2XBIA

Crystal structure of schistosoma mansoni thioredoxin at 1.6 angstrom
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
GSMSKLIELKQDGDLESLLEQHKNKLVVVDFFATWCGPCKTIAPLFKELSEKYDAIFVKVDVDKLEETARKYNISAMPTFIAIKNGEKVGDVVGASIAKVEDMIKKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN
publication title Structural and Functional Characterization of Schistosoma Mansoni Thioredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 33
structure length 108
sequence length 108
ec nomenclature ec 1.8.1.8: Protein-disulfide reductase.
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2xbiA00
1ZZYA 1ABAA 3UARA 1GUMA 1EP8A 4PXOA 4RQRA 4K2DA 3FRCA 3O3TA 1DE1A 17GSA 2JSYA 4MP4A 2JADA 1URMA 4PX1A 3HKRA 4TR1B 3HDCA 4GRFA 1YKAA 1UN2A 2YZHA 2J9HA 1DE2A 1TRVA 5IO0A 4EDYA 1E2YA 1QUWA 2GSTA 3WGXA 1R7HA 2YOIA 3C71A 2WFCA 1ERTA 14GSA 4IP6A 2CVKA 4E8HA 1R4WA 4IW9A 3ZITA 2LNTA 1V57A 3A2WA 1MD3A 5H5QA 1DBYA 1DUGA 3VURA 2IN3A 3KEBA 1B9XC 4KX4A 4YQUA 2N5FA 1F2EA 2H73A 5DCHA 1KBNA 3DXBA 1M9AA 4NXIA 3DEXA 3CXGA 3MSZA 3ZREA 5C04A 4I6XA 1TDIA 19GSA 2YN1A 1GL8A 13GSA 1HNBA 3HY2A 4HUAA 2VCVA 1FOVA 9GSSA 1PL2A 1GRXA 4F9ZA 2C3TA 3CMIA 1A8YA 3BCKA 1JZDA 3RDWA 1SJIA 2KLXA 2LNSA 4IBPA 4F2IA 4ECBA 2GLRA 1H75A 2VL9A 1GULA 1XVQA 5IM9A 2IIYA 3E9JB 4N10A 3P90A 1AW9A 2YP6A 1F3BA 3GHAA 2HXKA 2VD1A 3RBTA 4RQXA 4CDOA 3LYKA 4N0VA 1GSQA 3CRTA 3CSIA 5KN0A 5H5SA 4DSSB 4IKHA 1THOA 3KGKA 3M3MA 2CV4A 3IRAA 2YANA 3A2VA 3F8UA 2F51A 3LSZA 4BVXA 1XW5A 5F05A 2I3YA 1T4YA 1F9MA 1TI1A 1ZYQB 3FZ5A 1OE7A 1TU8A 3KJYA 5D9VA 3A5WA 2DC5A 3EE2A 1U3IA 3I9V2 5CREA 4ZL9A 3IAM2 1ST9A 2F9SA 2KUCA 3F0IA 2R6KA 5DALA 4QL7A 1QGVA 4JU5A 2H6XA 3F63A 2MBSA 4GSNA 3SWLA 4OCEA 4QQ7A 3HJMA 4OMVA 3C73A 1R5AA 1XBSA 2B6MA 3FHKA 4TRXA 2OACA 3NIVA 5H5RA 1EOGA 4TKYA 4L0WA 3J7Yk 1WJKA 4OO4A 2H0HA 4KCEA 1X5EA 2BJXA 1VF2A 3ZVJD 1GSYA 3WD6A 1X9MB 1AQXA 3QAGA 2H30A 3GX8A 3UOMA 2OJLA 1OAZA 5IOXA 1QK8A 4KAEA 3HYPA 2K8VA 2VL2C 2AHEA 3KP8A 5FHIA 5ABRA 1FB0A 4K7OA 3A2XA 5A4VA 4OFMA 1T7PB 4POMA 2OE3A 4L5OA 2WS2A 3PGTA 4NV2A 4EE0A 5G1LA 1Z7RA 4HDEA 3UMAA 1B8XA 1HYUA 2BMXA 2GT5A 1SKSB 1FAAA 2E7PA 1KEBA 3APSA 5DJMA 3UEMA 2GT6A 1JZWA 3IOSA 3ZLPA 1GH2A 5AN1A 3K8NA 3ME8A 5E59A 1U88A 1HNAA 2I9HA 2AV4A 4WR4A 1PQNA 1AUCA 3CTFA 2ON7A 1SJ6A 2MYGA 1KTEA 1RW1A 4MH2A 4XS4B 3CYNA 3G7YA 2H71A 2WB9A 2H76A 4ZB9A 1X0RA 5F06A 1TKDB 3ED3A 1ERUA 3E0UA 1WWJA 1EOHA 5F8BA 5CO3A 4V1Ap 3VWUA 1K0OA 1GTBA 1W89A 4ACSA 1K3OA 1ZYEA 1SKWB 1IYHA 3FR9A 1V9WA 4EL1A 4KNDA 1VF4A 2IJYA 1SK2A 3TRPA 2FWGA 5HFKA 1GSSA 4WEYA 2GSSA 1KNGA 4FIWA 3TB2A 5ECHB 4AJ7A 3G9BA 1GUHA 4DVCA 4MCUA 2DBCA 3GUSA 5IOWA 4MPGA 4V2LA 3GTUA 1C72A 3F3QA 1EWXA 3TOUA 3CTGA 5CAXA 1I5GA 2WGRA 2X64A 4MABA 4HOJA 3DYRA 2LRCA 3FYGA 3GFKA 5CYYA 3F6FA 4JBBA 5JWOB 4FH8A 3EC3A 1MDKA 2CA8A 2GSRA 3IK9A 2WCIA 4MF7A 5D96A 4OCFA 4KDYA 3H93A 5AIXA 2HLSA 1OC3A 1G6WA 2YWNA 4ZL7A 4PQ1A 3TJJA 3IBHA 2GTUA 3DVXA 4IELA 2H19A 2NTOA 4IHUA 3QR6A 1HNCA 2H1AA 11GSA 1XVWA 5GAPD 2G0FA 2IFQA 3QD9A 5JCGA 4ILFA 2KOKA 1T1VA 1WPIA 4Q5FA 1VF3A 3KMNA 3WT2A 5B8BA 2Z9SA 4IGJA 5IPGA 2V6KA 4YAPA 2DJ0A 3A3TA 2H0GA 2MBTA 2FCHA 5G2ZA 3CSJA 1XZOA 1XOBA 3GSSA 2VCXA 1GUKA 4GF0A 1Q4JA 4I2TA 2PVQA 2VLUA 1X5CA 1XW6A 4N0ZA 4RUVA 2VIMA 1AIUA 4F0BA 2YZUA 2TRCP 3HZ4A 4WXTA 3MWHA 1FVKA 2GGTA 3EU3A 3IV4A 1XWBA 3I43A 4MZWA 5L71A 1XWKA 3KZQA 3VWXA 1LBKA 3TRQA 1N8JA 3V1WA 2IMKA 2LQQA 2VM1A 4K6XA 1T3BA 4ULXA 2H0IA 3FZAA 4ZILA 5JWRB 2FHEA 3F3RA 3ZYWA 3QAWA 4TXOA 5F0GA 2H70A 2LS5A 3TJFA 3E3EA 2RUFA 1PRXA 3TKSC 1YKCA 4IQAA 5IO2A 4XS1A 2HRFA 1UA5A 3HXSA 2PWJA 4WBRD 4ECJA 1PKWA 4GWRA 4ZB6A 1TRSA 3DIEA 1SKRB 4WF5A 1HD2A 4ID0A 1ERWA 4K7IA 2L4CA 4O7HA 8GSSA 1ZGNA 4KH7A 2L59A 1FO5A 2K9FA 1CQGA 4ZXGA 1SL2B 1OC9A 5GSSA 2EIQA 4MF6A 2H75A 4PGTA 5IQYA 1GTAA 4ECIA 4MJEA 3ISOA 1SU9A 3VWWA 3QFBC 18GSA 1TRUA 2YCDA 1BX9A 1YEXA 1U6TA 5DQSA 1R5PA 1B4QA 2YWMA 5B8AA 3GKNA 2YV7A 2HNLA 4G2EA 3HZ8A 4K0NA 3O6TA 4TW5A 5COHA 16GSA 1E6BA 3TDGA 5INYA 1GTIA 2A2SA 1ZCPA 3GKMA 4EO3A 2LRTA 2CZ3A 2VCQA 4JRRA 1OVNA 2NBSA 1SL1B 3DGQA 4JZQA 5FT3A 4KA0A 1XWGA 3UJ1A 5ECKB 1K0MA 1VGLA 2D2ZA 5KN1A 4KGIA 1OC8A 4DEJA 5J41A 4O32A 1LU4A 5G1KA 5HR3A 3F4TA 1UVZA 4POBA 3DVWA 2AAWA 1NHYA 4IVFA 4RI6A 3U6VA 2KHPA 3MDKA 3HJOA 1Y25A 5GAND 5DQYA 2MMOA 3L9UA 4AJ8A 2C0EA 1A2LA 2LSTA 3TCOA 4L0UA 4DSQA 3FEUA 2KP2A 2DJ2A 3HVSA 3S9FA 3DWVA 4OWYA 1Z3EA 2AYTA 1T4ZA 1XOAA 1F6MC 6GSYA 2MMZA 2KP1A 3QCPA 4JE1A 3N9JA 1WE0A 2MZCA 1K3LA 4LL1B 4HI7A 4KSMA 1EGRA 3TKRA 3ZMLA 3GSTA 1J0FA 5DAKB 3GH9A 5D9XA 1XCCA 2OBIA 2I4AA 5C00A 5HR1A 4ZL8A 2VO4A 1TK0B 3EINA 2FWFA 4Q5NA 2C4JA 4FO5A 1EP7A 3IC4A 1BG5A 2XBIA 3ZMKA 3KH7A 2G2QA 4HZ2A 4LMVA 4HQZA 1BYEA 4K1FA 3LFLA 1O7UA 3WGDA 3M8NA 2B5EA 2M80A 1G0TA 3LYPA 3TJGA 2HSYA 4TR1A 1A24A 3RPPA 4MJCA 1TW9A 1WP0A 4GXZA 4WF4A 3FW2A 2PVOC 1PKZA 3WT1A 4HJ2A 4KW6A 2YJHA 3FR3A 2PMTA 1TTZA 4MDCA 3LJRA 4X0XA 2GZYA 4HEA2 5G31A 2REMA 2XPDA 1QFNA 2C0FA 2HI7A 3ZFLA 4KUNA 2NVLA 2L6DA 4LLRA 1MDJA 5JWQB 1PD21 3EWLA 1WRYA 1K3YA 1GP1A 2N5BA 2JL4A 2CX4A 5JCWA 5CRDA 1M2DA 1UC7A 4X43A 3D5JA 5DJLA 2AJQB 4P3YB 2N5AA 3GX0A 5ECRB 3BCIA 5ID2B 3RHCA 3QMXA 5G5FA 3CSHA 1ERVA 3DKSA 2LJAA 1EEJA 3ZL5A 2J23A 2ON5A 1FHEA 2FA4A 1V58A 3QOUA 5IMCA 1F3AA 3MAKA 3P2AA 5KN2A 3F6DA 2RIIA 3IHQA 3W6GA 1YZXA 4J56E 1XXUA 4HS1A 1A2MA 3GNJA 3DRNA 2HSHA 3LORA 2HZEB 2IMEA 1SJZA 1JLVA 1GTUA 5ECLB 1IYIA 1TI3A 2IMIA 4BWQA 4DSSA 2E0QA 4N11A 5B6MA 2YWIA 4GSTA 3VFIA 22GSA 2EIOA 1OKDA 6GSUA 2H6YA 2VUPA 3L78A 1GWCA 2FNOA 3GYKA 4EVMA 4BWSA 1O85A 5KN3A 3I69A 5CNWA 1GSFA 3GKKA 2H8LA 2GVPA 4I8BA 3KCMA 2FUG2 1Z9HA 4MZBA 5LCZA 5DAKA 2CQ9A 2VCTA 2PN8A 2O89A 2GSQA 2VL2A 4KSOA 5FWGA 2F8FA 1AC1A 3FY7A 4QL9A 2QKEA 3EMPA 2K6VA 3ZRDA 3TKSE 1ZOFA 1NW2A 1TU7A 3KP9A 5GSTA 1X9WB 5ECSA 3KM6A 1I9DA 1A0FA 2QC7A 1F37A 4JEDA 1AXDA 4ML1A 1Y6EA 1A8LA 3ZTLA 3P7XA 4PQIA 2BTOT 1O8WA 4KDXA 3C8EA 2EC4A 1OE8A 2LJKA 4JR4A 4MH3A 1B9YC 4GQCA 4Q5RA 2GS3A 4MJBA 2HFDA 2FLSA 2PERA 4OO5A 4GQFA 4LA1A 1X5DA 1GLPA 2GZZA 2H72A 3IXRA 1K0BA 1XW9A 2C80A 3HD5A 2VCZA 4PNFA 3M9KA 4OFNA 1A0RP 1AAZA 4EC0A 4D73B 2PUKC 1U87A 3WGEA 4MZCA 1BJXA 5ECNB 1Z7PA 1ML6A 3KTBA 2XHFA 2LJRA 4CW9A 3J7Yb 2OE1A 5G5EA 3L9SA 2OKAA 1NM3A 2O7KA 1WIKA 2C8UA 1YJ6A 2LRNA 1BQ7A 4GLTA 6GSVA 7GSSA 1O81A 2O85A 2LTKA 3GL5A 2H1BA 1SYRA 1YY7A 2A4VA 4IJ3A 2PBJA 2ALBA 4TR3A 4ZBBA 1NSWA 2R4VA 4ML6A 4AGSA 4K7NA 4XS4A 2CZ2A 2QGVA 3H1NA 2HT9A 3GIXA 3QFAC 1MDIA 4CHSA 1XFLA 2DJKA 5HQPA 4MPFA 6GSSA 4NWYA 4KCAA 1PA3A 4E8EA 3FK8A 3GMFA 1U3AA 2XC2A 2B1LA 2VM2A 1EV4A 2VL3A 2NDOA 4GTUA 2DLXA 3O76A 2GZPA 2CVDA 5CRHA 4BPYA 3C7MA 2RM5A 1PX6A 5HR0A 2ZCTA 1X9SB 1PN9A 4XRAA 5ECOB 4PURA 3HVVA 3IK7A 4WBJA 2XBQA 3I6AA 5J3RA 4MMMA 1TK8B 4MK3A 1TXXA 1SD9A 2JSZA 1SENA 2H01A 2IMFA 5D73A 5DALB 5EPFA 1K0AA 2DMLA 10GSA 2EIRA 2O8VB 5IIZA 3Q19A 2L6CA 1O8XA 2H1GA 1FW1A 2R5GA 4WR5A 4EDZA 5CRGA 3IE3A 2GQKA 2LQOA 2DJ1A 4NPBA 5IPHA 3UVHA 1CQHA 3TGZA 3D6IA 4NHWA 2GQMA 1G6YA 3GL3A 2JZRA 1M0UA 5A5KA 2CX3A 2V2GA 3EU4A 3UL3A 4PUAA 4HJMA 3M9JA 4RI7A 2DMMA 4YQVA 4WKWA 2MMAA 3LXTA 1EEMA 2OADA 3KMOA 3LGCA 5IMAA 2X99A 2GDRA 3PINA 4FYUA 5ELGA 4YQMA 3VWVA 1TOFA 1WOUA 3EMXA 4ZBAA 5J9BA 20GSA 4J57E 5D9WA 1TK5B 5ECPB 3L4NA 2HRNA 5AGYA 2FWEA 1B4PA 4TN8A 2VLVA 6GSWA 1M2BA 2YPMA 4MLYA 1S3AA 1GSUA 1TRWA 2TRXA 1TJDA 2LV3A 1PGTA 4K9ZA 4MA9A 1O73A 1BEDA 2F3MA 6GSTA 1HQOA 3M1GA 1TP9A 3TUEA 5IMDA 2B5YA 3G7IA 2OA7A 2WRTA 3ZIJA 1H4OA 2B3SA 1RK4A 5DDLA 4D73A 5G30A 3CRUA 1PSQA 2RM6A 3Q18A 4ISDA 4LL4B 2GQLA 3KXOA 3ZFBA 1B48A 4L5LA 2DJ3A 1V40A 3BBYA 4GSSA 4NMUA 1QMVA 3TKSA 2DIZA 3QAVA 3SBCA 3L0HA 3PH9A 4PNGA 4HU7A 5DCGA 1T8EB 4K0GA 4N30A 2OBKA 2ZNMA 4MF5A 3IA1A 2ZUPA 1XWCA 5J4UA 3FZ9A 2DSAA 3QDNA 3VI7A 3JCML 3GH6A 3H8QA 1AQVA 1ON4A 3F9UA 1K0DA 1QQ2A 1M2AA 3FKFA 3WYWA 3US3A 2C0DA 4EUYA 4JR6A 4G19A 2E2GA 5B7CA 3FR6A 1M9BA 5E4WA 4PUFC 3D22A 1R26A 2I1UA 3KD0A 2DJJA 2H1DA 3GTUB 5ECIB 5JCUA 1XPVA 3GA4A 1S3DA 3RHBA 4F0CA 3LQ7A 2O87A 4NV5A 1GNWA 4KB3A 4O92A 3TOTA 4TVEA 3DMLA 2IWTA 5B6NA 3IPZA 4V1Ag 2CAQA 2YWOA 4J2FA 1NHOA 2RUEA 3VI5A 3VLNA 3U5RE 2JACA 3GRXA 1YDKA 4TR4A 4XIHA 3APQA 2WDUA 2B7KA 3F4SA 3VPTA 1Q98A 2MMNA 2R3XA 4XTSA 5D8IA 3L9VA 1RQMA 4EKZA 1QXHA 2L4QA 2K8SA 5EY6A 5J5NA 1FG4A 4O5RA 3HA9A 2PGTA 3P8WA 2R2JA 1THXA 3IR4A 1Z6NA 3TKQA 1A23A 2M46A 3TJKA 2VD0A 3FZ4A 2PU9C 2E2MA 2L57A 2FA8A 2IFQB 4V2MA 1PMTA 1JZOA 4ZBDA 2VLTA 2JZTA 4TR0A 