B;  2GQL A;  2IMK A;  2R6K A;  4TXO B;  2QSI A;  1BYE A;  6GSW A;  1ON4 A;  2LEG A;  3GA4 A;  4IJI A;  3M0F A;  3F4T A;  5D9T A;  1HYU A;  1OC8 A;  2H72 A;  2VLT A;  1B9X C;  1SD9 A;  1YEX A;  4MK3 A;  1TRW A;  2C8U A;  4GWR A;  4POB A;  2HZE A;  1GSE A;  4L0W A;  3CTF A;  5DAL B;  4N0V A;  3LYK A;  3C7M A;  3HD5 A;  2CA8 A;  2JSZ A;  5ECL B;  4ZBD A;  3WGX A;  2TRC P;  4EDZ A;  3FZ4 A;  1O7U A;  1YQ1 A;  4MPF A;  3D5J A;  4IKH A;  5HFK A;  1SU9 A;  4WR5 A;  3QFA C;  2B7K A;  3Q18 A;  4NV2 A;  4XS4 A;  1V57 A;  3F0I A;  3VLN A;  5DAK B;  3IAM 2;  3M3M A;  4NWY A;  2GSR A;  3KMN A;  3KP8 A;  2VD1 A;  1YZX A;  3WGD A;  2X8H A;  1XBS A;  3LSZ A;  2H01 A;  1R5P A;  2CZ2 A;  2HSH A;  4TW5 A;  3FR3 A;  5H5R A;  1C72 A;  5IMV A;  4WR4 A;  3WGE A;  3EWL A;  1YEP A;  2GVP A;  4KDX A;  3IOS A;  2FY6 A;  1WWJ A;  2DML A;  1VF4 A;  4JU5 A;  1U88 A;  4JED A;  3IPZ A;  4ZL8 A;  2C0G A;  5D9V A;  2CAQ A;  3GX0 A;  4BWS A;  2DJ3 A;  2JAC A;  3TJF A;  1XVQ A;  4OWY A;  4YH2 A;  1K3O A;  3GNJ A;  3D4T A;  2TIR A;  4JR6 A;  2OJL A;  5IMZ A;  2YN1 A;  1V40 A;  1V9W A;  5ECQ B;  4X1U A;  5H5S A;  3APQ A;  4ACS A;  3GX8 A;  3DD3 A;  3LXZ A;  3ERW A;  5KN1 A;  2PWJ A;  2YPM A;  1J08 A;  2B3S A;  2PUK C;  1JHB A;  2LS5 A;  3KH9 A;  4L8E A;  1PRX A;  5G2Z A;  3Q6O A;  2TRX A;  1PA3 A;  1QGV A;  4TR3 A;  3RDW A;  2B5X A;  4J57 E;  2DMM A;  1S3D A;  8GSS A;  1ERW A;  4DSS B;  2IFQ A;  1G0T A;  1QK8 A;  2CX4 A;  2H75 A;  1JZO A;  4HOJ A;  2DC5 A;  1U87 A;  1TK0 B;  1FO5 A;  4BWQ A;  4K7O A;  3LWA A;  2DIZ A;  2H76 A;  4G10 A;  5A4W A;  1W89 A;  1T1V A;  2FWG A;  2FWF A;  2WFC A;  3R2Q A;  4HU9 A;  2XHF A;  1A8L A;  1R5A A;  2IME A;  3HZ4 A;  3GRX A;  1Y25 A;  5GAN D;  2CX3 A;  1K0N A;  3A2V A;  2RLI A;  1T3B A;  2OE0 A;  14GS A;  4MLY A;  1YJ6 A;  4OFT A;  4YQM A;  3F9U A;  2CAI A;  3KZQ A;  3LG6 A;  3ME8 A;  4ZBA A;  1MDI A;  3EYT A;  3GMF A;  2V32 A;  1GNW A;  3E0U A;  4ECI A;  3FZ5 A;  3CMI A;  1W4V A;  2KUC A;  1Z9H A;  5JWO B;  1T8E B;  3HJO A;  2NDO A;  2O85 A;  4MF6 A;  1FOV A;  2R5G A;  1OC3 A;  2N5B A;  1A8Y A;  5H5Q A;  2L5O A;  4KCE A;  1VF2 A;  2HNL A;  3FR6 A;  4BPY A;  1TXX A;  3FK8 A;  3ZL5 A;  3BBY A;  4K0N A;  1GSU A;  3QPM A;  3FYG A;  4D73 B;  4KSO A;  5F05 A;  5CO3 A;  2XPE A;  2H66 A;  4NXI A;  1XWG A;  3F4R A;  5FHI A;  1WP0 A;  2O8V B;  1M2A A;  5ID2 A;  5D8I A;  4POK A;  5DBQ A;  1ERV A;  2YZH A;  3HCZ A;  1X5D A;  4KND A;  1ABA A;  2VL2 C;  3D0Z A;  4KGI A;  2H71 A;  2HE3 A;  1QFN A;  2AJQ B;  3LOR A;  1XIY A;  4ECJ A;  13GS A;  11GS A;  3IR4 A;  2H6Y A;  2LJR A;  2XBQ A;  4E8E A;  2K8V A;  4WF4 A;  3L4N A;  5FT3 A;  1TRV A;  5B6N A;  4KH7 A;  4HDE A;  2H6Z A;  3TDG A;  3GSS A;  1K0M A;  5FWG A;  1LU4 A;  4RQX A;  3ZFB A;  4N10 A;  2GSS A;  3GL3 A;  1GRX A;  3GV1 A;  1A2M A;  5ECO B;  2OA7 A;  3ZZX A;  1JLW A;  3TRP A;  1N8J A;  3QAW A;  2GT6 A;  2DIY A;  4LMW A;  3U5R E;  1A2L A;  1DE1 A;  3GKK A;  5LD0 A;  3VWX A;  1PMT A;  4V2N A;  4FYC A;  1XW5 A;  5G5F A;  2N5A A;  4K7I A;  3KCM A;  2VL2 A;  3UAR A;  5DQS A;  3CSH A;  3F6F A;  4WEY A;  5JCU A;  12GS A;  4EUY A;  5CRE A;  2JSY A;  1AC1 A;  4MJE A;  1JZD A;  4GST A;  1HNC A;  3LXT A;  4PQ1 A;  1PGT A;  2FWE A;  5J9B A;  6GST A;  2YOI A;  1YF1 A;  3UVT A;  1XWB A;  2I3Y A;  1A0R P;  3DRN A;  4DSR A;  4Q5N A;  4YQV A;  3KIJ A;  5CYY A;  5F0G A;  2DLX A;  4OCE A;  3HXS A;  1T7P B;  1ZCP A;  3DVW A;  3RHB A;  1XXU A;  2FUG 2;  3G9B A;  4EKZ A;  4XRA A;  2YV9 A;  4TR1 A;  1F3B A;  3LJR A;  3D21 A;  2RUE A;  3WT1 A;  1V58 A;  3LQ7 A;  2QKE A;  2H73 A;  4MA9 A;  1K0D A;  4PXO A;  2QGV A;  2BMX A;  2PGT A;  1LBK A;  1V98 A;  4N30 A;  1GLP A;  5DAK A;  3ZVJ A;  4YAV A;  1THO A;  1TRU A;  2L6C A;  4IP1 A;  2KLX A;  2Z9S A;  3HVS A;  4J2F A;  4HEA 2;  1MTC A;  4TVE A;  4I97 A;  3N9J A;  1ZZY A;  2WCI A;  3W8S A;  2C4J A;  3M9J A;  4EC0 A;  4XIH A;  1AW9 A;  1Q98 A;  2HZF A;  4IVF A;  2PVQ A;  4XCS A;  4KUN A;  1K3L A;  2C1Y A;  3WYW A;  1ZGN A;  5DCH A;  4BA7 A;  4MZB A;  2NTO A;  3UMA A;  1OYJ A;  4L5L A;  4FH8 A;  4BVX A;  3US3 A;  5B8B A;  2LUS A;  1SK0 A;  2LQO A;  3ZTL A;  4GSS A;  2ZUP A;  1N2A A;  3FW2 A;  2GDR A;  4LL4 B;  2BJX A;  3A2X A;  4OO4 A;  1B9Y C;  2WGR A;  5AIX A;  4EXJ A;  3GFK A;  5IIZ A;  5CRW A;  4TXV A;  1BAY A;  3F63 A;  5HQP A;  2DJ0 A;  5IO0 A;  3UBK A;  3UEM A;  2ON7 A;  3P8W A;  2AAW A;  2IMD A;  2MYG A;  3MWH A;  2HRF A;  2C80 A;  1U6T A;  4POM A;  1SKR B;  2CZ3 A;  3HJP A;  1U3A A;  2PN8 A;  4EF0 A;  3E9J B;  1JZR A;  4HS1 A;  3UL3 A;  3A5W A;  5KN2 A;  3GKM A;  1T4Z A;  5D73 A;  1E2Y A;  2GQM A;  4MP4 A;  3HVX A;  4ZIJ A;  2HI7 A;  4AJ8 A;  5DQY A;  2EIO A;  1YKA A;  2V41 A;  19GS A;  2OKA A;  4QQ7 A;  10GS A;  1CQG A;  5GAP D;  