2XBIA

Crystal structure of schistosoma mansoni thioredoxin at 1.6 angstrom
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
GSMSKLIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKYDAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Structural and Functional Characterization of Schistosoma Mansoni Thioredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 33
structure length 108
sequence length 108
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xbiA00
4KGIA 1AW9A 5F06A 3VPTA 1THOA 4HJ2A 4WR4A 1S3AA 5IMDA 1TXXA 2YWMA 4FYCA 3TOUA 2P5QA 2V1MA 3MDKA 2KUCA 2AB6A 3P8WA 1NW2A 4LMWA 4JEDA 1VF4A 5D93A 4G2EA 1NHYA 3HCZA 2MYGA 1UA5A 2AUVA 5AGYA 2C0GA 4OCEA 2CT6A 2LUSA 5G30A 2H71A 2AAWA 3KP8A 1B8XA 4F82A 5HR2A 4DVCA 4MLYA 3LORA 2J9HA 4L5LA 1Z3EA 4IJ3A 3WGXA 2QKEA 1JZWA 1XFLA 2ZNMA 4XHMA 5ECHB 1PD21 2OKAA 3G7YA 2C80A 3H8QA 2EC4A 3FR9A 1Y25A 1ZOFA 1K0CA 5LCZA 2G2QA 3KZQA 4I5QA 1TOFA 2OA7A 2YJHA 2FNOA 3ZIJA 3TDGA 1J9BA 2H6XA 5G5EA 1U87A 3I6AA 2H0HA 1R26A 1A2JA 2P31A 4FH8A 3FKFA 3WT2A 1Q4JA 1GSYA 2B3SA 3IOSA 4PNFA 4ACSA 3E0UA 4DSSB 6GSVA 3BJ5A 3E9JB 2ZCTA 4NWYA 4OD7A 5CRHA 5KEJA 4EE0A 1GTIA 1IYHA 4GQFA 2L4QA 5G1LA 4ILFA 2FHEA 5ID2A 2YV9A 2MZCA 4MH2A 3Q18A 1W89A 1U3IA 4O7HA 3F6DA 2LJRA 2IJYA 5D9VA 2V6KA 1JZRA 4EVMA 3M3MA 3QDNA 3H1NA 3GHAA 4XRDA 2FWGA 4GCIA 2CX3A 1GUHA 3ZREA 1XWGA 3PINA 3D6IA 4N11A 3SBCA 3KH9A 4ECBA 2X8GA 3D5JA 2I1UA 1SL0B 2DSAA 2KOKA 2CV4A 1V2AA 1S3CA 1SK2A 5GSTA 3GH9A 2IPAA 4YQMA 3DIEA 2H0GA 5HFKA 1ML6A 4J2FA 4WR5A 3EVIA 4MK3A 2A2SA 3WD6A 5JWOB 4KDYA 3APQA 5DVBA 1A8YA 2ZUPA 5D9TA 2B6MA 2D2ZA 2YZHA 5DCHA 4PNGA 1ERUA 1ERWA 2JZSA 2I9HA 2LQOA 5EL8A 1BG5A 3APSA 2GTUA 1FAAA 4WKWA 2X8HA 4K9ZA 1N2AA 1EV4A 2YV7A 1URMA 3GUSA 1EEMA 5G5FA 3UEMA 3HKRA 1GP1A 3RBTA 1KBNA 2GVPA 3KTBA 3GNJA 3FY7A 3TUEA 1BAYA 2MMOA 4DSQA 3LG6A 4GTUA 1THXA 2LNSA 2PU9C 3CXGA 2K18A 2XBQA 1DUGA 2N5FA 2FGXA 2JU5A 2FA8A 3KXOA 1YQ1A 4AJ7A 1J0FA 2H73A 2YOIA 4NHWA 1GNEA 2A2RA 3KIJA 3EMXA 4PUAA 1SD9A 4ML6A 2IWTA 3FHKA 1H75A 4ZL7A 2F9SA 2O87A 2JSZA 5A4WA 2HXKA 5HFIA 3IE3A 5A4UA 4OFTA 3LGCA 1ZL9A 1YDKA 1EGRA 3W8JA 3IDVA 2TRXA 1G7EA 1K0MA 4QQ7A 4GLTA 6GSYA 2L5LA 1U6TA 1HNAA 2O8VB 3BOAA 4ZL9A 3TGZA 5E4WA 1M2BA 2I3YA 4GSSA 5F05A 1TK5B 4BWSA 5ID2B 2GZZA 3L78A 3HHVA 4WETA 1X5CA 3H93A 1MTCA 2X8CA 5IOWA 1T4ZA 2GZPA 2H1GA 1XOAA 4IKHA 2GDRA 3GSTA 1XOBA 4IP6A 1R4WA 1JHBA 4E8EA 1T00A 4YQUA 3VI7A 2XBIA 2JZTA 4OFNA 3BD2A 1YJ6A 4OO5A 1Z6NA 2CAQA 2DJJA 1YEPA 1SKSB 5EPFA 3GKMA 4HZ4A 3TOTA 2CQ9A 4V2NA 2C3NA 3QAGA 1Y6EA 3GTUA 5J9CA 4KX4A 2JSYA 1PX6A 1FW1A 3LYKA 3M0FA 4JR4A 5A4VA 3ME8A 6GSWA 3KP9A 4ISDA 1HD2A 3ZYWA 3KCMA 5CRGA 2LV3A 3FZ9A 2VCXA 2CAIA 9GSSA 1A8LA 4GRFA 4K7OA 1M99A 1Z6MA 1GTBA 1Z7PA 5F8BA 3QAWA 1MDJA 1X9WB 2YN1A 3HY2A 4YAVA 4GSTA 4ECIA 5INYA 2PUKC 5DCGA 1ON4A 1CQGA 2H30A 3DXBA 4KA0A 2GSTA 1GSDA 4LL1B 4BPYA 2YWOA 4NAXA 3W8SA 3CYNA 3S9FA 4IHUA 2PGTA 1ABAA 4F2IA 1OYJA 4JU5A 1UVZA 3IRAA 2VLTA 3HZ8A 4KNDA 2QGVA 2FLSA 4NXIA 2QC7A 17GSA 1RQMA 4KSMA 2DJ1A 1S3DA 1KTEA 4H86A 4MJCA 1JLVA 5B7CA 1M0UA 3HD5A 2FWFA 4GQCA 2R5GA 2M80A 1KEBA 3BCIA 3KH7A 3O3TA 4DSRA 3HVSA 4OWYA 4IVFA 6GSUA 1A2MA 5IM9A 2MMNA 4WXTA 5L71A 2PN8A 5LNKe 2KHPA 3DEXA 3QCPA 5D73A 3A2VA 1X5EA 1EOHA 5IPGA 1VGLA 3QFBC 3GN3A 1AUCA 3LQ7A 4WBJA 2MBTA 3F3QA 2H1DA 3KEBA 1AC1A 3L4NA 1JLWA 4N10A 3RHBA 4EDYA 2IMFA 3TKRA 5D9WA 4QL7A 2LTKA 1GSQA 2HT9A 2HFDA 3KD0A 1PKWA 3KM6A 4IP1A 3F4RA 3GKKA 5IMVA 4TOPA 4RI6A 2ON5A 1SK1A 2GQKA 4XRAA 1GLPA 2NPBA 3TKPA 2DJ3A 5IMAA 4MCUA 1WRYA 5DBQA 3KMNA 4CW9A 2H1BA 2DBCA 1SD8A 1VRSD 3GTUB 2L5OA 5GAND 4KW6A 19GSA 4NV2A 4V2MA 2VCVA 2K8SA 2GT5A 1USBA 3IR4A 3ZIVA 1K0OA 20GSA 1FVJA 5ECRB 1G0TA 1ZYQB 2GQMA 3LYPA 4PUFC 2FY6A 4ZB6A 4G9HA 2WJUA 2VD1A 2VUPA 2DIYA 4O92A 5KN3A 1DBYA 4ID0A 3TKSC 3RHCA 1BJXA 4MZWA 3G7IA 4O5RA 2VM1A 2HI7A 4YAPA 5DQSA 1TDIA 1TTZA 2FUG2 2OACA 5DJMA 3I69A 4GF0A 2R3XA 3TRQA 2R37A 1M2AA 3HJOA 3DKSA 3HA9A 1SJZA 2TIRA 3LSZA 5JCWA 2YANA 4J57E 1HYUA 3HJPA 1V9WA 3MSZA 2GZYA 4N0ZA 2VL2A 4AJ6A 2JZRA 3EYTA 4HJMA 4HEA2 4KDUA 2XPDA 2OE1A 1GTUA 4KCAA 3GYKA 1FB6A 3FZ5A 2AV4A 3TB2A 1TU8A 4POBA 2E2MA 4EC0A 3HXSA 5ENUA 5AIXA 2FA4A 1YF1A 5G1KA 4LL4B 1YZXA 1K0AA 5IMZA 1ZCPA 1UN2A 2LJKA 4NMUA 1O85A 2J23A 1XVWA 3FEUA 1HNCA 1T4YA 1OVNA 1EOGA 5H5RA 1QXHA 4E8HA 4I8BA 4BWQA 4G19A 1R5PA 2VCZA 10GSA 2CVBA 1GWCA 4OFMA 2WRTA 3N5OA 1OE8A 5JWRB 1QQ2A 2HE3A 2B5XA 2C0EA 1JFUA 3F6FA 1AQWA 3ZFLA 1Z9HA 3A2WA 3DGQA 3FZAA 1FVKA 3CTFA 5FHIA 5JCGA 1T1VA 1PSQA 2VLVA 4XS6A 5DDLA 5IPHA 5AISA 3UBKA 1XW9A 2LRCA 2VAFA 1PA3A 1XWCA 13GSA 2EIRA 3F63A 1PGTA 2B5YA 3GX0A 3LXTA 4F03A 4O32A 4MPFA 1F6MC 2O89A 4YQVA 2VO4A 3KGKA 1NHOA 3NZNA 1PX7A 1VF3A 1GH2A 3J7Yb 3Q19A 1V40A 1YKAA 4ZBBA 1GULA 4EL1A 4MF6A 2H76A 2LRTA 1GSFA 2H74A 2EIOA 2JADA 2RUEA 4BVXA 4EXJA 4HUAA 4AJ8A 3GMFA 3TKQA 2C0DA 2HLSA 5ECIB 3QMXA 4IJIA 4L0UA 1LU4A 2VCQA 4IN0A 5HR3A 4MMMA 4WEYA 4TXVA 3D22A 1O81A 1TJDA 2DIZA 4ZXGA 3WGDA 1YY7A 2RLIA 4XCSA 3EURA 2K9FA 2VCWA 1SKWB 5DJLA 2YWNA 1XZOA 2OBKA 18GSA 1JZOA 1OKTA 2B7JA 3EU3A 2LQQA 2IL3A 3CRTA 2A4VA 1VF1A 4OO4A 3ZLPA 1WIKA 1WPIA 3EC3A 3TCOA 4IS0A 4EUYA 4ZBAA 5B6NA 4ZBDA 1F3AA 2AJQB 1EEJA 3ME7A 2CZ3A 4OMVA 5D96A 5DQYA 5KN0A 4TW5A 1PRXA 3I43A 16GSA 2HRFA 2OJLA 3DVXA 2LSTA 3C8EA 3CSHA 4K7IA 4Q5NA 5ECSA 5J9BA 4CDOA 2B1LA 2O85A 3C7MA 4K2DA 2P5RA 4FO5A 5ECKB 2L57A 4NV5A 2C4JA 3IAM2 1XW6A 1B9YC 1FB0A 2V2GA 2GSSA 1SL2B 4POLA 3IA1A 1GSUA 3D4MA 4TVEA 2MMAA 4IBPA 4L5OA 1TRWA 1A24A 2ALBA 2CZ2A 2ON7A 3GKNA 5H5QA 1FG4A 3WGEA 1C72A 1GUKA 3JCML 4WF4A 2GT6A 4IW9A 2GGTA 5IIZA 2HSHA 3VWWA 5GZZB 1PL2A 5JWQB 3L9SA 3IBHA 3RDWA 1GLQA 1GUMA 4PXOA 4MZCA 2DJKA 4BL7A 4EO3A 3UL3A 1SKRB 3QPMA 1T3BA 2FWHA 4PGTA 2H66A 2L59A 4MF7A 1ERVA 2IMDA 1TI1A 3QOUA 3ERWA 5FT3A 5B8BA 2B1KA 1XVQA 3K8NA 3MWHA 1NSWA 4Q5QA 3L0HA 1EWXA 1F2EA 1OC3A 1HNBA 1XCCA 3J7Yk 5GSSA 2V32A 1W4VA 1GSEA 3DVWA 3ZMLA 3W6GA 5C00A 1O73A 5HFGA 2IMEA 3TRPA 2BTOT 2LKUA 1EGOA 1XBSA 1F37A 3C73A 3RPPA 4BA7A 4L0WA 1PQNA 3QD9A 1EZKA 3O76A 1X9SB 1WWJA 3CSJA 3C71A 2R2JA 1ILOA 5ECQB 1N8JA 1DE1A 5E59A 4HI7A 3FW2A 3D21A 2C8UA 3A3TA 5CRWA 5ECLB 1V58A 1PMTA 3TJBA 3FZ4A 3M9JA 22GSA 3N9JA 1K0DA 5JCUA 2V6OA 3L9UA 2X99A 4AGSA 3G9BA 3EWLA 2WFCA 1WMJA 1XPVA 4GWRA 4MF5A 2LS5A 4KCEA 3IV4A 1ZYEA 5G2ZA 1T8EB 1BQ7A 2FD3A 11GSA 1ACVA 2PERA 4F0CA 3ZFBA 1I5GA 1RK4A 4N0VA 1SYRA 2DMMA 3F0IA 2H72A 2F8AA 1M2DA 6GSXA 3CSIA 2VOCA 1B4PA 2XPEA 2IMKA 4NPBA 3F4SA 4IQAA 1MD4A 2VL9A 4YH2A 2YZUA 3TRXA 1GTAA 4RUVA 4RQXA 2Z9SA 2GSQA 3UOMA 4PX1A 3LWAA 2WB9A 3HDCA 1FHEA 1PN9A 2E0QA 3HVXA 3VWXA 1G6WA 1EV9A 4FYUA 1TRUA 1AIUA 4ULXA 2VL3A 3H79A 1SJ6A 2H6YA 4XTSA 5LD0A 2NVLA 6GSSA 3LFLA 1MDIA 2GLRA 2YPMA 4AF2A 1TRVA 4JE1A 1OAZA 3LXZA 1LJRA 2DLXA 1K3LA 2XC2A 5J4UA 4LA1A 2I81A 2P0GA 3ZTLA 4RQRA 1BYEA 1Z7RA 2K8VA 2NDOA 1O8WA 3A5WA 1GSSA 4ECJA 4X43A 4TR3A 2B5EA 1SJIA 4MDCA 1F3BA 3GKXA 3ZL5A 1AXDA 5CP1A 7GSSA 5F07A 4K0NA 3ERGA 3F9UA 2WCIA 2JACA 1K3YA 4PURA 5GAPD 1Q98A 2HNLA 1E2YA 4KAEA 4F9ZA 4X0XA 3GL3A 3F4TA 3UVHA 2OBIA 4TKYA 5IO2A 4I97A 2EIQA 4DEJA 1PKZA 3ISOA 4EF0A 4MP4A 5ECOB 3HYPA 2N5AA 3R2QA 3HZ4A 4PQIA 3GH6A 3H4KA 1U88A 2BJXA 1PL1A 2F8FA 2OE0A 3GIXA 1XXUA 2IMIA 1U3AA 2H19A 3FK8A 5HR0A 2H1AA 4XS4A 2MMZA 3U6VA 3C1RA 1A0FA 3QFAC 4L8EA 3RPNA 2RM5A 1R5AA 4MPGA 2G0FA 2H6ZA 4HU7A 1TK8B 1K3OA 3MNGA 1J08A 2LJAA 5A5KA 4TR4A 2VCTA 2M46A 4MJEA 4GXZA 3KJYA 3A2XA 3E3EA 4EKZA 3UJ1A 3KMOA 3IK7A 1TW9A 1SENA 3MAKA 3GV1A 3VFIA 1F9MA 4ZB8A 1M7TA 2HZFA 3FR6A 1ZMAA 2PVQA 5IMFA 1SK0A 1MD3A 1H4OA 2GSRA 4PQ1A 2X64A 1X5DA 2E7PA 3D4TA 5J3RA 1ZGNA 2LRNA 3F8UA 4HZ2A 3GURA 2LNTA 4TR1A 4HS1A 3WT1A 2XHFA 1XWAA 3HVVA 5IOXA 3GX8A 2H01A 3VWVA 1OC9A 2YP6A 1T7PB 1I9DA 3EINA 5G31A 5ECNB 5J41A 3QAVA 5ABRA 2N5BA 3Q6OA 1AQXA 2GS3A 5KN2A 2YJ7A 1G7OA 3VLNA 4FIWA 4JBBA 1GL8A 3UIWA 1K0NA 3DWVA 3ED3A 4XIHA 2QSIA 3ZITA 5AIVA 2OE3A 4X1UA 4Q5RA 2YWIA 4KUNA 5HQPA 4RI7A 5CYYA 4MABA 4JR6A 1E6BA 4CHSA 4K1FA 5DALA 3FR3A 2PVOC 3GFKA 4MA9A 2H75A 4WBRD 1YF0A 1BX9A 2L4CA 2H8LA 1SL1B 2HZEA 1FO5A 2DC5A 2RM6A 1TKDB 2PPTA 5C04A 4ML1A 3ZVJA 2WGRA 3L9VA 4XS4B 3AY8A 1A23A 2LEGA 4HQSA 4V1Ag 3I9V2 3G7JA 2PBJA 1OC8A 3TJFA 3PR8A 3UARA 2VL2C 2DJ2A 3P90A 5D8IA 4KDXA 2C3QA 2K6VA 2AHEA 4TXOA 2HRNA 2L6DA 2CVDA 1XIYA 2WZ9A 4K8MA 2RIIA 4K7NA 5HR1A 2KP1A 1LBKA 1A2LA 2M72A 3O6TA 2O7KA 1Z5YE 5CAXA 3HJMA 3ZVJD 4ZB9A 2GQLA 1EP8A 4OCFA 4MJAA 3C1SA 4BVYA 3KTLA 2NTOA 3APOA 4ECCA 4HQZA 2WULA 5ELGA 4D73A 1TP9A 4QL9A 1SYXA 4TR1B 3PH9A 3IHQA 3M8NA 3Q74A 4J56E 1WP0A 4NHZA 1K0BA 3FRCA 1OC9B 4V2LA 1KNGA 2C3TA 4HU9A 2V41A 3GRXA 5DAKA 2BMXA 1ST9A 1XW5A 5CREA 3FYGA 3RAZA 5IQYA 8GSSA 3CMIA 1G6YA 5ELAA 1XWBA 3ZMKA 1TI3A 1O6JA 4EDZA 3EMPA 4I2UA 3GA4A 3GSSA 3M9KA 3NOFA 5B6MA 4IGJA 4KH7A 2CX4A 1JZDA 3UAPA 4K6XA 1UC7A 1R7HA 1DSBA 3GL5A 3TJJA 1BEDA 3TJKA 4LLRA 3PGTA 4KSOA 5CO3A 5FWGA 3P7XA 2B7KA 4V1Ap 4WF5A 2CVKA 1MEKA 1QUWA 4F0BA 4ZL8A 2DMLA 5CRDA 3TKSA 3IK9A 3CRUA 3TJGA 4JZQA 6GSTA 3UVTA 5DALB 1OE7A 2REMA 2IFQA 5J5NA 3VURA 5IMCA 2C0FA 2HZEB 3UBLA 1TK0B 3TKSE 4K0GA 4Q5FA 3LJRA 1YEXA 4I6XA 1AQVA 4KB3A 2KP2A 5KN1A 5F0GA 2PWJA 2YCDA 4MJBA 4IQ1A 5EY6A 12GSA 3VPQA 4TXOB 3ERFA 1CQHA 2KLXA 5CNWA 3BBYA 3VK9A 5EVOA 5H5SA 4KE3A 1V98A 2MBSA 1V57A 4GSNA 3ZRDA 3NIVA 2VLUA 4ZILA 3IC4A 1EP7A 1RW1A 2I4AA 2IIYA 4POKA 4XS1A 1MDKA 1XWKA 1QFNA 1NM3A 4MZBA 2TRCP 4D73B 3VI5A 4JRRA 3VWUA 1AAZA 4POMA 2DJ0A 4TN8A 2R4VA 2WDUA 3SWLA 1WOUA 2E2GA 3DMLA 5ECPB 2C1YA 1YKCA 3DD3A 3US3A 1O8XA 3DRNA 2H0IA 2PMTA 2VIMA 1QGVA 1TU7A 1WE0A 5DAKB 2NBSA 4TRXA 2YNXA 4G10A 5AN1A 1DE2A 4TR0A 1FOVA 3LEFA 1B48A 2H70A 1ZZYA 3IAS2 2VD0A 3DYRA 3UMAA 3BCKA 1HQOA 1B9XC 1M9BA 2JL4A 4I2TA 4HDEA 5ECMB 1ERTA 2F3MA 3V1WA 1X9MB 1QK8A 1VF2A 2R6KA 2OADA 2F51A 2L6CA 5D9XA 3QR6A 1TRSA 3OR5A 1OKDA 4MH3A 1IYIA 4IELA 3EU4A 4PQHA 1WJKA 2ES7A 4DSSA 1M9AA 3D0ZA 1O7UA 2AYTA 2FCHA 2IFQB 4N30A 2CA8A 3P2AA 3IXRA 4FYBA 4Z7XA 14GSA 2WS2A 4ZIJA 1B4QA 1GNWA 3EE2A 4LMVA 3IPZA 5COHA 3CTGA 2HSYA 3CBUA 4P3YB 3M1GA 1QMVA 1X0RA 1SU9A 3F3RA 3WYWA 2FWEA 5IO0A 3U5RE 2RUFA 1GRXA 2IN3A 4HOJA 1A0RP 5B8AA 2HYXA 3ZZXA 2VM2A