2P0GA 1EZKA 1VF1A 2V41A 2IPAA 3GKXA 2IL3A 1JFUA 4AJ6A 4Z7XA 2VAFA 2YNXA 2C3QA 1SYXA 4IJIA 4MJAA 3UIWA 4POKA 4BL7A 2FY6A 4FYBA 2L5OA 4NHZA 4DSRA 4YAVA 3LWAA 4HU9A 2FD3A 1G7EA 2V6OA 5IMVA 5A4WA 2HZFA 1K0CA 1VRSD 3UBLA 1JZRA 3D21A 4KE3A 4OFTA 1EV9A 2XPEA 2C0GA 4IS0A 3MNGA 4GCIA 1AQWA 2R37A 1ZMAA 1SD8A 1G7OA 2OE0A 3HJPA 4BA7A 1W4VA 3ERGA 4Q5QA 1FVJA 4V2NA 2B1KA 1FB6A 1GSEA 4HZ4A 1GSDA 3LEFA 1T00A 2H6ZA 4G10A 4TXOB 2WJUA 2IMDA 1SK0A 1M7TA 3TRXA 2QSIA 1JHBA 4TXVA 3BJ5A 4IN0A 1J08A 1OYJA 2WZ9A 2YJ7A 2DIYA 4XCSA 5HR2A 4YH2A 3CBUA 2X8CA 4IP1A 4EF0A 4F03A 1SL0B 2CAIA 3C1RA 4H86A 1MD4A 2CT6A 3DD3A 1XIYA 3D4MA 3HHVA 4I5QA 3Q74A 2VOCA 3GV1A 1ILOA 5LD0A 1MEKA 3F4RA 2K18A 1V2AA 1N2AA 1OC9B 2F8AA 5A4UA 2P5RA 3ZVJA 3OR5A 3N5OA 1LJRA 2RLIA 1K0NA 2X8HA 1YF1A 3QPMA 3TKPA 1Z5YE 2VCWA 1V98A 3UVTA 4XRDA 2NPBA 5ECMB 3M0FA 1PX7A 3C1SA 1YF0A 1M99A 2C1YA 2V32A 2LUSA 3W8SA 4POLA 3AY8A 3KH9A 5HFIA 3NZNA 3GURA 4PQHA 4ECCA 1GNEA 5EVOA 1ACVA 2PPTA 1MTCA 2LEGA 5DBQA 2FWHA 3HCZA 5HFGA 2AB6A 3LXZA 5F07A 1YQ1A 4I2UA 2I81A 5KEJA 2P5QA 3VPQA 1SK1A 2P31A 4L8EA 4LMWA 4I97A 5ELAA 4IQ1A 2HYXA 1USBA 2B7JA 2C3NA 1WMJA 2AUVA 2TIRA 5AISA 3ME7A 5GZZB 2H74A 2L5LA 3W8JA 1GLQA 3ERFA 3G7JA 12GSA 3GN3A 3R2QA 2FGXA 3UBKA 1ZL9A 4F82A 2V1MA 3HVXA 3D4TA 3H4KA 2LKUA 1YEPA 1XWAA 5ID2A 3IDVA 1PL1A 3VK9A 5CRWA 3RAZA 4FYCA 4XS6A 3BOAA 4X1UA 6GSXA 3IAS2 2B5XA 2H66A 5DVBA 5IMFA 5AIVA 5EL8A 5CP1A 3EYTA 1J9BA 1DSBA 1BAYA 5IMZA 1JLWA 3UAPA 2WULA 3EVIA 2CVBA 4KDUA 5D9TA 5LNKe 1A2JA 3D0ZA 4BVYA 5D93A 4WETA 1O6JA 2HZEA 2X8GA 4AF2A 1Z6MA 3LG6A 3ZZXA 4ZB8A 3ERWA 4ZIJA 2YV9A 4NAXA 3Q6OA 1S3CA 3EURA 4G9HA 3ZIVA 5ECQB 3RPNA 3KIJA 4XHMA 3NOFA 2A2RA 3APOA 5J9CA 3BD2A 3KTLA 3TJBA 4OD7A 2JU5A 4HQSA 4EXJA 2JZSA 2M72A 3PR8A 2ES7A 3H79A 2HE3A 4K8MA 1EGOA 4TOPA 1OKTA 5ENUA
chains in the Genus database with same CATH superfamily
1ZZYA 1ABAA 3UARA 1GUMA 1EP8A 4PXOA 4RQRA 4K2DA 3FRCA 3O3TA 1DE1A 17GSA 2JSYA 4MP4A 3R3EA 2JADA 1URMA 4PX1A 4K5SA 3HKRA 4TR1B 3HDCA 4GRFA 1YKAA 1UN2A 2YZHA 2J9HA 1DE2A 1TRVA 5IO0A 4EDYA 1E2YA 1QUWA 2GSTA 3WGXA 1R7HA 2YOIA 3C71A 2WFCA 1ZYPA 1M3JA 1ERTA 14GSA 4IP6A 4K2XA 4ICYA 2CVKA 4E8HA 1R4WA 4IW9A 3ZITA 2LNTA 1V57A 3A2WA 1MD3A 5H5QA 1DBYA 1DUGA 3VURA 2IN3A 3KEBA 1B9XC 4KX4A 4YQUA 2N5FA 1F2EA 2H73A 5DCHA 1KBNA 3DXBA 1M9AA 4NXIA 3DEXA 3CXGA 3MSZA 3ZREA 5C04A 4I6XA 1TDIA 19GSA 2YN1A 1GL8A 13GSA 1HNBA 3HY2A 4HUAA 2VCVA 1FOVA 9GSSA 1PL2A 1GRXA 4F9ZA 2C3TA 3CMIA 1A8YA 3BCKA 1JZDA 3RDWA 1SJIA 2KLXA 2LNSA 4IBPA 4F2IA 4ECBA 3A5IA 2GLRA 1H75A 2VL9A 1GULA 1XVQA 5IM9A 2IIYA 3E9JB 4N10A 3P90A 1AW9A 2YP6A 1F3BA 3GHAA 2HXKA 2VD1A 3RBTA 4RQXA 4CDOA 3LYKA 4N0VA 1GSQA 3CRTA 3CSIA 5KN0A 5H5SA 4DSSB 4IKHA 1THOA 3KGKA 3M3MA 2CV4A 3IRAA 2YANA 3A2VA 3F8UA 2F51A 3LSZA 4BVXA 1XW5A 5F05A 2I3YA 1T4YA 1F9MA 1TI1A 1ZYQB 3FZ5A 1OE7A 1TU8A 3KJYA 2R0CA 5D9VA 3A5WA 2DC5A 3EE2A 1U3IA 3I9V2 5CREA 4ZL9A 3IAM2 1ST9A 2F9SA 2KUCA 3F0IA 2R6KA 5DALA 4QL7A 1QGVA 4JU5A 2H6XA 3F63A 4G0LA 2MBSA 4GSNA 3SWLA 4OCEA 4QQ7A 3HJMA 4OMVA 3C73A 1R5AA 1XBSA 2B6MA 3FHKA 4TRXA 2OACA 3NIVA 5H5RA 1EOGA 4TKYA 4L0WA 3J7Yk 1WJKA 4OO4A 2H0HA 4KCEA 1X5EA 2BJXA 1VF2A 3ZVJD 1GSYA 2QA2A 3WD6A 1X9MB 1AQXA 3QAGA 2H30A 3GX8A 3UOMA 2DKIA 2OJLA 1OAZA 5IOXA 1QK8A 4KAEA 3HYPA 2K8VA 2VL2C 2AHEA 3KP8A 2QA1A 5FHIA 5ABRA 1FB0A 4K7OA 3A2XA 5A4VA 4OFMA 1T7PB 4POMA 2OE3A 4L5OA 4BIKA 2WS2A 3PGTA 4NV2A 4EE0A 5G1LA 1Z7RA 4HDEA 3UMAA 1B8XA 1HYUA 2BMXA 2GT5A 1SKSB 1FAAA 2E7PA 1KEBA 3APSA 5DJMA 3UEMA 2GT6A 2HSMA 1JZWA 3IOSA 3ZLPA 1GH2A 5AN1A 3K8NA 3ME8A 1U88A 5E59A 1HNAA 2I9HA 2AV4A 4WR4A 1PQNA 1AUCA 3CTFA 2ON7A 1SJ6A 2MYGA 1KTEA 1RW1A 4MH2A 1FOHA 4XS4B 3CYNA 3G7YA 2H71A 2WB9A 2H76A 4ZB9A 1X0RA 5F06A 1TKDB 3ED3A 1ERUA 3E0UA 1WWJA 1EOHA 5F8BA 5CO3A 2X4AA 4V1Ap 3VWUA 1K0OA 1GTBA 1W89A 4ACSA 1K3OA 1ZYEA 1SKWB 1IYHA 3FR9A 1V9WA 4EL1A 4KNDA 1VF4A 2IJYA 1SK2A 3TRPA 2FWGA 5HFKA 1GSSA 2HRAA 4WEYA 2GSSA 1KNGA 4FIWA 3TB2A 5ECHB 4AJ7A 3G9BA 1GUHA 4DVCA 4MCUA 2DBCA 3GUSA 5IOWA 4MPGA 4V2LA 3GTUA 1C72A 3F3QA 1EWXA 3TOUA 3CTGA 5CAXA 1I5GA 2WGRA 2X49A 2X64A 4MABA 4HOJA 3DYRA 2LRCA 3FYGA 3GFKA 5CYYA 3F6FA 4JBBA 4Z2TA 5JWOB 4FH8A 3EC3A 1MDKA 2CA8A 2GSRA 3IK9A 2WCIA 4MF7A 5D96A 4OCFA 4KDYA 3H93A 5AIXA 2HLSA 1OC3A 1G6WA 2YWNA 4ZL7A 4PQ1A 3TJJA 3IBHA 2GTUA 3DVXA 4IELA 2H19A 2NTOA 4IHUA 3QR6A 1HNCA 2H1AA 11GSA 1XVWA 5GAPD 2G0FA 2IFQA 3QD9A 5JCGA 4ILFA 2KOKA 1T1VA 1WPIA 4Q5FA 1VF3A 3KMNA 3WT2A 5B8BA 2Z9SA 4IGJA 2R0GA 1ZYNA 5IPGA 2V6KA 4YAPA 2DJ0A 3A3TA 2H0GA 2MBTA 2FCHA 5G2ZA 3CSJA 1XZOA 1XOBA 3GSSA 2VCXA 1GUKA 4GF0A 1Q4JA 4I2TA 2PVQA 2VLUA 1X5CA 1XW6A 4N0ZA 4RUVA 2VIMA 1AIUA 4F0BA 2YZUA 2TRCP 3HZ4A 4WXTA 3MWHA 1FVKA 2GGTA 3EU3A 3IV4A 1XWBA 3I43A 4MZWA 5L71A 1XWKA 3KZQA 3VWXA 1LBKA 3TRQA 1N8JA 3V1WA 2IMKA 2LQQA 2VM1A 4K6XA 1T3BA 4ULXA 2H0IA 3FZAA 4ZILA 5JWRB 2FHEA 3F3RA 3ZYWA 3QAWA 4TXOA 5F0GA 2H70A 2LS5A 3TJFA 3E3EA 2RUFA 1PRXA 3TKSC 1YKCA 4IQAA 5IO2A 4XS1A 2HRFA 1UA5A 3HXSA 2PWJA 4WBRD 4ECJA 1PKWA 4GWRA 4ZB6A 1TRSA 3DIEA 1SKRB 4WF5A 1HD2A 4ID0A 1ERWA 4K7IA 2L4CA 4O7HA 8GSSA 1ZGNA 4KH7A 2L59A 1FO5A 2K9FA 1CQGA 4ZXGA 1SL2B 1OC9A 5GSSA 2UZ8A 2EIQA 4MF6A 2H75A 4PGTA 5IQYA 3EPTA 4HSCX 1GTAA 4ECIA 4MJEA 3ISOA 1SU9A 3VWWA 3QFBC 18GSA 1TRUA 2YCDA 1BX9A 1YEXA 1U6TA 5DQSA 1R5PA 1B4QA 2YWMA 5B8AA 3GKNA 2YV7A 2HNLA 4G2EA 3HZ8A 4K0NA 3O6TA 4TW5A 5COHA 16GSA 1E6BA 3TDGA 5INYA 1GTIA 2A2SA 1ZCPA 3GKMA 4EO3A 2LRTA 2CZ3A 2VCQA 4JRRA 1OVNA 2NBSA 1SL1B 4PTSA 3DGQA 4JZQA 5FT3A 4KA0A 1XWGA 3UJ1A 5ECKB 1K0MA 1VGLA 2D2ZA 5KN1A 4KGIA 1OC8A 4DEJA 5J41A 4O32A 1LU4A 5G1KA 5HR3A 3F4TA 1UVZA 4POBA 3DVWA 2AAWA 1NHYA 4IVFA 4RI6A 3U6VA 2KHPA 3MDKA 3HJOA 1Y25A 5GAND 5DQYA 2MMOA 3L9UA 4AJ8A 2C0EA 1A2LA 2LSTA 3TCOA 4L0UA 4DSQA 5BMUA 3FEUA 2KP2A 2DJ2A 3HVSA 3S9FA 3DWVA 4OWYA 1Z3EA 2AYTA 1T4ZA 3CQFA 1XOAA 1F6MC 6GSYA 2MMZA 2KP1A 3QCPA 4JE1A 3N9JA 1WE0A 2MZCA 1K3LA 4LL1B 4HI7A 4KSMA 1EGRA 3TKRA 3ZMLA 3GSTA 1J0FA 5DAKB 3GH9A 5D9XA 1XCCA 2OBIA 2I4AA 5C00A 5HR1A 4ZL8A 4X4JA 2VO4A 1TK0B 5KOXA 3EINA 2FWFA 4Q5NA 4USSA 2C4JA 4FO5A 1EP7A 3IC4A 1BG5A 2XBIA 3ZMKA 3KH7A 2G2QA 5KOWA 4HZ2A 4O5QA 4LMVA 4YKGA 4HQZA 1BYEA 4K1FA 3LFLA 1O7UA 3WGDA 3M8NA 2B5EA 2M80A 1XG8A 1G0TA 3LYPA 3TJGA 2HSYA 4TR1A 1A24A 3RPPA 4MJCA 1TW9A 1WP0A 4GXZA 4WF4A 3FW2A 2PVOC 1PKZA 3WT1A 4HJ2A 4KW6A 2YJHA 3FR3A 2PMTA 1TTZA 4MDCA 3LJRA 4X0XA 2GZYA 4HEA2 5G31A 2REMA 2XPDA 1QFNA 2C0FA 2HI7A 3ZFLA 4KUNA 2NVLA 2L6DA 4LLRA 1MDJA 5JWQB 1PD21 3EWLA 1WRYA 1K3YA 1GP1A 2N5BA 2JL4A 2CX4A 5JCWA 5CRDA 1M2DA 1UC7A 4X43A 3D5JA 5DJLA 2AJQB 3HVNA 4P3YB 2N5AA 3GX0A 5ECRB 3BCIA 5ID2B 3RHCA 3QMXA 5G5FA 3CSHA 1ERVA 3DKSA 2LJAA 1EEJA 2A2PA 3ZL5A 2J23A 2ON5A 1FHEA 2FA4A 1V58A 3QOUA 5IMCA 1F3AA 3MAKA 3P2AA 5KN2A 3F6DA 2RIIA 3IHQA 3W6GA 1YZXA 4J56E 1XXUA 4HS1A 1A2MA 3GNJA 4BVYB 3DRNA 2HSHA 3LORA 2HZEB 2IMEA 1SJZA 2A4HA 1JLVA 1GTUA 5ECLB 1IYIA 1TI3A 2IMIA 4BWQA 4DSSA 2E0QA 4N11A 5B6MA 2YWIA 4GSTA 3VFIA 22GSA 2EIOA 1OKDA 6GSUA 2H6YA 1PN0A 4G0KA 2VUPA 3L78A 1GWCA 2FNOA 3GYKA 4EVMA 4BWSA 1O85A 5KN3A 3I69A 5CNWA 1GSFA 3GKKA 2H8LA 2GVPA 4I8BA 3KCMA 2FUG2 1Z9HA 4MZBA 5LCZA 5DAKA 2CQ9A 2VCTA 2PN8A 2O89A 2GSQA 2VL2A 4KSOA 5FWGA 2F8FA 1AC1A 3FY7A 4QL9A 2QKEA 3EMPA 2K6VA 3ZRDA 3TKSE 1ZOFA 1NW2A 1TU7A 3KP9A 5GSTA 1X9WB 5ECSA 3KM6A 1I9DA 1A0FA 2QC7A 1F37A 4JEDA 1AXDA 4ML1A 1Y6EA 1A8LA 3ZTLA 3P7XA 4PQIA 2BTOT 1O8WA 4KDXA 3C8EA 2EC4A 1OE8A 2LJKA 4JR4A 4MH3A 1B9YC 3PPUA 4GQCA 4Q5RA 2GS3A 4MJBA 2HFDA 2FLSA 2PERA 4OO5A 4GQFA 4LA1A 1X5DA 1GLPA 2GZZA 2H72A 3IXRA 1K0BA 1XW9A 2C80A 3HD5A 2VCZA 4PNFA 3M9KA 4OFNA 1A0RP 1AAZA 4EC0A 4D73B 2PUKC 1U87A 3WGEA 4MZCA 1BJXA 5ECNB 1Z7PA 1ML6A 3KTBA 2XHFA 2LJRA 4CW9A 3J7Yb 2OE1A 5G5EA 3L9SA 2OKAA 1NM3A 2O7KA 1WIKA 2C8UA 1YJ6A 2LRNA 1BQ7A 4GLTA 6GSVA 7GSSA 1O81A 2O85A 2LTKA 3GL5A 3IHGA 4YKFA 2H1BA 1SYRA 1YY7A 2A4VA 4IJ3A 2PBJA 2ALBA 4TR3A 4ZBBA 1NSWA 2R4VA 4ML6A 4AGSA 4K7NA 4XS4A 2CZ2A 2QGVA 3H1NA 2HT9A 3GIXA 3QFAC 1MDIA 4CHSA 1XFLA 2DJKA 5HQPA 4MPFA 6GSSA 4NWYA 4KCAA 1PA3A 4E8EA 3FK8A 3GMFA 1U3AA 2XC2A 2B1LA 2VM2A 1EV4A 2VL3A 2NDOA 4GTUA 2DLXA 3O76A 2GZPA 2CVDA 5CRHA 4BPYA 4BVXB 3C7MA 2RM5A 1PX6A 5HR0A 2ZCTA 1X9SB 1PN9A 4XRAA 5ECOB 4PURA 3HVVA 3IK7A 1S3RA 4WBJA 2XBQA 3I6AA 5J3RA 4MMMA 1TK8B 4MK3A 1TXXA 1SD9A 2JSZA 1SENA 2H01A 2IMFA 5D73A 5DALB 5EPFA 1K0AA 2DMLA 10GSA 2EIRA 2O8VB 5IIZA 3Q19A 2L6CA 1O8XA 2H1GA 1FW1A 2R5GA 