3GUS A;  4KAE A;  1F37 A;  3AY8 A;  1TOF A;  3HZ8 A;  4FYB A;  3S9F A;  2JZR A;  1GTI A;  1R26 A;  2JL4 A;  1G7O A;  3I69 A;  2MBT A;  4KW6 A;  1SJI A;  2IMF A;  2VAF A;  1OKT A;  1BJX A;  4HQS A;  2E0Q A;  3WT2 A;  4DEJ A;  4IQA A;  3H79 A;  1BG5 A;  1HNA A;  1BED A;  3GH9 A;  4KB3 A;  1G6Y A;  3QFB C;  3CRU A;  4P3Y B;  3DWV A;  1XW9 A;  5ELA A;  1OE7 A;  4ULX A;  4GF0 A;  5F06 A;  3TUE A;  4ZL7 A;  2N5F A;  4OFM A;  3W8J A;  3TKP A;  1OC9 B;  2WZ9 A;  1ST9 A;  22GS A;  1ERU A;  2ON5 A;  4NMU A;  1YF0 A;  2GQK A;  1ACV A;  2YWM A;  3FKF A;  5AIV A;  1X9W B;  1VF3 A;  3DML A;  2C0F A;  2CV4 A;  4RI7 A;  1F6M C;  2YJ7 A;  2MMA A;  3QCP A;  2C3Q A;  2MMO A;  3H8Q A;  2G2Q A;  4BL7 A;  3ZIV A;  1GSQ A;  4IW9 A;  3RPN A;  2OBI A;  3FY7 A;  2GT5 A;  2KHP A;  2LJA A;  3GKX A;  4RQR A;  5HR2 A;  3UJ1 A;  4ECC A;  2NPB A;  1TDI A;  2P5R A;  4PX1 A;  5JCW A;  5D96 A;  3GH6 A;  4RI6 A;  2YV7 A;  3HYP A;  4V1A p;  3KH7 A;  2F8A A;  1MDK A;  3P2A A;  2DSA A;  2L4C A;  4JE1 A;  2RII A;  3EC3 A;  5ECN B;  3D6I A;  3GYK A;  1QQ2 A;  2NBS A;  1PL1 A;  1H4O A;  3DVX A;  5IMD A;  4V2M A;  3GTU B;  1NW2 A;  2JAD A;  3CYN A;  1PX7 A;  4PGT A;  4TR4 A;  1SYX A;  5ECK B;  1WMJ A;  3LEF A;  1XWA A;  4YAP A;  2H19 A;  2HYX A;  4WXT A;  4OCF A;  3UIW A;  1X0R A;  4BVY A;  3QAV A;  2LNT A;  1EZK A;  4HUA A;  4V2L A;  1EGR A;  4LL1 B;  1K3Y A;  3MNG A;  4H86 A;  1TK8 B;  3VUR A;  4MF5 A;  4ZB8 A;  4EVM A;  3IE3 A;  3WD6 A;  4O32 A;  2YAN A;  1HQO A;  4MMM A;  3TJK A;  3RHC A;  3G7I A;  5ENU A;  4MJC A;  1M9B A;  1T4Y A;  4EO3 A;  2QC7 A;  2AUV A;  4KDU A;  2YWN A;  4HZ4 A;  2E7P A;  1MD4 A;  3EE2 A;  2B6M A;  3BCI A;  2KP1 A;  2HZE B;  2CT6 A;  3QMX A;  4CDO A;  1PX6 A;  4IJ3 A;  1Z7R A;  5HFI A;  4ZIL A;  4OO5 A;  4PNF A;  2IMI A;  2RM6 A;  3HKR A;  1O8X A;  2E2G A;  1O73 A;  3F8U A;  1TK5 B;  3ZMK A;  3BJ5 A;  1M2D A;  5EY6 A;  1FB0 A;  4F0B A;  5INY A;  4HU7 A;  1GH2 A;  4MZW A;  3GUR A;  3EMP A;  5DJM A;  2GZZ A;  4AJ6 A;  3FHK A;  4NAX A;  1M2B A;  2KP2 A;  4G2E A;  4XS4 B;  1K0B A;  3J7Y b;  1XZO A;  4AF2 A;  2IN3 A;  4ISD A;  2D2Z A;  3O3T A;  1USB A;  2X64 A;  2WUL A;  5IPH A;  3L78 A;  4XHM A;  6GSV A;  1KBN A;  3DYR A;  4XS6 A;  2PVO C;  3UOM A;  4G9H A;  3L9S A;  3EU3 A;  4DVC A;  3G7J A;  5E4W A;  3I9V 2;  2ALB A;  4NHW A;  2HFD A;  2K9F A;  4K1F A;  1RK4 A;  3TOT A;  4ZL9 A;  3ZIT A;  3GKN A;  3NIV A;  2I9H A;  2MZC A;  1M99 A;  2XPD A;  4EE0 A;  4XS1 A;  4E8H A;  5IM9 A;  1TU7 A;  5J9C A;  3PGT A;  2GZP A;  1BQ7 A;  5CRG A;  2M72 A;  4MF7 A;  4I2T A;  2VL3 A;  6GSU A;  2L5L A;  3ZFL A;  1EOH A;  5GST A;  3IHQ A;  1YY7 A;  1WOU A;  4KX4 A;  5IOW A;  3SWL A;  3HJM A;  4HI7 A;  4JR4 A;  3ERG A;  2AV4 A;  2H1G A;  5ELG A;  3UVH A;  4GCI A;  2C3N A;  1BX9 A;  1IYH A;  5IOX A;  1SJ6 A;  5GZZ B;  1GUH A;  1Y6E A;  2H70 A;  3ISO A;  4EL1 A;  4TKY A;  1K0O A;  1PN9 A;  2K6V A;  2H6X A;  4J56 E;  6GSX A;  1GLQ A;  1Z5Y E;  1SYR A;  4PUF C;  4IBP A;  5C00 A;  3LYP A;  2JU5 A;  3C1R A;  2IFQ B;  2MMN A;  4TXO A;  2B7J A;  3KP9 A;  2GTU A;  1GUM A;  5IMC A;  2L59 A;  3VWU A;  2HRN A;  2CQ9 A;  3RAZ A;  1KTE A;  4TR0 A;  1J9B A;  2V2G A;  4MJB A;  3I43 A;  1AQW A;  2CVD A;  2OAD A;  2X8G A;  2G0F A;  1Z3E A;  1CQH A;  4GLT A;  3GL5 A;  1A24 A;  1I9D A;  5COH A;  3NOF A;  2GST A;  3ZVJ D;  2REM A;  2L6D A;  5DAL A;  3H1N A;  2A4V A;  3TJG A;  1ZOF A;  1FB6 A;  3EU4 A;  2J9H A;  1B8X A;  1TKD B;  2C3T A;  1GNE A;  3IRA A;  1SK2 A;  5CP1 A;  2VLU A;  2R3X A;  2V6K A;  2WDU A;  1PL2 A;  1GSS A;  4IQ1 A;  5D9W A;  1ZMA A;  3MAK A;  2O7K A;  2YNX A;  3VWV A;  1DUG A;  1KEB A;  5A4U A;  3HY2 A;  3TGZ A;  3FEU A;  4Q5Q A;  2L57 A;  4ZBB A;  3F3Q A;  3ME7 A;  1HD2 A;  4I6X A; 
#chains in the Genus database with same CATH topology
 4MAB A;  3GST A;  2V6O A;  3FRC A;  2VCW A;  1OE8 A;  2AHE A;  3TRX A;  5ECR B;  1QMV A;  1TTZ A;  2FA8 A;  5CRH A;  2LNS A;  1GP1 A;  3APO A;  2HT9 A;  5HFG A;  1O6J A;  2OE1 A;  2F51 A;  3Q19 A;  4Q5R A;  4XTS A;  2PBJ A;  1SL2 B;  5J3R A;  4QL7 A;  1WIK A;  3VFI A;  3O76 A;  4FYU A;  1AQX A;  1B4Q A;  1WPI A;  2VCQ A;  2XBI A;  2IIY A;  2J23 A;  3E3E A;  1M7T A;  1TRS A;  1X5C A;  3ZRE A;  5ID2 B;  2WJU A;  2DJ2 A;  1FG4 A;  4IGJ A;  1SKW B;  1JZW A;  1SEN A;  1J0F A;  4PQH A;  5IMA A;  1KNG A;  2C0E A;  5KN3 A;  2YWI A;  2F9S A;  4IS0 A;  5HR0 A;  1AXD A;  2HRK A;  4DSQ A;  4POL A;  1YKC A;  1VRS D;  4OD7 A;  4KE3 A;  3TB2 A;  3ED3 A;  1PKW A;  2HLS A;  4GTU A;  1A2J A;  3ZLP A;  2DJJ A;  5D93 A;  1M9A A;  4MNN A;  2YCD A;  4MPG A;  5ECM B;  3CBU A;  2CVK A;  3L0H A;  3VPQ A;  2HSY A;  3IV4 A;  4EDY A;  1VGL A;  2A2S A;  2VCV A;  3M9K A;  4YQU A;  2O89 A;  5DVB A;  3GN3 A;  4N0Z A;  3FZA A;  3HVV A;  