chains in the Genus database with same CATH superfamily
4KGIA 1AW9A 5F06A 3VPTA 1THOA 4HJ2A 4WR4A 1S3AA 5IMDA 1TXXA 2YWMA 4FYCA 3TOUA 2P5QA 2V1MA 3MDKA 2KUCA 4Z2RA 2AB6A 3P8WA 1NW2A 4LMWA 4JEDA 4G0LA 1VF4A 5D93A 4G2EA 1NHYA 3HCZA 2MYGA 1UA5A 2AUVA 4G0IA 5AGYA 2C0GA 4OCEA 2CT6A 2LUSA 5G30A 2H71A 2AAWA 3KP8A 1B8XA 4F82A 5HR2A 4DVCA 4MLYA 3LORA 2J9HA 4L5LA 4K2XA 1Z3EA 4IJ3A 3WGXA 2QKEA 1JZWA 1XFLA 2ZNMA 4XHMA 5ECHB 1PD21 2OKAA 3G7YA 2C80A 3H8QA 2EC4A 3FR9A 1Y25A 4CY6A 1ZOFA 1K0CA 5LCZA 2G2QA 3KZQA 4I5QA 1TOFA 2OA7A 2YJHA 2FNOA 3ZIJA 3TDGA 1J9BA 2H6XA 5G5EA 1U87A 3I6AA 2H0HA 1R26A 1A2JA 2P31A 4FH8A 1S3RA 3FKFA 3WT2A 1Q4JA 1GSYA 2B3SA 3IOSA 4PNFA 4ACSA 3E0UA 4DSSB 6GSVA 3BJ5A 3E9JB 2ZCTA 4NWYA 4OD7A 5CRHA 5KEJA 4EE0A 1GTIA 1IYHA 4GQFA 2L4QA 5G1LA 4ILFA 2FHEA 5ID2A 2YV9A 2MZCA 4MH2A 3R3EA 3Q18A 1W89A 1U3IA 4O7HA 3F6DA 2LJRA 2IJYA 5D9VA 2V6KA 1JZRA 4EVMA 3M3MA 3QDNA 3H1NA 3GHAA 4XRDA 2FWGA 4GCIA 2CX3A 1GUHA 3ZREA 1XWGA 3PINA 3D6IA 4N11A 3SBCA 3KH9A 4ECBA 2X8GA 3D5JA 2I1UA 1SL0B 2DSAA 2KOKA 2CV4A 1V2AA 1S3CA 1ZYNA 1SK2A 5GSTA 3GH9A 2IPAA 4YQMA 3DIEA 2H0GA 5HFKA 1ML6A 4J2FA 4WR5A 3EVIA 4MK3A 2A2SA 3WD6A 5JWOB 4KDYA 3APQA 5DVBA 1A8YA 2ZUPA 5D9TA 2B6MA 2X49A 2D2ZA 2YZHA 5DCHA 4PNGA 1ERUA 1ERWA 2JZSA 2I9HA 2LQOA 5EL8A 2HRKA 1BG5A 3APSA 2GTUA 1FAAA 4WKWA 2X8HA 4K9ZA 1N2AA 1EV4A 2YV7A 1URMA 3GUSA 1EEMA 5G5FA 3UEMA 1FOHA 3HKRA 1GP1A 3RBTA 1KBNA 2GVPA 3KTBA 3GNJA 3FY7A 3TUEA 1BAYA 2MMOA 4DSQA 3LG6A 4GTUA 1THXA 2LNSA 2PU9C 4ICYA 3CXGA 2K18A 2XBQA 1DUGA 2N5FA 2FGXA 2JU5A 2FA8A 3KXOA 1YQ1A 4AJ7A 1J0FA 2H73A 2YOIA 4NHWA 1GNEA 2A2RA 3KIJA 3EMXA 4PUAA 1SD9A 2A4HA 4ML6A 2IWTA 3FHKA 1H75A 4ZL7A 2F9SA 2O87A 2JSZA 5A4WA 2HXKA 5HFIA 3IE3A 5A4UA 4OFTA 3LGCA 1ZL9A 1YDKA 1EGRA 3W8JA 3IDVA 2TRXA 1G7EA 1K0MA 4QQ7A 4GLTA 6GSYA 2L5LA 1U6TA 1HNAA 2O8VB 3BOAA 4ZL9A 3TGZA 5E4WA 1M2BA 2I3YA 4GSSA 5F05A 1TK5B 4BWSA 5ID2B 2GZZA 3L78A 3HHVA 4WETA 1X5CA 3H93A 1MTCA 2X8CA 5IOWA 1T4ZA 2GZPA 2H1GA 1XOAA 4IKHA 2GDRA 3GSTA 1XOBA 4IP6A 3CQFA 1R4WA 1JHBA 4E8EA 1T00A 4YQUA 3VI7A 2XBIA 2JZTA 4OFNA 3BD2A 1YJ6A 4OO5A 1Z6NA 2CAQA 2DJJA 1YEPA 1SKSB 5EPFA 3GKMA 4HZ4A 3TOTA 4G0KA 2CQ9A 4V2NA 2C3NA 3QAGA 1Y6EA 3GTUA 5J9CA 4KX4A 2JSYA 1PX6A 1FW1A 3LYKA 3M0FA 4JR4A 5A4VA 3ME8A 6GSWA 3KP9A 4ISDA 1HD2A 3ZYWA 4O5UA 3KCMA 5CRGA 2LV3A 3FZ9A 2VCXA 2CAIA 9GSSA 1A8LA 4GRFA 4K7OA 1M99A 1Z6MA 1GTBA 1Z7PA 5F8BA 3QAWA 1MDJA 1X9WB 2YN1A 3HY2A 4YAVA 4GSTA 4ECIA 1PFOA 5INYA 2PUKC 5DCGA 1ON4A 1CQGA 2H30A 3DXBA 4KA0A 2GSTA 1GSDA 4LL1B 4BPYA 2YWOA 4NAXA 3W8SA 3CYNA 3S9FA 4IHUA 2PGTA 1ABAA 4F2IA 4K5SA 1OYJA 4JU5A 1UVZA 3IRAA 2VLTA 3HZ8A 4KNDA 2QGVA 2FLSA 4NXIA 2QC7A 17GSA 1RQMA 4KSMA 2DJ1A 1S3DA 1KTEA 4H86A 4MJCA 1JLVA 5B7CA 1M0UA 3HD5A 2FWFA 4GQCA 2R5GA 2M80A 1KEBA 3BCIA 3KH7A 3O3TA 4DSRA 3HVSA 4OWYA 4IVFA 6GSUA 1A2MA 5IM9A 2MMNA 4WXTA 5L71A 2PN8A 5LNKe 2KHPA 3DEXA 3QCPA 5D73A 3A2VA 1X5EA 1EOHA 5IPGA 1VGLA 3QFBC 3GN3A 1AUCA 3LQ7A 4WBJA 2MBTA 3F3QA 2H1DA 3KEBA 1AC1A 3L4NA 1JLWA 4N10A 3RHBA 4EDYA 2IMFA 3TKRA 5D9WA 4QL7A 2LTKA 1GSQA 2HT9A 2HFDA 3KD0A 1PKWA 2QA1A 3KM6A 4IP1A 3F4RA 3GKKA 5IMVA 4TOPA 4RI6A 2ON5A 1SK1A 2GQKA 4XRAA 1GLPA 2NPBA 3TKPA 2DJ3A 5IMAA 4MCUA 1WRYA 5DBQA 3KMNA 4CW9A 4YKGA 2H1BA 2DBCA 1SD8A 1VRSD 3GTUB 2L5OA 5GAND 4KW6A 19GSA 4NV2A 4V2MA 2VCVA 2K8SA 2GT5A 1USBA 3IR4A 3ZIVA 1K0OA 20GSA 1FVJA 5ECRB 1G0TA 1ZYQB 2GQMA 3LYPA 4PUFC 2FY6A 4ZB6A 4G9HA 2WJUA 2VD1A 2VUPA 2DIYA 4O92A 5KN3A 1DBYA 4ID0A 3TKSC 3RHCA 1BJXA 4MZWA 3G7IA 4O5RA 2VM1A 2HI7A 4YAPA 5DQSA 1TDIA 1TTZA 2FUG2 2OACA 5DJMA 3I69A 4GF0A 2R3XA 3IC8A 3TRQA 2R37A 1M2AA 3HJOA 3DKSA 3HA9A 1SJZA 2TIRA 3LSZA 5JCWA 2A2PA 2YANA 4J57E 4CY8A 1HYUA 3HJPA 1V9WA 3MSZA 2GZYA 4N0ZA 4Z2TA 2VL2A 4AJ6A 2JZRA 3EYTA 4HJMA 4HEA2 4KDUA 2XPDA 2OE1A 1GTUA 4KCAA 3GYKA 1FB6A 3FZ5A 2AV4A 3TB2A 1TU8A 4POBA 1M3JA 2E2MA 4EC0A 3HXSA 5ENUA 5AIXA 2FA4A 1YF1A 4X4JA 5G1KA 4LL4B 1YZXA 1K0AA 5IMZA 1ZCPA 1UN2A 2LJKA 4NMUA 1O85A 2J23A 1XVWA 3FEUA 1HNCA 1T4YA 1OVNA 1EOGA 5H5RA 1QXHA 4E8HA 4I8BA 4BWQA 4G19A 1R5PA 2VCZA 10GSA 2CVBA 1GWCA 4OFMA 2WRTA 3N5OA 1OE8A 5JWRB 1QQ2A 2HE3A 2B5XA 2C0EA 1JFUA 3F6FA 1AQWA 3ZFLA 1Z9HA 3A2WA 3DGQA 3FZAA 1FVKA 3CTFA 5FHIA 5JCGA 1T1VA 1PSQA 2VLVA 4XS6A 5DDLA 5IPHA 5AISA 3UBKA 1XW9A 2LRCA 2VAFA 1PA3A 1XWCA 13GSA 2EIRA 3F63A 1PGTA 2B5YA 3GX0A 3LXTA 4F03A 4O32A 4MPFA 1F6MC 2O89A 4YQVA 2VO4A 3KGKA 1NHOA 3NZNA 1PX7A 1VF3A 4BIKA 1GH2A 3J7Yb 3Q19A 1V40A 1YKAA 4ZBBA 1GULA 4EL1A 4MF6A 2H76A 2LRTA 1GSFA 4KF9A 2H74A 2EIOA 2JADA 2RUEA 4BVXA 4EXJA 4HUAA 4AJ8A 3GMFA 3TKQA 2C0DA 2HLSA 5ECIB 4A5PA 3QMXA 4HSCX 4IJIA 4L0UA 1LU4A 2VCQA 4IN0A 5HR3A 4MMMA 4WEYA 4TXVA 3D22A 1O81A 1TJDA 2DIZA 3LW9A 4ZXGA 3WGDA 1YY7A 2RLIA 4XCSA 3EURA 2HRAA 2K9FA 2VCWA 1SKWB 5DJLA 2YWNA 1XZOA 2OBKA 18GSA 1JZOA 1OKTA 2B7JA 3EU3A 2LQQA 2IL3A 3CRTA 2A4VA 1VF1A 4OO4A 3ZLPA 1WIKA 1WPIA 3EC3A 3TCOA 4IS0A 4USSA 4EUYA 4ZBAA 5B6NA 4ZBDA 1F3AA 2AJQB 1EEJA 3ME7A 2CZ3A 4OMVA 5D96A 5DQYA 5KN0A 4TW5A 1PRXA 3I43A 16GSA 2HRFA 2OJLA 2QA2A 3DVXA 2LSTA 3C8EA 3CSHA 4K7IA 4Q5NA 5ECSA 5J9BA 4CDOA 3HVNA 2B1LA 2O85A 3C7MA 4K2DA 2P5RA 4FO5A 5ECKB 2L57A 4NV5A 2C4JA 3IAM2 1XW6A 1B9YC 1FB0A 2V2GA 2GSSA 1SL2B 4POLA 3IA1A 1GSUA 3D4MA 4TVEA 3EPTA 2MMAA 4IBPA 4L5OA 1TRWA 1A24A 2ALBA 4PTSA 4FQUA 2CZ2A 2ON7A 3GKNA 5H5QA 1FG4A 3WGEA 1C72A 1GUKA 3JCML 4WF4A 2GT6A 4IW9A 2GGTA 5IIZA 2HSHA 3VWWA 5GZZB 1PL2A 5JWQB 3L9SA 3IBHA 3RDWA 1GLQA 1GUMA 4PXOA 4MZCA 2DJKA 4BL7A 4BVXB 3UL3A 4EO3A 1SKRB 3QPMA 1T3BA 2FWHA 4PGTA 2H66A 2L59A 4MF7A 1ERVA 2IMDA 1TI1A 3QOUA 3ERWA 5FT3A 5B8BA 2UZ8A 2B1KA 1XVQA 3K8NA 3MWHA 1NSWA 4Q5QA 3L0HA 1EWXA 1F2EA 1OC3A 1HNBA 1XCCA 3J7Yk 5GSSA 2V32A 1W4VA 1GSEA 3DVWA 3ZMLA 3W6GA 5C00A 1O73A 5HFGA 2IMEA 3TRPA 2BTOT 2LKUA 2DKHA 1EGOA 1XBSA 1F37A 3C73A 3RPPA 4BA7A 4L0WA 1PQNA 3QD9A 1EZKA 3O76A 1X9SB 2X4AA 1WWJA 3CSJA 3C71A 2R2JA 1ILOA 5ECQB 1N8JA 1DE1A 5E59A 4HI7A 3FW2A 3D21A 2C8UA 3A3TA 5CRWA 5ECLB 1V58A 1PMTA 3TJBA 3FZ4A 3M9JA 22GSA 3N9JA 1K0DA 5JCUA 2V6OA 3L9UA 2X99A 4AGSA 3G9BA 3EWLA 2WFCA 1WMJA 1XPVA 4GWRA 4MF5A 2LS5A 4KCEA 3IV4A 1ZYEA 5G2ZA 1T8EB 1BQ7A 2FD3A 11GSA 1ACVA 2PERA 4F0CA 3ZFBA 1I5GA 1RK4A 4N0VA 1SYRA 2DMMA 3F0IA 2H72A 2F8AA 1M2DA 6GSXA 3CSIA 2VOCA 1B4PA 2XPEA 2IMKA 4NPBA 3F4SA 4IQAA 1MD4A 2VL9A 4YH2A 2YZUA 3TRXA 1GTAA 4BL7B 4RUVA 4RQXA 2Z9SA 2GSQA 3UOMA 4PX1A 3LWAA 2WB9A 3HDCA 1FHEA 3MIXA 1PN9A 2E0QA 3HVXA 3VWXA 1G6WA 1EV9A 4FYUA 1TRUA 1AIUA 4ULXA 2VL3A 3H79A 1SJ6A 2H6YA 4XTSA 4Z2UA 5LD0A 2NVLA 6GSSA 3LFLA 1MDIA 2GLRA 2YPMA 4AF2A 1TRVA 4JE1A 1OAZA 3LXZA 1LJRA 2DLXA 1K3LA 2XC2A 5J4UA 4LA1A 2I81A 2P0GA 3ZTLA 1M3IA 4RQRA 1BYEA 1Z7RA 2K8VA 2NDOA 1O8WA 3A5WA 1GSSA 4ECJA 2R0CA 4X43A 4TR3A 2B5EA 1SJIA 4MDCA 1F3BA 3GKXA 3ZL5A 1AXDA 5CP1A 7GSSA 5F07A 4K0NA 3ERGA 3F9UA 2WCIA 2DKIA 2JACA 1K3YA 5KOWA 4PURA 5GAPD 1Q98A 2HNLA 1E2YA 4KAEA 4F9ZA 4X0XA 3GL3A 3F4TA 3UVHA 2OBIA 4TKYA 5IO2A 4I97A 2EIQA 4DEJA 1PKZA 3ISOA 4EF0A 4MP4A 5ECOB 3HYPA 2N5AA 3R2QA 3HZ4A 4PQIA 3GH6A 3H4KA 1U88A 2BJXA 1PL1A 2F8FA 2OE0A 3GIXA 1XXUA 2IMIA 1U3AA 2H19A 3FK8A 5HR0A 2H1AA 4XS4A 2MMZA 3U6VA 3C1RA 1A0FA 3QFAC 4L8EA 3RPNA 2RM5A 1R5AA 4MPGA 4K5RA 2G0FA 2H6ZA 4HU7A 1TK8B 1K3OA 3MNGA 1J08A 2LJAA 5A5KA 4TR4A 2VCTA 2M46A 4MJEA 4GXZA 3KJYA 3A2XA 3A5IA 3E3EA 4EKZA 3UJ1A 3KMOA 3IK7A 1TW9A 1ZYPA 1SENA 3MAKA 3GV1A 3VFIA 1F9MA 2R0GA 4ZB8A 1M7TA 2HZFA 3FR6A 1ZMAA 2PVQA 5IMFA 1SK0A 5BMUA 1MD3A 1H4OA 2GSRA 4PQ1A 2X64A 1X5DA 2E7PA 3D4TA 5J3RA 1ZGNA 2LRNA 3F8UA 4HZ2A 3GURA 2LNTA 4TR1A 4HS1A 3WT1A 2XHFA 1XWAA 3HVVA 5IOXA 3GX8A 2H01A 3VWVA 1OC9A 2YP6A 1T7PB 1I9DA 3PPUA 3EINA 5G31A 5ECNB 5J41A 3QAVA 5ABRA 2N5BA 3Q6OA 1AQXA 2GS3A 5KN2A 2YJ7A 1G7OA 3VLNA 4FIWA 4JBBA 1GL8A 3UIWA 1K0NA 3DWVA 4YKFA 3ED3A 4XIHA 2QSIA 3ZITA 5AIVA 2OE3A 4X1UA 1PN0A 4Q5RA 2YWIA 4KUNA 5HQPA 4RI7A 5CYYA 4MABA 4JR6A 1E6BA 4CHSA 3IHGA 4K1FA 5DALA 3FR3A 2PVOC 3GFKA 4MA9A 2H75A 4WBRD 1YF0A 1BX9A 2L4CA 2H8LA 1SL1B 4EIPA 2HZEA 1FO5A 2DC5A 2RM6A 1TKDB 2PPTA 5C04A 4ML1A 3ZVJA 2WGRA 3L9VA 4XS4B 3AY8A 1A23A 2LEGA 4HQSA 4V1Ag 3I9V2 3G7JA 2PBJA 1OC8A 3TJFA 3PR8A 3UARA 2HSMA 2VL2C 2DJ2A 3P90A 5D8IA 4KDXA 2C3QA 2K6VA 2AHEA 4TXOA 2HRNA 2L6DA 2CVDA 1XIYA 2WZ9A 4K8MA 2RIIA 4K7NA 5HR1A 2KP1A 1LBKA 1A2LA 2M72A 3O6TA 2O7KA 1Z5YE 5CAXA 3HJMA 3ZVJD 4ZB9A 2GQLA 1EP8A 4OCFA 4MJAA 3C1SA 4BVYA 3KTLA 2NTOA 3APOA 4ECCA 4HQZA 2WULA 5ELGA 4D73A 5BRTA 1TP9A 4QL9A 1SYXA 4TR1B 3PH9A 3IHQA 3M8NA 3Q74A 4J56E 1WP0A 4NHZA 1K0BA 3FRCA 1OC9B 4V2LA 1KNGA 2C3TA 4HU9A 2V41A 3GRXA 5DAKA 2BMXA 1ST9A 1XW5A 5CREA 3FYGA 3RAZA 5IQYA 8GSSA 3CMIA 1G6YA 5ELAA 1XWBA 1XG8A 