4WR5A 4EDZA 5CRGA 3IE3A 2GQKA 2LQOA 2DJ1A 4NPBA 5IPHA 3UVHA 1CQHA 3TGZA 3D6IA 4NHWA 3MYDA 2GQMA 1G6YA 3GL3A 2JZRA 1M0UA 5A5KA 2CX3A 4KF9A 2V2GA 3EU4A 3UL3A 4PUAA 4HJMA 3M9JA 4RI7A 2DMMA 4YQVA 4WKWA 2MMAA 3LXTA 1EEMA 2OADA 3KMOA 3LGCA 5IMAA 2X99A 2GDRA 3PINA 4FYUA 5ELGA 4YQMA 3VWVA 1TOFA 1WOUA 3EMXA 4ZBAA 5J9BA 20GSA 3FMWA 4J57E 5D9WA 1TK5B 5ECPB 3L4NA 2HRNA 5AGYA 2FWEA 1B4PA 4TN8A 2VLVA 6GSWA 1M2BA 2YPMA 4MLYA 1S3AA 1GSUA 1TRWA 4BL7B 2TRXA 3IC8A 1TJDA 2LV3A 1PGTA 4K9ZA 4MA9A 1O73A 1BEDA 2F3MA 6GSTA 1HQOA 3M1GA 1TP9A 3TUEA 5IMDA 2B5YA 3G7IA 2OA7A 2WRTA 3ZIJA 1H4OA 2B3SA 1RK4A 5DDLA 4D73A 5G30A 3CRUA 1PSQA 2RM6A 3Q18A 4ISDA 4LL4B 2GQLA 3KXOA 3ZFBA 1B48A 4L5LA 2DJ3A 1V40A 3BBYA 4GSSA 4NMUA 1QMVA 3TKSA 2DIZA 3QAVA 3SBCA 3L0HA 3PH9A 4PNGA 4HU7A 5DCGA 1T8EB 4K0GA 4N30A 4EIQA 2OBKA 2ZNMA 4MF5A 3IA1A 2ZUPA 1XWCA 5J4UA 3FZ9A 2DSAA 3QDNA 3VI7A 3JCML 3GH6A 3H8QA 1AQVA 1ON4A 3F9UA 1K0DA 1QQ2A 1M2AA 3FKFA 3WYWA 3US3A 2C0DA 4EUYA 4JR6A 4G19A 2E2GA 5B7CA 3FR6A 1M9BA 5E4WA 4PUFC 3D22A 1R26A 2I1UA 3KD0A 2DJJA 2H1DA 3GTUB 5ECIB 5JCUA 1XPVA 3GA4A 1S3DA 3RHBA 4F0CA 3LQ7A 2O87A 4NV5A 1GNWA 4KB3A 4O92A 3TOTA 4TVEA 3DMLA 2IWTA 5B6NA 3IPZA 4V1Ag 2CAQA 2YWOA 4J2FA 1NHOA 2RUEA 3VI5A 3VLNA 3U5RE 2JACA 3GRXA 1YDKA 4TR4A 4XIHA 3APQA 2WDUA 2B7KA 3F4SA 4O5UA 3VPTA 1Q98A 2MMNA 2R3XA 4XTSA 5D8IA 3L9VA 1RQMA 4EKZA 1QXHA 2L4QA 2K8SA 5EY6A 5J5NA 1FG4A 4O5RA 3HA9A 2PGTA 3P8WA 2R2JA 1THXA 3IR4A 1Z6NA 3TKQA 1A23A 2M46A 3TJKA 2VD0A 3FZ4A 2PU9C 2E2MA 2L57A 2FA8A 2IFQB 4V2MA 4MNNA 1PMTA 1JZOA 4ZBDA 2VLTA 2JZTA 4TR0A 2P0GA 1EZKA 1VF1A 2V41A 2IPAA 3GKXA 2IL3A 1JFUA 4AJ6A 4Z7XA 2VAFA 2YNXA 2C3QA 1SYXA 4IJIA 4MJAA 3UIWA 4POKA 4BL7A 2FY6A 4FYBA 2L5OA 4NHZA 4DSRA 4YAVA 3LWAA 4HU9A 2FD3A 1G7EA 2V6OA 5IMVA 5A4WA 2HZFA 1K0CA 2HRKA 1VRSD 3UBLA 1JZRA 3D21A 4KE3A 4OFTA 1EV9A 2XPEA 2C0GA 4IS0A 3MNGA 4G0IA 4GCIA 1AQWA 2R37A 1ZMAA 1SD8A 1G7OA 2OE0A 4K5RA 3HJPA 4BA7A 1PFOA 1W4VA 3ERGA 4Q5QA 4Z2RA 1FVJA 4V2NA 2B1KA 1FB6A 1GSEA 4HZ4A 1GSDA 3LEFA 1T00A 2H6ZA 4CY8A 4G10A 4TXOB 2WJUA 2IMDA 1SK0A 1M7TA 3TRXA 2QSIA 1JHBA 4TXVA 3BJ5A 4IN0A 1J08A 1OYJA 2WZ9A 2YJ7A 2DIYA 4XCSA 5HR2A 4YH2A 3CBUA 2X8CA 4IP1A 4EF0A 4F03A 1SL0B 2CAIA 3C1RA 4H86A 1MD4A 2CT6A 3DD3A 1XIYA 3D4MA 3HHVA 4I5QA 3Q74A 2VOCA 3GV1A 2DKHA 1ILOA 5LD0A 4EIPA 1MEKA 3F4RA 2K18A 1V2AA 1N2AA 1OC9B 2F8AA 5A4UA 2P5RA 3ZVJA 4CY6A 3OR5A 3N5OA 1LJRA 2RLIA 1K0NA 2X8HA 1YF1A 3QPMA 3TKPA 1Z5YE 2VCWA 1V98A 3UVTA 4XRDA 2NPBA 5ECMB 3M0FA 1PX7A 3C1SA 1YF0A 1M99A 2C1YA 2V32A 2LUSA 3W8SA 4POLA 3AY8A 3KH9A 5HFIA 3NZNA 3GURA 4PQHA 4ECCA 1GNEA 5EVOA 1ACVA 2PPTA 1MTCA 2LEGA 5DBQA 2FWHA 3HCZA 5HFGA 2AB6A 3LXZA 5F07A 1YQ1A 4I2UA 2I81A 5KEJA 2P5QA 3VPQA 1SK1A 2P31A 4L8EA 4LMWA 4I97A 5ELAA 4IQ1A 2HYXA 1USBA 2B7JA 2C3NA 1WMJA 2AUVA 2TIRA 5AISA 3ME7A 5GZZB 2H74A 2L5LA 3W8JA 1GLQA 3ERFA 3G7JA 12GSA 3GN3A 3R2QA 2FGXA 3UBKA 1ZL9A 4F82A 2V1MA 1M3IA 3HVXA 3D4TA 3H4KA 2LKUA 1YEPA 1XWAA 5ID2A 3IDVA 1PL1A 3VK9A 5CRWA 3RAZA 4FYCA 4XS6A 3BOAA 4X1UA 6GSXA 2R0PA 3IAS2 2B5XA 2H66A 5DVBA 5IMFA 5AIVA 5EL8A 5CP1A 3EYTA 1J9BA 1DSBA 1BAYA 5IMZA 4FQUA 1JLWA 3UAPA 2WULA 3EVIA 2CVBA 4KDUA 5D9TA 5LNKe 1A2JA 3D0ZA 4BVYA 5D93A 4WETA 1O6JA 2HZEA 2X8GA 4AF2A 1Z6MA 3LG6A 3ZZXA 4ZB8A 3ERWA 4ZIJA 2YV9A 4NAXA 3Q6OA 3MIXA 1S3CA 3EURA 4G9HA 3ZIVA 5ECQB 3RPNA 4A5PA 3KIJA 4XHMA 3NOFA 2A2RA 3APOA 5J9CA 3BD2A 3KTLA 3TJBA 4OD7A 2JU5A 4HQSA 4EXJA 2JZSA 2M72A 3PR8A 2ES7A 3H79A 3LW9A 2HE3A 4Z2UA 4K8MA 1EGOA 4TOPA 1OKTA 5BRTA 5ENUA
chains in the Genus database with same CATH topology
1ZZYA 1ABAA 3UARA 1GUMA 1EP8A 4PXOA 4RQRA 4K2DA 3FRCA 3O3TA 1DE1A 17GSA 2JSYA 4MP4A 3R3EA 2JADA 1URMA 4PX1A 4K5SA 3HKRA 4TR1B 3HDCA 4GRFA 1YKAA 1UN2A 2YZHA 2J9HA 1DE2A 1TRVA 5IO0A 4EDYA 1E2YA 1QUWA 2GSTA 3WGXA 1R7HA 2YOIA 3C71A 2WFCA 1ZYPA 1ERTA 14GSA 4IP6A 4K2XA 4ICYA 2CVKA 4E8HA 1R4WA 4IW9A 3ZITA 2LNTA 1V57A 3A2WA 1MD3A 5H5QA 1DBYA 1DUGA 3VURA 2IN3A 3KEBA 1B9XC 4KX4A 4YQUA 2N5FA 1F2EA 2H73A 5DCHA 1KBNA 3DXBA 1M9AA 4NXIA 3DEXA 3CXGA 3MSZA 3ZREA 5C04A 4I6XA 1TDIA 19GSA 2YN1A 1GL8A 13GSA 1HNBA 3HY2A 4HUAA 2VCVA 1FOVA 9GSSA 1PL2A 1GRXA 4F9ZA 2C3TA 3CMIA 1A8YA 3BCKA 1JZDA 3RDWA 1SJIA 2KLXA 2LNSA 4IBPA 4F2IA 4ECBA 3A5IA 2GLRA 1H75A 2VL9A 1GULA 1XVQA 5IM9A 2IIYA 3E9JB 4N10A 3P90A 1AW9A 2YP6A 1F3BA 3GHAA 2HXKA 2VD1A 3RBTA 4RQXA 4CDOA 3LYKA 4N0VA 1GSQA 3CRTA 3CSIA 5KN0A 5H5SA 4DSSB 4IKHA 1THOA 3KGKA 3M3MA 2CV4A 3IRAA 2YANA 3A2VA 3F8UA 2F51A 3LSZA 4BVXA 1XW5A 5F05A 2I3YA 1T4YA 1F9MA 1TI1A 1ZYQB 3FZ5A 1OE7A 1TU8A 3KJYA 2R0CA 5D9VA 3A5WA 2DC5A 3EE2A 1U3IA 3I9V2 5CREA 4ZL9A 3IAM2 1ST9A 2F9SA 2KUCA 3F0IA 2R6KA 5DALA 4QL7A 1QGVA 4JU5A 2H6XA 3F63A 4G0LA 2MBSA 4GSNA 3SWLA 4OCEA 4QQ7A 3HJMA 4OMVA 3C73A 1R5AA 1XBSA 2B6MA 3FHKA 4TRXA 2OACA 3NIVA 5H5RA 1EOGA 4TKYA 4L0WA 3J7Yk 1WJKA 4OO4A 2H0HA 4KCEA 1X5EA 2BJXA 1VF2A 3ZVJD 1GSYA 2QA2A 3WD6A 1X9MB 1AQXA 3QAGA 2H30A 3GX8A 3UOMA 2DKIA 2OJLA 1OAZA 5IOXA 1QK8A 4KAEA 3HYPA 2K8VA 2VL2C 2AHEA 3KP8A 2QA1A 5FHIA 5ABRA 1FB0A 4K7OA 3A2XA 5A4VA 4OFMA 1T7PB 4POMA 2OE3A 4L5OA 2WS2A 3PGTA 4NV2A 4EE0A 5G1LA 1Z7RA 4HDEA 3UMAA 1B8XA 1HYUA 2BMXA 2GT5A 1SKSB 1FAAA 2E7PA 1KEBA 3APSA 5DJMA 3UEMA 2GT6A 2HSMA 1JZWA 3IOSA 3ZLPA 1GH2A 5AN1A 3K8NA 3ME8A 1U88A 5E59A 1HNAA 2I9HA 2AV4A 4WR4A 1PQNA 1AUCA 3CTFA 2ON7A 1SJ6A 2MYGA 1KTEA 1RW1A 4MH2A 1FOHA 4XS4B 3CYNA 3G7YA 2H71A 2WB9A 2H76A 4ZB9A 1X0RA 5F06A 1TKDB 3ED3A 1ERUA 3E0UA 1WWJA 1EOHA 5F8BA 5CO3A 2X4AA 4V1Ap 3VWUA 1K0OA 1GTBA 1W89A 4ACSA 1K3OA 1ZYEA 1SKWB 1IYHA 3FR9A 1V9WA 4EL1A 4KNDA 1VF4A 2IJYA 1SK2A 3TRPA 2FWGA 5HFKA 1GSSA 2HRAA 4WEYA 2GSSA 1KNGA 4FIWA 3TB2A 5ECHB 4AJ7A 3G9BA 1GUHA 4DVCA 4MCUA 2DBCA 3GUSA 5IOWA 4MPGA 4V2LA 3GTUA 1C72A 3F3QA 1EWXA 3TOUA 3CTGA 5CAXA 1I5GA 2WGRA 2X49A 2X64A 4MABA 4HOJA 3DYRA 2LRCA 3FYGA 3GFKA 5CYYA 3F6FA 4JBBA 4Z2TA 5JWOB 4FH8A 3EC3A 1MDKA 2CA8A 2GSRA 3IK9A 2WCIA 4MF7A 5D96A 4OCFA 4KDYA 3H93A 5AIXA 2HLSA 1OC3A 1G6WA 2YWNA 4ZL7A 4PQ1A 3TJJA 3IBHA 2GTUA 3DVXA 4IELA 2H19A 2NTOA 4IHUA 3QR6A 1HNCA 2H1AA 11GSA 1XVWA 5GAPD 2G0FA 2IFQA 3QD9A 5JCGA 4ILFA 2KOKA 1T1VA 1WPIA 4Q5FA 1VF3A 3KMNA 3WT2A 5B8BA 2Z9SA 4IGJA 2R0GA 1ZYNA 5IPGA 2V6KA 4YAPA 2DJ0A 3A3TA 2H0GA 2MBTA 2FCHA 5G2ZA 3CSJA 1XZOA 1XOBA 3GSSA 2VCXA 1GUKA 4GF0A 1Q4JA 4I2TA 2PVQA 2VLUA 1X5CA 1XW6A 4N0ZA 4RUVA 2VIMA 1AIUA 4F0BA 2YZUA 2TRCP 3HZ4A 4WXTA 3MWHA 1FVKA 2GGTA 3EU3A 3IV4A 1XWBA 3I43A 4MZWA 5L71A 1XWKA 3KZQA 3VWXA 1LBKA 3TRQA 1N8JA 3V1WA 2IMKA 2LQQA 2VM1A 4K6XA 1T3BA 4ULXA 2H0IA 3FZAA 4ZILA 5JWRB 2FHEA 3F3RA 3ZYWA 3QAWA 4TXOA 5F0GA 2H70A 2LS5A 3TJFA 3E3EA 2RUFA 1PRXA 3TKSC 1YKCA 4IQAA 5IO2A 4XS1A 2HRFA 1UA5A 3HXSA 2PWJA 4WBRD 4ECJA 1PKWA 4GWRA 4ZB6A 1TRSA 3DIEA 1SKRB 4WF5A 1HD2A 4ID0A 1ERWA 4K7IA 2L4CA 4O7HA 8GSSA 1ZGNA 4KH7A 2L59A 1FO5A 2K9FA 1CQGA 4ZXGA 1SL2B 1OC9A 5GSSA 2UZ8A 2EIQA 4MF6A 2H75A 4PGTA 5IQYA 3EPTA 1GTAA 4ECIA 4MJEA 3ISOA 1SU9A 3VWWA 3QFBC 18GSA 1TRUA 2YCDA 1BX9A 1YEXA 1U6TA 5DQSA 1R5PA 1B4QA 2YWMA 5B8AA 3GKNA 2YV7A 2HNLA 4G2EA 3HZ8A 4K0NA 3O6TA 4TW5A 5COHA 16GSA 1E6BA 3TDGA 5INYA 1GTIA 2A2SA 1ZCPA 3GKMA 4EO3A 2LRTA 2CZ3A 2VCQA 4JRRA 1OVNA 2NBSA 1SL1B 4PTSA 3DGQA 4JZQA 5FT3A 4KA0A 1XWGA 3UJ1A 5ECKB 1K0MA 1VGLA 2D2ZA 5KN1A 4KGIA 1OC8A 4DEJA 5J41A 4O32A 1LU4A 5G1KA 5HR3A 3F4TA 1UVZA 4POBA 3DVWA 2AAWA 1NHYA 4IVFA 4RI6A 3U6VA 2KHPA 3MDKA 3HJOA 1Y25A 5GAND 5DQYA 2MMOA 3L9UA 4AJ8A 2C0EA 1A2LA 2LSTA 3TCOA 4L0UA 4DSQA 5BMUA 3FEUA 2KP2A 2DJ2A 3HVSA 3S9FA 3DWVA 4OWYA 1Z3EA 2AYTA 1T4ZA 1XOAA 1F6MC 6GSYA 2MMZA 2KP1A 3QCPA 4JE1A 3N9JA 1WE0A 2MZCA 1K3LA 4LL1B 4HI7A 4KSMA 1EGRA 3TKRA 3ZMLA 3GSTA 1J0FA 5DAKB 3GH9A 5D9XA 1XCCA 2OBIA 2I4AA 5C00A 5HR1A 4ZL8A 4X4JA 2VO4A 1TK0B 5KOXA 3EINA 2FWFA 4Q5NA 4USSA 2C4JA 4FO5A 1EP7A 3IC4A 1BG5A 2XBIA 3ZMKA 3KH7A 2G2QA 5KOWA 4HZ2A 4O5QA 4LMVA 4YKGA 4HQZA 1BYEA 4K1FA 3LFLA 1O7UA 3WGDA 3M8NA 2B5EA 2M80A 1G0TA 3LYPA 3TJGA 2HSYA 4TR1A 1A24A 3RPPA 4MJCA 1TW9A 1WP0A 4GXZA 4WF4A 3FW2A 2PVOC 1PKZA 3WT1A 4HJ2A 4KW6A 2YJHA 3FR3A 2PMTA 1TTZA 4MDCA 3LJRA 4X0XA 2GZYA 4HEA2 5G31A 2REMA 2XPDA 1QFNA 2C0FA 2HI7A 3ZFLA 4KUNA 2NVLA 2L6DA 4LLRA 1MDJA 5JWQB 1PD21 3EWLA 1WRYA 1K3YA 1GP1A 2N5BA 2JL4A 2CX4A 5JCWA 5CRDA 1M2DA 1UC7A 4X43A 3D5JA 5DJLA 2AJQB 4P3YB 2N5AA 3GX0A 5ECRB 3BCIA 5ID2B 3RHCA 3QMXA 5G5FA 3CSHA 1ERVA 3DKSA 2LJAA 1EEJA 2A2PA 3ZL5A 2J23A 2ON5A 1FHEA 2FA4A 1V58A 3QOUA 5IMCA 1F3AA 3MAKA 3P2AA 