3RPP A;  1AUC A;  4DSS A;  3IDV A;  2R4V A;  9GSS A;  4GSN A;  2FLS A;  4K7N A;  4K6X A;  3A3T A;  3TCO A;  2CVB A;  1TJD A;  1F9M A;  2PPT A;  3TJJ A;  3KGK A;  1S3A A;  4KCA A;  1SJZ A;  2FHE A;  5F07 A;  4F03 A;  3TKQ A;  2VLV A;  1G6W A;  1M0U A;  2VIM A;  5JWQ B;  1O85 A;  1SL0 B;  2WRT A;  2EIR A;  4JRR A;  5HR1 A;  4WBJ A;  3KM6 A;  1MEK A;  2ES7 A;  2LRT A;  7GSS A;  2GZY A;  4IHU A;  1OAZ A;  1V2A A;  3VWW A;  1QXH A;  2FNO A;  2WS2 A;  2DJ1 A;  3Q74 A;  3DXB A;  1WE0 A;  3QDN A;  1I5G A;  2IL3 A;  1JFU A;  4MH2 A;  4TR1 B;  5C04 A;  1TI3 A;  4MJA A;  5A5K A;  3F3R A;  4Z7X A;  3NZN A;  5LCZ A;  1PQN A;  1FVK A;  4HZ2 A;  4KDY A;  3IC4 A;  4Q5F A;  3EUR A;  2H1A A;  1EGO A;  4G19 A;  3C71 A;  3DIE A;  1EP7 A;  4NV5 A;  1K0A A;  5ECI B;  3O6T A;  1GUK A;  4FIW A;  4CHS A;  5AIS A;  2VUP A;  2I81 A;  2IWT A;  4PUR A;  4L0U A;  1O81 A;  4D73 A;  4ZXG A;  3JCM L;  4LMV A;  2VCX A;  1FW1 A;  1ML6 A;  2PMT A;  2YP6 A;  1ILO A;  2R0P A;  1E6B A;  2LV3 A;  4TN8 A;  1YDK A;  5G1K A;  4O7H A;  2B5E A;  2X99 A;  3W6G A;  4WET A;  3GHA A;  2PU9 C;  4ML6 A;  3VI5 A;  2A2R A;  1FHE A;  3CRT A;  3FR9 A;  2M46 A;  2I1U A;  4BVX B;  1UA5 A;  1R7H A;  2C0D A;  1DSB A;  3LGC A;  1RQM A;  4MDC A;  2MMZ A;  4HJ2 A;  1NM3 A;  2JZT A;  2UZ8 A;  2H1D A;  1R4W A;  4JBB A;  2GSQ A;  4PTS A;  4K8M A;  3QAG A;  5EL8 A;  5DCG A;  4RUV A;  3SBC A;  1AQV A;  4KA0 A;  5ABR A;  5J5N A;  1HNB A;  2K8S A;  4K9Z A;  3H4K A;  3CSJ A;  5G1L A;  3RBT A;  4AGS A;  1H75 A;  4PNG A;  1XPV A;  2FWH A;  2HSM A;  4O5R A;  3IXR A;  5G31 A;  5EVO A;  5ECS A;  5AGY A;  4K0G A;  1NHY A;  2GLR A;  4I5Q A;  1UC7 A;  3ZYW A;  4TRX A;  16GS A;  5DDL A;  1SD8 A;  4LA1 A;  3P90 A;  2A2P A;  3VPT A;  5HR3 A;  5J4U A;  2LRN A;  3I6A A;  3TJB A;  2JZS A;  3ZIJ A;  2OBK A;  3CXG A;  3KTL A;  3H93 A;  1A23 A;  2FD3 A;  2PER A;  1AAZ A;  3KTB A;  4HJM A;  1X9S B;  2E2M A;  2H1B A;  2LJK A;  3KD0 A;  6GSS A;  1G7E A;  5IPG A;  1SK1 A;  2IPA A;  4ZB6 A;  1F3A A;  3DGQ A;  1X5E A;  3MIX A;  4WF5 A;  2VCZ A;  3PH9 A;  4GXZ A;  1UVZ A;  6GSY A;  2X8C A;  5KEJ A;  4PUA A;  3PR8 A;  4K5R A;  4MCU A;  1ZYN A;  1OKD A;  1Z7P A;  3M8N A;  2H30 A;  1GSD A;  1QUW A;  4F2I A;  1RW1 A;  4F82 A;  4F0C A;  3IA1 A;  4K2D A;  3BD2 A;  4KSM A;  3DKS A;  5L71 A;  2WB9 A;  3KXO A;  4QL9 A;  1VF1 A;  1EV9 A;  2XC2 A;  3CTG A;  2LST A;  2VOC A;  5D9X A;  20GS A;  2V1M A;  3VK9 A;  2ZCT A;  2LQQ A;  5CRD A;  2YJH A;  1FAA A;  3C8E A;  4WBR D;  2OAC A;  1XVW A;  2VD0 A;  3APS A;  1GWC A;  5LNK e;  2B1L A;  4MZC A;  2ZNM A;  4V1A g;  3K8N A;  3ZML A;  5CNW A;  18GS A;  1XWK A;  1PD2 1;  4GQC A;  5G30 A;  3MYD A;  5CAX A;  3UBL A;  5ECH B;  3QOU A;  3TKS C;  4AJ7 A;  4BL7 B;  3DEX A;  1ZL9 A;  1EV4 A;  4XRD A;  3R3E A;  3M1G A;  2RUF A;  1MD3 A;  1B4P A;  1WJK A;  1ZYQ B;  3CSI A;  5BRT A;  4N11 A;  2B5Y A;  1GSY A;  4Z2U A;  1F2E A;  4NPB A;  4CW9 A;  4OFN A;  5B8A A;  1EEJ A;  1K0C A;  4Z2R A;  1LJR A;  4O5U A;  4L5O A;  3TOU A;  4GQF A;  1ERT A;  2YZU A;  2P31 A;  2R2J A;  3MSZ A;  4O92 A;  2P5Q A;  3GIX A;  1NSW A;  2H74 A;  2VO4 A;  3KEB A;  4HSC X;  1GL8 A;  1DE2 A;  2VM2 A;  1OVN A;  4BVY B;  1GTA A;  1URM A;  1IYI A;  3TKS A;  4MH3 A;  4I2U A;  1GSF A;  1O8W A;  4ILF A;  1U3I A;  5ECP B;  2VM1 A;  3MDK A;  4WKW A;  2DJK A;  1DBY A;  1XOA A;  2H8L A;  4OMV A;  5E59 A;  2F8F A;  4NHZ A;  2VCT A;  3HDC A;  5B6M A;  17GS A;  3IAS 2;  2AB6 A;  1EWX A;  2NVL A;  3PIN A;  5A4V A;  3N5O A;  5JWR B;  1TI1 A;  5F8B A;  1XWC A;  3ERF A;  3FZ9 A;  4GRF A;  4FO5 A;  3L9U A;  4ZB9 A;  3F4S A;  5JCG A;  2FCH A;  4LLR A;  3QR6 A;  4HQZ A;  3C73 A;  5IO2 A;  2DBC A;  3C1S A;  2LRC A;  2HXK A;  1PKZ A;  3BCK A;  2VL9 A;  1TP9 A;  1WRY A;  3KMO A;  3TKS E;  3J7Y k;  1EP8 A;  4CY6 A;  1ZYE A;  5IMF A;  4IN0 A;  3ZRD A;  1XW6 A;  1EOG A;  3IK9 A;  1XOB A;  1TW9 A;  2A4H A;  5KOX A;  4ML1 A;  3L9V A;  2H0G A;  3EVI A;  4TOP A;  1OC9 A;  2LKU A;  2H0H A;  1GUL A;  1GTB A;  5DJL A;  4I8B A;  2EIQ A;  3D22 A;  1EEM A;  2F3M A;  4X0X A;  2R37 A;  1MDJ A;  2B1K A;  5IQY A;  4ID0 A;  3G7Y A;  4F9Z A;  5J41 A;  4ECB A;  2L4Q A;  2YWO A;  3F6D A;  3A2W A;  4YKF A;  1FVJ A;  2GGT A;  2QA1 A;  5EPF A;  3HHV A;  2MBS A;  1TU8 A;  3KJY A;  2BTO T;  4JZQ A;  2GS3 A;  3U6V A;  2DKI A;  1AIU A;  2H0I A;  2FGX A;  5AN1 A;  1XFL A;  3UAP A;  2LTK A;  2FA4 A;  2HRA A;  3TKR A;  1Z6N A;  1NHO A;  3V1W A;  4EIQ A;  3PPU A;  5KN0 A;  1Z6M A;  2P0G A;  3BOA A;  3TRQ A;  1GTU A;  2O87 A;  2RM5 A;  1XCC A;  3OR5 A;  5GSS A;  2K18 A;  2IJY A;  1S3C A;  3D4M A;  3P7X A;  2EC4 A;  4IP6 A;  3LFL A;  1X9M B;  2KOK A;  3GTU A;  3IK7 A;  5B7C A;  1A0F A;  3EMX A;  1UN2 A;  3VI7 A;  2I4A A;  4X43 A;  1B48 A;  1THX A;  1JLV