3ZMKA 1TI3A 1O6JA 4EDZA 3EMPA 4I2UA 3GA4A 3GSSA 3M9KA 3NOFA 5B6MA 4IGJA 4KH7A 2CX4A 1JZDA 3UAPA 4K6XA 1UC7A 1R7HA 1DSBA 3GL5A 3TJJA 1BEDA 3MYDA 3TJKA 4LLRA 4EIQA 3PGTA 4KSOA 5CO3A 5FWGA 3P7XA 2B7KA 4V1Ap 4WF5A 2CVKA 1MEKA 1QUWA 4F0BA 4ZL8A 2DMLA 5CRDA 3TKSA 3IK9A 3CRUA 3TJGA 4JZQA 6GSTA 3UVTA 5DALB 1OE7A 5KOXA 2REMA 2IFQA 5J5NA 3VURA 5IMCA 2C0FA 2HZEB 3UBLA 1TK0B 3TKSE 4K0GA 4Q5FA 3LJRA 1YEXA 4I6XA 1AQVA 4KB3A 2KP2A 5KN1A 5F0GA 2PWJA 2YCDA 4MJBA 4IQ1A 5EY6A 12GSA 4MNNA 3VPQA 4TXOB 3ERFA 1CQHA 2KLXA 5CNWA 3BBYA 3VK9A 5EVOA 5H5SA 4KE3A 1V98A 2MBSA 1V57A 4GSNA 3ZRDA 3NIVA 2VLUA 4ZILA 3IC4A 1EP7A 1RW1A 2I4AA 2IIYA 4POKA 4XS1A 1MDKA 3FMWA 1XWKA 1QFNA 4BVYB 1NM3A 4MZBA 2TRCP 4D73B 3VI5A 4JRRA 3VWUA 1AAZA 4POMA 2DJ0A 4O5QA 4TN8A 2R4VA 2WDUA 3SWLA 1WOUA 2E2GA 3DMLA 5ECPB 2C1YA 1YKCA 3DD3A 3US3A 1O8XA 3DRNA 2H0IA 2PMTA 2VIMA 1QGVA 1TU7A 1WE0A 5DAKB 2NBSA 4TRXA 2YNXA 4G10A 5AN1A 1DE2A 4TR0A 1FOVA 3LEFA 1B48A 2H70A 1ZZYA 3IAS2 2VD0A 3DYRA 3UMAA 3BCKA 1HQOA 1B9XC 1M9BA 2JL4A 4I2TA 4HDEA 5ECMB 1ERTA 2F3MA 3V1WA 1X9MB 1QK8A 1VF2A 2R6KA 2OADA 2F51A 2L6CA 5D9XA 3QR6A 1TRSA 3OR5A 1OKDA 4MH3A 1IYIA 4IELA 3EU4A 4PQHA 1WJKA 2ES7A 4DSSA 1M9AA 3D0ZA 1O7UA 2AYTA 2FCHA 2IFQB 4N30A 2CA8A 3P2AA 3IXRA 4FYBA 4Z7XA 14GSA 2WS2A 4ZIJA 1B4QA 1GNWA 3EE2A 4LMVA 3IPZA 5COHA 3CTGA 2HSYA 3CBUA 4P3YB 3M1GA 1QMVA 1X0RA 1SU9A 3F3RA 3WYWA 2FWEA 5IO0A 3U5RE 2RUFA 1GRXA 2IN3A 4HOJA 1A0RP 5B8AA 2R0PA 2HYXA 3ZZXA 2VM2A
chains in the Genus database with same CATH topology
4KGIA 1AW9A 5F06A 3VPTA 1THOA 4HJ2A 4WR4A 1S3AA 5IMDA 1TXXA 2YWMA 4FYCA 3TOUA 2P5QA 2V1MA 3MDKA 2KUCA 4Z2RA 2AB6A 3P8WA 1NW2A 4LMWA 4JEDA 4G0LA 1VF4A 5D93A 4G2EA 1NHYA 3HCZA 2MYGA 1UA5A 2AUVA 4G0IA 5AGYA 2C0GA 4OCEA 2CT6A 2LUSA 5G30A 2H71A 2AAWA 3KP8A 1B8XA 4F82A 5HR2A 4DVCA 4MLYA 3LORA 2J9HA 4L5LA 4K2XA 1Z3EA 4IJ3A 3WGXA 2QKEA 1JZWA 1XFLA 2ZNMA 4XHMA 5ECHB 1PD21 2OKAA 3G7YA 2C80A 3H8QA 2EC4A 3FR9A 1Y25A 4CY6A 1ZOFA 1K0CA 5LCZA 2G2QA 3KZQA 4I5QA 1TOFA 2OA7A 2YJHA 2FNOA 3ZIJA 3TDGA 1J9BA 2H6XA 5G5EA 1U87A 3I6AA 2H0HA 1R26A 1A2JA 2P31A 4FH8A 3FKFA 3WT2A 1Q4JA 1GSYA 2B3SA 3IOSA 4PNFA 4ACSA 3E0UA 4DSSB 6GSVA 3BJ5A 3E9JB 2ZCTA 4NWYA 4OD7A 5CRHA 5KEJA 4EE0A 1GTIA 1IYHA 4GQFA 2L4QA 5G1LA 4ILFA 2FHEA 5ID2A 2YV9A 2MZCA 4MH2A 3R3EA 3Q18A 1W89A 1U3IA 4O7HA 3F6DA 2LJRA 2IJYA 5D9VA 2V6KA 1JZRA 4EVMA 3M3MA 3QDNA 3H1NA 3GHAA 4XRDA 2FWGA 4GCIA 2CX3A 1GUHA 3ZREA 1XWGA 3PINA 3D6IA 4N11A 3SBCA 3KH9A 4ECBA 2X8GA 3D5JA 2I1UA 1SL0B 2DSAA 2KOKA 2CV4A 1V2AA 1S3CA 1ZYNA 1SK2A 5GSTA 3GH9A 2IPAA 4YQMA 3DIEA 2H0GA 5HFKA 1ML6A 4J2FA 4WR5A 3EVIA 4MK3A 2A2SA 3WD6A 5JWOB 4KDYA 3APQA 5DVBA 1A8YA 2ZUPA 5D9TA 2B6MA 2X49A 2D2ZA 2YZHA 5DCHA 4PNGA 1ERUA 1ERWA 2JZSA 2I9HA 2LQOA 5EL8A 2HRKA 1BG5A 3APSA 2GTUA 1FAAA 4WKWA 2X8HA 4K9ZA 1N2AA 1EV4A 2YV7A 1URMA 3GUSA 1EEMA 5G5FA 3UEMA 1FOHA 3HKRA 1GP1A 3RBTA 1KBNA 2GVPA 3KTBA 3GNJA 3FY7A 3TUEA 1BAYA 2MMOA 4DSQA 3LG6A 4GTUA 1THXA 2LNSA 2PU9C 4ICYA 3CXGA 2K18A 2XBQA 1DUGA 2N5FA 2FGXA 2JU5A 2FA8A 3KXOA 1YQ1A 4AJ7A 1J0FA 2H73A 2YOIA 4NHWA 1GNEA 2A2RA 3KIJA 3EMXA 4PUAA 1SD9A 2A4HA 4ML6A 2IWTA 3FHKA 1H75A 4ZL7A 2F9SA 2O87A 2JSZA 5A4WA 2HXKA 5HFIA 3IE3A 5A4UA 4OFTA 3LGCA 1ZL9A 1YDKA 1EGRA 3W8JA 3IDVA 2TRXA 1G7EA 1K0MA 4QQ7A 4GLTA 6GSYA 2L5LA 1U6TA 1HNAA 2O8VB 3BOAA 4ZL9A 3TGZA 5E4WA 1M2BA 2I3YA 4GSSA 5F05A 1TK5B 4BWSA 5ID2B 2GZZA 3L78A 3HHVA 4WETA 1X5CA 3H93A 1MTCA 2X8CA 5IOWA 1T4ZA 2GZPA 2H1GA 1XOAA 4IKHA 2GDRA 3GSTA 1XOBA 4IP6A 1R4WA 1JHBA 4E8EA 1T00A 4YQUA 3VI7A 2XBIA 2JZTA 4OFNA 3BD2A 1YJ6A 4OO5A 1Z6NA 2CAQA 2DJJA 1YEPA 1SKSB 5EPFA 3GKMA 4HZ4A 3TOTA 4G0KA 2CQ9A 4V2NA 2C3NA 3QAGA 1Y6EA 3GTUA 5J9CA 4KX4A 2JSYA 1PX6A 1FW1A 3LYKA 3M0FA 4JR4A 5A4VA 3ME8A 6GSWA 3KP9A 4ISDA 1HD2A 3ZYWA 4O5UA 3KCMA 5CRGA 2LV3A 3FZ9A 2VCXA 2CAIA 9GSSA 1A8LA 4GRFA 4K7OA 1M99A 1Z6MA 1GTBA 1Z7PA 5F8BA 3QAWA 1MDJA 1X9WB 2YN1A 3HY2A 4YAVA 4GSTA 4ECIA 5INYA 2PUKC 5DCGA 1ON4A 1CQGA 2H30A 3DXBA 4KA0A 2GSTA 1GSDA 4LL1B 4BPYA 2YWOA 4NAXA 3W8SA 3CYNA 3S9FA 4IHUA 2PGTA 1ABAA 4F2IA 4K5SA 1OYJA 4JU5A 1UVZA 3IRAA 2VLTA 3HZ8A 4KNDA 2QGVA 2FLSA 4NXIA 2QC7A 17GSA 1RQMA 4KSMA 2DJ1A 1S3DA 1KTEA 4H86A 4MJCA 1JLVA 5B7CA 1M0UA 3HD5A 2FWFA 4GQCA 2R5GA 2M80A 1KEBA 3BCIA 3KH7A 3O3TA 4DSRA 3HVSA 4OWYA 4IVFA 6GSUA 1A2MA 5IM9A 2MMNA 4WXTA 5L71A 2PN8A 5LNKe 2KHPA 3DEXA 3QCPA 5D73A 3A2VA 1X5EA 1EOHA 5IPGA 1VGLA 3QFBC 3GN3A 1AUCA 3LQ7A 4WBJA 2MBTA 3F3QA 2H1DA 3KEBA 1AC1A 3L4NA 1JLWA 4N10A 3RHBA 4EDYA 2IMFA 3TKRA 5D9WA 4QL7A 2LTKA 1GSQA 2HT9A 2HFDA 3KD0A 1PKWA 2QA1A 3KM6A 4IP1A 3F4RA 3GKKA 5IMVA 4TOPA 4RI6A 2ON5A 1SK1A 2GQKA 4XRAA 1GLPA 2NPBA 3TKPA 2DJ3A 5IMAA 4MCUA 1WRYA 5DBQA 3KMNA 4CW9A 4YKGA 2H1BA 2DBCA 1SD8A 1VRSD 3GTUB 2L5OA 5GAND 4KW6A 19GSA 4NV2A 4V2MA 2VCVA 2K8SA 2GT5A 1USBA 3IR4A 3ZIVA 1K0OA 20GSA 1FVJA 5ECRB 1G0TA 1ZYQB 2GQMA 3LYPA 4PUFC 2FY6A 4ZB6A 4G9HA 2WJUA 2VD1A 2VUPA 2DIYA 4O92A 5KN3A 1DBYA 4ID0A 3TKSC 3RHCA 1BJXA 4MZWA 3G7IA 4O5RA 2VM1A 2HI7A 4YAPA 5DQSA 1TDIA 1TTZA 2FUG2 2OACA 5DJMA 3I69A 4GF0A 2R3XA 3IC8A 3TRQA 2R37A 1M2AA 3HJOA 3DKSA 3HA9A 1SJZA 2TIRA 3LSZA 5JCWA 2A2PA 2YANA 4J57E 4CY8A 1HYUA 3HJPA 1V9WA 3MSZA 2GZYA 4N0ZA 4Z2TA 2VL2A 4AJ6A 2JZRA 3EYTA 4HJMA 4HEA2 4KDUA 2XPDA 2OE1A 1GTUA 4KCAA 3GYKA 1FB6A 3FZ5A 2AV4A 3TB2A 1TU8A 4POBA 2E2MA 4EC0A 3HXSA 5ENUA 5AIXA 2FA4A 1YF1A 4X4JA 5G1KA 4LL4B 1YZXA 1K0AA 5IMZA 1ZCPA 1UN2A 2LJKA 4NMUA 1O85A 2J23A 1XVWA 3FEUA 1HNCA 1T4YA 1OVNA 1EOGA 5H5RA 1QXHA 4E8HA 4I8BA 4BWQA 4G19A 1R5PA 2VCZA 10GSA 2CVBA 1GWCA 4OFMA 2WRTA 3N5OA 1OE8A 5JWRB 1QQ2A 2HE3A 2B5XA 2C0EA 1JFUA 3F6FA 1AQWA 3ZFLA 1Z9HA 3A2WA 3DGQA 3FZAA 1FVKA 3CTFA 5FHIA 5JCGA 1T1VA 1PSQA 2VLVA 4XS6A 5DDLA 5IPHA 5AISA 3UBKA 1XW9A 2LRCA 2VAFA 1PA3A 1XWCA 13GSA 2EIRA 3F63A 1PGTA 2B5YA 3GX0A 3LXTA 4F03A 4O32A 4MPFA 1F6MC 2O89A 4YQVA 2VO4A 3KGKA 1NHOA 3NZNA 1PX7A 1VF3A 1GH2A 3J7Yb 3Q19A 1V40A 1YKAA 4ZBBA 1GULA 4EL1A 4MF6A 2H76A 2LRTA 1GSFA 4KF9A 2H74A 2EIOA 2JADA 2RUEA 4BVXA 4EXJA 4HUAA 4AJ8A 3GMFA 3TKQA 2C0DA 2HLSA 5ECIB 4A5PA 3QMXA 4IJIA 4L0UA 1LU4A 2VCQA 4IN0A 5HR3A 4MMMA 4WEYA 4TXVA 3D22A 1O81A 1TJDA 2DIZA 3LW9A 4ZXGA 3WGDA 1YY7A 2RLIA 4XCSA 3EURA 2HRAA 2K9FA 2VCWA 1SKWB 5DJLA 2YWNA 1XZOA 2OBKA 18GSA 1JZOA 1OKTA 2B7JA 3EU3A 2LQQA 2IL3A 3CRTA 2A4VA 1VF1A 4OO4A 3ZLPA 1WIKA 1WPIA 3EC3A 3TCOA 4IS0A 4USSA 4EUYA 4ZBAA 5B6NA 4ZBDA 1F3AA 2AJQB 1EEJA 3ME7A 2CZ3A 4OMVA 5D96A 5DQYA 5KN0A 4TW5A 1PRXA 3I43A 16GSA 2HRFA 2OJLA 2QA2A 3DVXA 2LSTA 3C8EA 3CSHA 4K7IA 4Q5NA 5ECSA 5J9BA 4CDOA 2B1LA 2O85A 3C7MA 4K2DA 2P5RA 4FO5A 5ECKB 2L57A 4NV5A 2C4JA 3IAM2 1XW6A 1B9YC 1FB0A 2V2GA 2GSSA 1SL2B 4POLA 3IA1A 1GSUA 3D4MA 4TVEA 3EPTA 2MMAA 4IBPA 4L5OA 1TRWA 1A24A 2ALBA 4PTSA 4FQUA 2CZ2A 2ON7A 3GKNA 5H5QA 1FG4A 3WGEA 1C72A 1GUKA 3JCML 4WF4A 2GT6A 4IW9A 2GGTA 5IIZA 2HSHA 3VWWA 5GZZB 1PL2A 5JWQB 3L9SA 3IBHA 3RDWA 1GLQA 1GUMA 4PXOA 4MZCA 2DJKA 4BL7A 4BVXB 3UL3A 4EO3A 1SKRB 3QPMA 1T3BA 2FWHA 4PGTA 2H66A 2L59A 4MF7A 1ERVA 2IMDA 1TI1A 3QOUA 3ERWA 5FT3A 5B8BA 2UZ8A 2B1KA 1XVQA 3K8NA 3MWHA 1NSWA 4Q5QA 3L0HA 1EWXA 1F2EA 1OC3A 1HNBA 1XCCA 3J7Yk 5GSSA 2V32A 1W4VA 1GSEA 3DVWA 3ZMLA 3W6GA 5C00A 1O73A 5HFGA 2IMEA 3TRPA 2BTOT 2LKUA 2DKHA 1EGOA 1XBSA 1F37A 3C73A 3RPPA 4BA7A 4L0WA 1PQNA 3QD9A 1EZKA 3O76A 1X9SB 2X4AA 1WWJA 3CSJA 3C71A 2R2JA 1ILOA 5ECQB 1N8JA 1DE1A 5E59A 4HI7A 3FW2A 3D21A 2C8UA 3A3TA 5CRWA 5ECLB 1V58A 1PMTA 3TJBA 3FZ4A 3M9JA 22GSA 3N9JA 1K0DA 5JCUA 2V6OA 3L9UA 2X99A 4AGSA 3G9BA 3EWLA 2WFCA 1WMJA 1XPVA 4GWRA 4MF5A 2LS5A 4KCEA 3IV4A 1ZYEA 5G2ZA 1T8EB 1BQ7A 2FD3A 11GSA 1ACVA 2PERA 4F0CA 3ZFBA 1I5GA 1RK4A 4N0VA 1SYRA 2DMMA 3F0IA 2H72A 2F8AA 1M2DA 6GSXA 3CSIA 2VOCA 1B4PA 2XPEA 2IMKA 4NPBA 3F4SA 4IQAA 1MD4A 2VL9A 4YH2A 2YZUA 3TRXA 1GTAA 4BL7B 4RUVA 4RQXA 2Z9SA 2GSQA 3UOMA 4PX1A 3LWAA 2WB9A 3HDCA 1FHEA 3MIXA 1PN9A 2E0QA 3HVXA 3VWXA 1G6WA 1EV9A 4FYUA 1TRUA 1AIUA 4ULXA 2VL3A 3H79A 1SJ6A 2H6YA 4XTSA 4Z2UA 5LD0A 2NVLA 6GSSA 3LFLA 1MDIA 2GLRA 2YPMA 4AF2A 1TRVA 4JE1A 1OAZA 3LXZA 1LJRA 2DLXA 1K3LA 2XC2A 5J4UA 4LA1A 2I81A 2P0GA 3ZTLA 4RQRA 1BYEA 1Z7RA 2K8VA 2NDOA 1O8WA 3A5WA 1GSSA 4ECJA 2R0CA 4X43A 4TR3A 2B5EA 1SJIA 4MDCA 1F3BA 3GKXA 3ZL5A 1AXDA 5CP1A 7GSSA 5F07A 4K0NA 3ERGA 3F9UA 2WCIA 2DKIA 2JACA 1K3YA 5KOWA 4PURA 5GAPD 1Q98A 2HNLA 1E2YA 4KAEA 4F9ZA 4X0XA 3GL3A 3F4TA 3UVHA 2OBIA 4TKYA 5IO2A 4I97A 2EIQA 4DEJA 1PKZA 3ISOA 4EF0A 4MP4A 5ECOB 3HYPA 2N5AA 3R2QA 3HZ4A 4PQIA 3GH6A 3H4KA 1U88A 2BJXA 1PL1A 2F8FA 2OE0A 3GIXA 1XXUA 2IMIA 1U3AA 2H19A 3FK8A 5HR0A 2H1AA 4XS4A 2MMZA 3U6VA 3C1RA 1A0FA 3QFAC 4L8EA 3RPNA 2RM5A 1R5AA 4MPGA 4K5RA 2G0FA 2H6ZA 4HU7A 1TK8B 1K3OA 3MNGA 1J08A 2LJAA 5A5KA 4TR4A 2VCTA 2M46A 4MJEA 4GXZA 3KJYA 3A2XA 3A5IA 3E3EA 4EKZA 3UJ1A 3KMOA 3IK7A 1TW9A 1ZYPA 1SENA 3MAKA 3GV1A 3VFIA 1F9MA 2R0GA 4ZB8A 1M7TA 2HZFA 3FR6A 1ZMAA 2PVQA 5IMFA 1SK0A 5BMUA 1MD3A 1H4OA 2GSRA 4PQ1A 2X64A 1X5DA 2E7PA 3D4TA 5J3RA 1ZGNA 2LRNA 3F8UA 4HZ2A 3GURA 2LNTA 4TR1A 4HS1A 3WT1A 2XHFA 1XWAA 3HVVA 5IOXA 3GX8A 2H01A 3VWVA 1OC9A 2YP6A 1T7PB 1I9DA 3PPUA 3EINA 5G31A 5ECNB 5J41A 3QAVA 5ABRA 2N5BA 3Q6OA 1AQXA 2GS3A 5KN2A 2YJ7A 1G7OA 3VLNA 4FIWA 4JBBA 1GL8A 3UIWA 1K0NA 3DWVA 4YKFA 3ED3A 4XIHA 2QSIA 3ZITA 5AIVA 2OE3A 4X1UA 1PN0A 4Q5RA 2YWIA 4KUNA 5HQPA 4RI7A 5CYYA 4MABA 4JR6A 1E6BA 4CHSA 3IHGA 4K1FA 5DALA 3FR3A 2PVOC 3GFKA 4MA9A 2H75A 4WBRD 1YF0A 1BX9A 