5KN2A 3F6DA 2RIIA 3IHQA 3W6GA 1YZXA 4J56E 1XXUA 4HS1A 1A2MA 3GNJA 4BVYB 3DRNA 2HSHA 3LORA 2HZEB 2IMEA 1SJZA 2A4HA 1JLVA 1GTUA 5ECLB 1IYIA 1TI3A 2IMIA 4BWQA 4DSSA 2E0QA 4N11A 5B6MA 2YWIA 4GSTA 3VFIA 22GSA 2EIOA 1OKDA 6GSUA 2H6YA 1PN0A 4G0KA 2VUPA 3L78A 1GWCA 2FNOA 3GYKA 4EVMA 4BWSA 1O85A 5KN3A 3I69A 5CNWA 1GSFA 3GKKA 2H8LA 2GVPA 4I8BA 3KCMA 2FUG2 1Z9HA 4MZBA 5LCZA 5DAKA 2CQ9A 2VCTA 2PN8A 2O89A 2GSQA 2VL2A 4KSOA 5FWGA 2F8FA 1AC1A 3FY7A 4QL9A 2QKEA 3EMPA 2K6VA 3ZRDA 3TKSE 1ZOFA 1NW2A 1TU7A 3KP9A 5GSTA 1X9WB 5ECSA 3KM6A 1I9DA 1A0FA 2QC7A 1F37A 4JEDA 1AXDA 4ML1A 1Y6EA 1A8LA 3ZTLA 3P7XA 4PQIA 2BTOT 1O8WA 4KDXA 3C8EA 2EC4A 1OE8A 2LJKA 4JR4A 4MH3A 1B9YC 3PPUA 4GQCA 4Q5RA 2GS3A 4MJBA 2HFDA 2FLSA 2PERA 4OO5A 4GQFA 4LA1A 1X5DA 1GLPA 2GZZA 2H72A 3IXRA 1K0BA 1XW9A 2C80A 3HD5A 2VCZA 4PNFA 3M9KA 4OFNA 1A0RP 1AAZA 4EC0A 4D73B 2PUKC 1U87A 3WGEA 4MZCA 1BJXA 5ECNB 1Z7PA 1ML6A 3KTBA 2XHFA 2LJRA 4CW9A 3J7Yb 2OE1A 5G5EA 3L9SA 2OKAA 1NM3A 2O7KA 1WIKA 2C8UA 1YJ6A 2LRNA 1BQ7A 4GLTA 6GSVA 7GSSA 1O81A 2O85A 2LTKA 3GL5A 3IHGA 4YKFA 2H1BA 1SYRA 1YY7A 2A4VA 4IJ3A 2PBJA 2ALBA 4TR3A 4ZBBA 1NSWA 2R4VA 4ML6A 4AGSA 4K7NA 4XS4A 2CZ2A 2QGVA 3H1NA 2HT9A 3GIXA 3QFAC 1MDIA 4CHSA 1XFLA 2DJKA 5HQPA 4MPFA 6GSSA 4NWYA 4KCAA 1PA3A 4E8EA 3FK8A 3GMFA 1U3AA 2XC2A 2B1LA 2VM2A 1EV4A 2VL3A 2NDOA 4GTUA 2DLXA 3O76A 2GZPA 2CVDA 5CRHA 4BPYA 4BVXB 3C7MA 2RM5A 1PX6A 5HR0A 2ZCTA 1X9SB 1PN9A 4XRAA 5ECOB 4PURA 3HVVA 3IK7A 4WBJA 2XBQA 3I6AA 5J3RA 4MMMA 1TK8B 4MK3A 1TXXA 1SD9A 2JSZA 1SENA 2H01A 2IMFA 5D73A 5DALB 5EPFA 1K0AA 2DMLA 10GSA 2EIRA 2O8VB 5IIZA 3Q19A 2L6CA 1O8XA 2H1GA 1FW1A 2R5GA 4WR5A 4EDZA 5CRGA 3IE3A 2GQKA 2LQOA 2DJ1A 4NPBA 5IPHA 3UVHA 1CQHA 3TGZA 3D6IA 4NHWA 3MYDA 2GQMA 1G6YA 3GL3A 2JZRA 1M0UA 5A5KA 2CX3A 4KF9A 2V2GA 3EU4A 3UL3A 4PUAA 4HJMA 3M9JA 4RI7A 2DMMA 4YQVA 4WKWA 2MMAA 3LXTA 1EEMA 2OADA 3KMOA 3LGCA 5IMAA 2X99A 2GDRA 3PINA 4FYUA 5ELGA 4YQMA 3VWVA 1TOFA 1WOUA 3EMXA 4ZBAA 5J9BA 20GSA 3FMWA 4J57E 5D9WA 1TK5B 5ECPB 3L4NA 2HRNA 5AGYA 2FWEA 1B4PA 4TN8A 2VLVA 6GSWA 1M2BA 2YPMA 4MLYA 1S3AA 1GSUA 1TRWA 4BL7B 2TRXA 3IC8A 1TJDA 2LV3A 1PGTA 4K9ZA 4MA9A 1O73A 1BEDA 2F3MA 6GSTA 1HQOA 3M1GA 1TP9A 3TUEA 5IMDA 2B5YA 3G7IA 2OA7A 2WRTA 3ZIJA 1H4OA 2B3SA 1RK4A 5DDLA 4D73A 5G30A 3CRUA 1PSQA 2RM6A 3Q18A 4ISDA 4LL4B 2GQLA 3KXOA 3ZFBA 1B48A 4L5LA 2DJ3A 1V40A 3BBYA 4GSSA 4NMUA 1QMVA 3TKSA 2DIZA 3QAVA 3SBCA 3L0HA 3PH9A 4PNGA 4HU7A 5DCGA 1T8EB 4K0GA 4N30A 4EIQA 2OBKA 2ZNMA 4MF5A 3IA1A 2ZUPA 1XWCA 5J4UA 3FZ9A 2DSAA 3QDNA 3VI7A 3JCML 3GH6A 3H8QA 1AQVA 1ON4A 3F9UA 1K0DA 1QQ2A 1M2AA 3FKFA 3WYWA 3US3A 2C0DA 4EUYA 4JR6A 4G19A 2E2GA 5B7CA 3FR6A 1M9BA 5E4WA 4PUFC 3D22A 1R26A 2I1UA 3KD0A 2DJJA 2H1DA 3GTUB 5ECIB 5JCUA 1XPVA 3GA4A 1S3DA 3RHBA 4F0CA 3LQ7A 2O87A 4NV5A 1GNWA 4KB3A 4O92A 3TOTA 4TVEA 3DMLA 2IWTA 5B6NA 3IPZA 4V1Ag 2CAQA 2YWOA 4J2FA 1NHOA 2RUEA 3VI5A 3VLNA 3U5RE 2JACA 3GRXA 1YDKA 4TR4A 4XIHA 3APQA 2WDUA 2B7KA 3F4SA 4O5UA 3VPTA 1Q98A 2MMNA 2R3XA 4XTSA 5D8IA 3L9VA 1RQMA 4EKZA 1QXHA 2L4QA 2K8SA 5EY6A 5J5NA 1FG4A 4O5RA 3HA9A 2PGTA 3P8WA 2R2JA 1THXA 3IR4A 1Z6NA 3TKQA 1A23A 2M46A 3TJKA 2VD0A 3FZ4A 2PU9C 2E2MA 2L57A 2FA8A 2IFQB 4V2MA 4MNNA 1PMTA 1JZOA 4ZBDA 2VLTA 2JZTA 4TR0A 2P0GA 1EZKA 1VF1A 2V41A 2IPAA 3GKXA 2IL3A 1JFUA 4AJ6A 4Z7XA 2VAFA 2YNXA 2C3QA 1SYXA 4IJIA 4MJAA 3UIWA 4POKA 4BL7A 2FY6A 4FYBA 2L5OA 4NHZA 4DSRA 4YAVA 3LWAA 4HU9A 2FD3A 1G7EA 2V6OA 5IMVA 5A4WA 2HZFA 1K0CA 2HRKA 1VRSD 3UBLA 1JZRA 3D21A 4KE3A 4OFTA 1EV9A 2XPEA 2C0GA 4IS0A 3MNGA 4G0IA 4GCIA 1AQWA 2R37A 1ZMAA 1SD8A 1G7OA 2OE0A 4K5RA 3HJPA 4BA7A 1W4VA 3ERGA 4Q5QA 4Z2RA 1FVJA 4V2NA 2B1KA 1FB6A 1GSEA 4HZ4A 1GSDA 3LEFA 1T00A 2H6ZA 4CY8A 4G10A 4TXOB 2WJUA 2IMDA 1SK0A 1M7TA 3TRXA 2QSIA 1JHBA 4TXVA 3BJ5A 4IN0A 1J08A 1OYJA 2WZ9A 2YJ7A 2DIYA 4XCSA 5HR2A 4YH2A 3CBUA 2X8CA 4IP1A 4EF0A 4F03A 1SL0B 2CAIA 3C1RA 4H86A 1MD4A 2CT6A 3DD3A 1XIYA 3D4MA 3HHVA 4I5QA 3Q74A 2VOCA 3GV1A 2DKHA 1ILOA 5LD0A 4EIPA 1MEKA 3F4RA 2K18A 1V2AA 1N2AA 1OC9B 2F8AA 5A4UA 2P5RA 3ZVJA 4CY6A 3OR5A 3N5OA 1LJRA 2RLIA 1K0NA 2X8HA 1YF1A 3QPMA 3TKPA 1Z5YE 2VCWA 1V98A 3UVTA 4XRDA 2NPBA 5ECMB 3M0FA 1PX7A 3C1SA 1YF0A 1M99A 2C1YA 2V32A 2LUSA 3W8SA 4POLA 3AY8A 3KH9A 5HFIA 3NZNA 3GURA 4PQHA 4ECCA 1GNEA 5EVOA 1ACVA 2PPTA 1MTCA 2LEGA 5DBQA 2FWHA 3HCZA 5HFGA 2AB6A 3LXZA 5F07A 1YQ1A 4I2UA 2I81A 5KEJA 2P5QA 3VPQA 1SK1A 2P31A 4L8EA 4LMWA 4I97A 5ELAA 4IQ1A 2HYXA 1USBA 2B7JA 2C3NA 1WMJA 2AUVA 2TIRA 5AISA 3ME7A 5GZZB 2H74A 2L5LA 3W8JA 1GLQA 3ERFA 3G7JA 12GSA 3GN3A 3R2QA 2FGXA 3UBKA 1ZL9A 4F82A 2V1MA 3HVXA 3D4TA 3H4KA 2LKUA 1YEPA 1XWAA 5ID2A 3IDVA 1PL1A 3VK9A 5CRWA 3RAZA 4FYCA 4XS6A 3BOAA 4X1UA 6GSXA 2R0PA 3IAS2 2B5XA 2H66A 5DVBA 5IMFA 5AIVA 5EL8A 5CP1A 3EYTA 1J9BA 1DSBA 1BAYA 5IMZA 4FQUA 1JLWA 3UAPA 2WULA 3EVIA 2CVBA 4KDUA 5D9TA 5LNKe 1A2JA 3D0ZA 4BVYA 5D93A 4WETA 1O6JA 2HZEA 2X8GA 4AF2A 1Z6MA 3LG6A 3ZZXA 4ZB8A 3ERWA 4ZIJA 2YV9A 4NAXA 3Q6OA 3MIXA 1S3CA 3EURA 4G9HA 3ZIVA 5ECQB 3RPNA 4A5PA 3KIJA 4XHMA 3NOFA 2A2RA 3APOA 5J9CA 3BD2A 3KTLA 3TJBA 4OD7A 2JU5A 4HQSA 4EXJA 2JZSA 2M72A 3PR8A 2ES7A 3H79A 3LW9A 2HE3A 4Z2UA 4K8MA 1EGOA 4TOPA 1OKTA 5BRTA 5ENUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZY A;  1ABA A;  3UAR A;  1GUM A;  1EP8 A;  4PXO A;  4RQR A;  4K2D A;  3FRC A;  3O3T A;  1DE1 A;  17GS A;  2JSY A;  4MP4 A;  2JAD A;  1URM A;  4PX1 A;  3HKR A;  4TR1 B;  3HDC A;  4GRF A;  1YKA A;  1UN2 A;  2YZH A;  2J9H A;  1DE2 A;  1TRV A;  5IO0 A;  4EDY A;  1E2Y A;  1QUW A;  2GST A;  3WGX A;  1R7H A;  2YOI A;  3C71 A;  2WFC A;  1ERT A;  14GS A;  4IP6 A;  2CVK A;  4E8H A;  1R4W A;  4IW9 A;  3ZIT A;  2LNT A;  1V57 A;  3A2W A;  1MD3 A;  5H5Q A;  1DBY A;  1DUG A;  3VUR A;  2IN3 A;  3KEB A;  1B9X C;  4KX4 A;  4YQU A;  2N5F A;  1F2E A;  2H73 A;  5DCH A;  1KBN A;  3DXB A;  1M9A A;  4NXI A;  3DEX A;  3CXG A;  3MSZ A;  3ZRE A;  5C04 A;  4I6X A;  1TDI A;  19GS A;  2YN1 A;  1GL8 A;  13GS A;  1HNB A;  3HY2 A;  4HUA A;  2VCV A;  1FOV A;  9GSS A;  1PL2 A;  1GRX A;  4F9Z A;  2C3T A;  3CMI A;  1A8Y A;  3BCK A;  1JZD A;  3RDW A;  1SJI A;  2KLX A;  2LNS A;  4IBP A;  4F2I A;  4ECB A;  2GLR A;  1H75 A;  2VL9 A;  1GUL A;  1XVQ A;  5IM9 A;  2IIY A;  3E9J B;  4N10 A;  3P90 A;  1AW9 A;  2YP6 A;  1F3B A;  3GHA A;  2HXK A;  2VD1 A;  3RBT A;  4RQX A;  4CDO A;  3LYK A;  4N0V A;  1GSQ A;  3CRT A;  3CSI A;  5KN0 A;  5H5S A;  4DSS B;  4IKH A;  1THO A;  3KGK A;  3M3M A;  2CV4 A;  3IRA A;  2YAN A;  3A2V A;  3F8U A;  2F51 A;  3LSZ A;  4BVX A;  1XW5 A;  5F05 A;  2I3Y A;  1T4Y A;  1F9M A;  1TI1 A;  1ZYQ B;  3FZ5 A;  1OE7 A;  1TU8 A;  3KJY A;  5D9V A;  3A5W A;  2DC5 A;  3EE2 A;  1U3I A;  3I9V 2;  5CRE A;  4ZL9 A;  3IAM 2;  1ST9 A;  2F9S A;  2KUC A;  3F0I A;  2R6K A;  5DAL A;  4QL7 A;  1QGV A;  4JU5 A;  2H6X A;  3F63 A;  2MBS A;  4GSN A;  3SWL A;  4OCE A;  4QQ7 A;  3HJM A;  4OMV A;  3C73 A;  1R5A A;  1XBS A;  2B6M A;  3FHK A;  4TRX A;  2OAC A;  3NIV A;  5H5R A;  1EOG A;  4TKY A;  4L0W A;  3J7Y k;  1WJK A;  4OO4 A;  2H0H A;  4KCE A;  1X5E A;  2BJX A;  1VF2 A;  3ZVJ D;  1GSY A;  3WD6 A;  1X9M B;  1AQX A;  3QAG A;  2H30 A;  3GX8 A;  3UOM A;  2OJL A;  1OAZ A;  5IOX A;  1QK8 A;  4KAE A;  3HYP A;  2K8V A;  2VL2 C;  2AHE A;  3KP8 A;  5FHI A;  5ABR A;  1FB0 A;  4K7O A;  3A2X A;  5A4V A;  4OFM A;  1T7P B;  4POM A;  2OE3 A;  4L5O A;  2WS2 A;  3PGT A;  4NV2 A;  4EE0 A;  5G1L A;  1Z7R A;  4HDE A;  3UMA A;  1B8X A;  1HYU A;  2BMX A;  2GT5 A;  1SKS B;  1FAA A;  2E7P A;  1KEB A;  3APS A;  5DJM A;  3UEM A;  2GT6 A;  1JZW A;  3IOS A;  3ZLP A;  1GH2 A;  5AN1 A;  3K8N A;  3ME8 A;  5E59 A;  1U88 A;  1HNA A;  2I9H A;  2AV4 A;  4WR4 A;  1PQN A;  1AUC A;  3CTF A;  2ON7 A;  1SJ6 A;  2MYG A;  1KTE A;  1RW1 A;  4MH2 A;  4XS4 B;  3CYN A;  3G7Y A;  2H71 A;  2WB9 A;  2H76 A;  4ZB9 A;  1X0R A;  5F06 A;  1TKD B;  3ED3 A;  1ERU A;  3E0U A;  1WWJ A;  1EOH A;  5F8B A;  5CO3 A;  4V1A p;  3VWU A;  1K0O A;  1GTB A;  1W89 A;  4ACS A;  1K3O A;  1ZYE A;  1SKW B;  1IYH A;  3FR9 A;  1V9W A;  4EL1 A;  4KND A;  1VF4 A;  2IJY A;  1SK2 A;  3TRP A;  2FWG A;  5HFK A;  1GSS A;  4WEY A;  2GSS A;  1KNG A;  4FIW A;  3TB2 A;  5ECH B;  4AJ7 A;  3G9B A;  1GUH A;  4DVC A;  4MCU A;  2DBC A;  3GUS A;  5IOW A;  4MPG A;  4V2L A;  3GTU A;  1C72 A;  3F3Q A;  1EWX A;  3TOU A;  3CTG A;  5CAX A;  1I5G A;  2WGR A;  2X64 A;  4MAB A;  4HOJ A;  3DYR A;  