A;  1PSQ A;  1T00 A;  4PQI A;  3CQF A;  2OE3 A;  3HA9 A;  5G5E A;  2AYT A;  3IBH A;  1SL1 B;  4IEL A;  2M80 A;  3EIN A;  3QD9 A;  1Q4J A;  1SKS B;  2GQL A;  4G0I A;  2IMK A;  2R6K A;  4TXO B;  2QSI A;  1BYE A;  6GSW A;  1ON4 A;  2LEG A;  3GA4 A;  4IJI A;  3M0F A;  3F4T A;  5D9T A;  1HYU A;  1OC8 A;  2H72 A;  2VLT A;  1B9X C;  1SD9 A;  1YEX A;  4MK3 A;  1TRW A;  2C8U A;  4GWR A;  4POB A;  2HZE A;  1GSE A;  4L0W A;  3CTF A;  5DAL B;  4N0V A;  3LYK A;  3C7M A;  3HD5 A;  2CA8 A;  2JSZ A;  5ECL B;  4ZBD A;  3WGX A;  2TRC P;  4EDZ A;  3FZ4 A;  5KOW A;  1O7U A;  1YQ1 A;  4MPF A;  3D5J A;  4IKH A;  5HFK A;  1SU9 A;  4WR5 A;  3QFA C;  2B7K A;  3Q18 A;  4ICY A;  4NV2 A;  4XS4 A;  1V57 A;  3F0I A;  3VLN A;  5DAK B;  3IAM 2;  3M3M A;  4NWY A;  2GSR A;  3KMN A;  3KP8 A;  2VD1 A;  1YZX A;  3WGD A;  2X8H A;  1XBS A;  3LSZ A;  2H01 A;  1R5P A;  2CZ2 A;  2HSH A;  4TW5 A;  3FR3 A;  5H5R A;  1C72 A;  4BIK A;  5IMV A;  4WR4 A;  3WGE A;  3EWL A;  1YEP A;  2GVP A;  4KDX A;  3IOS A;  2FY6 A;  1WWJ A;  2DML A;  1VF4 A;  4JU5 A;  1U88 A;  4JED A;  3IPZ A;  4ZL8 A;  2C0G A;  5D9V A;  2CAQ A;  3GX0 A;  4BWS A;  2DJ3 A;  2JAC A;  3TJF A;  5BMU A;  1XVQ A;  4OWY A;  4YH2 A;  1XG8 A;  4K5S A;  1K3O A;  3GNJ A;  3D4T A;  2TIR A;  4JR6 A;  2OJL A;  5IMZ A;  2YN1 A;  1V40 A;  1V9W A;  5ECQ B;  4X1U A;  5H5S A;  3APQ A;  4ACS A;  3GX8 A;  3DD3 A;  3LXZ A;  3ERW A;  5KN1 A;  2PWJ A;  2YPM A;  1J08 A;  2B3S A;  2PUK C;  1JHB A;  2LS5 A;  3KH9 A;  4L8E A;  1PRX A;  5G2Z A;  3Q6O A;  2TRX A;  1PA3 A;  1QGV A;  4TR3 A;  3RDW A;  2B5X A;  4J57 E;  2DMM A;  1S3D A;  8GSS A;  1ERW A;  4DSS B;  2IFQ A;  1G0T A;  1QK8 A;  2CX4 A;  2H75 A;  1JZO A;  4HOJ A;  2DC5 A;  1U87 A;  1TK0 B;  1FO5 A;  4BWQ A;  4K7O A;  3LWA A;  2DIZ A;  2H76 A;  4G10 A;  5A4W A;  1W89 A;  1T1V A;  2FWG A;  2FWF A;  2WFC A;  3R2Q A;  4HU9 A;  2XHF A;  1A8L A;  1R5A A;  2IME A;  3HZ4 A;  3GRX A;  1Y25 A;  5GAN D;  2CX3 A;  1K0N A;  3A2V A;  2RLI A;  1T3B A;  2OE0 A;  14GS A;  1S3R A;  4MLY A;  1YJ6 A;  4OFT A;  4YQM A;  3F9U A;  2CAI A;  3KZQ A;  3LG6 A;  3ME8 A;  4ZBA A;  1MDI A;  2QA2 A;  3EYT A;  4G0L A;  3GMF A;  2V32 A;  1GNW A;  3E0U A;  4ECI A;  3FZ5 A;  3CMI A;  1W4V A;  2KUC A;  1Z9H A;  5JWO B;  1T8E B;  3HJO A;  2NDO A;  2O85 A;  4MF6 A;  1FOV A;  2R5G A;  1PFO A;  1OC3 A;  2N5B A;  1ZYP A;  1A8Y A;  5H5Q A;  2L5O A;  4KCE A;  1VF2 A;  2HNL A;  3FR6 A;  4BPY A;  1TXX A;  2X4A A;  3FK8 A;  3ZL5 A;  3BBY A;  4K0N A;  1GSU A;  3QPM A;  3FYG A;  4D73 B;  4KSO A;  5F05 A;  1FOH A;  5CO3 A;  2XPE A;  2H66 A;  4NXI A;  1XWG A;  3F4R A;  5FHI A;  1WP0 A;  2O8V B;  1M2A A;  5ID2 A;  5D8I A;  4POK A;  5DBQ A;  1ERV A;  2YZH A;  3HCZ A;  1X5D A;  4KND A;  1ABA A;  2VL2 C;  3D0Z A;  4KGI A;  2H71 A;  2HE3 A;  1QFN A;  2AJQ B;  3LOR A;  1XIY A;  4ECJ A;  1PN0 A;  13GS A;  11GS A;  3IR4 A;  2H6Y A;  2LJR A;  2XBQ A;  3EPT A;  4E8E A;  2K8V A;  4WF4 A;  3L4N A;  5FT3 A;  1TRV A;  5B6N A;  4KH7 A;  4HDE A;  2H6Z A;  3TDG A;  3GSS A;  1K0M A;  5FWG A;  1LU4 A;  4RQX A;  3ZFB A;  4N10 A;  3IC8 A;  2GSS A;  3GL3 A;  1GRX A;  3GV1 A;  1A2M A;  5ECO B;  2OA7 A;  3ZZX A;  1JLW A;  3TRP A;  1N8J A;  3QAW A;  2GT6 A;  2DIY A;  4LMW A;  3U5R E;  1A2L A;  1DE1 A;  3GKK A;  5LD0 A;  3VWX A;  1PMT A;  4V2N A;  4FYC A;  1XW5 A;  5G5F A;  2N5A A;  4K7I A;  3KCM A;  2VL2 A;  3UAR A;  5DQS A;  3CSH A;  3F6F A;  4WEY A;  5JCU A;  12GS A;  4EUY A;  5CRE A;  2JSY A;  1AC1 A;  4MJE A;  1JZD A;  4GST A;  1HNC A;  3LXT A;  4PQ1 A;  1PGT A;  2FWE A;  5J9B A;  6GST A;  2YOI A;  1YF1 A;  3UVT A;  1XWB A;  2I3Y A;  1A0R P;  3DRN A;  4DSR A;  4Q5N A;  4YQV A;  3KIJ A;  5CYY A;  5F0G A;  2DLX A;  4OCE A;  3HXS A;  1T7P B;  1ZCP A;  3DVW A;  3RHB A;  1XXU A;  2FUG 2;  3G9B A;  4EKZ A;  4XRA A;  2YV9 A;  4TR1 A;  1F3B A;  3LJR A;  3D21 A;  2RUE A;  3WT1 A;  1V58 A;  3LQ7 A;  2QKE A;  2H73 A;  4MA9 A;  1K0D A;  4PXO A;  2QGV A;  2BMX A;  2PGT A;  1LBK A;  1V98 A;  4N30 A;  1GLP A;  5DAK A;  2X49 A;  3ZVJ A;  4YAV A;  1THO A;  1TRU A;  2L6C A;  4IP1 A;  2KLX A;  2Z9S A;  3HVS A;  4J2F A;  1M3I A;  4HEA 2;  1MTC A;  4TVE A;  4I97 A;  3N9J A;  1ZZY A;  2WCI A;  3W8S A;  2C4J A;  3M9J A;  4EC0 A;  4XIH A;  1AW9 A;  1Q98 A;  2HZF A;  4IVF A;  2PVQ A;  4XCS A;  4KUN A;  1K3L A;  2C1Y A;  3WYW A;  1ZGN A;  4O5Q A;  5DCH A;  4BA7 A;  4MZB A;  2NTO A;  3UMA A;  1OYJ A;  4L5L A;  4FH8 A;  4BVX A;  3US3 A;  3A5I A;  5B8B A;  2LUS A;  1SK0 A;  2LQO A;  3ZTL A;  4GSS A;  2ZUP A;  1N2A A;  3FW2 A;  2GDR A;  4LL4 B;  2BJX A;  3A2X A;  4OO4 A;  1B9Y C;  2WGR A;  5AIX A;  4EXJ A;  3GFK A;  5IIZ A;  5CRW A;  4TXV A;  1BAY A;  3F63 A;  5HQP A;  2DJ0 A;  5IO0 A;  3UBK A;  3UEM A;  4K2X A;  2ON7 A;  3P8W A;  2AAW A;  2IMD A;  