2L4CA 2H8LA 1SL1B 4EIPA 2HZEA 1FO5A 2DC5A 2RM6A 1TKDB 2PPTA 5C04A 4ML1A 3ZVJA 2WGRA 3L9VA 4XS4B 3AY8A 1A23A 2LEGA 4HQSA 4V1Ag 3I9V2 3G7JA 2PBJA 1OC8A 3TJFA 3PR8A 3UARA 2HSMA 2VL2C 2DJ2A 3P90A 5D8IA 4KDXA 2C3QA 2K6VA 2AHEA 4TXOA 2HRNA 2L6DA 2CVDA 1XIYA 2WZ9A 4K8MA 2RIIA 4K7NA 5HR1A 2KP1A 1LBKA 1A2LA 2M72A 3O6TA 2O7KA 1Z5YE 5CAXA 3HJMA 3ZVJD 4ZB9A 2GQLA 1EP8A 4OCFA 4MJAA 3C1SA 4BVYA 3KTLA 2NTOA 3APOA 4ECCA 4HQZA 2WULA 5ELGA 4D73A 5BRTA 1TP9A 4QL9A 1SYXA 4TR1B 3PH9A 3IHQA 3M8NA 3Q74A 4J56E 1WP0A 4NHZA 1K0BA 3FRCA 1OC9B 4V2LA 1KNGA 2C3TA 4HU9A 2V41A 3GRXA 5DAKA 2BMXA 1ST9A 1XW5A 5CREA 3FYGA 3RAZA 5IQYA 8GSSA 3CMIA 1G6YA 5ELAA 1XWBA 3ZMKA 1TI3A 1O6JA 4EDZA 3EMPA 4I2UA 3GA4A 3GSSA 3M9KA 3NOFA 5B6MA 4IGJA 4KH7A 2CX4A 1JZDA 3UAPA 4K6XA 1UC7A 1R7HA 1DSBA 3GL5A 3TJJA 1BEDA 3MYDA 3TJKA 4LLRA 4EIQA 3PGTA 4KSOA 5CO3A 5FWGA 3P7XA 2B7KA 4V1Ap 4WF5A 2CVKA 1MEKA 1QUWA 4F0BA 4ZL8A 2DMLA 5CRDA 3TKSA 3IK9A 3CRUA 3TJGA 4JZQA 6GSTA 3UVTA 5DALB 1OE7A 5KOXA 2REMA 2IFQA 5J5NA 3VURA 5IMCA 2C0FA 2HZEB 3UBLA 1TK0B 3TKSE 4K0GA 4Q5FA 3LJRA 1YEXA 4I6XA 1AQVA 4KB3A 2KP2A 5KN1A 5F0GA 2PWJA 2YCDA 4MJBA 4IQ1A 5EY6A 12GSA 4MNNA 3VPQA 4TXOB 3ERFA 1CQHA 2KLXA 5CNWA 3BBYA 3VK9A 5EVOA 5H5SA 4KE3A 1V98A 2MBSA 1V57A 4GSNA 3ZRDA 3NIVA 2VLUA 4ZILA 3IC4A 1EP7A 1RW1A 2I4AA 2IIYA 4POKA 4XS1A 1MDKA 3FMWA 1XWKA 1QFNA 4BVYB 1NM3A 4MZBA 2TRCP 4D73B 3VI5A 4JRRA 3VWUA 1AAZA 4POMA 2DJ0A 4O5QA 4TN8A 2R4VA 2WDUA 3SWLA 1WOUA 2E2GA 3DMLA 5ECPB 2C1YA 1YKCA 3DD3A 3US3A 1O8XA 3DRNA 2H0IA 2PMTA 2VIMA 1QGVA 1TU7A 1WE0A 5DAKB 2NBSA 4TRXA 2YNXA 4G10A 5AN1A 1DE2A 4TR0A 1FOVA 3LEFA 1B48A 2H70A 1ZZYA 3IAS2 2VD0A 3DYRA 3UMAA 3BCKA 1HQOA 1B9XC 1M9BA 2JL4A 4I2TA 4HDEA 5ECMB 1ERTA 2F3MA 3V1WA 1X9MB 1QK8A 1VF2A 2R6KA 2OADA 2F51A 2L6CA 5D9XA 3QR6A 1TRSA 3OR5A 1OKDA 4MH3A 1IYIA 4IELA 3EU4A 4PQHA 1WJKA 2ES7A 4DSSA 1M9AA 3D0ZA 1O7UA 2AYTA 2FCHA 2IFQB 4N30A 2CA8A 3P2AA 3IXRA 4FYBA 4Z7XA 14GSA 2WS2A 4ZIJA 1B4QA 1GNWA 3EE2A 4LMVA 3IPZA 5COHA 3CTGA 2HSYA 3CBUA 4P3YB 3M1GA 1QMVA 1X0RA 1SU9A 3F3RA 3WYWA 2FWEA 5IO0A 3U5RE 2RUFA 1GRXA 2IN3A 4HOJA 1A0RP 5B8AA 2R0PA 2HYXA 3ZZXA 2VM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGI A;  1AW9 A;  5F06 A;  3VPT A;  1THO A;  4HJ2 A;  4WR4 A;  1S3A A;  5IMD A;  1TXX A;  2YWM A;  4FYC A;  3TOU A;  2P5Q A;  2V1M A;  3MDK A;  2KUC A;  2AB6 A;  3P8W A;  1NW2 A;  4LMW A;  4JED A;  1VF4 A;  5D93 A;  4G2E A;  1NHY A;  3HCZ A;  2MYG A;  1UA5 A;  2AUV A;  5AGY A;  2C0G A;  4OCE A;  2CT6 A;  2LUS A;  5G30 A;  2H71 A;  2AAW A;  3KP8 A;  1B8X A;  4F82 A;  5HR2 A;  4DVC A;  4MLY A;  3LOR A;  2J9H A;  4L5L A;  1Z3E A;  4IJ3 A;  3WGX A;  2QKE A;  1JZW A;  1XFL A;  2ZNM A;  4XHM A;  5ECH B;  1PD2 1;  2OKA A;  3G7Y A;  2C80 A;  3H8Q A;  2EC4 A;  3FR9 A;  1Y25 A;  1ZOF A;  1K0C A;  5LCZ A;  2G2Q A;  3KZQ A;  4I5Q A;  1TOF A;  2OA7 A;  2YJH A;  2FNO A;  3ZIJ A;  3TDG A;  1J9B A;  2H6X A;  5G5E A;  1U87 A;  3I6A A;  2H0H A;  1R26 A;  1A2J A;  2P31 A;  4FH8 A;  3FKF A;  3WT2 A;  1Q4J A;  1GSY A;  2B3S A;  3IOS A;  4PNF A;  4ACS A;  3E0U A;  4DSS B;  6GSV A;  3BJ5 A;  3E9J B;  2ZCT A;  4NWY A;  4OD7 A;  5CRH A;  5KEJ A;  4EE0 A;  1GTI A;  1IYH A;  4GQF A;  2L4Q A;  5G1L A;  4ILF A;  2FHE A;  5ID2 A;  2YV9 A;  2MZC A;  4MH2 A;  3Q18 A;  1W89 A;  1U3I A;  4O7H A;  3F6D A;  2LJR A;  2IJY A;  5D9V A;  2V6K A;  1JZR A;  4EVM A;  3M3M A;  3QDN A;  3H1N A;  3GHA A;  4XRD A;  2FWG A;  4GCI A;  2CX3 A;  1GUH A;  3ZRE A;  1XWG A;  3PIN A;  3D6I A;  4N11 A;  3SBC A;  3KH9 A;  4ECB A;  2X8G A;  3D5J A;  2I1U A;  1SL0 B;  2DSA A;  2KOK A;  2CV4 A;  1V2A A;  1S3C A;  1SK2 A;  5GST A;  3GH9 A;  2IPA A;  4YQM A;  3DIE A;  2H0G A;  5HFK A;  1ML6 A;  4J2F A;  4WR5 A;  3EVI A;  4MK3 A;  2A2S A;  3WD6 A;  5JWO B;  4KDY A;  3APQ A;  5DVB A;  1A8Y A;  2ZUP A;  5D9T A;  2B6M A;  2D2Z A;  2YZH A;  5DCH A;  4PNG A;  1ERU A;  1ERW A;  2JZS A;  2I9H A;  2LQO A;  5EL8 A;  1BG5 A;  3APS A;  2GTU A;  1FAA A;  4WKW A;  2X8H A;  4K9Z A;  1N2A A;  1EV4 A;  2YV7 A;  1URM A;  3GUS A;  1EEM A;  5G5F A;  3UEM A;  3HKR A;  1GP1 A;  3RBT A;  1KBN A;  2GVP A;  3KTB A;  3GNJ A;  3FY7 A;  3TUE A;  1BAY A;  2MMO A;  4DSQ A;  3LG6 A;  4GTU A;  1THX A;  2LNS A;  2PU9 C;  3CXG A;  2K18 A;  2XBQ A;  1DUG A;  2N5F A;  2FGX A;  2JU5 A;  2FA8 A;  3KXO A;  1YQ1 A;  4AJ7 A;  1J0F A;  2H73 A;  2YOI A;  4NHW A;  1GNE A;  2A2R A;  3KIJ A;  3EMX A;  4PUA A;  1SD9 A;  4ML6 A;  2IWT A;  3FHK A;  1H75 A;  4ZL7 A;  2F9S A;  2O87 A;  2JSZ A;  5A4W A;  2HXK A;  5HFI A;  3IE3 A;  5A4U A;  4OFT A;  3LGC A;  1ZL9 A;  1YDK A;  1EGR A;  3W8J A;  3IDV A;  2TRX A;  1G7E A;  1K0M A;  4QQ7 A;  4GLT A;  6GSY A;  2L5L A;  1U6T A;  1HNA A;  2O8V B;  3BOA A;  4ZL9 A;  3TGZ A;  5E4W A;  1M2B A;  2I3Y A;  4GSS A;  5F05 A;  1TK5 B;  4BWS A;  5ID2 B;  2GZZ A;  3L78 A;  3HHV A;  4WET A;  1X5C A;  3H93 A;  1MTC A;  2X8C A;  5IOW A;  1T4Z A;  2GZP A;  2H1G A;  1XOA A;  4IKH A;  2GDR A;  3GST A;  1XOB A;  4IP6 A;  1R4W A;  1JHB A;  4E8E A;  1T00 A;  4YQU A;  3VI7 A;  2XBI A;  2JZT A;  4OFN A;  3BD2 A;  1YJ6 A;  4OO5 A;  1Z6N A;  2CAQ A;  2DJJ A;  1YEP A;  1SKS B;  5EPF A;  3GKM A;  4HZ4 A;  3TOT A;  2CQ9 A;  4V2N A;  2C3N A;  3QAG A;  1Y6E A;  3GTU A;  5J9C A;  4KX4 A;  2JSY A;  1PX6 A;  1FW1 A;  3LYK A;  3M0F A;  4JR4 A;  5A4V A;  3ME8 A;  6GSW A;  3KP9 A;  4ISD A;  1HD2 A;  3ZYW A;  3KCM A;  5CRG A;  2LV3 A;  3FZ9 A;  2VCX A;  2CAI A;  9GSS A;  1A8L A;  4GRF A;  4K7O A;  1M99 A;  1Z6M A;  1GTB A;  1Z7P A;  5F8B A;  3QAW A;  1MDJ A;  1X9W B;  2YN1 A;  3HY2 A;  4YAV A;  4GST A;  4ECI A;  5INY A;  2PUK C;  5DCG A;  1ON4 A;  1CQG A;  2H30 A;  3DXB A;  4KA0 A;  2GST A;  1GSD A;  4LL1 B;  4BPY A;  2YWO A;  4NAX A;  3W8S A;  3CYN A;  3S9F A;  4IHU A;  2PGT A;  1ABA A;  4F2I A;  1OYJ A;  4JU5 A;  1UVZ A;  3IRA A;  2VLT A;  3HZ8 A;  4KND A;  2QGV A;  2FLS A;  4NXI A;  2QC7 A;  17GS A;  1RQM A;  4KSM A;  2DJ1 A;  1S3D A;  1KTE A;  4H86 A;  4MJC A;  1JLV A;  5B7C A;  1M0U A;  3HD5 A;  2FWF A;  4GQC A;  2R5G A;  2M80 A;  1KEB A;  3BCI A;  3KH7 A;  3O3T A;  4DSR A;  3HVS A;  4OWY A;  4IVF A;  6GSU A;  1A2M A;  5IM9 A;  2MMN A;  4WXT A;  5L71 A;  2PN8 A;  5LNK e;  2KHP A;  3DEX A;  3QCP A;  5D73 A;  3A2V A;  1X5E A;  1EOH A;  5IPG A;  1VGL A;  3QFB C;  3GN3 A;  1AUC A;  3LQ7 A;  4WBJ A;  2MBT A;  3F3Q A;  2H1D A;  3KEB A;  1AC1 A;  3L4N A;  1JLW A;  4N10 A;  3RHB A;  4EDY A;  2IMF A;  3TKR A;  5D9W A;  4QL7 A;  2LTK A;  1GSQ A;  2HT9 A;  2HFD A;  3KD0 A;  1PKW A;  3KM6 A;  4IP1 A;  3F4R A;  3GKK A;  5IMV A;  4TOP A;  4RI6 A;  2ON5 A;  1SK1 A;  2GQK A;  4XRA A;  1GLP A;  2NPB A;  3TKP A;  2DJ3 A;  5IMA A;  4MCU A;  1WRY A;  5DBQ A;  3KMN A;  4CW9 A;  2H1B A;  2DBC A;  1SD8 A;  1VRS D;  3GTU B;  2L5O A;  5GAN D;  4KW6 A;  19GS A;  4NV2 A;  4V2M A;  2VCV A;  2K8S A;  2GT5 A;  1USB A;  3IR4 A;  3ZIV A;  1K0O A;  20GS A;  1FVJ A;  5ECR B;  1G0T A;  1ZYQ B;  2GQM A;  3LYP A;  4PUF C;  2FY6 A;  4ZB6 A;  4G9H A;  2WJU A;  2VD1 A;  2VUP A;  2DIY A;  4O92 A;  5KN3 A;  1DBY A;  4ID0 A;  3TKS C;  3RHC A;  1BJX A;  4MZW A;  3G7I A;  4O5R A;  2VM1 A;  2HI7 A;  4YAP A;  5DQS A;  1TDI A;  1TTZ A;  2FUG 2;  2OAC A;  5DJM A;  3I69 A;  4GF0 A;  2R3X A;  3TRQ A;  2R37 A;  1M2A A;  3HJO A;  3DKS A;  3HA9 A;  1SJZ A;  2TIR A;  3LSZ A;  5JCW A;  2YAN A;  4J57 E;  1HYU A;  3HJP A;  1V9W A;  3MSZ A;  2GZY A;  4N0Z A;  2VL2 A;  4AJ6 A;  2JZR A;  3EYT A;  4HJM A;  4HEA 2;  4KDU A;  2XPD A;  2OE1 A;  1GTU A;  4KCA A;  3GYK A;  1FB6 A;  3FZ5 A;  2AV4 A;  3TB2 A;  1TU8 A;  4POB A;  2E2M A;  4EC0 A;  3HXS A;  5ENU A;  5AIX A;  2FA4 A;  1YF1 A;  5G1K A;  4LL4 B;  1YZX A;  1K0A A;  5IMZ A;  1ZCP A;  1UN2 A;  2LJK A;  4NMU A;  1O85 A;  2J23 A;  1XVW A;  3FEU A;  1HNC A;  1T4Y A;  1OVN A;  1EOG A;  5H5R A;  1QXH A;  4E8H A;  4I8B A;  4BWQ A;  4G19 A;  1R5P A;  2VCZ A;  10GS A;  2CVB A;  1GWC A;  4OFM A;  2WRT A;  3N5O A;  1OE8 A;  5JWR B;  1QQ2 A;  2HE3 A;  2B5X A;  2C0E A;  1JFU A;  3F6F A;  1AQW A;  3ZFL A;  1Z9H A;  3A2W A;  3DGQ A;  3FZA A;  1FVK A;  3CTF A;  5FHI A;  5JCG A;  1T1V A;  1PSQ A;  2VLV A;  4XS6 A;  5DDL A;  5IPH A;  5AIS A;  3UBK A;  1XW9 A;  2LRC A;  2VAF A;  1PA3 A;  1XWC A;  13GS A;  2EIR A;  3F63 A;  1PGT A;  2B5Y A;  3GX0 A;  3LXT A;  4F03 A;  4O32 A;  4MPF A;  1F6M C;  2O89 A;  4YQV A;  2VO4 A;  3KGK A;  1NHO A;  3NZN A;  1PX7 A;  1VF3 A;  1GH2 A;  3J7Y b;  3Q19 A;  1V40 A;  1YKA A;  4ZBB A;  1GUL A;  4EL1 A;  4MF6 A;  2H76 A;  2LRT A;  1GSF A;  2H74 A;  2EIO A;  2JAD A;  2RUE A;  4BVX A;  4EXJ A;  4HUA A;  4AJ8 A;  3GMF A;  3TKQ A;  2C0D A;  2HLS A;  5ECI B;  3QMX A;  4IJI A;  4L0U A;  1LU4 A;  2VCQ A;  4IN0 A;  5HR3 A;  4MMM A;  4WEY A;  4TXV A;  3D22 A;  1O81 A;  1TJD A;  2DIZ A;  4ZXG A;  3WGD A;  1YY7 A;  2RLI A;  4XCS A;  3EUR A;  2K9F A;  2VCW A;  1SKW B;  5DJL A;  2YWN A;  1XZO A;  2OBK A;  18GS A;  1JZO A;  1OKT A;  2B7J A;  3EU3 A;  2LQQ A;  2IL3 A;  3CRT A;  2A4V A;  1VF1 A;  4OO4 A;  3ZLP A;  1WIK A;  1WPI A;  3EC3 A;  3TCO A;  4IS0 A;  4EUY A;  4ZBA A;  5B6N A;  4ZBD A;  1F3A A;  2AJQ B;  1EEJ A;  3ME7 A;  2CZ3 A;  4OMV A;  5D96 A;  5DQY A;  5KN0 A;  4TW5 A;  1PRX A;  3I43 A;  16GS A;  2HRF A;  2OJL A;  3DVX