2LRC A;  3FYG A;  3GFK A;  5CYY A;  3F6F A;  4JBB A;  5JWO B;  4FH8 A;  3EC3 A;  1MDK A;  2CA8 A;  2GSR A;  3IK9 A;  2WCI A;  4MF7 A;  5D96 A;  4OCF A;  4KDY A;  3H93 A;  5AIX A;  2HLS A;  1OC3 A;  1G6W A;  2YWN A;  4ZL7 A;  4PQ1 A;  3TJJ A;  3IBH A;  2GTU A;  3DVX A;  4IEL A;  2H19 A;  2NTO A;  4IHU A;  3QR6 A;  1HNC A;  2H1A A;  11GS A;  1XVW A;  5GAP D;  2G0F A;  2IFQ A;  3QD9 A;  5JCG A;  4ILF A;  2KOK A;  1T1V A;  1WPI A;  4Q5F A;  1VF3 A;  3KMN A;  3WT2 A;  5B8B A;  2Z9S A;  4IGJ A;  5IPG A;  2V6K A;  4YAP A;  2DJ0 A;  3A3T A;  2H0G A;  2MBT A;  2FCH A;  5G2Z A;  3CSJ A;  1XZO A;  1XOB A;  3GSS A;  2VCX A;  1GUK A;  4GF0 A;  1Q4J A;  4I2T A;  2PVQ A;  2VLU A;  1X5C A;  1XW6 A;  4N0Z A;  4RUV A;  2VIM A;  1AIU A;  4F0B A;  2YZU A;  2TRC P;  3HZ4 A;  4WXT A;  3MWH A;  1FVK A;  2GGT A;  3EU3 A;  3IV4 A;  1XWB A;  3I43 A;  4MZW A;  5L71 A;  1XWK A;  3KZQ A;  3VWX A;  1LBK A;  3TRQ A;  1N8J A;  3V1W A;  2IMK A;  2LQQ A;  2VM1 A;  4K6X A;  1T3B A;  4ULX A;  2H0I A;  3FZA A;  4ZIL A;  5JWR B;  2FHE A;  3F3R A;  3ZYW A;  3QAW A;  4TXO A;  5F0G A;  2H70 A;  2LS5 A;  3TJF A;  3E3E A;  2RUF A;  1PRX A;  3TKS C;  1YKC A;  4IQA A;  5IO2 A;  4XS1 A;  2HRF A;  1UA5 A;  3HXS A;  2PWJ A;  4WBR D;  4ECJ A;  1PKW A;  4GWR A;  4ZB6 A;  1TRS A;  3DIE A;  1SKR B;  4WF5 A;  1HD2 A;  4ID0 A;  1ERW A;  4K7I A;  2L4C A;  4O7H A;  8GSS A;  1ZGN A;  4KH7 A;  2L59 A;  1FO5 A;  2K9F A;  1CQG A;  4ZXG A;  1SL2 B;  1OC9 A;  5GSS A;  2EIQ A;  4MF6 A;  2H75 A;  4PGT A;  5IQY A;  1GTA A;  4ECI A;  4MJE A;  3ISO A;  1SU9 A;  3VWW A;  3QFB C;  18GS A;  1TRU A;  2YCD A;  1BX9 A;  1YEX A;  1U6T A;  5DQS A;  1R5P A;  1B4Q A;  2YWM A;  5B8A A;  3GKN A;  2YV7 A;  2HNL A;  4G2E A;  3HZ8 A;  4K0N A;  3O6T A;  4TW5 A;  5COH A;  16GS A;  1E6B A;  3TDG A;  5INY A;  1GTI A;  2A2S A;  1ZCP A;  3GKM A;  4EO3 A;  2LRT A;  2CZ3 A;  2VCQ A;  4JRR A;  1OVN A;  2NBS A;  1SL1 B;  3DGQ A;  4JZQ A;  5FT3 A;  4KA0 A;  1XWG A;  3UJ1 A;  5ECK B;  1K0M A;  1VGL A;  2D2Z A;  5KN1 A;  4KGI A;  1OC8 A;  4DEJ A;  5J41 A;  4O32 A;  1LU4 A;  5G1K A;  5HR3 A;  3F4T A;  1UVZ A;  4POB A;  3DVW A;  2AAW A;  1NHY A;  4IVF A;  4RI6 A;  3U6V A;  2KHP A;  3MDK A;  3HJO A;  1Y25 A;  5GAN D;  5DQY A;  2MMO A;  3L9U A;  4AJ8 A;  2C0E A;  1A2L A;  2LST A;  3TCO A;  4L0U A;  4DSQ A;  3FEU A;  2KP2 A;  2DJ2 A;  3HVS A;  3S9F A;  3DWV A;  4OWY A;  1Z3E A;  2AYT A;  1T4Z A;  1XOA A;  1F6M C;  6GSY A;  2MMZ A;  2KP1 A;  3QCP A;  4JE1 A;  3N9J A;  1WE0 A;  2MZC A;  1K3L A;  4LL1 B;  4HI7 A;  4KSM A;  1EGR A;  3TKR A;  3ZML A;  3GST A;  1J0F A;  5DAK B;  3GH9 A;  5D9X A;  1XCC A;  2OBI A;  2I4A A;  5C00 A;  5HR1 A;  4ZL8 A;  2VO4 A;  1TK0 B;  3EIN A;  2FWF A;  4Q5N A;  2C4J A;  4FO5 A;  1EP7 A;  3IC4 A;  1BG5 A;  2XBI A;  3ZMK A;  3KH7 A;  2G2Q A;  4HZ2 A;  4LMV A;  4HQZ A;  1BYE A;  4K1F A;  3LFL A;  1O7U A;  3WGD A;  3M8N A;  2B5E A;  2M80 A;  1G0T A;  3LYP A;  3TJG A;  2HSY A;  4TR1 A;  1A24 A;  3RPP A;  4MJC A;  1TW9 A;  1WP0 A;  4GXZ A;  4WF4 A;  3FW2 A;  2PVO C;  1PKZ A;  3WT1 A;  4HJ2 A;  4KW6 A;  2YJH A;  3FR3 A;  2PMT A;  1TTZ A;  4MDC A;  3LJR A;  4X0X A;  2GZY A;  4HEA 2;  5G31 A;  2REM A;  2XPD A;  1QFN A;  2C0F A;  2HI7 A;  3ZFL A;  4KUN A;  2NVL A;  2L6D A;  4LLR A;  1MDJ A;  5JWQ B;  1PD2 1;  3EWL A;  1WRY A;  1K3Y A;  1GP1 A;  2N5B A;  2JL4 A;  2CX4 A;  5JCW A;  5CRD A;  1M2D A;  1UC7 A;  4X43 A;  3D5J A;  5DJL A;  2AJQ B;  4P3Y B;  2N5A A;  3GX0 A;  5ECR B;  3BCI A;  5ID2 B;  3RHC A;  3QMX A;  5G5F A;  3CSH A;  1ERV A;  3DKS A;  2LJA A;  1EEJ A;  3ZL5 A;  2J23 A;  2ON5 A;  1FHE A;  2FA4 A;  1V58 A;  3QOU A;  5IMC A;  1F3A A;  3MAK A;  3P2A A;  5KN2 A;  3F6D A;  2RII A;  3IHQ A;  3W6G A;  1YZX A;  4J56 E;  1XXU A;  4HS1 A;  1A2M A;  3GNJ A;  3DRN A;  2HSH A;  3LOR A;  2HZE B;  2IME A;  1SJZ A;  1JLV A;  1GTU A;  5ECL B;  1IYI A;  1TI3 A;  2IMI A;  4BWQ A;  4DSS A;  2E0Q A;  4N11 A;  5B6M A;  2YWI A;  4GST A;  3VFI A;  22GS A;  2EIO A;  1OKD A;  6GSU A;  2H6Y A;  2VUP A;  3L78 A;  1GWC A;  2FNO A;  3GYK A;  4EVM A;  4BWS A;  1O85 A;  5KN3 A;  3I69 A;  5CNW A;  1GSF A;  3GKK A;  2H8L A;  2GVP A;  4I8B A;  3KCM A;  2FUG 2;  1Z9H A;  4MZB A;  5LCZ A;  5DAK A;  2CQ9 A;  2VCT A;  2PN8 A;  2O89 A;  2GSQ A;  2VL2 A;  4KSO A;  5FWG A;  2F8F A;  1AC1 A;  3FY7 A;  4QL9 A;  2QKE A;  3EMP A;  2K6V A;  3ZRD A;  3TKS E;  1ZOF A;  1NW2 A;  1TU7 A;  3KP9 A;  5GST A;  1X9W B;  5ECS A;  3KM6 A;  1I9D A;  1A0F A;  2QC7 A;  1F37 A;  4JED A;  1AXD A;  4ML1 A;  1Y6E A;  1A8L A;  3ZTL A;  3P7X A;  4PQI A;  2BTO T;  1O8W A;  4KDX A;  3C8E A;  2EC4 A;  1OE8 A;  2LJK A;  4JR4 A;  4MH3 A;  1B9Y C;  4GQC A;  4Q5R A;  2GS3 A;  4MJB A;  2HFD A;  2FLS A;  2PER A;  4OO5 A;  4GQF A;  4LA1 A;  1X5D A;  1GLP A;  2GZZ A;  2H72 A;  3IXR A;  1K0B A;  1XW9 A;  2C80 A;  3HD5 A;  2VCZ A;  4PNF A;  3M9K A;  4OFN A;  1A0R P;  1AAZ A;  4EC0 A;  4D73 B;  2PUK C;  1U87 A;  3WGE A;  4MZC A;  1BJX A;  5ECN B;  1Z7P A;  1ML6 A;  3KTB A;  2XHF A;  2LJR A;  4CW9 A;  3J7Y b;  2OE1 A;  5G5E A;  3L9S A;  2OKA A;  1NM3 A;  2O7K A;  1WIK A;  2C8U A;  1YJ6 A;  2LRN A;  1BQ7 A;  4GLT A;  6GSV A;  7GSS A;  1O81 A;  2O85 A;  2LTK A;  3GL5 A;  2H1B A;  1SYR A;  1YY7 A;  2A4V A;  4IJ3 A;  2PBJ A;  2ALB A;  4TR3 A;  4ZBB A;  1NSW A;  2R4V A;  4ML6 A;  4AGS A;  4K7N A;  4XS4 A;  2CZ2 A;  2QGV A;  3H1N A;  2HT9 A;  3GIX A;  3QFA C;  1MDI A;  4CHS A;  1XFL A;  2DJK A;  5HQP A;  4MPF A;  6GSS A;  4NWY A;  4KCA A;  1PA3 A;  4E8E A;  3FK8 A;  3GMF A;  1U3A A;  2XC2 A;  2B1L A;  2VM2 A;  1EV4 A;  2VL3 A;  2NDO A;  4GTU A;  2DLX A;  3O76 A;  2GZP A;  2CVD A;  5CRH A;  4BPY A;  3C7M A;  2RM5 A;  1PX6 A;  5HR0 A;  2ZCT A;  1X9S B;  1PN9 A;  4XRA A;  5ECO B;  4PUR A;  3HVV A;  3IK7 A;  4WBJ A;  2XBQ A;  3I6A A;  5J3R A;  4MMM A;  1TK8 B;  4MK3 A;  1TXX A;  1SD9 A;  2JSZ A;  1SEN A;  2H01 A;  2IMF A;  5D73 A;  5DAL B;  5EPF A;  1K0A A;  2DML A;  10GS A;  2EIR A;  2O8V B;  5IIZ A;  3Q19 A;  2L6C A;  1O8X A;  2H1G A;  1FW1 A;  2R5G A;  4WR5 A;  4EDZ A;  5CRG A;  3IE3 A;  2GQK A;  2LQO A;  2DJ1 A;  4NPB A;  5IPH A;  3UVH A;  1CQH A;  3TGZ A;  3D6I A;  4NHW A;  2GQM A;  1G6Y A;  3GL3 A;  2JZR A;  1M0U A;  5A5K A;  2CX3 A;  2V2G A;  3EU4 A;  3UL3 A;  4PUA A;  4HJM A;  3M9J A;  4RI7 A;  2DMM A;  4YQV A;  4WKW A;  2MMA A;  3LXT A;  1EEM A;  2OAD A;  3KMO A;  3LGC A;  5IMA A;  2X99 A;  2GDR A;  3PIN A;  4FYU A;  5ELG A;  4YQM A;  3VWV A;  1TOF A;  1WOU A;  3EMX A;  4ZBA A;  5J9B A;  20GS A;  4J57 E;  5D9W A;  1TK5 B;  5ECP B;  3L4N A;  2HRN A;  5AGY A;  2FWE A;  1B4P A;  4TN8 A;  2VLV A;  6GSW A;  1M2B A;  2YPM A;  4MLY A;  1S3A A;  1GSU A;  1TRW A;  2TRX A;  1TJD A;  2LV3 A;  1PGT A;  4K9Z A;  4MA9 A;  1O73 A;  1BED A;  2F3M A;  6GST A;  1HQO A;  3M1G A;  1TP9 A;  3TUE A;  5IMD A;  2B5Y A;  3G7I A;  2OA7 A;  2WRT A;  3ZIJ A;  1H4O A;  2B3S A;  1RK4 A;  5DDL A;  4D73 A;  5G30 A;  3CRU A;  1PSQ A;  2RM6 A;  3Q18 A;  4ISD A;  4LL4 B;  2GQL A;  3KXO A;  3ZFB A;  1B48 A;  4L5L A;  2DJ3 A;  1V40 A;  3BBY A;  4GSS A;  4NMU A;  1QMV A;  3TKS A;  2DIZ A;  3QAV A;  3SBC A;  3L0H A;  3PH9 A;  4PNG A;  4HU7 A;  5DCG A;  1T8E B;  4K0G A;  4N30 A;  2OBK A;  2ZNM A;  4MF5 A;  3IA1 A;  2ZUP A;  1XWC A;  5J4U A;  3FZ9 A;  2DSA A;  3QDN A;  3VI7 A;  3JCM L;  3GH6 A;  3H8Q A;  1AQV A;  1ON4 A;  3F9U A;  1K0D A;  1QQ2 A;  1M2A A;  3FKF A;  3WYW A;  3US3 A;  2C0D A;  4EUY A;  4JR6 A;  4G19 A;  2E2G A;  5B7C A;  3FR6 A;  1M9B A;  5E4W A;  4PUF C;  3D22 A;  1R26 A;  2I1U A;  3KD0 A;  2DJJ A;  2H1D A;  3GTU B;  5ECI B;  5JCU A;  1XPV A;  3GA4 A;  1S3D A;  3RHB A;  4F0C A;  3LQ7 A;  2O87 A;  4NV5 A;  1GNW A;  4KB3 A;  4O92 A;  3TOT A;  4TVE A;  3DML A;  2IWT A;  5B6N A;  3IPZ A;  4V1A g;  2CAQ A;  2YWO A;  4J2F A;  1NHO A;  2RUE A;  3VI5 A;  3VLN A;  3U5R E;  2JAC A;  3GRX A;  1YDK A;  4TR4 A;  4XIH A;  3APQ A;  2WDU A;  2B7K A;  3F4S A;  3VPT A;  1Q98 A;  2MMN A;  2R3X A;  4XTS A;  5D8I A;  3L9V A;  1RQM A;  4EKZ A;  1QXH A;  2L4Q A;  2K8S A;  5EY6 A;  5J5N A;  1FG4 A;  4O5R A;  3HA9 A;  2PGT A;  3P8W A;  2R2J A;  1THX A;  3IR4 A;  1Z6N A;  3TKQ A;  1A23 A;  2M46 A;  3TJK A;  2VD0 A;  3FZ4 A;  2PU9 C;  2E2M A;  2L57 A;  2FA8 A;  2IFQ B;  