2MYG A;  3MWH A;  4YKG A;  2HRF A;  2C80 A;  1U6T A;  4POM A;  1SKR B;  2CZ3 A;  3HJP A;  1U3A A;  2PN8 A;  4EF0 A;  3E9J B;  4Z2T A;  1JZR A;  4HS1 A;  3UL3 A;  3A5W A;  5KN2 A;  3GKM A;  1T4Z A;  5D73 A;  1E2Y A;  2GQM A;  4MP4 A;  3HVX A;  4ZIJ A;  4G0K A;  2HI7 A;  4AJ8 A;  5DQY A;  2EIO A;  1YKA A;  2V41 A;  19GS A;  2OKA A;  4QQ7 A;  10GS A;  1CQG A;  5GAP D;  3GUS A;  4KAE A;  1F37 A;  3AY8 A;  3LW9 A;  1TOF A;  3HZ8 A;  4FYB A;  3S9F A;  2JZR A;  1GTI A;  1R26 A;  2JL4 A;  1G7O A;  3I69 A;  2MBT A;  4KW6 A;  1SJI A;  2IMF A;  2VAF A;  1OKT A;  1BJX A;  4HQS A;  2E0Q A;  3WT2 A;  4DEJ A;  4IQA A;  3H79 A;  1BG5 A;  1HNA A;  1BED A;  3GH9 A;  4KB3 A;  1G6Y A;  3QFB C;  3CRU A;  4P3Y B;  3DWV A;  1XW9 A;  5ELA A;  1OE7 A;  4ULX A;  4GF0 A;  5F06 A;  3TUE A;  4ZL7 A;  2N5F A;  4OFM A;  3W8J A;  3TKP A;  1OC9 B;  2WZ9 A;  1ST9 A;  22GS A;  1ERU A;  2ON5 A;  4NMU A;  1YF0 A;  2GQK A;  1ACV A;  2YWM A;  3FKF A;  5AIV A;  1X9W B;  1VF3 A;  3DML A;  2C0F A;  2CV4 A;  4RI7 A;  1F6M C;  2YJ7 A;  2MMA A;  3QCP A;  2C3Q A;  2MMO A;  3H8Q A;  2G2Q A;  4BL7 A;  3ZIV A;  1GSQ A;  4IW9 A;  3RPN A;  2OBI A;  3FY7 A;  2GT5 A;  2KHP A;  2LJA A;  3GKX A;  4RQR A;  5HR2 A;  3UJ1 A;  4ECC A;  2NPB A;  1TDI A;  2P5R A;  4PX1 A;  5JCW A;  5D96 A;  3GH6 A;  4RI6 A;  2YV7 A;  3HYP A;  4V1A p;  3KH7 A;  2F8A A;  1MDK A;  3P2A A;  2DSA A;  2L4C A;  4JE1 A;  2RII A;  3EC3 A;  5ECN B;  3D6I A;  3GYK A;  1QQ2 A;  2NBS A;  1PL1 A;  1H4O A;  3DVX A;  5IMD A;  4V2M A;  2DKH A;  3GTU B;  1NW2 A;  2JAD A;  3CYN A;  1PX7 A;  4PGT A;  4TR4 A;  1SYX A;  3HVN A;  5ECK B;  2R0C A;  1WMJ A;  3LEF A;  1XWA A;  4YAP A;  2H19 A;  2HYX A;  4WXT A;  4OCF A;  3UIW A;  1X0R A;  4BVY A;  3QAV A;  2LNT A;  1EZK A;  4HUA A;  4V2L A;  1EGR A;  4LL1 B;  1K3Y A;  3MNG A;  4H86 A;  1TK8 B;  3VUR A;  4MF5 A;  4ZB8 A;  4EVM A;  3IE3 A;  3WD6 A;  4O32 A;  2YAN A;  1HQO A;  4MMM A;  3TJK A;  3RHC A;  3G7I A;  5ENU A;  4MJC A;  1M9B A;  1T4Y A;  4EO3 A;  2R0G A;  2QC7 A;  2AUV A;  4KDU A;  4EIP A;  4X4J A;  2YWN A;  4HZ4 A;  2E7P A;  1MD4 A;  3EE2 A;  2B6M A;  3BCI A;  2KP1 A;  2HZE B;  2CT6 A;  3QMX A;  4CDO A;  1PX6 A;  4IJ3 A;  1Z7R A;  5HFI A;  4ZIL A;  4OO5 A;  4PNF A;  2IMI A;  4CY8 A;  2RM6 A;  3HKR A;  1O8X A;  2E2G A;  1O73 A;  3F8U A;  1TK5 B;  3ZMK A;  3BJ5 A;  1M2D A;  5EY6 A;  1FB0 A;  4F0B A;  5INY A;  4HU7 A;  1GH2 A;  4MZW A;  3GUR A;  3EMP A;  5DJM A;  2GZZ A;  4AJ6 A;  3FHK A;  4NAX A;  1M2B A;  2KP2 A;  4G2E A;  4XS4 B;  1K0B A;  3J7Y b;  1XZO A;  4AF2 A;  2IN3 A;  4ISD A;  2D2Z A;  3O3T A;  1USB A;  2X64 A;  2WUL A;  5IPH A;  3L78 A;  4XHM A;  6GSV A;  1KBN A;  3DYR A;  4XS6 A;  2PVO C;  3UOM A;  4G9H A;  3L9S A;  3EU3 A;  4DVC A;  3G7J A;  5E4W A;  3I9V 2;  2ALB A;  4NHW A;  2HFD A;  2K9F A;  4K1F A;  1RK4 A;  3TOT A;  4ZL9 A;  3ZIT A;  3GKN A;  3NIV A;  2I9H A;  2MZC A;  1M99 A;  2XPD A;  4EE0 A;  4XS1 A;  4E8H A;  5IM9 A;  1TU7 A;  5J9C A;  3PGT A;  2GZP A;  1BQ7 A;  5CRG A;  2M72 A;  4MF7 A;  4I2T A;  2VL3 A;  6GSU A;  2L5L A;  3ZFL A;  1EOH A;  5GST A;  3IHQ A;  1YY7 A;  4FQU A;  1WOU A;  4KX4 A;  5IOW A;  3SWL A;  3HJM A;  4HI7 A;  4JR4 A;  3ERG A;  2AV4 A;  4A5P A;  2H1G A;  5ELG A;  3UVH A;  4GCI A;  2C3N A;  1BX9 A;  1IYH A;  5IOX A;  1SJ6 A;  5GZZ B;  1GUH A;  1Y6E A;  2H70 A;  3ISO A;  4EL1 A;  4TKY A;  1K0O A;  1PN9 A;  2K6V A;  4USS A;  2H6X A;  4J56 E;  6GSX A;  1GLQ A;  1Z5Y E;  1SYR A;  4PUF C;  4IBP A;  5C00 A;  3LYP A;  2JU5 A;  3C1R A;  2IFQ B;  2MMN A;  4TXO A;  2B7J A;  3KP9 A;  2GTU A;  1GUM A;  5IMC A;  2L59 A;  3VWU A;  2HRN A;  2CQ9 A;  3RAZ A;  3IHG A;  1KTE A;  4TR0 A;  1J9B A;  2V2G A;  4MJB A;  3I43 A;  1AQW A;  2CVD A;  2OAD A;  2X8G A;  2G0F A;  1Z3E A;  1CQH A;  4GLT A;  3GL5 A;  1M3J A;  1A24 A;  1I9D A;  5COH A;  3NOF A;  2GST A;  3ZVJ D;  2REM A;  2L6D A;  5DAL A;  3H1N A;  2A4V A;  3TJG A;  1ZOF A;  1FB6 A;  3EU4 A;  2J9H A;  1B8X A;  1TKD B;  2C3T A;  1GNE A;  3IRA A;  1SK2 A;  5CP1 A;  2VLU A;  2R3X A;  2V6K A;  2WDU A;  1PL2 A;  1GSS A;  4IQ1 A;  5D9W A;  1ZMA A;  3MAK A;  2O7K A;  2YNX A;  4KF9 A;  3VWV A;  1DUG A;  1KEB A;  3FMW A;  5A4U A;  3HY2 A;  3TGZ A;  3FEU A;  4Q5Q A;  2L57 A;  4ZBB A;  3F3Q A;  3ME7 A;  1HD2 A;  4I6X A; 
#chains in the Genus database with same CATH homology