A;  2LST A;  3C8E A;  3CSH A;  4K7I A;  4Q5N A;  5ECS A;  5J9B A;  4CDO A;  2B1L A;  2O85 A;  3C7M A;  4K2D A;  2P5R A;  4FO5 A;  5ECK B;  2L57 A;  4NV5 A;  2C4J A;  3IAM 2;  1XW6 A;  1B9Y C;  1FB0 A;  2V2G A;  2GSS A;  1SL2 B;  4POL A;  3IA1 A;  1GSU A;  3D4M A;  4TVE A;  2MMA A;  4IBP A;  4L5O A;  1TRW A;  1A24 A;  2ALB A;  2CZ2 A;  2ON7 A;  3GKN A;  5H5Q A;  1FG4 A;  3WGE A;  1C72 A;  1GUK A;  3JCM L;  4WF4 A;  2GT6 A;  4IW9 A;  2GGT A;  5IIZ A;  2HSH A;  3VWW A;  5GZZ B;  1PL2 A;  5JWQ B;  3L9S A;  3IBH A;  3RDW A;  1GLQ A;  1GUM A;  4PXO A;  4MZC A;  2DJK A;  4BL7 A;  4EO3 A;  3UL3 A;  1SKR B;  3QPM A;  1T3B A;  2FWH A;  4PGT A;  2H66 A;  2L59 A;  4MF7 A;  1ERV A;  2IMD A;  1TI1 A;  3QOU A;  3ERW A;  5FT3 A;  5B8B A;  2B1K A;  1XVQ A;  3K8N A;  3MWH A;  1NSW A;  4Q5Q A;  3L0H A;  1EWX A;  1F2E A;  1OC3 A;  1HNB A;  1XCC A;  3J7Y k;  5GSS A;  2V32 A;  1W4V A;  1GSE A;  3DVW A;  3ZML A;  3W6G A;  5C00 A;  1O73 A;  5HFG A;  2IME A;  3TRP A;  2BTO T;  2LKU A;  1EGO A;  1XBS A;  1F37 A;  3C73 A;  3RPP A;  4BA7 A;  4L0W A;  1PQN A;  3QD9 A;  1EZK A;  3O76 A;  1X9S B;  1WWJ A;  3CSJ A;  3C71 A;  2R2J A;  1ILO A;  5ECQ B;  1N8J A;  1DE1 A;  5E59 A;  4HI7 A;  3FW2 A;  3D21 A;  2C8U A;  3A3T A;  5CRW A;  5ECL B;  1V58 A;  1PMT A;  3TJB A;  3FZ4 A;  3M9J A;  22GS A;  3N9J A;  1K0D A;  5JCU A;  2V6O A;  3L9U A;  2X99 A;  4AGS A;  3G9B A;  3EWL A;  2WFC A;  1WMJ A;  1XPV A;  4GWR A;  4MF5 A;  2LS5 A;  4KCE A;  3IV4 A;  1ZYE A;  5G2Z A;  1T8E B;  1BQ7 A;  2FD3 A;  11GS A;  1ACV A;  2PER A;  4F0C A;  3ZFB A;  1I5G A;  1RK4 A;  4N0V A;  1SYR A;  2DMM A;  3F0I A;  2H72 A;  2F8A A;  1M2D A;  6GSX A;  3CSI A;  2VOC A;  1B4P A;  2XPE A;  2IMK A;  4NPB A;  3F4S A;  4IQA A;  1MD4 A;  2VL9 A;  4YH2 A;  2YZU A;  3TRX A;  1GTA A;  4RUV A;  4RQX A;  2Z9S A;  2GSQ A;  3UOM A;  4PX1 A;  3LWA A;  2WB9 A;  3HDC A;  1FHE A;  1PN9 A;  2E0Q A;  3HVX A;  3VWX A;  1G6W A;  1EV9 A;  4FYU A;  1TRU A;  1AIU A;  4ULX A;  2VL3 A;  3H79 A;  1SJ6 A;  2H6Y A;  4XTS A;  5LD0 A;  2NVL A;  6GSS A;  3LFL A;  1MDI A;  2GLR A;  2YPM A;  4AF2 A;  1TRV A;  4JE1 A;  1OAZ A;  3LXZ A;  1LJR A;  2DLX A;  1K3L A;  2XC2 A;  5J4U A;  4LA1 A;  2I81 A;  2P0G A;  3ZTL A;  4RQR A;  1BYE A;  1Z7R A;  2K8V A;  2NDO A;  1O8W A;  3A5W A;  1GSS A;  4ECJ A;  4X43 A;  4TR3 A;  2B5E A;  1SJI A;  4MDC A;  1F3B A;  3GKX A;  3ZL5 A;  1AXD A;  5CP1 A;  7GSS A;  5F07 A;  4K0N A;  3ERG A;  3F9U A;  2WCI A;  2JAC A;  1K3Y A;  4PUR A;  5GAP D;  1Q98 A;  2HNL A;  1E2Y A;  4KAE A;  4F9Z A;  4X0X A;  3GL3 A;  3F4T A;  3UVH A;  2OBI A;  4TKY A;  5IO2 A;  4I97 A;  2EIQ A;  4DEJ A;  1PKZ A;  3ISO A;  4EF0 A;  4MP4 A;  5ECO B;  3HYP A;  2N5A A;  3R2Q A;  3HZ4 A;  4PQI A;  3GH6 A;  3H4K A;  1U88 A;  2BJX A;  1PL1 A;  2F8F A;  2OE0 A;  3GIX A;  1XXU A;  2IMI A;  1U3A A;  2H19 A;  3FK8 A;  5HR0 A;  2H1A A;  4XS4 A;  2MMZ A;  3U6V A;  3C1R A;  1A0F A;  3QFA C;  4L8E A;  3RPN A;  2RM5 A;  1R5A A;  4MPG A;  2G0F A;  2H6Z A;  4HU7 A;  1TK8 B;  1K3O A;  3MNG A;  1J08 A;  2LJA A;  5A5K A;  4TR4 A;  2VCT A;  2M46 A;  4MJE A;  4GXZ A;  3KJY A;  3A2X A;  3E3E A;  4EKZ A;  3UJ1 A;  3KMO A;  3IK7 A;  1TW9 A;  1SEN A;  3MAK A;  3GV1 A;  3VFI A;  1F9M A;  4ZB8 A;  1M7T A;  2HZF A;  3FR6 A;  1ZMA A;  2PVQ A;  5IMF A;  1SK0 A;  1MD3 A;  1H4O A;  2GSR A;  4PQ1 A;  2X64 A;  1X5D A;  2E7P A;  3D4T A;  5J3R A;  1ZGN A;  2LRN A;  3F8U A;  4HZ2 A;  3GUR A;  2LNT A;  4TR1 A;  4HS1 A;  3WT1 A;  2XHF A;  1XWA A;  3HVV A;  5IOX A;  3GX8 A;  2H01 A;  3VWV A;  1OC9 A;  2YP6 A;  1T7P B;  1I9D A;  3EIN A;  5G31 A;  5ECN B;  5J41 A;  3QAV A;  5ABR A;  2N5B A;  3Q6O A;  1AQX A;  2GS3 A;  5KN2 A;  2YJ7 A;  1G7O A;  3VLN A;  4FIW A;  4JBB A;  1GL8 A;  3UIW A;  1K0N A;  3DWV A;  3ED3 A;  4XIH A;  2QSI A;  3ZIT A;  5AIV A;  2OE3 A;  4X1U A;  4Q5R A;  2YWI A;  4KUN A;  5HQP A;  4RI7 A;  5CYY A;  4MAB A;  4JR6 A;  1E6B A;  4CHS A;  4K1F A;  5DAL A;  3FR3 A;  2PVO C;  3GFK A;  4MA9 A;  2H75 A;  4WBR D;  1YF0 A;  1BX9 A;  2L4C A;  2H8L A;  1SL1 B;  2HZE A;  1FO5 A;  2DC5 A;  2RM6 A;  1TKD B;  2PPT A;  5C04 A;  4ML1 A;  3ZVJ A;  2WGR A;  3L9V A;  4XS4 B;  3AY8 A;  1A23 A;  2LEG A;  4HQS A;  4V1A g;  3I9V 2;  3G7J A;  2PBJ A;  1OC8 A;  3TJF A;  3PR8 A;  3UAR A;  2VL2 C;  2DJ2 A;  3P90 A;  5D8I A;  4KDX A;  2C3Q A;  2K6V A;  2AHE A;  4TXO A;  2HRN A;  2L6D A;  2CVD A;  1XIY A;  2WZ9 A;  4K8M A;  2RII A;  4K7N A;  5HR1 A;  2KP1 A;  1LBK A;  1A2L A;  2M72 A;  3O6T A;  2O7K A;  1Z5Y E;  5CAX A;  3HJM A;  3ZVJ D;  4ZB9 A;  2GQL A;  1EP8 A;  4OCF A;  4MJA A;  3C1S A;  4BVY A;  3KTL A;  2NTO A;  3APO A;  4ECC A;  4HQZ A;  2WUL A;  5ELG A;  4D73 A;  1TP9 A;  4QL9 A;  1SYX A;  4TR1 B;  3PH9 A;  3IHQ A;  3M8N A;  3Q74 A;  4J56 E;  1WP0 A;  4NHZ A;  1K0B A;  3FRC A;  1OC9 B;  4V2L A;  1KNG A;  2C3T A;  4HU9 A;  2V41 A;  3GRX A;  5DAK A;  2BMX A;  1ST9 A;  1XW5 A;  5CRE A;  3FYG A;  3RAZ A;  5IQY A;  8GSS A;  3CMI A;  1G6Y A;  5ELA A;  1XWB A;  3ZMK A;  1TI3 A;  1O6J A;  4EDZ A;  3EMP A;  4I2U A;  3GA4 A;  3GSS A;  3M9K A;  3NOF A;  5B6M A;  4IGJ A;  4KH7 A;  2CX4 A;  1JZD A;  3UAP A;  4K6X A;  1UC7 A;  1R7H A;  1DSB A;  3GL5 A;  3TJJ A;  1BED A;  3TJK A;  4LLR A;  3PGT A;  4KSO A;  5CO3 A;  5FWG A;  3P7X A;  2B7K A;  4V1A p;  4WF5 A;  2CVK A;  1MEK A;  1QUW A;  4F0B A;  4ZL8 A;  2DML A;  5CRD A;  3TKS A;  3IK9 A;  3CRU A;  3TJG A;  4JZQ A;  6GST A;  3UVT A;  5DAL B;  1OE7 A;  2REM A;  2IFQ A;  5J5N A;  3VUR A;  5IMC A;  2C0F A;  2HZE B;  3UBL A;  1TK0 B;  3TKS E;  4K0G A;  4Q5F A;  3LJR A;  1YEX A;  4I6X A;  1AQV A;  4KB3 A;  2KP2 A;  5KN1 A;  5F0G A;  2PWJ A;  2YCD A;  4MJB A;  4IQ1 A;  5EY6 A;  12GS A;  3VPQ A;  4TXO B;  3ERF A;  1CQH A;  2KLX A;  5CNW A;  3BBY A;  3VK9 A;  5EVO A;  5H5S A;  4KE3 A;  1V98 A;  2MBS A;  1V57 A;  4GSN A;  3ZRD A;  3NIV A;  2VLU A;  4ZIL A;  3IC4 A;  1EP7 A;  1RW1 A;  2I4A A;  2IIY A;  4POK A;  4XS1 A;  1MDK A;  1XWK A;  1QFN A;  1NM3 A;  4MZB A;  2TRC P;  4D73 B;  3VI5 A;  4JRR A;  3VWU A;  1AAZ A;  4POM A;  2DJ0 A;  4TN8 A;  2R4V A;  2WDU A;  3SWL A;  1WOU A;  2E2G A;  3DML A;  5ECP B;  2C1Y A;  1YKC A;  3DD3 A;  3US3 A;  1O8X A;  3DRN A;  2H0I A;  2PMT A;  2VIM A;  1QGV A;  1TU7 A;  1WE0 A;  5DAK B;  2NBS A;  4TRX A;  2YNX A;  4G10 A;  5AN1 A;  1DE2 A;  4TR0 A;  1FOV A;  3LEF A;  1B48 A;  2H70 A;  1ZZY A;  3IAS 2;  2VD0 A;  3DYR A;  3UMA A;  3BCK A;  1HQO A;  1B9X C;  1M9B A;  2JL4 A;  4I2T A;  4HDE A;  5ECM B;  1ERT A;  2F3M A;  3V1W A;  1X9M B;  1QK8 A;  1VF2 A;  2R6K A;  2OAD A;  2F51 A;  2L6C A;  5D9X A;  3QR6 A;  1TRS A;  3OR5 A;  1OKD A;  4MH3 A;  1IYI A;  4IEL A;  3EU4 A;  4PQH A;  1WJK A;  2ES7 A;  4DSS A;  1M9A A;  3D0Z A;  1O7U A;  2AYT A;  2FCH A;  2IFQ B;  4N30 A;  2CA8 A;  3P2A A;  3IXR A;  4FYB A;  4Z7X A;  14GS A;  2WS2 A;  4ZIJ A;  1B4Q A;  1GNW A;  3EE2 A;  4LMV A;  3IPZ A;  5COH A;  3CTG A;  2HSY A;  3CBU A;  4P3Y B;  3M1G A;  1QMV A;  1X0R A;  1SU9 A;  3F3R A;  3WYW A;  2FWE A;  5IO0 A;  3U5R E;  2RUF A;  1GRX A;  2IN3 A;  4HOJ A;  1A0R P;  5B8A A;  2HYX A;  3ZZX A;  2VM2 A; 
#chains in the Genus database with same CATH topology
 4KGI A;  1AW9 A;  5F06 A;  3VPT A;  1THO A;  4HJ2 A;  4WR4 A;  1S3A A;  5IMD A;  1TXX A;  2YWM A;  4FYC A;  3TOU A;  2P5Q A;  2V1M A;  3MDK A;  2KUC A;  4Z2R A;  2AB6 A;  3P8W A;  1NW2 A;  4LMW A;  4JED A;  4G0L A;  1VF4 A;  5D93 A;  4G2E A;  1NHY A;  3HCZ A;  2MYG A;  1UA5 A;  2AUV A;  4G0I A;  5AGY A;  2C0G A;  4OCE A;  2CT6 A;  2LUS A;  5G30 A;  2H71 A;  2AAW A;  3KP8 A;  1B8X A;  4F82 A;  5HR2 A;  4DVC A;  4MLY A;  3LOR A;  2J9H A;  4L5L A;  4K2X A;  1Z3E A;  4IJ3 A;  3WGX A;  2QKE A;  1JZW A;  1XFL A;  2ZNM A;  4XHM A;  5ECH B;  1PD2 1;  2OKA A;  3G7Y A;  2C80 A;  3H8Q A;  2EC4 A;  3FR9 A;  1Y25 A;  4CY6 A;  1ZOF A;  1K0C A;  5LCZ A;  2G2Q A;  3KZQ A;  4I5Q A;  1TOF A;  2OA7 A;  2YJH A;  2FNO A;  3ZIJ A;  3TDG A;  1J9B A;  2H6X A;  5G5E A;  1U87 A;  3I6A A;  2H0H A;  1R26 A;  1A2J A;  2P31 A;  4FH8 A;  1S3R A;  3FKF A;  3WT2 A;  1Q4J A;  1GSY A;  2B3S A;  3IOS A;  4PNF A;  4ACS A;  3E0U A;  4DSS B;  6GSV A;  3BJ5 A;  3E9J B;  2ZCT A;  4NWY A;  4OD7 A;  5CRH A;  5KEJ A;  4EE0 A;  1GTI A;  1IYH A;  4GQF A;  2L4Q A;  5G1L A;  4ILF A;  2FHE A;  5ID2 A;  2YV9 A;  2MZC A;  4MH2 A;  3R3E A;  3Q18 A;  1W89 A;  1U3I A;  4O7H A;  3F6D A;  2LJR A;  2IJY A;  5D9V A;  2V6K A;  1JZR A;  4EVM A;  3M3M A;  3QDN A;  3H1N A;  3GHA A;  4XRD A;  2FWG A;  4GCI A;  2CX3 A;  1GUH A;  3ZRE A;  1XWG A;  3PIN A;  3D6I A;  4N11 A;  3SBC A;  3KH9 A;  4ECB A;  2X8G A;  3D5J A;  2I1U A;  1SL0 B;  2DSA A;  2KOK A;  2CV4 A;  1V2A A;  1S3C A;  1ZYN A;  1SK2 A;  5GST A;  3GH9 A;  2IPA A;  4YQM A;  3DIE A;  2H0G A;  5HFK A;  1ML6 A;  4J2F A;  4WR5 A;  3EVI A;  4MK3 A;  2A2S A;  3WD6 A;  5JWO B;  4KDY A;  3APQ A;  5DVB A;  1A8Y A;  2ZUP A;  5D9T A;  2B6M A;  2X49 A;  2D2Z A;  2YZH A;  5DCH A;  4PNG A;  1ERU A;  1ERW A;  2JZS A;  2I9H A;  2LQO A;  5EL8 A;  2HRK A;  1BG5 A;  3APS A;  2GTU A;  1FAA A;  4WKW A;  2X8H A;  4K9Z A;  1N2A A;  1EV4 A;  2YV7 A;  1URM A;  3GUS A;  1EEM A;  5G5F A;  3UEM A;  1FOH A;  3HKR A;  1GP1 A;  3RBT A;  1KBN A;  