4V2M A;  1PMT A;  1JZO A;  4ZBD A;  2VLT A;  2JZT A;  4TR0 A;  2P0G A;  1EZK A;  1VF1 A;  2V41 A;  2IPA A;  3GKX A;  2IL3 A;  1JFU A;  4AJ6 A;  4Z7X A;  2VAF A;  2YNX A;  2C3Q A;  1SYX A;  4IJI A;  4MJA A;  3UIW A;  4POK A;  4BL7 A;  2FY6 A;  4FYB A;  2L5O A;  4NHZ A;  4DSR A;  4YAV A;  3LWA A;  4HU9 A;  2FD3 A;  1G7E A;  2V6O A;  5IMV A;  5A4W A;  2HZF A;  1K0C A;  1VRS D;  3UBL A;  1JZR A;  3D21 A;  4KE3 A;  4OFT A;  1EV9 A;  2XPE A;  2C0G A;  4IS0 A;  3MNG A;  4GCI A;  1AQW A;  2R37 A;  1ZMA A;  1SD8 A;  1G7O A;  2OE0 A;  3HJP A;  4BA7 A;  1W4V A;  3ERG A;  4Q5Q A;  1FVJ A;  4V2N A;  2B1K A;  1FB6 A;  1GSE A;  4HZ4 A;  1GSD A;  3LEF A;  1T00 A;  2H6Z A;  4G10 A;  4TXO B;  2WJU A;  2IMD A;  1SK0 A;  1M7T A;  3TRX A;  2QSI A;  1JHB A;  4TXV A;  3BJ5 A;  4IN0 A;  1J08 A;  1OYJ A;  2WZ9 A;  2YJ7 A;  2DIY A;  4XCS A;  5HR2 A;  4YH2 A;  3CBU A;  2X8C A;  4IP1 A;  4EF0 A;  4F03 A;  1SL0 B;  2CAI A;  3C1R A;  4H86 A;  1MD4 A;  2CT6 A;  3DD3 A;  1XIY A;  3D4M A;  3HHV A;  4I5Q A;  3Q74 A;  2VOC A;  3GV1 A;  1ILO A;  5LD0 A;  1MEK A;  3F4R A;  2K18 A;  1V2A A;  1N2A A;  1OC9 B;  2F8A A;  5A4U A;  2P5R A;  3ZVJ A;  3OR5 A;  3N5O A;  1LJR A;  2RLI A;  1K0N A;  2X8H A;  1YF1 A;  3QPM A;  3TKP A;  1Z5Y E;  2VCW A;  1V98 A;  3UVT A;  4XRD A;  2NPB A;  5ECM B;  3M0F A;  1PX7 A;  3C1S A;  1YF0 A;  1M99 A;  2C1Y A;  2V32 A;  2LUS A;  3W8S A;  4POL A;  3AY8 A;  3KH9 A;  5HFI A;  3NZN A;  3GUR A;  4PQH A;  4ECC A;  1GNE A;  5EVO A;  1ACV A;  2PPT A;  1MTC A;  2LEG A;  5DBQ A;  2FWH A;  3HCZ A;  5HFG A;  2AB6 A;  3LXZ A;  5F07 A;  1YQ1 A;  4I2U A;  2I81 A;  5KEJ A;  2P5Q A;  3VPQ A;  1SK1 A;  2P31 A;  4L8E A;  4LMW A;  4I97 A;  5ELA A;  4IQ1 A;  2HYX A;  1USB A;  2B7J A;  2C3N A;  1WMJ A;  2AUV A;  2TIR A;  5AIS A;  3ME7 A;  5GZZ B;  2H74 A;  2L5L A;  3W8J A;  1GLQ A;  3ERF A;  3G7J A;  12GS A;  3GN3 A;  3R2Q A;  2FGX A;  3UBK A;  1ZL9 A;  4F82 A;  2V1M A;  3HVX A;  3D4T A;  3H4K A;  2LKU A;  1YEP A;  1XWA A;  5ID2 A;  3IDV A;  1PL1 A;  3VK9 A;  5CRW A;  3RAZ A;  4FYC A;  4XS6 A;  3BOA A;  4X1U A;  6GSX A;  3IAS 2;  2B5X A;  2H66 A;  5DVB A;  5IMF A;  5AIV A;  5EL8 A;  5CP1 A;  3EYT A;  1J9B A;  1DSB A;  1BAY A;  5IMZ A;  1JLW A;  3UAP A;  2WUL A;  3EVI A;  2CVB A;  4KDU A;  5D9T A;  5LNK e;  1A2J A;  3D0Z A;  4BVY A;  5D93 A;  4WET A;  1O6J A;  2HZE A;  2X8G A;  4AF2 A;  1Z6M A;  3LG6 A;  3ZZX A;  4ZB8 A;  3ERW A;  4ZIJ A;  2YV9 A;  4NAX A;  3Q6O A;  1S3C A;  3EUR A;  4G9H A;  3ZIV A;  5ECQ B;  3RPN A;  3KIJ A;  4XHM A;  3NOF A;  2A2R A;  3APO A;  5J9C A;  3BD2 A;  3KTL A;  3TJB A;  4OD7 A;  2JU5 A;  4HQS A;  4EXJ A;  2JZS A;  2M72 A;  3PR8 A;  2ES7 A;  3H79 A;  2HE3 A;  4K8M A;  1EGO A;  4TOP A;  1OKT A;  5ENU A; 
#chains in the Genus database with same CATH topology
 1ZZY A;  1ABA A;  3UAR A;  1GUM A;  1EP8 A;  4PXO A;  4RQR A;  4K2D A;  3FRC A;  3O3T A;  1DE1 A;  17GS A;  2JSY A;  4MP4 A;  3R3E A;  2JAD A;  1URM A;  4PX1 A;  4K5S A;  3HKR A;  4TR1 B;  3HDC A;  4GRF A;  1YKA A;  1UN2 A;  2YZH A;  2J9H A;  1DE2 A;  1TRV A;  5IO0 A;  4EDY A;  1E2Y A;  1QUW A;  2GST A;  3WGX A;  1R7H A;  2YOI A;  3C71 A;  2WFC A;  1ZYP A;  1M3J A;  1ERT A;  14GS A;  4IP6 A;  4K2X A;  4ICY A;  2CVK A;  4E8H A;  1R4W A;  4IW9 A;  3ZIT A;  2LNT A;  1V57 A;  3A2W A;  1MD3 A;  5H5Q A;  1DBY A;  1DUG A;  3VUR A;  2IN3 A;  3KEB A;  1B9X C;  4KX4 A;  4YQU A;  2N5F A;  1F2E A;  2H73 A;  5DCH A;  1KBN A;  3DXB A;  1M9A A;  4NXI A;  3DEX A;  3CXG A;  3MSZ A;  3ZRE A;  5C04 A;  4I6X A;  1TDI A;  19GS A;  2YN1 A;  1GL8 A;  13GS A;  1HNB A;  3HY2 A;  4HUA A;  2VCV A;  1FOV A;  9GSS A;  1PL2 A;  1GRX A;  4F9Z A;  2C3T A;  3CMI A;  1A8Y A;  3BCK A;  1JZD A;  3RDW A;  1SJI A;  2KLX A;  2LNS A;  4IBP A;  4F2I A;  4ECB A;  3A5I A;  2GLR A;  1H75 A;  2VL9 A;  1GUL A;  1XVQ A;  5IM9 A;  2IIY A;  3E9J B;  4N10 A;  3P90 A;  1AW9 A;  2YP6 A;  1F3B A;  3GHA A;  2HXK A;  2VD1 A;  3RBT A;  4RQX A;  4CDO A;  3LYK A;  4N0V A;  1GSQ A;  3CRT A;  3CSI A;  5KN0 A;  5H5S A;  4DSS B;  4IKH A;  1THO A;  3KGK A;  3M3M A;  2CV4 A;  3IRA A;  2YAN A;  3A2V A;  3F8U A;  2F51 A;  3LSZ A;  4BVX A;  1XW5 A;  5F05 A;  2I3Y A;  1T4Y A;  1F9M A;  1TI1 A;  1ZYQ B;  3FZ5 A;  1OE7 A;  1TU8 A;  3KJY A;  2R0C A;  5D9V A;  3A5W A;  2DC5 A;  3EE2 A;  1U3I A;  3I9V 2;  5CRE A;  4ZL9 A;  3IAM 2;  1ST9 A;  2F9S A;  2KUC A;  3F0I A;  2R6K A;  5DAL A;  4QL7 A;  1QGV A;  4JU5 A;  2H6X A;  3F63 A;  4G0L A;  2MBS A;  4GSN A;  3SWL A;  4OCE A;  4QQ7 A;  3HJM A;  4OMV A;  3C73 A;  1R5A A;  1XBS A;  2B6M A;  3FHK A;  4TRX A;  2OAC A;  3NIV A;  5H5R A;  1EOG A;  4TKY A;  4L0W A;  3J7Y k;  1WJK A;  4OO4 A;  2H0H A;  4KCE A;  1X5E A;  2BJX A;  1VF2 A;  3ZVJ D;  1GSY A;  2QA2 A;  3WD6 A;  1X9M B;  1AQX A;  3QAG A;  2H30 A;  3GX8 A;  3UOM A;  2DKI A;  2OJL A;  1OAZ A;  5IOX A;  1QK8 A;  4KAE A;  3HYP A;  2K8V A;  2VL2 C;  2AHE A;  3KP8 A;  2QA1 A;  5FHI A;  5ABR A;  1FB0 A;  4K7O A;  3A2X A;  5A4V A;  4OFM A;  1T7P B;  4POM A;  2OE3 A;  4L5O A;  4BIK A;  2WS2 A;  3PGT A;  4NV2 A;  4EE0 A;  5G1L A;  1Z7R A;  4HDE A;  3UMA A;  1B8X A;  1HYU A;  2BMX A;  2GT5 A;  1SKS B;  1FAA A;  2E7P A;  1KEB A;  3APS A;  5DJM A;  3UEM A;  2GT6 A;  2HSM A;  1JZW A;  3IOS A;  3ZLP A;  1GH2 A;  5AN1 A;  3K8N A;  3ME8 A;  1U88 A;  5E59 A;  1HNA A;  2I9H A;  2AV4 A;  4WR4 A;  1PQN A;  1AUC A;  3CTF A;  2ON7 A;  1SJ6 A;  2MYG A;  1KTE A;  1RW1 A;  4MH2 A;  1FOH A;  4XS4 B;  3CYN A;  3G7Y A;  2H71 A;  2WB9 A;  2H76 A;  4ZB9 A;  1X0R A;  5F06 A;  1TKD B;  3ED3 A;  1ERU A;  3E0U A;  1WWJ A;  1EOH A;  5F8B A;  5CO3 A;  2X4A A;  4V1A p;  3VWU A;  1K0O A;  1GTB A;  1W89 A;  4ACS A;  1K3O A;  1ZYE A;  1SKW B;  1IYH A;  3FR9 A;  1V9W A;  4EL1 A;  4KND A;  1VF4 A;  2IJY A;  1SK2 A;  3TRP A;  2FWG A;  5HFK A;  1GSS A;  2HRA A;  4WEY A;  2GSS A;  1KNG A;  4FIW A;  3TB2 A;  5ECH B;  4AJ7 A;  3G9B A;  1GUH A;  4DVC A;  4MCU A;  2DBC A;  3GUS A;  5IOW A;  4MPG A;  4V2L A;  3GTU A;  1C72 A;  3F3Q A;  1EWX A;  3TOU A;  3CTG A;  5CAX A;  1I5G A;  2WGR A;  2X49 A;  2X64 A;  4MAB A;  4HOJ A;  3DYR A;  2LRC A;  3FYG A;  3GFK A;  5CYY A;  3F6F A;  4JBB A;  4Z2T A;  5JWO B;  4FH8 A;  3EC3 A;  1MDK A;  2CA8 A;  2GSR A;  3IK9 A;  2WCI A;  4MF7 A;  5D96 A;  4OCF A;  4KDY A;  3H93 A;  5AIX A;  2HLS A;  1OC3 A;  1G6W A;  2YWN A;  4ZL7 A;  4PQ1 A;  3TJJ A;  3IBH A;  2GTU A;  3DVX A;  4IEL A;  2H19 A;  2NTO A;  4IHU A;  3QR6 A;  1HNC A;  2H1A A;  11GS A;  1XVW A;  5GAP D;  2G0F A;  2IFQ A;  3QD9 A;  5JCG A;  4ILF A;  2KOK A;  1T1V A;  1WPI A;  4Q5F A;  1VF3 A;  3KMN A;  3WT2 A;  5B8B A;  2Z9S A;  4IGJ A;  2R0G A;  1ZYN A;  5IPG A;  2V6K A;  4YAP A;  2DJ0 A;  3A3T A;  2H0G A;  2MBT A;  2FCH A;  5G2Z A;  3CSJ A;  1XZO A;  1XOB A;  3GSS A;  2VCX A;  1GUK A;  4GF0 A;  1Q4J A;  4I2T A;  2PVQ A;  2VLU A;  1X5C A;  1XW6 A;  4N0Z A;  4RUV A;  2VIM A;  1AIU A;  4F0B A;  2YZU A;  2TRC P;  3HZ4 A;  4WXT A;  3MWH A;  1FVK A;  2GGT A;  3EU3 A;  3IV4 A;  1XWB A;  3I43 A;  4MZW A;  5L71 A;  1XWK A;  3KZQ A;  3VWX A;  1LBK A;  3TRQ A;  1N8J A;  3V1W A;  2IMK A;  2LQQ A;  2VM1 A;  4K6X A;  1T3B A;  4ULX A;  2H0I A;  3FZA A;  4ZIL A;  5JWR B;  2FHE A;  3F3R A;  3ZYW A;  3QAW A;  4TXO A;  5F0G A;  2H70 A;  2LS5 A;  3TJF A;  3E3E A;  2RUF A;  1PRX A;  3TKS C;  1YKC A;  4IQA A;  5IO2 A;  4XS1 A;  2HRF A;  1UA5 A;  3HXS A;  2PWJ A;  4WBR D;  4ECJ A;  1PKW A;  4GWR A;  4ZB6 A;  1TRS A;  3DIE A;  1SKR B;  4WF5 A;  1HD2 A;  4ID0 A;  1ERW A;  4K7I A;  2L4C A;  4O7H A;  8GSS A;  1ZGN A;  4KH7 A;  2L59 A;  1FO5 A;  2K9F A;  1CQG A;  4ZXG A;  1SL2 B;  1OC9 A;  5GSS A;  2UZ8 A;  2EIQ A;  4MF6 A;  2H75 A;  4PGT A;  5IQY A;  3EPT A;  4HSC X;  1GTA A;  4ECI A;  4MJE A;  3ISO A;  1SU9 A;  3VWW A;  3QFB C;  18GS A;  1TRU A;  2YCD A;  1BX9 A;  1YEX A;  1U6T A;  5DQS A;  1R5P A;  1B4Q A;  2YWM A;  5B8A A;  3GKN A;  2YV7 A;  2HNL A;  4G2E A;  3HZ8 A;  4K0N A;  3O6T A;  4TW5 A;  5COH A;  16GS A;  1E6B A;  3TDG A;  5INY A;  1GTI A;  2A2S A;  1ZCP A;  3GKM A;  4EO3 A;  2LRT A;  2CZ3 A;  2VCQ A;  4JRR A;  1OVN A;  2NBS A;  1SL1 B;  4PTS A;  3DGQ A;  4JZQ A;  5FT3 A;  4KA0 A;  1XWG A;  3UJ1 A;  5ECK B;  1K0M A;  1VGL A;  2D2Z A;  5KN1 A;  4KGI A;  1OC8 A;  4DEJ A;  5J41 