 4MAB A;  3GST A;  2V6O A;  3FRC A;  2VCW A;  1OE8 A;  2AHE A;  3TRX A;  5ECR B;  1QMV A;  1TTZ A;  2FA8 A;  5CRH A;  2LNS A;  1GP1 A;  3APO A;  2HT9 A;  5HFG A;  1O6J A;  2OE1 A;  2F51 A;  3Q19 A;  4Q5R A;  4XTS A;  2PBJ A;  1SL2 B;  5J3R A;  4QL7 A;  1WIK A;  3VFI A;  3O76 A;  4FYU A;  1AQX A;  1B4Q A;  1WPI A;  2VCQ A;  2XBI A;  2IIY A;  2J23 A;  3E3E A;  1M7T A;  1TRS A;  1X5C A;  3ZRE A;  5ID2 B;  2WJU A;  2DJ2 A;  1FG4 A;  4IGJ A;  1SKW B;  1JZW A;  1SEN A;  1J0F A;  4PQH A;  5IMA A;  1KNG A;  2C0E A;  5KN3 A;  2YWI A;  2F9S A;  4IS0 A;  5HR0 A;  1AXD A;  2HRK A;  4DSQ A;  4POL A;  1YKC A;  1VRS D;  4OD7 A;  4KE3 A;  3TB2 A;  3ED3 A;  1PKW A;  2HLS A;  4GTU A;  1A2J A;  3ZLP A;  2DJJ A;  5D93 A;  1M9A A;  4MNN A;  2YCD A;  4MPG A;  5ECM B;  3CBU A;  2CVK A;  3L0H A;  3VPQ A;  2HSY A;  3IV4 A;  4EDY A;  1VGL A;  2A2S A;  2VCV A;  3M9K A;  4YQU A;  2O89 A;  5DVB A;  3GN3 A;  4N0Z A;  3FZA A;  3HVV A;  3RPP A;  1AUC A;  4DSS A;  3IDV A;  2R4V A;  9GSS A;  4GSN A;  2FLS A;  4K7N A;  4K6X A;  3A3T A;  3TCO A;  2CVB A;  1TJD A;  1F9M A;  2PPT A;  3TJJ A;  3KGK A;  1S3A A;  4KCA A;  1SJZ A;  2FHE A;  5F07 A;  4F03 A;  3TKQ A;  2VLV A;  1G6W A;  1M0U A;  2VIM A;  5JWQ B;  1O85 A;  1SL0 B;  2WRT A;  2EIR A;  4JRR A;  5HR1 A;  4WBJ A;  3KM6 A;  1MEK A;  2ES7 A;  2LRT A;  7GSS A;  2GZY A;  4IHU A;  1OAZ A;  1V2A A;  3VWW A;  1QXH A;  2FNO A;  2WS2 A;  2DJ1 A;  3Q74 A;  3DXB A;  1WE0 A;  3QDN A;  1I5G A;  2IL3 A;  1JFU A;  4MH2 A;  4TR1 B;  5C04 A;  1TI3 A;  4MJA A;  5A5K A;  3F3R A;  4Z7X A;  3NZN A;  5LCZ A;  1PQN A;  1FVK A;  4HZ2 A;  4KDY A;  3IC4 A;  4Q5F A;  3EUR A;  2H1A A;  1EGO A;  4G19 A;  3C71 A;  3DIE A;  1EP7 A;  4NV5 A;  1K0A A;  5ECI B;  3O6T A;  1GUK A;  4FIW A;  4CHS A;  5AIS A;  2VUP A;  2I81 A;  2IWT A;  4PUR A;  4L0U A;  1O81 A;  4D73 A;  4ZXG A;  3JCM L;  4LMV A;  2VCX A;  1FW1 A;  1ML6 A;  2PMT A;  2YP6 A;  1ILO A;  2R0P A;  1E6B A;  2LV3 A;  4TN8 A;  1YDK A;  5G1K A;  4O7H A;  2B5E A;  2X99 A;  3W6G A;  4WET A;  3GHA A;  2PU9 C;  4ML6 A;  3VI5 A;  2A2R A;  1FHE A;  3CRT A;  3FR9 A;  2M46 A;  2I1U A;  4BVX B;  1UA5 A;  1R7H A;  2C0D A;  1DSB A;  3LGC A;  1RQM A;  4MDC A;  2MMZ A;  4HJ2 A;  1NM3 A;  2JZT A;  2UZ8 A;  2H1D A;  1R4W A;  4JBB A;  2GSQ A;  4PTS A;  4K8M A;  3QAG A;  5EL8 A;  5DCG A;  4RUV A;  3SBC A;  1AQV A;  4KA0 A;  5ABR A;  5J5N A;  1HNB A;  2K8S A;  4K9Z A;  3H4K A;  3CSJ A;  5G1L A;  3RBT A;  4AGS A;  1H75 A;  4PNG A;  1XPV A;  2FWH A;  2HSM A;  4O5R A;  3IXR A;  5G31 A;  5EVO A;  5ECS A;  5AGY A;  4K0G A;  1NHY A;  2GLR A;  4I5Q A;  1UC7 A;  3ZYW A;  4TRX A;  16GS A;  5DDL A;  1SD8 A;  4LA1 A;  3P90 A;  2A2P A;  3VPT A;  5HR3 A;  5J4U A;  2LRN A;  3I6A A;  3TJB A;  2JZS A;  3ZIJ A;  2OBK A;  3CXG A;  3KTL A;  3H93 A;  1A23 A;  2FD3 A;  2PER A;  1AAZ A;  3KTB A;  4HJM A;  1X9S B;  2E2M A;  2H1B A;  2LJK A;  3KD0 A;  6GSS A;  1G7E A;  5IPG A;  1SK1 A;  2IPA A;  4ZB6 A;  1F3A A;  3DGQ A;  1X5E A;  3MIX A;  4WF5 A;  2VCZ A;  3PH9 A;  4GXZ A;  1UVZ A;  6GSY A;  2X8C A;  5KEJ A;  4PUA A;  3PR8 A;  4K5R A;  4MCU A;  1ZYN A;  1OKD A;  1Z7P A;  3M8N A;  2H30 A;  1GSD A;  1QUW A;  4F2I A;  1RW1 A;  4F82 A;  4F0C A;  3IA1 A;  4K2D A;  3BD2 A;  4KSM A;  3DKS A;  5L71 A;  2WB9 A;  3KXO A;  4QL9 A;  1VF1 A;  1EV9 A;  2XC2 A;  3CTG A;  2LST A;  2VOC A;  5D9X A;  20GS A;  2V1M A;  3VK9 A;  2ZCT A;  2LQQ A;  5CRD A;  2YJH A;  1FAA A;  3C8E A;  4WBR D;  2OAC A;  1XVW A;  2VD0 A;  3APS A;  1GWC A;  5LNK e;  2B1L A;  4MZC A;  2ZNM A;  4V1A g;  3K8N A;  3ZML A;  5CNW A;  18GS A;  1XWK A;  1PD2 1;  4GQC A;  5G30 A;  3MYD A;  5CAX A;  3UBL A;  5ECH B;  3QOU A;  3TKS C;  4AJ7 A;  4BL7 B;  3DEX A;  1ZL9 A;  1EV4 A;  4XRD A;  3R3E A;  3M1G A;  2RUF A;  1MD3 A;  1B4P A;  1WJK A;  1ZYQ B;  3CSI A;  5BRT A;  4N11 A;  2B5Y A;  1GSY A;  4Z2U A;  1F2E A;  4NPB A;  4CW9 A;  4OFN A;  5B8A A;  1EEJ A;  1K0C A;  4Z2R A;  1LJR A;  4O5U A;  4L5O A;  3TOU A;  4GQF A;  1ERT A;  2YZU A;  2P31 A;  2R2J A;  3MSZ A;  4O92 A;  2P5Q A;  3GIX A;  1NSW A;  2H74 A;  2VO4 A;  3KEB A;  1GL8 A;  1DE2 A;  2VM2 A;  1OVN A;  4BVY B;  1GTA A;  1URM A;  1IYI A;  3TKS A;  4MH3 A;  4I2U A;  1GSF A;  1O8W A;  4ILF A;  1U3I A;  5ECP B;  2VM1 A;  3MDK A;  4WKW A;  2DJK A;  1DBY A;  1XOA A;  2H8L A;  4OMV A;  5E59 A;  2F8F A;  4NHZ A;  2VCT A;  3HDC A;  5B6M A;  17GS A;  3IAS 2;  2AB6 A;  1EWX A;  2NVL A;  3PIN A;  5A4V A;  3N5O A;  5JWR B;  1TI1 A;  5F8B A;  1XWC A;  3ERF A;  3FZ9 A;  4GRF A;  4FO5 A;  3L9U A;  4ZB9 A;  3F4S A;  5JCG A;  2FCH A;  4LLR A;  3QR6 A;  4HQZ A;  3C73 A;  5IO2 A;  2DBC A;  3C1S A;  2LRC A;  2HXK A;  1PKZ A;  3BCK A;  2VL9 A;  1TP9 A;  1WRY A;  3KMO A;  3TKS E;  3J7Y k;  1EP8 A;  4CY6 A;  1ZYE A;  5IMF A;  4IN0 A;  3ZRD A;  1XW6 A;  1EOG A;  3IK9 A;  1XOB A;  1TW9 A;  2A4H A;  5KOX A;  4ML1 A;  3L9V A;  2H0G A;  3EVI A;  4TOP A;  1OC9 A;  2LKU A;  2H0H A;  1GUL A;  1GTB A;  5DJL A;  4I8B A;  2EIQ A;  3D22 A;  1EEM A;  2F3M A;  4X0X A;  2R37 A;  1MDJ A;  2B1K A;  5IQY A;  4ID0 A;  3G7Y A;  4F9Z A;  5J41 A;  4ECB A;  2L4Q A;  2YWO A;  3F6D A;  3A2W A;  4YKF A;  1FVJ A;  2GGT A;  2QA1 A;  5EPF A;  3HHV A;  2MBS