2GVP A;  3KTB A;  3GNJ A;  3FY7 A;  3TUE A;  1BAY A;  2MMO A;  4DSQ A;  3LG6 A;  4GTU A;  1THX A;  2LNS A;  2PU9 C;  4ICY A;  3CXG A;  2K18 A;  2XBQ A;  1DUG A;  2N5F A;  2FGX A;  2JU5 A;  2FA8 A;  3KXO A;  1YQ1 A;  4AJ7 A;  1J0F A;  2H73 A;  2YOI A;  4NHW A;  1GNE A;  2A2R A;  3KIJ A;  3EMX A;  4PUA A;  1SD9 A;  2A4H A;  4ML6 A;  2IWT A;  3FHK A;  1H75 A;  4ZL7 A;  2F9S A;  2O87 A;  2JSZ A;  5A4W A;  2HXK A;  5HFI A;  3IE3 A;  5A4U A;  4OFT A;  3LGC A;  1ZL9 A;  1YDK A;  1EGR A;  3W8J A;  3IDV A;  2TRX A;  1G7E A;  1K0M A;  4QQ7 A;  4GLT A;  6GSY A;  2L5L A;  1U6T A;  1HNA A;  2O8V B;  3BOA A;  4ZL9 A;  3TGZ A;  5E4W A;  1M2B A;  2I3Y A;  4GSS A;  5F05 A;  1TK5 B;  4BWS A;  5ID2 B;  2GZZ A;  3L78 A;  3HHV A;  4WET A;  1X5C A;  3H93 A;  1MTC A;  2X8C A;  5IOW A;  1T4Z A;  2GZP A;  2H1G A;  1XOA A;  4IKH A;  2GDR A;  3GST A;  1XOB A;  4IP6 A;  3CQF A;  1R4W A;  1JHB A;  4E8E A;  1T00 A;  4YQU A;  3VI7 A;  2XBI A;  2JZT A;  4OFN A;  3BD2 A;  1YJ6 A;  4OO5 A;  1Z6N A;  2CAQ A;  2DJJ A;  1YEP A;  1SKS B;  5EPF A;  3GKM A;  4HZ4 A;  3TOT A;  4G0K A;  2CQ9 A;  4V2N A;  2C3N A;  3QAG A;  1Y6E A;  3GTU A;  5J9C A;  4KX4 A;  2JSY A;  1PX6 A;  1FW1 A;  3LYK A;  3M0F A;  4JR4 A;  5A4V A;  3ME8 A;  6GSW A;  3KP9 A;  4ISD A;  1HD2 A;  3ZYW A;  4O5U A;  3KCM A;  5CRG A;  2LV3 A;  3FZ9 A;  2VCX A;  2CAI A;  9GSS A;  1A8L A;  4GRF A;  4K7O A;  1M99 A;  1Z6M A;  1GTB A;  1Z7P A;  5F8B A;  3QAW A;  1MDJ A;  1X9W B;  2YN1 A;  3HY2 A;  4YAV A;  4GST A;  4ECI A;  1PFO A;  5INY A;  2PUK C;  5DCG A;  1ON4 A;  1CQG A;  2H30 A;  3DXB A;  4KA0 A;  2GST A;  1GSD A;  4LL1 B;  4BPY A;  2YWO A;  4NAX A;  3W8S A;  3CYN A;  3S9F A;  4IHU A;  2PGT A;  1ABA A;  4F2I A;  4K5S A;  1OYJ A;  4JU5 A;  1UVZ A;  3IRA A;  2VLT A;  3HZ8 A;  4KND A;  2QGV A;  2FLS A;  4NXI A;  2QC7 A;  17GS A;  1RQM A;  4KSM A;  2DJ1 A;  1S3D A;  1KTE A;  4H86 A;  4MJC A;  1JLV A;  5B7C A;  1M0U A;  3HD5 A;  2FWF A;  4GQC A;  2R5G A;  2M80 A;  1KEB A;  3BCI A;  3KH7 A;  3O3T A;  4DSR A;  3HVS A;  4OWY A;  4IVF A;  6GSU A;  1A2M A;  5IM9 A;  2MMN A;  4WXT A;  5L71 A;  2PN8 A;  5LNK e;  2KHP A;  3DEX A;  3QCP A;  5D73 A;  3A2V A;  1X5E A;  1EOH A;  5IPG A;  1VGL A;  3QFB C;  3GN3 A;  1AUC A;  3LQ7 A;  4WBJ A;  2MBT A;  3F3Q A;  2H1D A;  3KEB A;  1AC1 A;  3L4N A;  1JLW A;  4N10 A;  3RHB A;  4EDY A;  2IMF A;  3TKR A;  5D9W A;  4QL7 A;  2LTK A;  1GSQ A;  2HT9 A;  2HFD A;  3KD0 A;  1PKW A;  2QA1 A;  3KM6 A;  4IP1 A;  3F4R A;  3GKK A;  5IMV A;  4TOP A;  4RI6 A;  2ON5 A;  1SK1 A;  2GQK A;  4XRA A;  1GLP A;  2NPB A;  3TKP A;  2DJ3 A;  5IMA A;  4MCU A;  1WRY A;  5DBQ A;  3KMN A;  4CW9 A;  4YKG A;  2H1B A;  2DBC A;  1SD8 A;  1VRS D;  3GTU B;  2L5O A;  5GAN D;  4KW6 A;  19GS A;  4NV2 A;  4V2M A;  2VCV A;  2K8S A;  2GT5 A;  1USB A;  3IR4 A;  3ZIV A;  1K0O A;  20GS A;  1FVJ A;  5ECR B;  1G0T A;  1ZYQ B;  2GQM A;  3LYP A;  4PUF C;  2FY6 A;  4ZB6 A;  4G9H A;  2WJU A;  2VD1 A;  2VUP A;  2DIY A;  4O92 A;  5KN3 A;  1DBY A;  4ID0 A;  3TKS C;  3RHC A;  1BJX A;  4MZW A;  3G7I A;  4O5R A;  2VM1 A;  2HI7 A;  4YAP A;  5DQS A;  1TDI A;  1TTZ A;  2FUG 2;  2OAC A;  5DJM A;  3I69 A;  4GF0 A;  2R3X A;  3IC8 A;  3TRQ A;  2R37 A;  1M2A A;  3HJO A;  3DKS A;  3HA9 A;  1SJZ A;  2TIR A;  3LSZ A;  5JCW A;  2A2P A;  2YAN A;  4J57 E;  4CY8 A;  1HYU A;  3HJP A;  1V9W A;  3MSZ A;  2GZY A;  4N0Z A;  4Z2T A;  2VL2 A;  4AJ6 A;  2JZR A;  3EYT A;  4HJM A;  4HEA 2;  4KDU A;  2XPD A;  2OE1 A;  1GTU A;  4KCA A;  3GYK A;  1FB6 A;  3FZ5 A;  2AV4 A;  3TB2 A;  1TU8 A;  4POB A;  1M3J A;  2E2M A;  4EC0 A;  3HXS A;  5ENU A;  5AIX A;  2FA4 A;  1YF1 A;  4X4J A;  5G1K A;  4LL4 B;  1YZX A;  1K0A A;  5IMZ A;  1ZCP A;  1UN2 A;  2LJK A;  4NMU A;  1O85 A;  2J23 A;  1XVW A;  3FEU A;  1HNC A;  1T4Y A;  1OVN A;  1EOG A;  5H5R A;  1QXH A;  4E8H A;  4I8B A;  4BWQ A;  4G19 A;  1R5P A;  2VCZ A;  10GS A;  2CVB A;  1GWC A;  4OFM A;  2WRT A;  3N5O A;  1OE8 A;  5JWR B;  1QQ2 A;  2HE3 A;  2B5X A;  2C0E A;  1JFU A;  3F6F A;  1AQW A;  3ZFL A;  1Z9H A;  3A2W A;  3DGQ A;  3FZA A;  1FVK A;  3CTF A;  5FHI A;  5JCG A;  1T1V A;  1PSQ A;  2VLV A;  4XS6 A;  5DDL A;  5IPH A;  5AIS A;  3UBK A;  1XW9 A;  2LRC A;  2VAF A;  1PA3 A;  1XWC A;  13GS A;  2EIR A;  3F63 A;  1PGT A;  2B5Y A;  3GX0 A;  3LXT A;  4F03 A;  4O32 A;  4MPF A;  1F6M C;  2O89 A;  4YQV A;  2VO4 A;  3KGK A;  1NHO A;  3NZN A;  1PX7 A;  1VF3 A;  4BIK A;  1GH2 A;  3J7Y b;  3Q19 A;  1V40 A;  1YKA A;  4ZBB A;  1GUL A;  4EL1 A;  4MF6 A;  2H76 A;  2LRT A;  1GSF A;  4KF9 A;  2H74 A;  2EIO A;  2JAD A;  2RUE A;  4BVX A;  4EXJ A;  4HUA A;  4AJ8 A;  3GMF A;  3TKQ A;  2C0D A;  2HLS A;  5ECI B;  4A5P A;  3QMX A;  4HSC X;  4IJI A;  4L0U A;  1LU4 A;  2VCQ A;  4IN0 A;  5HR3 A;  4MMM A;  4WEY A;  4TXV A;  3D22 A;  1O81 A;  1TJD A;  2DIZ A;  3LW9 A;  4ZXG A;  3WGD A;  1YY7 A;  2RLI A;  4XCS A;  3EUR A;  2HRA A;  2K9F A;  2VCW A;  1SKW B;  5DJL A;  2YWN A;  1XZO A;  2OBK A;  18GS A;  1JZO A;  1OKT A;  2B7J A;  3EU3 A;  2LQQ A;  2IL3 A;  3CRT A;  2A4V A;  1VF1 A;  4OO4 A;  3ZLP A;  1WIK A;  1WPI A;  3EC3 A;  3TCO A;  4IS0 A;  4USS A;  4EUY A;  4ZBA A;  5B6N A;  4ZBD A;  1F3A A;  2AJQ B;  1EEJ A;  3ME7 A;  2CZ3 A;  4OMV A;  5D96 A;  5DQY A;  5KN0 A;  4TW5 A;  1PRX A;  3I43 A;  16GS A;  2HRF A;  2OJL A;  2QA2 A;  3DVX A;  2LST A;  3C8E A;  3CSH A;  4K7I A;  4Q5N A;  5ECS A;  5J9B A;  4CDO A;  3HVN A;  2B1L A;  2O85 A;  3C7M A;  4K2D A;  2P5R A;  4FO5 A;  5ECK B;  2L57 A;  4NV5 A;  2C4J A;  3IAM 2;  1XW6 A;  1B9Y C;  1FB0 A;  2V2G A;  2GSS A;  1SL2 B;  4POL A;  3IA1 A;  1GSU A;  3D4M A;  4TVE A;  3EPT A;  2MMA A;  4IBP A;  4L5O A;  1TRW A;  1A24 A;  2ALB A;  4PTS A;  4FQU A;  2CZ2 A;  2ON7 A;  3GKN A;  5H5Q A;  1FG4 A;  3WGE A;  1C72 A;  1GUK A;  3JCM L;  4WF4 A;  2GT6 A;  4IW9 A;  2GGT A;  5IIZ A;  2HSH A;  3VWW A;  5GZZ B;  1PL2 A;  5JWQ B;  3L9S A;  3IBH A;  3RDW A;  1GLQ A;  1GUM A;  4PXO A;  4MZC A;  2DJK A;  4BL7 A;  4BVX B;  3UL3 A;  4EO3 A;  1SKR B;  3QPM A;  1T3B A;  2FWH A;  4PGT A;  2H66 A;  2L59 A;  4MF7 A;  1ERV A;  2IMD A;  1TI1 A;  3QOU A;  3ERW A;  5FT3 A;  5B8B A;  2UZ8 A;  2B1K A;  1XVQ A;  3K8N A;  3MWH A;  1NSW A;  4Q5Q A;  3L0H A;  1EWX A;  1F2E A;  1OC3 A;  1HNB A;  1XCC A;  3J7Y k;  5GSS A;  2V32 A;  1W4V A;  1GSE A;  3DVW A;  3ZML A;  3W6G A;  5C00 A;  1O73 A;  5HFG A;  2IME A;  3TRP A;  2BTO T;  2LKU A;  2DKH A;  1EGO A;  1XBS A;  1F37 A;  3C73 A;  3RPP A;  4BA7 A;  4L0W A;  1PQN A;  3QD9 A;  1EZK A;  3O76 A;  1X9S B;  2X4A A;  1WWJ A;  3CSJ A;  3C71 A;  2R2J A;  1ILO A;  5ECQ B;  1N8J A;  1DE1 A;  5E59 A;  4HI7 A;  3FW2 A;  3D21 A;  2C8U A;  3A3T A;  5CRW A;  5ECL B;  1V58 A;  1PMT A;  3TJB A;  3FZ4 A;  3M9J A;  22GS A;  3N9J A;  1K0D A;  5JCU A;  2V6O A;  3L9U A;  2X99 A;  4AGS A;  3G9B A;  3EWL A;  2WFC A;  1WMJ A;  1XPV A;  4GWR A;  4MF5 A;  2LS5 A;  4KCE A;  3IV4 A;  1ZYE A;  5G2Z A;  1T8E B;  1BQ7 A;  2FD3 A;  11GS A;  1ACV A;  2PER A;  4F0C A;  3ZFB A;  1I5G A;  1RK4 A;  4N0V A;  1SYR A;  2DMM A;  3F0I A;  2H72 A;  2F8A A;  1M2D A;  6GSX A;  3CSI A;  2VOC A;  1B4P A;  2XPE A;  2IMK A;  4NPB A;  3F4S A;  4IQA A;  1MD4 A;  2VL9 A;  4YH2 A;  2YZU A;  3TRX A;  1GTA A;  4BL7 B;  4RUV A;  4RQX A;  2Z9S A;  2GSQ A;  3UOM A;  4PX1 A;  3LWA A;  2WB9 A;  3HDC A;  1FHE A;  3MIX A;  1PN9 A;  2E0Q A;  3HVX A;  3VWX A;  1G6W A;  1EV9 A;  4FYU A;  1TRU A;  1AIU A;  4ULX A;  2VL3 A;  3H79 A;  1SJ6 A;  2H6Y A;  4XTS A;  4Z2U A;  5LD0 A;  2NVL A;  6GSS A;  3LFL A;  1MDI A;  2GLR A;  2YPM A;  4AF2 A;  1TRV A;  4JE1 A;  1OAZ A;  3LXZ A;  1LJR A;  2DLX A;  1K3L A;  2XC2 A;  5J4U A;  4LA1 A;  2I81 A;  2P0G A;  3ZTL A;  1M3I A;  4RQR A;  1BYE A;  1Z7R A;  2K8V A;  2NDO A;  1O8W A;  3A5W A;  1GSS A;  4ECJ A;  2R0C A;  4X43 A;  4TR3 A;  2B5E A;  1SJI A;  4MDC A;  1F3B A;  3GKX A;  3ZL5 A;  1AXD A;  5CP1 A;  7GSS A;  5F07 A;  4K0N A;  3ERG A;  3F9U A;  2WCI A;  2DKI A;  2JAC A;  1K3Y A;  5KOW A;  4PUR A;  5GAP D;  1Q98 A;  2HNL A;  1E2Y A;  4KAE A;  4F9Z A;  4X0X A;  3GL3 A;  3F4T A;  3UVH A;  2OBI A;  4TKY A;  5IO2 A;  4I97 A;  2EIQ A;  4DEJ A;  1PKZ A;  3ISO A;  4EF0 A;  4MP4 A;  5ECO B;  3HYP A;  2N5A A;  3R2Q A;  3HZ4 A;  4PQI A;  3GH6 A;  3H4K A;  1U88 A;  2BJX A;  1PL1 A;  2F8F A;  2OE0 A;  3GIX A;  1XXU A;  2IMI A;  1U3A A;  2H19 A;  3FK8 A;  5HR0 A;  2H1A A;  4XS4 A;  2MMZ A;  3U6V A;  3C1R A;  1A0F A;  3QFA C;  4L8E A;  3RPN A;  2RM5 A;  1R5A A;  4MPG A;  4K5R A;  2G0F A;  2H6Z A;  4HU7 A;  1TK8 B;  1K3O A;  3MNG A;  1J08 A;  2LJA A;  5A5K A;  4TR4 A;  2VCT A;  2M46 A;  4MJE A;  4GXZ A;  3KJY A;  3A2X A;  3A5I A;  3E3E A;  4EKZ A;  3UJ1 A;  3KMO A;  3IK7 A;  1TW9 A;  1ZYP A;  1SEN A;  3MAK A;  3GV1 A;  3VFI A;  1F9M A;  2R0G A;  4ZB8 A;  1M7T A;  2HZF A;  3FR6 A;  1ZMA A;  2PVQ A;  5IMF A;  1SK0 A;  5BMU A;  1MD3 A;  1H4O A;  2GSR A;  4PQ1 A;  2X64 A;  1X5D A;  2E7P A;  3D4T A;  5J3R A;  1ZGN A;  2LRN A;  3F8U A;  4HZ2 A;  3GUR A;  2LNT A;  4TR1 A;  4HS1 A;  3WT1 A;  2XHF A;  1XWA A;  3HVV A;  5IOX A;  3GX8 A;  2H01 A;  3VWV A;  1OC9 A;  2YP6 A;  1T7P B;  1I9D A;  3PPU A;  3EIN A;  5G31 A;  5ECN B;  5J41 A;  3QAV A;  5ABR A;  2N5B A;  3Q6O A;  1AQX A;  