A;  4O32 A;  1LU4 A;  5G1K A;  5HR3 A;  3F4T A;  1UVZ A;  4POB A;  3DVW A;  2AAW A;  1NHY A;  4IVF A;  4RI6 A;  3U6V A;  2KHP A;  3MDK A;  3HJO A;  1Y25 A;  5GAN D;  5DQY A;  2MMO A;  3L9U A;  4AJ8 A;  2C0E A;  1A2L A;  2LST A;  3TCO A;  4L0U A;  4DSQ A;  5BMU A;  3FEU A;  2KP2 A;  2DJ2 A;  3HVS A;  3S9F A;  3DWV A;  4OWY A;  1Z3E A;  2AYT A;  1T4Z A;  3CQF A;  1XOA A;  1F6M C;  6GSY A;  2MMZ A;  2KP1 A;  3QCP A;  4JE1 A;  3N9J A;  1WE0 A;  2MZC A;  1K3L A;  4LL1 B;  4HI7 A;  4KSM A;  1EGR A;  3TKR A;  3ZML A;  3GST A;  1J0F A;  5DAK B;  3GH9 A;  5D9X A;  1XCC A;  2OBI A;  2I4A A;  5C00 A;  5HR1 A;  4ZL8 A;  4X4J A;  2VO4 A;  1TK0 B;  5KOX A;  3EIN A;  2FWF A;  4Q5N A;  4USS A;  2C4J A;  4FO5 A;  1EP7 A;  3IC4 A;  1BG5 A;  2XBI A;  3ZMK A;  3KH7 A;  2G2Q A;  5KOW A;  4HZ2 A;  4O5Q A;  4LMV A;  4YKG A;  4HQZ A;  1BYE A;  4K1F A;  3LFL A;  1O7U A;  3WGD A;  3M8N A;  2B5E A;  2M80 A;  1XG8 A;  1G0T A;  3LYP A;  3TJG A;  2HSY A;  4TR1 A;  1A24 A;  3RPP A;  4MJC A;  1TW9 A;  1WP0 A;  4GXZ A;  4WF4 A;  3FW2 A;  2PVO C;  1PKZ A;  3WT1 A;  4HJ2 A;  4KW6 A;  2YJH A;  3FR3 A;  2PMT A;  1TTZ A;  4MDC A;  3LJR A;  4X0X A;  2GZY A;  4HEA 2;  5G31 A;  2REM A;  2XPD A;  1QFN A;  2C0F A;  2HI7 A;  3ZFL A;  4KUN A;  2NVL A;  2L6D A;  4LLR A;  1MDJ A;  5JWQ B;  1PD2 1;  3EWL A;  1WRY A;  1K3Y A;  1GP1 A;  2N5B A;  2JL4 A;  2CX4 A;  5JCW A;  5CRD A;  1M2D A;  1UC7 A;  4X43 A;  3D5J A;  5DJL A;  2AJQ B;  3HVN A;  4P3Y B;  2N5A A;  3GX0 A;  5ECR B;  3BCI A;  5ID2 B;  3RHC A;  3QMX A;  5G5F A;  3CSH A;  1ERV A;  3DKS A;  2LJA A;  1EEJ A;  2A2P A;  3ZL5 A;  2J23 A;  2ON5 A;  1FHE A;  2FA4 A;  1V58 A;  3QOU A;  5IMC A;  1F3A A;  3MAK A;  3P2A A;  5KN2 A;  3F6D A;  2RII A;  3IHQ A;  3W6G A;  1YZX A;  4J56 E;  1XXU A;  4HS1 A;  1A2M A;  3GNJ A;  4BVY B;  3DRN A;  2HSH A;  3LOR A;  2HZE B;  2IME A;  1SJZ A;  2A4H A;  1JLV A;  1GTU A;  5ECL B;  1IYI A;  1TI3 A;  2IMI A;  4BWQ A;  4DSS A;  2E0Q A;  4N11 A;  5B6M A;  2YWI A;  4GST A;  3VFI A;  22GS A;  2EIO A;  1OKD A;  6GSU A;  2H6Y A;  1PN0 A;  4G0K A;  2VUP A;  3L78 A;  1GWC A;  2FNO A;  3GYK A;  4EVM A;  4BWS A;  1O85 A;  5KN3 A;  3I69 A;  5CNW A;  1GSF A;  3GKK A;  2H8L A;  2GVP A;  4I8B A;  3KCM A;  2FUG 2;  1Z9H A;  4MZB A;  5LCZ A;  5DAK A;  2CQ9 A;  2VCT A;  2PN8 A;  2O89 A;  2GSQ A;  2VL2 A;  4KSO A;  5FWG A;  2F8F A;  1AC1 A;  3FY7 A;  4QL9 A;  2QKE A;  3EMP A;  2K6V A;  3ZRD A;  3TKS E;  1ZOF A;  1NW2 A;  1TU7 A;  3KP9 A;  5GST A;  1X9W B;  5ECS A;  3KM6 A;  1I9D A;  1A0F A;  2QC7 A;  1F37 A;  4JED A;  1AXD A;  4ML1 A;  1Y6E A;  1A8L A;  3ZTL A;  3P7X A;  4PQI A;  2BTO T;  1O8W A;  4KDX A;  3C8E A;  2EC4 A;  1OE8 A;  2LJK A;  4JR4 A;  4MH3 A;  1B9Y C;  3PPU A;  4GQC A;  4Q5R A;  2GS3 A;  4MJB A;  2HFD A;  2FLS A;  2PER A;  4OO5 A;  4GQF A;  4LA1 A;  1X5D A;  1GLP A;  2GZZ A;  2H72 A;  3IXR A;  1K0B A;  1XW9 A;  2C80 A;  3HD5 A;  2VCZ A;  4PNF A;  3M9K A;  4OFN A;  1A0R P;  1AAZ A;  4EC0 A;  4D73 B;  2PUK C;  1U87 A;  3WGE A;  4MZC A;  1BJX A;  5ECN B;  1Z7P A;  1ML6 A;  3KTB A;  2XHF A;  2LJR A;  4CW9 A;  3J7Y b;  2OE1 A;  5G5E A;  3L9S A;  2OKA A;  1NM3 A;  2O7K A;  1WIK A;  2C8U A;  1YJ6 A;  2LRN A;  1BQ7 A;  4GLT A;  6GSV A;  7GSS A;  1O81 A;  2O85 A;  2LTK A;  3GL5 A;  3IHG A;  4YKF A;  2H1B A;  1SYR A;  1YY7 A;  2A4V A;  4IJ3 A;  2PBJ A;  2ALB A;  4TR3 A;  4ZBB A;  1NSW A;  2R4V A;  4ML6 A;  4AGS A;  4K7N A;  4XS4 A;  2CZ2 A;  2QGV A;  3H1N A;  2HT9 A;  3GIX A;  3QFA C;  1MDI A;  4CHS A;  1XFL A;  2DJK A;  5HQP A;  4MPF A;  6GSS A;  4NWY A;  4KCA A;  1PA3 A;  4E8E A;  3FK8 A;  3GMF A;  1U3A A;  2XC2 A;  2B1L A;  2VM2 A;  1EV4 A;  2VL3 A;  2NDO A;  4GTU A;  2DLX A;  3O76 A;  2GZP A;  2CVD A;  5CRH A;  4BPY A;  4BVX B;  3C7M A;  2RM5 A;  1PX6 A;  5HR0 A;  2ZCT A;  1X9S B;  1PN9 A;  4XRA A;  5ECO B;  4PUR A;  3HVV A;  3IK7 A;  1S3R A;  4WBJ A;  2XBQ A;  3I6A A;  5J3R A;  4MMM A;  1TK8 B;  4MK3 A;  1TXX A;  1SD9 A;  2JSZ A;  1SEN A;  2H01 A;  2IMF A;  5D73 A;  5DAL B;  5EPF A;  1K0A A;  2DML A;  10GS A;  2EIR A;  2O8V B;  5IIZ A;  3Q19 A;  2L6C A;  1O8X A;  2H1G A;  1FW1 A;  2R5G A;  4WR5 A;  4EDZ A;  5CRG A;  3IE3 A;  2GQK A;  2LQO A;  2DJ1 A;  4NPB A;  5IPH A;  3UVH A;  1CQH A;  3TGZ A;  3D6I A;  4NHW A;  3MYD A;  2GQM A;  1G6Y A;  3GL3 A;  2JZR A;  1M0U A;  5A5K A;  2CX3 A;  4KF9 A;  2V2G A;  3EU4 A;  3UL3 A;  4PUA A;  4HJM A;  3M9J A;  4RI7 A;  2DMM A;  4YQV A;  4WKW A;  2MMA A;  3LXT A;  1EEM A;  2OAD A;  3KMO A;  3LGC A;  5IMA A;  2X99 A;  2GDR A;  3PIN A;  4FYU A;  5ELG A;  4YQM A;  3VWV A;  1TOF A;  1WOU A;  3EMX A;  4ZBA A;  5J9B A;  20GS A;  3FMW A;  4J57 E;  5D9W A;  1TK5 B;  5ECP B;  3L4N A;  2HRN A;  5AGY A;  2FWE A;  1B4P A;  4TN8 A;  2VLV A;  6GSW A;  1M2B A;  2YPM A;  4MLY A;  1S3A A;  1GSU A;  1TRW A;  4BL7 B;  2TRX A;  3IC8 A;  1TJD A;  2LV3 A;  1PGT A;  4K9Z A;  4MA9 A;  1O73 A;  1BED A;  2F3M A;  6GST A;  1HQO A;  3M1G A;  1TP9 A;  3TUE A;  5IMD A;  2B5Y A;  3G7I A;  2OA7 A;  2WRT A;  3ZIJ A;  1H4O A;  2B3S A;  1RK4 A;  5DDL A;  4D73 A;  5G30 A;  3CRU A;  1PSQ A;  2RM6 A;  3Q18 A;  4ISD A;  4LL4 B;  2GQL A;  3KXO A;  3ZFB A;  1B48 A;  4L5L A;  2DJ3 A;  1V40 A;  3BBY A;  4GSS A;  4NMU A;  1QMV A;  3TKS A;  2DIZ A;  3QAV A;  3SBC A;  3L0H A;  3PH9 A;  4PNG A;  4HU7 A;  5DCG A;  1T8E B;  4K0G A;  4N30 A;  4EIQ A;  2OBK A;  2ZNM A;  4MF5 A;  3IA1 A;  2ZUP A;  1XWC A;  5J4U A;  3FZ9 A;  2DSA A;  3QDN A;  3VI7 A;  3JCM L;  3GH6 A;  3H8Q A;  1AQV A;  1ON4 A;  3F9U A;  1K0D A;  1QQ2 A;  1M2A A;  3FKF A;  3WYW A;  3US3 A;  2C0D A;  4EUY A;  4JR6 A;  4G19 A;  2E2G A;  5B7C A;  3FR6 A;  1M9B A;  5E4W A;  4PUF C;  3D22 A;  1R26 A;  2I1U A;  3KD0 A;  2DJJ A;  2H1D A;  3GTU B;  5ECI B;  5JCU A;  1XPV A;  3GA4 A;  1S3D A;  3RHB A;  4F0C A;  3LQ7 A;  2O87 A;  4NV5 A;  1GNW A;  4KB3 A;  4O92 A;  3TOT A;  4TVE A;  3DML A;  2IWT A;  5B6N A;  3IPZ A;  4V1A g;  2CAQ A;  2YWO A;  4J2F A;  1NHO A;  2RUE A;  3VI5 A;  3VLN A;  3U5R E;  2JAC A;  3GRX A;  1YDK A;  4TR4 A;  4XIH A;  3APQ A;  2WDU A;  2B7K A;  3F4S A;  4O5U A;  3VPT A;  1Q98 A;  2MMN A;  2R3X A;  4XTS A;  5D8I A;  3L9V A;  1RQM A;  4EKZ A;  1QXH A;  2L4Q A;  2K8S A;  5EY6 A;  5J5N A;  1FG4 A;  4O5R A;  3HA9 A;  2PGT A;  3P8W A;  2R2J A;  1THX A;  3IR4 A;  1Z6N A;  3TKQ A;  1A23 A;  2M46 A;  3TJK A;  2VD0 A;  3FZ4 A;  2PU9 C;  2E2M A;  2L57 A;  2FA8 A;  2IFQ B;  4V2M A;  4MNN A;  1PMT A;  1JZO A;  4ZBD A;  2VLT A;  2JZT A;  4TR0 A;  2P0G A;  1EZK A;  1VF1 A;  2V41 A;  2IPA A;  3GKX A;  2IL3 A;  1JFU A;  4AJ6 A;  4Z7X A;  2VAF A;  2YNX A;  2C3Q A;  1SYX A;  4IJI A;  4MJA A;  3UIW A;  4POK A;  4BL7 A;  2FY6 A;  4FYB A;  2L5O A;  4NHZ A;  4DSR A;  4YAV A;  3LWA A;  4HU9 A;  2FD3 A;  1G7E A;  2V6O A;  5IMV A;  5A4W A;  2HZF A;  1K0C A;  2HRK A;  1VRS D;  3UBL A;  1JZR A;  3D21 A;  4KE3 A;  4OFT A;  1EV9 A;  2XPE A;  2C0G A;  4IS0 A;  3MNG A;  4G0I A;  4GCI A;  1AQW A;  2R37 A;  1ZMA A;  1SD8 A;  1G7O A;  2OE0 A;  4K5R A;  3HJP A;  4BA7 A;  1PFO A;  1W4V A;  3ERG A;  4Q5Q A;  4Z2R A;  1FVJ A;  4V2N A;  2B1K A;  1FB6 A;  1GSE A;  4HZ4 A;  1GSD A;  3LEF A;  1T00 A;  2H6Z A;  4CY8 A;  4G10 A;  4TXO B;  2WJU A;  2IMD A;  1SK0 A;  1M7T A;  3TRX A;  2QSI A;  1JHB A;  4TXV A;  3BJ5 A;  4IN0 A;  1J08 A;  1OYJ A;  2WZ9 A;  2YJ7 A;  2DIY A;  4XCS A;  5HR2 A;  4YH2 A;  3CBU A;  2X8C A;  4IP1 A;  4EF0 A;  4F03 A;  1SL0 B;  2CAI A;  3C1R A;  4H86 A;  1MD4 A;  2CT6 A;  3DD3 A;  1XIY A;  3D4M A;  3HHV A;  4I5Q A;  3Q74 A;  2VOC A;  3GV1 A;  2DKH A;  1ILO A;  5LD0 A;  4EIP A;  1MEK A;  3F4R A;  2K18 A;  1V2A A;  1N2A A;  1OC9 B;  2F8A A;  5A4U A;  2P5R A;  3ZVJ A;  4CY6 A;  3OR5 A;  3N5O A;  1LJR A;  2RLI A;  1K0N A;  2X8H A;  1YF1 A;  3QPM A;  3TKP A;  1Z5Y E;  2VCW A;  1V98 A;  3UVT A;  4XRD A;  2NPB A;  5ECM B;  3M0F A;  1PX7 A;  3C1S A;  1YF0 A;  1M99 A;  2C1Y A;  2V32 A;  2LUS A;  3W8S A;  4POL A;  3AY8 A;  3KH9 A;  5HFI A;  3NZN A;  3GUR A;  4PQH A;  4ECC A;  1GNE A;  5EVO A;  1ACV A;  2PPT A;  1MTC A;  2LEG A;  5DBQ A;  2FWH A;  3HCZ A;  5HFG A;  2AB6 A;  3LXZ A;  5F07 A;  1YQ1 A;  4I2U A;  2I81 A;  5KEJ A;  2P5Q A;  3VPQ A;  1SK1 A;  2P31 A;  4L8E A;  4LMW A;  4I97 A;  5ELA A;  4IQ1 A;  2HYX A;  1USB A;  2B7J A;  2C3N A;  1WMJ A;  2AUV A;  2TIR A;  5AIS A;  3ME7 A;  5GZZ B;  2H74 A;  2L5L A;  3W8J A;  1GLQ A;  3ERF A;  3G7J A;  12GS A;  3GN3 A;  3R2Q A;  2FGX A;  3UBK A;  1ZL9 A;  4F82 A;  2V1M A;  1M3I A;  3HVX A;  3D4T A;  3H4K A;  2LKU A;  1YEP A;  1XWA A;  5ID2 A;  3IDV A;  1PL1 A;  3VK9 A;  5CRW A;  3RAZ A;  4FYC A;  4XS6 A;  3BOA A;  4X1U A;  6GSX A;  2R0P A;  3IAS 2;  2B5X A;  2H66 A;  5DVB A;  5IMF A;  5AIV A;  5EL8 A;  5CP1 A;  3EYT A;  1J9B A;  1DSB A;  1BAY A;  5IMZ A;  4FQU A;  1JLW A;  3UAP A;  2WUL A;  3EVI A;  2CVB A;  4KDU A;  5D9T A;  5LNK e;  1A2J A;  3D0Z A;  4BVY A;  5D93 A;  4WET A;  1O6J A;  2HZE A;  2X8G A;  4AF2 A;  1Z6M A;  3LG6 A;  3ZZX A;  4ZB8 A;  3ERW A;  4ZIJ A;  2YV9 A;  4NAX A;  3Q6O A;  3MIX A;  1S3C A;  3EUR A;  4G9H A;  3ZIV A;  5ECQ B;  3RPN A;  4A5P A;  3KIJ A;  4XHM A;  3NOF A;  2A2R A;  3APO A;  5J9C A;  3BD2 A;  3KTL A;  3TJB A;  4OD7 A;  2JU5 A;  4HQS A;  4EXJ A;  2JZS A;  2M72 A;  3PR8 A;  2ES7 A;  3H79 A;  3LW9 A;  2HE3 A;  4Z2U A;  4K8M A;  1EGO A;  4TOP A;  1OKT A;  5BRT A;  5ENU A; 