A;  1TU8 A;  3KJY A;  2BTO T;  4JZQ A;  2GS3 A;  3U6V A;  2DKI A;  1AIU A;  2H0I A;  2FGX A;  5AN1 A;  1XFL A;  3UAP A;  2LTK A;  2FA4 A;  2HRA A;  3TKR A;  1Z6N A;  1NHO A;  3V1W A;  4EIQ A;  3PPU A;  5KN0 A;  1Z6M A;  2P0G A;  3BOA A;  3TRQ A;  1GTU A;  2O87 A;  2RM5 A;  1XCC A;  3OR5 A;  5GSS A;  2K18 A;  2IJY A;  1S3C A;  3D4M A;  3P7X A;  2EC4 A;  4IP6 A;  3LFL A;  1X9M B;  2KOK A;  3GTU A;  3IK7 A;  5B7C A;  1A0F A;  3EMX A;  1UN2 A;  3VI7 A;  2I4A A;  4X43 A;  1B48 A;  1THX A;  1JLV A;  1PSQ A;  1T00 A;  4PQI A;  2OE3 A;  3HA9 A;  5G5E A;  2AYT A;  3IBH A;  1SL1 B;  4IEL A;  2M80 A;  3EIN A;  3QD9 A;  1Q4J A;  1SKS B;  2GQL A;  4G0I A;  2IMK A;  2R6K A;  4TXO B;  2QSI A;  1BYE A;  6GSW A;  1ON4 A;  2LEG A;  3GA4 A;  4IJI A;  3M0F A;  3F4T A;  5D9T A;  1HYU A;  1OC8 A;  2H72 A;  2VLT A;  1B9X C;  1SD9 A;  1YEX A;  4MK3 A;  1TRW A;  2C8U A;  4GWR A;  4POB A;  2HZE A;  1GSE A;  4L0W A;  3CTF A;  5DAL B;  4N0V A;  3LYK A;  3C7M A;  3HD5 A;  2CA8 A;  2JSZ A;  5ECL B;  4ZBD A;  3WGX A;  2TRC P;  4EDZ A;  3FZ4 A;  5KOW A;  1O7U A;  1YQ1 A;  4MPF A;  3D5J A;  4IKH A;  5HFK A;  1SU9 A;  4WR5 A;  3QFA C;  2B7K A;  3Q18 A;  4ICY A;  4NV2 A;  4XS4 A;  1V57 A;  3F0I A;  3VLN A;  5DAK B;  3IAM 2;  3M3M A;  4NWY A;  2GSR A;  3KMN A;  3KP8 A;  2VD1 A;  1YZX A;  3WGD A;  2X8H A;  1XBS A;  3LSZ A;  2H01 A;  1R5P A;  2CZ2 A;  2HSH A;  4TW5 A;  3FR3 A;  5H5R A;  1C72 A;  5IMV A;  4WR4 A;  3WGE A;  3EWL A;  1YEP A;  2GVP A;  4KDX A;  3IOS A;  2FY6 A;  1WWJ A;  2DML A;  1VF4 A;  4JU5 A;  1U88 A;  4JED A;  3IPZ A;  4ZL8 A;  2C0G A;  5D9V A;  2CAQ A;  3GX0 A;  4BWS A;  2DJ3 A;  2JAC A;  3TJF A;  5BMU A;  1XVQ A;  4OWY A;  4YH2 A;  4K5S A;  1K3O A;  3GNJ A;  3D4T A;  2TIR A;  4JR6 A;  2OJL A;  5IMZ A;  2YN1 A;  1V40 A;  1V9W A;  5ECQ B;  4X1U A;  5H5S A;  3APQ A;  4ACS A;  3GX8 A;  3DD3 A;  3LXZ A;  3ERW A;  5KN1 A;  2PWJ A;  2YPM A;  1J08 A;  2B3S A;  2PUK C;  1JHB A;  2LS5 A;  3KH9 A;  4L8E A;  1PRX A;  5G2Z A;  3Q6O A;  2TRX A;  1PA3 A;  1QGV A;  4TR3 A;  3RDW A;  2B5X A;  4J57 E;  2DMM A;  1S3D A;  8GSS A;  1ERW A;  4DSS B;  2IFQ A;  1G0T A;  1QK8 A;  2CX4 A;  2H75 A;  1JZO A;  4HOJ A;  2DC5 A;  1U87 A;  1TK0 B;  1FO5 A;  4BWQ A;  4K7O A;  3LWA A;  2DIZ A;  2H76 A;  4G10 A;  5A4W A;  1W89 A;  1T1V A;  2FWG A;  2FWF A;  2WFC A;  3R2Q A;  4HU9 A;  2XHF A;  1A8L A;  1R5A A;  2IME A;  3HZ4 A;  3GRX A;  1Y25 A;  5GAN D;  2CX3 A;  1K0N A;  3A2V A;  2RLI A;  1T3B A;  2OE0 A;  14GS A;  4MLY A;  1YJ6 A;  4OFT A;  4YQM A;  3F9U A;  2CAI A;  3KZQ A;  3LG6 A;  3ME8 A;  4ZBA A;  1MDI A;  2QA2 A;  3EYT A;  4G0L A;  3GMF A;  2V32 A;  1GNW A;  3E0U A;  4ECI A;  3FZ5 A;  3CMI A;  1W4V A;  2KUC A;  1Z9H A;  5JWO B;  1T8E B;  3HJO A;  2NDO A;  2O85 A;  4MF6 A;  1FOV A;  2R5G A;  1OC3 A;  2N5B A;  1ZYP A;  1A8Y A;  5H5Q A;  2L5O A;  4KCE A;  1VF2 A;  2HNL A;  3FR6 A;  4BPY A;  1TXX A;  2X4A A;  3FK8 A;  3ZL5 A;  3BBY A;  4K0N A;  1GSU A;  3QPM A;  3FYG A;  4D73 B;  4KSO A;  5F05 A;  1FOH A;  5CO3 A;  2XPE A;  2H66 A;  4NXI A;  1XWG A;  3F4R A;  5FHI A;  1WP0 A;  2O8V B;  1M2A A;  5ID2 A;  5D8I A;  4POK A;  5DBQ A;  1ERV A;  2YZH A;  3HCZ A;  1X5D A;  4KND A;  1ABA A;  2VL2 C;  3D0Z A;  4KGI A;  2H71 A;  2HE3 A;  1QFN A;  2AJQ B;  3LOR A;  1XIY A;  4ECJ A;  1PN0 A;  13GS A;  11GS A;  3IR4 A;  2H6Y A;  2LJR A;  2XBQ A;  3EPT A;  4E8E A;  2K8V A;  4WF4 A;  3L4N A;  5FT3 A;  1TRV A;  5B6N A;  4KH7 A;  4HDE A;  2H6Z A;  3TDG A;  3GSS A;  1K0M A;  5FWG A;  1LU4 A;  4RQX A;  3ZFB A;  4N10 A;  3IC8 A;  2GSS A;  3GL3 A;  1GRX A;  3GV1 A;  1A2M A;  5ECO B;  2OA7 A;  3ZZX A;  1JLW A;  3TRP A;  1N8J A;  3QAW A;  2GT6 A;  2DIY A;  4LMW A;  3U5R E;  1A2L A;  1DE1 A;  3GKK A;  5LD0 A;  3VWX A;  1PMT A;  4V2N A;  4FYC A;  1XW5 A;  5G5F A;  2N5A A;  4K7I A;  3KCM A;  2VL2 A;  3UAR A;  5DQS A;  3CSH A;  3F6F A;  4WEY A;  5JCU A;  12GS A;  4EUY A;  5CRE A;  2JSY A;  1AC1 A;  4MJE A;  1JZD A;  4GST A;  1HNC A;  3LXT A;  4PQ1 A;  1PGT A;  2FWE A;  5J9B A;  6GST A;  2YOI A;  1YF1 A;  3UVT A;  1XWB A;  2I3Y A;  1A0R P;  3DRN A;  4DSR A;  4Q5N A;  4YQV A;  3KIJ A;  5CYY A;  5F0G A;  2DLX A;  4OCE A;  3HXS A;  1T7P B;  1ZCP A;  3DVW A;  3RHB A;  1XXU A;  2FUG 2;  3G9B A;  4EKZ A;  4XRA A;  2YV9 A;  4TR1 A;  1F3B A;  3LJR A;  3D21 A;  2RUE A;  3WT1 A;  1V58 A;  3LQ7 A;  2QKE A;  2H73 A;  4MA9 A;  1K0D A;  4PXO A;  2QGV A;  2BMX A;  2PGT A;  1LBK A;  1V98 A;  4N30 A;  1GLP A;  5DAK A;  2X49 A;  3ZVJ A;  4YAV A;  1THO A;  1TRU A;  2L6C A;  4IP1 A;  2KLX A;  2Z9S A;  3HVS A;  4J2F A;  4HEA 2;  1MTC A;  4TVE A;  4I97 A;  3N9J A;  1ZZY A;  2WCI A;  3W8S A;  2C4J A;  3M9J A;  4EC0 A;  4XIH A;  1AW9 A;  1Q98 A;  2HZF A;  4IVF A;  2PVQ A;  4XCS A;  4KUN A;  1K3L A;  