2GS3 A;  5KN2 A;  2YJ7 A;  1G7O A;  3VLN A;  4FIW A;  4JBB A;  1GL8 A;  3UIW A;  1K0N A;  3DWV A;  4YKF A;  3ED3 A;  4XIH A;  2QSI A;  3ZIT A;  5AIV A;  2OE3 A;  4X1U A;  1PN0 A;  4Q5R A;  2YWI A;  4KUN A;  5HQP A;  4RI7 A;  5CYY A;  4MAB A;  4JR6 A;  1E6B A;  4CHS A;  3IHG A;  4K1F A;  5DAL A;  3FR3 A;  2PVO C;  3GFK A;  4MA9 A;  2H75 A;  4WBR D;  1YF0 A;  1BX9 A;  2L4C A;  2H8L A;  1SL1 B;  4EIP A;  2HZE A;  1FO5 A;  2DC5 A;  2RM6 A;  1TKD B;  2PPT A;  5C04 A;  4ML1 A;  3ZVJ A;  2WGR A;  3L9V A;  4XS4 B;  3AY8 A;  1A23 A;  2LEG A;  4HQS A;  4V1A g;  3I9V 2;  3G7J A;  2PBJ A;  1OC8 A;  3TJF A;  3PR8 A;  3UAR A;  2HSM A;  2VL2 C;  2DJ2 A;  3P90 A;  5D8I A;  4KDX A;  2C3Q A;  2K6V A;  2AHE A;  4TXO A;  2HRN A;  2L6D A;  2CVD A;  1XIY A;  2WZ9 A;  4K8M A;  2RII A;  4K7N A;  5HR1 A;  2KP1 A;  1LBK A;  1A2L A;  2M72 A;  3O6T A;  2O7K A;  1Z5Y E;  5CAX A;  3HJM A;  3ZVJ D;  4ZB9 A;  2GQL A;  1EP8 A;  4OCF A;  4MJA A;  3C1S A;  4BVY A;  3KTL A;  2NTO A;  3APO A;  4ECC A;  4HQZ A;  2WUL A;  5ELG A;  4D73 A;  5BRT A;  1TP9 A;  4QL9 A;  1SYX A;  4TR1 B;  3PH9 A;  3IHQ A;  3M8N A;  3Q74 A;  4J56 E;  1WP0 A;  4NHZ A;  1K0B A;  3FRC A;  1OC9 B;  4V2L A;  1KNG A;  2C3T A;  4HU9 A;  2V41 A;  3GRX A;  5DAK A;  2BMX A;  1ST9 A;  1XW5 A;  5CRE A;  3FYG A;  3RAZ A;  5IQY A;  8GSS A;  3CMI A;  1G6Y A;  5ELA A;  1XWB A;  1XG8 A;  3ZMK A;  1TI3 A;  1O6J A;  4EDZ A;  3EMP A;  4I2U A;  3GA4 A;  3GSS A;  3M9K A;  3NOF A;  5B6M A;  4IGJ A;  4KH7 A;  2CX4 A;  1JZD A;  3UAP A;  4K6X A;  1UC7 A;  1R7H A;  1DSB A;  3GL5 A;  3TJJ A;  1BED A;  3MYD A;  3TJK A;  4LLR A;  4EIQ A;  3PGT A;  4KSO A;  5CO3 A;  5FWG A;  3P7X A;  2B7K A;  4V1A p;  4WF5 A;  2CVK A;  1MEK A;  1QUW A;  4F0B A;  4ZL8 A;  2DML A;  5CRD A;  3TKS A;  3IK9 A;  3CRU A;  3TJG A;  4JZQ A;  6GST A;  3UVT A;  5DAL B;  1OE7 A;  5KOX A;  2REM A;  2IFQ A;  5J5N A;  3VUR A;  5IMC A;  2C0F A;  2HZE B;  3UBL A;  1TK0 B;  3TKS E;  4K0G A;  4Q5F A;  3LJR A;  1YEX A;  4I6X A;  1AQV A;  4KB3 A;  2KP2 A;  5KN1 A;  5F0G A;  2PWJ A;  2YCD A;  4MJB A;  4IQ1 A;  5EY6 A;  12GS A;  4MNN A;  3VPQ A;  4TXO B;  3ERF A;  1CQH A;  2KLX A;  5CNW A;  3BBY A;  3VK9 A;  5EVO A;  5H5S A;  4KE3 A;  1V98 A;  2MBS A;  1V57 A;  4GSN A;  3ZRD A;  3NIV A;  2VLU A;  4ZIL A;  3IC4 A;  1EP7 A;  1RW1 A;  2I4A A;  2IIY A;  4POK A;  4XS1 A;  1MDK A;  3FMW A;  1XWK A;  1QFN A;  4BVY B;  1NM3 A;  4MZB A;  2TRC P;  4D73 B;  3VI5 A;  4JRR A;  3VWU A;  1AAZ A;  4POM A;  2DJ0 A;  4O5Q A;  4TN8 A;  2R4V A;  2WDU A;  3SWL A;  1WOU A;  2E2G A;  3DML A;  5ECP B;  2C1Y A;  1YKC A;  3DD3 A;  3US3 A;  1O8X A;  3DRN A;  2H0I A;  2PMT A;  2VIM A;  1QGV A;  1TU7 A;  1WE0 A;  5DAK B;  2NBS A;  4TRX A;  2YNX A;  4G10 A;  5AN1 A;  1DE2 A;  4TR0 A;  1FOV A;  3LEF A;  1B48 A;  2H70 A;  1ZZY A;  3IAS 2;  2VD0 A;  3DYR A;  3UMA A;  3BCK A;  1HQO A;  1B9X C;  1M9B A;  2JL4 A;  4I2T A;  4HDE A;  5ECM B;  1ERT A;  2F3M A;  3V1W A;  1X9M B;  1QK8 A;  1VF2 A;  2R6K A;  2OAD A;  2F51 A;  2L6C A;  5D9X A;  3QR6 A;  1TRS A;  3OR5 A;  1OKD A;  4MH3 A;  1IYI A;  4IEL A;  3EU4 A;  4PQH A;  1WJK A;  2ES7 A;  4DSS A;  1M9A A;  3D0Z A;  1O7U A;  2AYT A;  2FCH A;  2IFQ B;  4N30 A;  2CA8 A;  3P2A A;  3IXR A;  4FYB A;  4Z7X A;  14GS A;  2WS2 A;  4ZIJ A;  1B4Q A;  1GNW A;  3EE2 A;  4LMV A;  3IPZ A;  5COH A;  3CTG A;  2HSY A;  3CBU A;  4P3Y B;  3M1G A;  1QMV A;  1X0R A;  1SU9 A;  3F3R A;  3WYW A;  2FWE A;  5IO0 A;  3U5R E;  2RUF A;  1GRX A;  2IN3 A;  4HOJ A;  1A0R P;  5B8A A;  2R0P A;  2HYX A;  3ZZX A;  2VM2 A; 
#chains in the Genus database with same CATH homology
 4KGI A;  1AW9 A;  5F06 A;  3VPT A;  1THO A;  4HJ2 A;  4WR4 A;  1S3A A;  5IMD A;  1TXX A;  2YWM A;  4FYC A;  3TOU A;  2P5Q A;  2V1M A;  3MDK A;  2KUC A;  4Z2R A;  2AB6 A;  3P8W A;  1NW2 A;  4LMW A;  4JED A;  4G0L A;  1VF4 A;  5D93 A;  4G2E A;  1NHY A;  3HCZ A;  2MYG A;  1UA5 A;  2AUV A;  4G0I A;  5AGY A;  2C0G A;  4OCE A;  2CT6 A;  2LUS A;  5G30 A;  2H71 A;  2AAW A;  3KP8 A;  1B8X A;  4F82 A;  5HR2 A;  4DVC A;  4MLY A;  3LOR A;  2J9H A;  4L5L A;  4K2X A;  1Z3E A;  4IJ3 A;  3WGX A;  2QKE A;  1JZW A;  1XFL A;  2ZNM A;  4XHM A;  5ECH B;  1PD2 1;  2OKA A;  3G7Y A;  2C80 A;  3H8Q A;  2EC4 A;  3FR9 A;  1Y25 A;  4CY6 A;  1ZOF A;  1K0C A;  5LCZ A;  2G2Q A;  3KZQ A;  4I5Q A;  1TOF A;  2OA7 A;  2YJH A;  2FNO A;  3ZIJ A;  3TDG A;  1J9B A;  2H6X A;  5G5E A;  1U87 A;  3I6A A;  2H0H A;  1R26 A;  1A2J A;  2P31 A;  4FH8 A;  3FKF A;  3WT2 A;  1Q4J A;  1GSY A;  2B3S A;  3IOS A;  4PNF A;  4ACS A;  3E0U A;  4DSS B;  6GSV A;  3BJ5 A;  3E9J B;  2ZCT A;  4NWY A;  4OD7 A;  5CRH A;  5KEJ A;  4EE0 A;  1GTI A;  1IYH A;  4GQF A;  2L4Q A;  5G1L A;  4ILF A;  2FHE A;  5ID2 A;  2YV9 A;  2MZC A;  4MH2 A;  3R3E A;  3Q18 A;  1W89 A;  1U3I A;  4O7H A;  3F6D A;  2LJR A;  2IJY A;  5D9V A;  2V6K A;  1JZR A;  4EVM A;  3M3M A;  3QDN A;  3H1N A;  3GHA A;  4XRD A;  2FWG A;  4GCI A;  2CX3 A;  1GUH A;  3ZRE A;  1XWG A;  3PIN A;  3D6I A;  4N11 A;  3SBC A;  3KH9 A;  4ECB A;  2X8G A;  3D5J A;  2I1U A;  1SL0 B;  2DSA A;  2KOK A;  2CV4 A;  1V2A A;  1S3C A;  1ZYN A;  1SK2 A;  5GST A;  3GH9 A;  2IPA A;  4YQM A;  3DIE A;  2H0G A;  5HFK A;  1ML6 A;  4J2F A;  4WR5 A;  3EVI A;  4MK3 A;  2A2S A;  3WD6 A;  5JWO B;  4KDY A;  3APQ A;  5DVB A;  1A8Y A;  2ZUP A;  5D9T A;  2B6M A;  2X49 A;  2D2Z A;  2YZH A;  5DCH A;  4PNG A;  1ERU A;  1ERW A;  2JZS A;  2I9H A;  2LQO A;  5EL8 A;  2HRK A;  1BG5 A;  3APS A;  2GTU A;  1FAA A;  4WKW A;  2X8H A;  4K9Z A;  1N2A A;  1EV4 A;  2YV7 A;  1URM A;  3GUS A;  1EEM A;  5G5F A;  3UEM A;  1FOH A;  3HKR A;  1GP1 A;  3RBT A;  1KBN A;  2GVP A;  3KTB A;  3GNJ A;  3FY7 A;  3TUE A;  1BAY A;  2MMO A;  4DSQ A;  3LG6 A;  4GTU A;  1THX A;  2LNS A;  2PU9 C;  4ICY A;  3CXG A;  2K18 A;  2XBQ A;  1DUG A;  2N5F A;  2FGX A;  2JU5 A;  2FA8 A;  3KXO A;  1YQ1 A;  4AJ7 A;  1J0F A;  2H73 A;  2YOI A;  4NHW A;  1GNE A;  2A2R A;  3KIJ A;  3EMX A;  4PUA A;  1SD9 A;  2A4H A;  4ML6 A;  2IWT A;  3FHK A;  1H75 A;  4ZL7 A;  2F9S A;  2O87 A;  2JSZ A;  5A4W A;  2HXK A;  5HFI A;  3IE3 A;  5A4U A;  4OFT A;  3LGC A;  1ZL9 A;  1YDK A;  1EGR A;  3W8J A;  3IDV A;  2TRX A;  1G7E A;  1K0M A;  4QQ7 A;  4GLT A;  6GSY A;  2L5L A;  1U6T A;  1HNA A;  2O8V B;  3BOA A;  4ZL9 A;  3TGZ A;  5E4W A;  1M2B A;  2I3Y A;  4GSS A;  5F05 A;  1TK5 B;  4BWS A;  5ID2 B;  2GZZ A;  3L78 A;  3HHV A;  4WET A;  1X5C A;  3H93 A;  1MTC A;  2X8C A;  5IOW A;  1T4Z A;  2GZP A;  2H1G A;  1XOA A;  4IKH A;  2GDR A;  3GST A;  1XOB A;  4IP6 A;  1R4W A;  1JHB A;  4E8E A;  1T00 A;  4YQU A;  3VI7 A;  2XBI A;  2JZT A;  4OFN A;  3BD2 A;  1YJ6 A;  4OO5 A;  1Z6N A;  2CAQ A;  2DJJ A;  1YEP A;  1SKS B;  5EPF A;  3GKM A;  4HZ4 A;  3TOT A;  4G0K A;  2CQ9 A;  4V2N A;  2C3N A;  3QAG A;  1Y6E A;  3GTU A;  5J9C A;  4KX4 A;  2JSY A;  1PX6 A;  1FW1 A;  3LYK A;  3M0F A;  4JR4 A;  5A4V A;  3ME8 A;  6GSW A;  3KP9 A;  4ISD A;  1HD2 A;  3ZYW A;  4O5U A;  3KCM A;  5CRG A;  2LV3 A;  3FZ9 A;  2VCX A;  2CAI A;  9GSS A;  1A8L A;  4GRF A;  4K7O A;  1M99 A;  1Z6M A;  1GTB A;  1Z7P A;  5F8B A;  3QAW A;  1MDJ A;  1X9W B;  2YN1 A;  3HY2 A;  4YAV A;  4GST A;  4ECI A;  5INY A;  2PUK C;  5DCG A;  1ON4 A;  1CQG A;  2H30 A;  3DXB A;  4KA0 A;  2GST A;  1GSD A;  4LL1 B;  4BPY A;  2YWO A;  4NAX A;  3W8S A;  3CYN A;  3S9F A;  4IHU A;  2PGT A;  1ABA A;  4F2I A;  4K5S A;  1OYJ A;  4JU5 A;  1UVZ A;  3IRA A;  2VLT A;  3HZ8 A;  4KND A;  2QGV A;  2FLS A;  4NXI A;  2QC7 A;  17GS A;  1RQM A;  4KSM A;  2DJ1 A;  1S3D A;  1KTE A;  4H86 A;  4MJC A;  1JLV A;  5B7C A;  1M0U A;  3HD5 A;  2FWF A;  4GQC A;  2R5G A;  2M80 A;  1KEB A;  3BCI A;  3KH7 A;  3O3T A;  4DSR A;  3HVS A;  4OWY A;  4IVF A;  6GSU A;  1A2M A;  5IM9 A;  2MMN A;  4WXT A;  5L71 A;  2PN8 A;  5LNK e;  2KHP A;  3DEX A;  3QCP A;  5D73 A;  3A2V A;  1X5E A;  1EOH A;  5IPG A;  1VGL A;  3QFB C;  3GN3 A;  1AUC A;  3LQ7 A;  4WBJ A;  2MBT A;  3F3Q A;  2H1D A;  3KEB A;  1AC1 A;  3L4N A;  1JLW A;  4N10 A;  3RHB A;  4EDY A;  2IMF A;  3TKR A;  5D9W A;  4QL7 A;  2LTK A;  1GSQ A;  2HT9 A;  2HFD A;  3KD0 A;  1PKW A;  2QA1 A;  3KM6 A;  4IP1 A;  3F4R A;  3GKK A;  5IMV A;  4TOP A;  4RI6 A;  2ON5 A;  1SK1 A;  2GQK A;  4XRA A;  1GLP A;  2NPB A;  3TKP A;  2DJ3 A;  5IMA A;  4MCU A;  1WRY A;  5DBQ A;  3KMN A;  4CW9 A;  4YKG A;  2H1B A;  2DBC A;  1SD8 A;  1VRS D;  3GTU B;  2L5O A;  5GAN D;  4KW6 A;  19GS A;  4NV2 A;  4V2M A;  2VCV A;  2K8S A;  2GT5 A;  1USB A;  3IR4 A;  3ZIV A;  1K0O A;  20GS A;  1FVJ A;  5ECR B;  1G0T A;  1ZYQ B;  2GQM A;  3LYP A;  4PUF C;  2FY6 A;  4ZB6 A;  4G9H A;  2WJU A;  2VD1 A;  2VUP A;  2DIY A;  4O92 A;  5KN3 A;  1DBY A;  4ID0 A;  3TKS C;  3RHC A;  1BJX A;  4MZW A;  3G7I A;  4O5R A;  2VM1 A;  2HI7 A;  4YAP A;  5DQS A;  1TDI A;  1TTZ A;  2FUG 2;  2OAC A;  5DJM A;  3I69 A;  4GF0 A;  2R3X A;  3IC8 A;  3TRQ A;  2R37 A;  1M2A A;  3HJO A;  3DKS A;  3HA9 A;  1SJZ A;  2TIR A;  3LSZ A;  5JCW A;  2A2P A;  2YAN A;  4J57 E;  4CY8 A;  1HYU A;  3HJP A;  1V9W A;  3MSZ A;  2GZY A;  4N0Z A;  4Z2T A;  2VL2 A;  4AJ6 A;  2JZR A;  3EYT A;  4HJM A;  4HEA 2;  4KDU A;  2XPD A;  2OE1 A;  1GTU A;  4KCA A;  3GYK A;  1FB6 A;  3FZ5 A;  2AV4 A;  3TB2 A;  1TU8 A;  4POB