2C1Y A;  3WYW A;  1ZGN A;  4O5Q A;  5DCH A;  4BA7 A;  4MZB A;  2NTO A;  3UMA A;  1OYJ A;  4L5L A;  4FH8 A;  4BVX A;  3US3 A;  3A5I A;  5B8B A;  2LUS A;  1SK0 A;  2LQO A;  3ZTL A;  4GSS A;  2ZUP A;  1N2A A;  3FW2 A;  2GDR A;  4LL4 B;  2BJX A;  3A2X A;  4OO4 A;  1B9Y C;  2WGR A;  5AIX A;  4EXJ A;  3GFK A;  5IIZ A;  5CRW A;  4TXV A;  1BAY A;  3F63 A;  5HQP A;  2DJ0 A;  5IO0 A;  3UBK A;  3UEM A;  4K2X A;  2ON7 A;  3P8W A;  2AAW A;  2IMD A;  2MYG A;  3MWH A;  4YKG A;  2HRF A;  2C80 A;  1U6T A;  4POM A;  1SKR B;  2CZ3 A;  3HJP A;  1U3A A;  2PN8 A;  4EF0 A;  3E9J B;  4Z2T A;  1JZR A;  4HS1 A;  3UL3 A;  3A5W A;  5KN2 A;  3GKM A;  1T4Z A;  5D73 A;  1E2Y A;  2GQM A;  4MP4 A;  3HVX A;  4ZIJ A;  4G0K A;  2HI7 A;  4AJ8 A;  5DQY A;  2EIO A;  1YKA A;  2V41 A;  19GS A;  2OKA A;  4QQ7 A;  10GS A;  1CQG A;  5GAP D;  3GUS A;  4KAE A;  1F37 A;  3AY8 A;  3LW9 A;  1TOF A;  3HZ8 A;  4FYB A;  3S9F A;  2JZR A;  1GTI A;  1R26 A;  2JL4 A;  1G7O A;  3I69 A;  2MBT A;  4KW6 A;  1SJI A;  2IMF A;  2VAF A;  1OKT A;  1BJX A;  4HQS A;  2E0Q A;  3WT2 A;  4DEJ A;  4IQA A;  3H79 A;  1BG5 A;  1HNA A;  1BED A;  3GH9 A;  4KB3 A;  1G6Y A;  3QFB C;  3CRU A;  4P3Y B;  3DWV A;  1XW9 A;  5ELA A;  1OE7 A;  4ULX A;  4GF0 A;  5F06 A;  3TUE A;  4ZL7 A;  2N5F A;  4OFM A;  3W8J A;  3TKP A;  1OC9 B;  2WZ9 A;  1ST9 A;  22GS A;  1ERU A;  2ON5 A;  4NMU A;  1YF0 A;  2GQK A;  1ACV A;  2YWM A;  3FKF A;  5AIV A;  1X9W B;  1VF3 A;  3DML A;  2C0F A;  2CV4 A;  4RI7 A;  1F6M C;  2YJ7 A;  2MMA A;  3QCP A;  2C3Q A;  2MMO A;  3H8Q A;  2G2Q A;  4BL7 A;  3ZIV A;  1GSQ A;  4IW9 A;  3RPN A;  2OBI A;  3FY7 A;  2GT5 A;  2KHP A;  2LJA A;  3GKX A;  4RQR A;  5HR2 A;  3UJ1 A;  4ECC A;  2NPB A;  1TDI A;  2P5R A;  4PX1 A;  5JCW A;  5D96 A;  3GH6 A;  4RI6 A;  2YV7 A;  3HYP A;  4V1A p;  3KH7 A;  2F8A A;  1MDK A;  3P2A A;  2DSA A;  2L4C A;  4JE1 A;  2RII A;  3EC3 A;  5ECN B;  3D6I A;  3GYK A;  1QQ2 A;  2NBS A;  1PL1 A;  1H4O A;  3DVX A;  5IMD A;  4V2M A;  2DKH A;  3GTU B;  1NW2 A;  2JAD A;  3CYN A;  1PX7 A;  4PGT A;  4TR4 A;  1SYX A;  5ECK B;  2R0C A;  1WMJ A;  3LEF A;  1XWA A;  4YAP A;  2H19 A;  2HYX A;  4WXT A;  4OCF A;  3UIW A;  1X0R A;  4BVY A;  3QAV A;  2LNT A;  1EZK A;  4HUA A;  4V2L A;  1EGR A;  4LL1 B;  1K3Y A;  3MNG A;  4H86 A;  1TK8 B;  3VUR A;  4MF5 A;  4ZB8 A;  4EVM A;  3IE3 A;  3WD6 A;  4O32 A;  2YAN A;  1HQO A;  4MMM A;  3TJK A;  3RHC A;  3G7I A;  5ENU A;  4MJC A;  1M9B A;  1T4Y A;  4EO3 A;  2R0G A;  2QC7 A;  2AUV A;  4KDU A;  4EIP A;  4X4J A;  2YWN A;  4HZ4 A;  2E7P A;  1MD4 A;  3EE2 A;  2B6M A;  3BCI A;  2KP1 A;  2HZE B;  2CT6 A;  3QMX A;  4CDO A;  1PX6 A;  4IJ3 A;  1Z7R A;  5HFI A;  4ZIL A;  4OO5 A;  4PNF A;  2IMI A;  4CY8 A;  2RM6 A;  3HKR A;  1O8X A;  2E2G A;  1O73 A;  3F8U A;  1TK5 B;  3ZMK A;  3BJ5 A;  1M2D A;  5EY6 A;  1FB0 A;  4F0B A;  5INY A;  4HU7 A;  1GH2 A;  4MZW A;  3GUR A;  3EMP A;  5DJM A;  2GZZ A;  4AJ6 A;  3FHK A;  4NAX A;  1M2B A;  2KP2 A;  4G2E A;  4XS4 B;  1K0B A;  3J7Y b;  1XZO A;  4AF2 A;  2IN3 A;  4ISD A;  2D2Z A;  3O3T A;  1USB A;  2X64 A;  2WUL A;  5IPH A;  3L78 A;  4XHM A;  6GSV A;  1KBN A;  3DYR A;  4XS6 A;  2PVO C;  3UOM A;  4G9H A;  3L9S A;  3EU3 A;  4DVC A;  3G7J A;  5E4W A;  3I9V 2;  2ALB A;  4NHW A;  2HFD A;  2K9F A;  4K1F A;  1RK4 A;  3TOT A;  4ZL9 A;  3ZIT A;  3GKN A;  3NIV A;  2I9H A;  2MZC A;  1M99 A;  2XPD A;  4EE0 A;  4XS1 A;  4E8H A;  5IM9 A;  1TU7 A;  5J9C A;  3PGT A;  2GZP A;  1BQ7 A;  5CRG A;  2M72 A;  4MF7 A;  4I2T A;  2VL3 A;  6GSU A;  2L5L A;  3ZFL A;  1EOH A;  5GST A;  3IHQ A;  1YY7 A;  4FQU A;  1WOU A;  4KX4 A;  5IOW A;  3SWL A;  3HJM A;  4HI7 A;  4JR4 A;  3ERG A;  2AV4 A;  4A5P A;  2H1G A;  5ELG A;  3UVH A;  4GCI A;  2C3N A;  1BX9 A;  1IYH A;  5IOX A;  1SJ6 A;  5GZZ B;  1GUH A;  1Y6E A;  2H70 A;  3ISO A;  4EL1 A;  4TKY A;  1K0O A;  1PN9 A;  2K6V A;  4USS A;  2H6X A;  4J56 E;  6GSX A;  1GLQ A;  1Z5Y E;  1SYR A;  4PUF C;  4IBP A;  5C00 A;  3LYP A;  2JU5 A;  3C1R A;  2IFQ B;  2MMN A;  4TXO A;  2B7J A;  3KP9 A;  2GTU A;  1GUM A;  5IMC A;  2L59 A;  3VWU A;  2HRN A;  2CQ9 A;  3RAZ A;  3IHG A;  1KTE A;  4TR0 A;  1J9B A;  2V2G A;  4MJB A;  3I43 A;  1AQW A;  2CVD A;  2OAD A;  2X8G A;  2G0F A;  1Z3E A;  1CQH A;  4GLT A;  3GL5 A;  1A24 A;  1I9D A;  5COH A;  3NOF A;  2GST A;  3ZVJ D;  2REM A;  2L6D A;  5DAL A;  3H1N A;  2A4V A;  3TJG A;  1ZOF A;  1FB6 A;  3EU4 A;  2J9H A;  1B8X A;  1TKD B;  2C3T A;  1GNE A;  3IRA A;  1SK2 A;  5CP1 A;  2VLU A;  2R3X A;  2V6K A;  2WDU A;  1PL2 A;  1GSS A;  4IQ1 A;  5D9W A;  1ZMA A;  3MAK A;  2O7K A;  2YNX A;  4KF9 A;  3VWV A;  1DUG A;  1KEB A;  3FMW A;  5A4U A;  3HY2 A;  3TGZ A;  3FEU A;  4Q5Q A;  2L57 A;  4ZBB A;  3F3Q A;  3ME7 A;  1HD2 A;  4I6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...