A;  2E2M A;  4EC0 A;  3HXS A;  5ENU A;  5AIX A;  2FA4 A;  1YF1 A;  4X4J A;  5G1K A;  4LL4 B;  1YZX A;  1K0A A;  5IMZ A;  1ZCP A;  1UN2 A;  2LJK A;  4NMU A;  1O85 A;  2J23 A;  1XVW A;  3FEU A;  1HNC A;  1T4Y A;  1OVN A;  1EOG A;  5H5R A;  1QXH A;  4E8H A;  4I8B A;  4BWQ A;  4G19 A;  1R5P A;  2VCZ A;  10GS A;  2CVB A;  1GWC A;  4OFM A;  2WRT A;  3N5O A;  1OE8 A;  5JWR B;  1QQ2 A;  2HE3 A;  2B5X A;  2C0E A;  1JFU A;  3F6F A;  1AQW A;  3ZFL A;  1Z9H A;  3A2W A;  3DGQ A;  3FZA A;  1FVK A;  3CTF A;  5FHI A;  5JCG A;  1T1V A;  1PSQ A;  2VLV A;  4XS6 A;  5DDL A;  5IPH A;  5AIS A;  3UBK A;  1XW9 A;  2LRC A;  2VAF A;  1PA3 A;  1XWC A;  13GS A;  2EIR A;  3F63 A;  1PGT A;  2B5Y A;  3GX0 A;  3LXT A;  4F03 A;  4O32 A;  4MPF A;  1F6M C;  2O89 A;  4YQV A;  2VO4 A;  3KGK A;  1NHO A;  3NZN A;  1PX7 A;  1VF3 A;  1GH2 A;  3J7Y b;  3Q19 A;  1V40 A;  1YKA A;  4ZBB A;  1GUL A;  4EL1 A;  4MF6 A;  2H76 A;  2LRT A;  1GSF A;  4KF9 A;  2H74 A;  2EIO A;  2JAD A;  2RUE A;  4BVX A;  4EXJ A;  4HUA A;  4AJ8 A;  3GMF A;  3TKQ A;  2C0D A;  2HLS A;  5ECI B;  4A5P A;  3QMX A;  4IJI A;  4L0U A;  1LU4 A;  2VCQ A;  4IN0 A;  5HR3 A;  4MMM A;  4WEY A;  4TXV A;  3D22 A;  1O81 A;  1TJD A;  2DIZ A;  3LW9 A;  4ZXG A;  3WGD A;  1YY7 A;  2RLI A;  4XCS A;  3EUR A;  2HRA A;  2K9F A;  2VCW A;  1SKW B;  5DJL A;  2YWN A;  1XZO A;  2OBK A;  18GS A;  1JZO A;  1OKT A;  2B7J A;  3EU3 A;  2LQQ A;  2IL3 A;  3CRT A;  2A4V A;  1VF1 A;  4OO4 A;  3ZLP A;  1WIK A;  1WPI A;  3EC3 A;  3TCO A;  4IS0 A;  4USS A;  4EUY A;  4ZBA A;  5B6N A;  4ZBD A;  1F3A A;  2AJQ B;  1EEJ A;  3ME7 A;  2CZ3 A;  4OMV A;  5D96 A;  5DQY A;  5KN0 A;  4TW5 A;  1PRX A;  3I43 A;  16GS A;  2HRF A;  2OJL A;  2QA2 A;  3DVX A;  2LST A;  3C8E A;  3CSH A;  4K7I A;  4Q5N A;  5ECS A;  5J9B A;  4CDO A;  2B1L A;  2O85 A;  3C7M A;  4K2D A;  2P5R A;  4FO5 A;  5ECK B;  2L57 A;  4NV5 A;  2C4J A;  3IAM 2;  1XW6 A;  1B9Y C;  1FB0 A;  2V2G A;  2GSS A;  1SL2 B;  4POL A;  3IA1 A;  1GSU A;  3D4M A;  4TVE A;  3EPT A;  2MMA A;  4IBP A;  4L5O A;  1TRW A;  1A24 A;  2ALB A;  4PTS A;  4FQU A;  2CZ2 A;  2ON7 A;  3GKN A;  5H5Q A;  1FG4 A;  3WGE A;  1C72 A;  1GUK A;  3JCM L;  4WF4 A;  2GT6 A;  4IW9 A;  2GGT A;  5IIZ A;  2HSH A;  3VWW A;  5GZZ B;  1PL2 A;  5JWQ B;  3L9S A;  3IBH A;  3RDW A;  1GLQ A;  1GUM A;  4PXO A;  4MZC A;  2DJK A;  4BL7 A;  4BVX B;  3UL3 A;  4EO3 A;  1SKR B;  3QPM A;  1T3B A;  2FWH A;  4PGT A;  2H66 A;  2L59 A;  4MF7 A;  1ERV A;  2IMD A;  1TI1 A;  3QOU A;  3ERW A;  5FT3 A;  5B8B A;  2UZ8 A;  2B1K A;  1XVQ A;  3K8N A;  3MWH A;  1NSW A;  4Q5Q A;  3L0H A;  1EWX A;  1F2E A;  1OC3 A;  1HNB A;  1XCC A;  3J7Y k;  5GSS A;  2V32 A;  1W4V A;  1GSE A;  3DVW A;  3ZML A;  3W6G A;  5C00 A;  1O73 A;  5HFG A;  2IME A;  3TRP A;  2BTO T;  2LKU A;  2DKH A;  1EGO A;  1XBS A;  1F37 A;  3C73 A;  3RPP A;  4BA7 A;  4L0W A;  1PQN A;  3QD9 A;  1EZK A;  3O76 A;  1X9S B;  2X4A A;  1WWJ A;  3CSJ A;  3C71 A;  2R2J A;  1ILO A;  5ECQ B;  1N8J A;  1DE1 A;  5E59 A;  4HI7 A;  3FW2 A;  3D21 A;  2C8U A;  3A3T A;  5CRW A;  5ECL B;  1V58 A;  1PMT A;  3TJB A;  3FZ4 A;  3M9J A;  22GS A;  3N9J A;  1K0D A;  5JCU A;  2V6O A;  3L9U A;  2X99 A;  4AGS A;  3G9B A;  3EWL A;  2WFC A;  1WMJ A;  1XPV A;  4GWR A;  4MF5 A;  2LS5 A;  4KCE A;  3IV4 A;  1ZYE A;  5G2Z A;  1T8E B;  1BQ7 A;  2FD3 A;  11GS A;  1ACV A;  2PER A;  4F0C A;  3ZFB A;  1I5G A;  1RK4 A;  4N0V A;  1SYR A;  2DMM A;  3F0I A;  2H72 A;  2F8A A;  1M2D A;  6GSX A;  3CSI A;  2VOC A;  1B4P A;  2XPE A;  2IMK A;  4NPB A;  3F4S A;  4IQA A;  1MD4 A;  2VL9 A;  4YH2 A;  2YZU A;  3TRX A;  1GTA A;  4BL7 B;  4RUV A;  4RQX A;  2Z9S A;  2GSQ A;  3UOM A;  4PX1 A;  3LWA A;  2WB9 A;  3HDC A;  1FHE A;  3MIX A;  1PN9 A;  2E0Q A;  3HVX A;  3VWX A;  1G6W A;  1EV9 A;  4FYU A;  1TRU A;  1AIU A;  4ULX A;  2VL3 A;  3H79 A;  1SJ6 A;  2H6Y A;  4XTS A;  4Z2U A;  5LD0 A;  2NVL A;  6GSS A;  3LFL A;  1MDI A;  2GLR A;  2YPM A;  4AF2 A;  1TRV A;  4JE1 A;  1OAZ A;  3LXZ A;  1LJR A;  2DLX A;  1K3L A;  2XC2 A;  5J4U A;  4LA1 A;  2I81 A;  2P0G A;  3ZTL A;  4RQR A;  1BYE A;  1Z7R A;  2K8V A;  2NDO A;  1O8W A;  3A5W A;  1GSS A;  4ECJ A;  2R0C A;  4X43 A;  4TR3 A;  2B5E A;  1SJI A;  4MDC A;  1F3B A;  3GKX A;  3ZL5 A;  1AXD A;  5CP1 A;  7GSS A;  5F07 A;  4K0N A;  3ERG A;  3F9U A;  2WCI A;  2DKI A;  2JAC A;  1K3Y A;  5KOW A;  4PUR A;  5GAP D;  1Q98 A;  2HNL A;  1E2Y A;  4KAE A;  4F9Z A;  4X0X A;  3GL3 A;  3F4T A;  3UVH A;  2OBI A;  4TKY A;  5IO2 A;  4I97 A;  2EIQ A;  4DEJ A;  1PKZ A;  3ISO A;  4EF0 A;  4MP4 A;  5ECO B;  3HYP A;  2N5A A;  3R2Q A;  3HZ4 A;  4PQI A;  3GH6 A;  3H4K A;  1U88 A;  2BJX A;  1PL1 A;  2F8F A;  2OE0 A;  3GIX A;  1XXU A;  2IMI A;  1U3A A;  2H19 A;  3FK8 A;  5HR0 A;  2H1A A;  4XS4 A;  2MMZ A;  3U6V A;  3C1R A;  1A0F A;  3QFA C;  4L8E A;  3RPN A;  2RM5 A;  1R5A A;  4MPG A;  4K5R A;  2G0F A;  2H6Z A;  4HU7 A;  1TK8 B;  1K3O A;  3MNG A;  1J08 A;  2LJA A;  5A5K A;  4TR4 A;  2VCT A;  2M46 A;  4MJE A;  4GXZ A;  3KJY A;  3A2X A;  3A5I A;  3E3E A;  4EKZ A;  3UJ1 A;  3KMO A;  3IK7 A;  1TW9 A;  1ZYP A;  1SEN A;  3MAK A;  3GV1 A;  3VFI A;  1F9M A;  2R0G A;  4ZB8 A;  1M7T A;  2HZF A;  3FR6 A;  1ZMA A;  2PVQ A;  5IMF A;  1SK0 A;  5BMU A;  1MD3 A;  1H4O A;  2GSR A;  4PQ1 A;  2X64 A;  1X5D A;  2E7P A;  3D4T A;  5J3R A;  1ZGN A;  2LRN A;  3F8U A;  4HZ2 A;  3GUR A;  2LNT A;  4TR1 A;  4HS1 A;  3WT1 A;  2XHF A;  1XWA A;  3HVV A;  5IOX A;  3GX8 A;  2H01 A;  3VWV A;  1OC9 A;  2YP6 A;  1T7P B;  1I9D A;  3PPU A;  3EIN A;  5G31 A;  5ECN B;  5J41 A;  3QAV A;  5ABR A;  2N5B A;  3Q6O A;  1AQX A;  2GS3 A;  5KN2 A;  2YJ7 A;  1G7O A;  3VLN A;  4FIW A;  4JBB A;  1GL8 A;  3UIW A;  1K0N A;  3DWV A;  4YKF A;  3ED3 A;  4XIH A;  2QSI A;  3ZIT A;  5AIV A;  2OE3 A;  4X1U A;  1PN0 A;  4Q5R A;  2YWI A;  4KUN A;  5HQP A;  4RI7 A;  5CYY A;  4MAB A;  4JR6 A;  1E6B A;  4CHS A;  3IHG A;  4K1F A;  5DAL A;  3FR3 A;  2PVO C;  3GFK A;  4MA9 A;  2H75 A;  4WBR D;  1YF0 A;  1BX9 A;  2L4C A;  2H8L A;  1SL1 B;  4EIP A;  2HZE A;  1FO5 A;  2DC5 A;  2RM6 A;  1TKD B;  2PPT A;  5C04 A;  4ML1 A;  3ZVJ A;  2WGR A;  3L9V A;  4XS4 B;  3AY8 A;  1A23 A;  2LEG A;  4HQS A;  4V1A g;  3I9V 2;  3G7J A;  2PBJ A;  1OC8 A;  3TJF A;  3PR8 A;  3UAR A;  2HSM A;  2VL2 C;  2DJ2 A;  3P90 A;  5D8I A;  4KDX A;  2C3Q A;  2K6V A;  2AHE A;  4TXO A;  2HRN A;  2L6D A;  2CVD A;  1XIY A;  2WZ9 A;  4K8M A;  2RII A;  4K7N A;  5HR1 A;  2KP1 A;  1LBK A;  1A2L A;  2M72 A;  3O6T A;  2O7K A;  1Z5Y E;  5CAX A;  3HJM A;  3ZVJ D;  4ZB9 A;  2GQL A;  1EP8 A;  4OCF A;  4MJA A;  3C1S A;  4BVY A;  3KTL A;  2NTO A;  3APO A;  4ECC A;  4HQZ A;  2WUL A;  5ELG A;  4D73 A;  5BRT A;  1TP9 A;  4QL9 A;  1SYX A;  4TR1 B;  3PH9 A;  3IHQ A;  3M8N A;  3Q74 A;  4J56 E;  1WP0 A;  4NHZ A;  1K0B A;  3FRC A;  1OC9 B;  4V2L A;  1KNG A;  2C3T A;  4HU9 A;  2V41 A;  3GRX A;  5DAK A;  2BMX A;  1ST9 A;  1XW5 A;  5CRE A;  3FYG A;  3RAZ A;  5IQY A;  8GSS A;  3CMI A;  1G6Y A;  5ELA A;  1XWB A;  3ZMK A;  1TI3 A;  1O6J A;  4EDZ A;  3EMP A;  4I2U A;  3GA4 A;  3GSS A;  3M9K A;  3NOF A;  5B6M A;  4IGJ A;  4KH7 A;  2CX4 A;  1JZD A;  3UAP A;  4K6X A;  1UC7 A;  1R7H A;  1DSB A;  3GL5 A;  3TJJ A;  1BED A;  3MYD A;  3TJK A;  4LLR A;  4EIQ A;  3PGT A;  4KSO A;  5CO3 A;  5FWG A;  3P7X A;  2B7K A;  4V1A p;  4WF5 A;  2CVK A;  1MEK A;  1QUW A;  4F0B A;  4ZL8 A;  2DML A;  5CRD A;  3TKS A;  3IK9 A;  3CRU A;  3TJG A;  4JZQ A;  6GST A;  3UVT A;  5DAL B;  1OE7 A;  5KOX A;  2REM A;  2IFQ A;  5J5N A;  3VUR A;  5IMC A;  2C0F A;  2HZE B;  3UBL A;  1TK0 B;  3TKS E;  4K0G A;  4Q5F A;  3LJR A;  1YEX A;  4I6X A;  1AQV A;  4KB3 A;  2KP2 A;  5KN1 A;  5F0G A;  2PWJ A;  2YCD A;  4MJB A;  4IQ1 A;  5EY6 A;  12GS A;  4MNN A;  3VPQ A;  4TXO B;  3ERF A;  1CQH A;  2KLX A;  5CNW A;  3BBY A;  3VK9 A;  5EVO A;  5H5S A;  4KE3 A;  1V98 A;  2MBS A;  1V57 A;  4GSN A;  3ZRD A;  3NIV A;  2VLU A;  4ZIL A;  3IC4 A;  1EP7 A;  1RW1 A;  2I4A A;  2IIY A;  4POK A;  4XS1 A;  1MDK A;  3FMW A;  1XWK A;  1QFN A;  4BVY B;  1NM3 A;  4MZB A;  2TRC P;  4D73 B;  3VI5 A;  4JRR A;  3VWU A;  1AAZ A;  4POM A;  2DJ0 A;  4O5Q A;  4TN8 A;  2R4V A;  2WDU A;  3SWL A;  1WOU A;  2E2G A;  3DML A;  5ECP B;  2C1Y A;  1YKC A;  3DD3 A;  3US3 A;  1O8X A;  3DRN A;  2H0I A;  2PMT A;  2VIM A;  1QGV A;  1TU7 A;  1WE0 A;  5DAK B;  2NBS A;  4TRX A;  2YNX A;  4G10 A;  5AN1 A;  1DE2 A;  4TR0 A;  1FOV A;  3LEF A;  1B48 A;  2H70 A;  1ZZY A;  3IAS 2;  2VD0 A;  3DYR A;  3UMA A;  3BCK A;  1HQO A;  1B9X C;  1M9B A;  2JL4 A;  4I2T A;  4HDE A;  5ECM B;  1ERT A;  2F3M A;  3V1W A;  1X9M B;  1QK8 A;  1VF2 A;  2R6K A;  2OAD A;  2F51 A;  2L6C A;  5D9X A;  3QR6 A;  1TRS A;  3OR5 A;  1OKD A;  4MH3 A;  1IYI A;  4IEL A;  3EU4 A;  4PQH A;  1WJK A;  2ES7 A;  4DSS A;  1M9A A;  3D0Z A;  1O7U A;  2AYT A;  2FCH A;  2IFQ B;  4N30 A;  2CA8 A;  3P2A A;  3IXR A;  4FYB A;  4Z7X A;  14GS A;  2WS2 A;  4ZIJ A;  1B4Q A;  1GNW A;  3EE2 A;  4LMV A;  3IPZ A;  5COH A;  3CTG A;  2HSY A;  3CBU A;  4P3Y B;  3M1G A;  1QMV A;  1X0R A;  1SU9 A;  3F3R A;  3WYW A;  2FWE A;  5IO0 A;  3U5R E;  2RUF A;  1GRX A;  2IN3 A;  4HOJ A;  1A0R P;  5B8A A;  2R0P A;  2HYX A;  3ZZX A;  2VM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...