#chains in the Genus database with same CATH homology
 1ZZY A;  1ABA A;  3UAR A;  1GUM A;  1EP8 A;  4PXO A;  4RQR A;  4K2D A;  3FRC A;  3O3T A;  1DE1 A;  17GS A;  2JSY A;  4MP4 A;  3R3E A;  2JAD A;  1URM A;  4PX1 A;  4K5S A;  3HKR A;  4TR1 B;  3HDC A;  4GRF A;  1YKA A;  1UN2 A;  2YZH A;  2J9H A;  1DE2 A;  1TRV A;  5IO0 A;  4EDY A;  1E2Y A;  1QUW A;  2GST A;  3WGX A;  1R7H A;  2YOI A;  3C71 A;  2WFC A;  1ZYP A;  1ERT A;  14GS A;  4IP6 A;  4K2X A;  4ICY A;  2CVK A;  4E8H A;  1R4W A;  4IW9 A;  3ZIT A;  2LNT A;  1V57 A;  3A2W A;  1MD3 A;  5H5Q A;  1DBY A;  1DUG A;  3VUR A;  2IN3 A;  3KEB A;  1B9X C;  4KX4 A;  4YQU A;  2N5F A;  1F2E A;  2H73 A;  5DCH A;  1KBN A;  3DXB A;  1M9A A;  4NXI A;  3DEX A;  3CXG A;  3MSZ A;  3ZRE A;  5C04 A;  4I6X A;  1TDI A;  19GS A;  2YN1 A;  1GL8 A;  13GS A;  1HNB A;  3HY2 A;  4HUA A;  2VCV A;  1FOV A;  9GSS A;  1PL2 A;  1GRX A;  4F9Z A;  2C3T A;  3CMI A;  1A8Y A;  3BCK A;  1JZD A;  3RDW A;  1SJI A;  2KLX A;  2LNS A;  4IBP A;  4F2I A;  4ECB A;  3A5I A;  2GLR A;  1H75 A;  2VL9 A;  1GUL A;  1XVQ A;  5IM9 A;  2IIY A;  3E9J B;  4N10 A;  3P90 A;  1AW9 A;  2YP6 A;  1F3B A;  3GHA A;  2HXK A;  2VD1 A;  3RBT A;  4RQX A;  4CDO A;  3LYK A;  4N0V A;  1GSQ A;  3CRT A;  3CSI A;  5KN0 A;  5H5S A;  4DSS B;  4IKH A;  1THO A;  3KGK A;  3M3M A;  2CV4 A;  3IRA A;  2YAN A;  3A2V A;  3F8U A;  2F51 A;  3LSZ A;  4BVX A;  1XW5 A;  5F05 A;  2I3Y A;  1T4Y A;  1F9M A;  1TI1 A;  1ZYQ B;  3FZ5 A;  1OE7 A;  1TU8 A;  3KJY A;  2R0C A;  5D9V A;  3A5W A;  2DC5 A;  3EE2 A;  1U3I A;  3I9V 2;  5CRE A;  4ZL9 A;  3IAM 2;  1ST9 A;  2F9S A;  2KUC A;  3F0I A;  2R6K A;  5DAL A;  4QL7 A;  1QGV A;  4JU5 A;  2H6X A;  3F63 A;  4G0L A;  2MBS A;  4GSN A;  3SWL A;  4OCE A;  4QQ7 A;  3HJM A;  4OMV A;  3C73 A;  1R5A A;  1XBS A;  2B6M A;  3FHK A;  4TRX A;  2OAC A;  3NIV A;  5H5R A;  1EOG A;  4TKY A;  4L0W A;  3J7Y k;  1WJK A;  4OO4 A;  2H0H A;  4KCE A;  1X5E A;  2BJX A;  1VF2 A;  3ZVJ D;  1GSY A;  2QA2 A;  3WD6 A;  1X9M B;  1AQX A;  3QAG A;  2H30 A;  3GX8 A;  3UOM A;  2DKI A;  2OJL A;  1OAZ A;  5IOX A;  1QK8 A;  4KAE A;  3HYP A;  2K8V A;  2VL2 C;  2AHE A;  3KP8 A;  2QA1 A;  5FHI A;  5ABR A;  1FB0 A;  4K7O A;  3A2X A;  5A4V A;  4OFM A;  1T7P B;  4POM A;  2OE3 A;  4L5O A;  2WS2 A;  3PGT A;  4NV2 A;  4EE0 A;  5G1L A;  1Z7R A;  4HDE A;  3UMA A;  1B8X A;  1HYU A;  2BMX A;  2GT5 A;  1SKS B;  1FAA A;  2E7P A;  1KEB A;  3APS A;  5DJM A;  3UEM A;  2GT6 A;  2HSM A;  1JZW A;  3IOS A;  3ZLP A;  1GH2 A;  5AN1 A;  3K8N A;  3ME8 A;  1U88 A;  5E59 A;  1HNA A;  2I9H A;  2AV4 A;  4WR4 A;  1PQN A;  1AUC A;  3CTF A;  2ON7 A;  1SJ6 A;  2MYG A;  1KTE A;  1RW1 A;  4MH2 A;  1FOH A;  4XS4 B;  3CYN A;  3G7Y A;  2H71 A;  2WB9 A;  2H76 A;  4ZB9 A;  1X0R A;  5F06 A;  1TKD B;  3ED3 A;  1ERU A;  3E0U A;  1WWJ A;  1EOH A;  5F8B A;  5CO3 A;  2X4A A;  4V1A p;  3VWU A;  1K0O A;  1GTB A;  1W89 A;  4ACS A;  1K3O A;  1ZYE A;  1SKW B;  1IYH A;  3FR9 A;  1V9W A;  4EL1 A;  4KND A;  1VF4 A;  2IJY A;  1SK2 A;  3TRP A;  2FWG A;  5HFK A;  1GSS A;  2HRA A;  4WEY A;  2GSS A;  1KNG A;  4FIW A;  3TB2 A;  5ECH B;  4AJ7 A;  3G9B A;  1GUH A;  4DVC A;  4MCU A;  2DBC A;  3GUS A;  5IOW A;  4MPG A;  4V2L A;  3GTU A;  1C72 A;  3F3Q A;  1EWX A;  3TOU A;  3CTG A;  5CAX A;  1I5G A;  2WGR A;  2X49 A;  2X64 A;  4MAB A;  4HOJ A;  3DYR A;  2LRC A;  3FYG A;  3GFK A;  5CYY A;  3F6F A;  4JBB A;  4Z2T A;  5JWO B;  4FH8 A;  3EC3 A;  1MDK A;  2CA8 A;  2GSR A;  3IK9 A;  2WCI A;  4MF7 A;  5D96 A;  4OCF A;  4KDY A;  3H93 A;  5AIX A;  2HLS A;  1OC3 A;  1G6W A;  2YWN A;  4ZL7 A;  4PQ1 A;  3TJJ A;  3IBH A;  2GTU A;  3DVX A;  4IEL A;  2H19 A;  2NTO A;  4IHU A;  3QR6 A;  1HNC A;  2H1A A;  11GS A;  1XVW A;  5GAP D;  2G0F A;  2IFQ A;  3QD9 A;  5JCG A;  4ILF A;  2KOK A;  1T1V A;  1WPI A;  4Q5F A;  1VF3 A;  3KMN A;  3WT2 A;  5B8B A;  2Z9S A;  4IGJ A;  2R0G A;  1ZYN A;  5IPG A;  2V6K A;  4YAP A;  2DJ0 A;  3A3T A;  2H0G A;  2MBT A;  2FCH A;  5G2Z A;  3CSJ A;  1XZO A;  1XOB A;  3GSS A;  2VCX A;  1GUK A;  4GF0 A;  1Q4J A;  4I2T A;  2PVQ A;  2VLU A;  1X5C A;  1XW6 A;  4N0Z A;  4RUV A;  2VIM A;  1AIU A;  4F0B A;  2YZU A;  2TRC P;  3HZ4 A;  4WXT A;  3MWH A;  1FVK A;  2GGT A;  3EU3 A;  3IV4 A;  1XWB A;  3I43 A;  4MZW A;  5L71 A;  1XWK A;  3KZQ A;  3VWX A;  1LBK A;  3TRQ A;  1N8J A;  3V1W A;  2IMK A;  2LQQ A;  2VM1 A;  4K6X A;  1T3B A;  4ULX A;  2H0I A;  3FZA A;  4ZIL A;  5JWR B;  2FHE A;  3F3R A;  3ZYW A;  3QAW A;  4TXO A;  5F0G A;  2H70 A;  2LS5 A;  3TJF A;  3E3E A;  2RUF A;  1PRX A;  3TKS C;  1YKC A;  4IQA A;  5IO2 A;  4XS1 A;  2HRF A;  1UA5 A;  3HXS A;  2PWJ A;  4WBR D;  4ECJ A;  1PKW A;  4GWR A;  4ZB6 A;  1TRS A;  3DIE A;  1SKR B;  4WF5 A;  1HD2 A;  4ID0 A;  1ERW A;  4K7I A;  2L4C A;  4O7H A;  8GSS A;  1ZGN A;  4KH7 A;  2L59 A;  1FO5 A;  2K9F A;  1CQG A;  4ZXG A;  1SL2 B;  1OC9 A;  5GSS A;  2UZ8 A;  2EIQ A;  4MF6 A;  2H75 A;  4PGT A;  5IQY A;  3EPT A;  1GTA A;  4ECI A;  4MJE A;  3ISO A;  1SU9 A;  3VWW A;  3QFB C;  18GS A;  1TRU A;  2YCD A;  1BX9 A;  1YEX A;  1U6T A;  5DQS A;  1R5P A;  1B4Q A;  2YWM A;  5B8A A;  3GKN A;  2YV7 A;  2HNL A;  4G2E A;  3HZ8 A;  4K0N A;  3O6T A;  4TW5 A;  5COH A;  16GS A;  1E6B A;  3TDG A;  5INY A;  1GTI A;  2A2S A;  1ZCP A;  3GKM A;  4EO3 A;  2LRT A;  2CZ3 A;  2VCQ A;  4JRR A;  1OVN A;  2NBS A;  1SL1 B;  4PTS A;  3DGQ A;  4JZQ A;  5FT3 A;  4KA0 A;  1XWG A;  3UJ1 A;  5ECK B;  1K0M A;  1VGL A;  2D2Z A;  5KN1 A;  4KGI A;  1OC8 A;  4DEJ A;  5J41 A;  4O32 A;  1LU4 A;  5G1K A;  5HR3 A;  3F4T A;  1UVZ A;  4POB A;  3DVW A;  2AAW A;  1NHY A;  4IVF A;  4RI6 A;  3U6V A;  2KHP A;  3MDK A;  3HJO A;  1Y25 A;  5GAN D;  5DQY A;  2MMO A;  3L9U A;  4AJ8 A;  2C0E A;  1A2L A;  2LST A;  3TCO A;  4L0U A;  4DSQ A;  5BMU A;  3FEU A;  2KP2 A;  2DJ2 A;  3HVS A;  3S9F A;  3DWV A;  4OWY A;  1Z3E A;  2AYT A;  1T4Z A;  1XOA A;  1F6M C;  6GSY A;  2MMZ A;  2KP1 A;  3QCP A;  4JE1 A;  3N9J A;  1WE0 A;  2MZC A;  1K3L A;  4LL1 B;  4HI7 A;  4KSM A;  1EGR A;  3TKR A;  3ZML A;  3GST A;  1J0F A;  5DAK B;  3GH9 A;  5D9X A;  1XCC A;  2OBI A;  2I4A A;  5C00 A;  5HR1 A;  4ZL8 A;  4X4J A;  2VO4 A;  1TK0 B;  5KOX A;  3EIN A;  2FWF A;  4Q5N A;  4USS A;  2C4J A;  4FO5 A;  1EP7 A;  3IC4 A;  1BG5 A;  2XBI A;  3ZMK A;  3KH7 A;  2G2Q A;  5KOW A;  4HZ2 A;  4O5Q A;  4LMV A;  4YKG A;  4HQZ A;  1BYE A;  4K1F A;  3LFL A;  1O7U A;  3WGD A;  3M8N A;  2B5E A;  2M80 A;  1G0T A;  3LYP A;  3TJG A;  2HSY A;  4TR1 A;  1A24 A;  3RPP A;  4MJC A;  1TW9 A;  1WP0 A;  4GXZ A;  4WF4 A;  3FW2 A;  2PVO C;  1PKZ A;  3WT1 A;  4HJ2 A;  4KW6 A;  2YJH A;  3FR3 A;  2PMT A;  1TTZ A;  4MDC A;  3LJR A;  4X0X A;  2GZY A;  4HEA 2;  5G31 A;  2REM A;  2XPD A;  1QFN A;  2C0F A;  2HI7 A;  3ZFL A;  4KUN A;  2NVL A;  2L6D A;  4LLR A;  1MDJ A;  5JWQ B;  1PD2 1;  3EWL A;  1WRY A;  1K3Y A;  1GP1 A;  2N5B A;  2JL4 A;  2CX4 A;  5JCW A;  5CRD A;  1M2D A;  1UC7 A;  4X43 A;  3D5J A;  5DJL A;  2AJQ B;  4P3Y B;  2N5A A;  3GX0 A;  5ECR B;  3BCI A;  5ID2 B;  3RHC A;  3QMX A;  5G5F A;  3CSH A;  1ERV A;  3DKS A;  2LJA A;  1EEJ A;  2A2P A;  3ZL5 A;  2J23 A;  2ON5 A;  1FHE A;  2FA4 A;  1V58 A;  3QOU A;  5IMC A;  1F3A A;  3MAK A;  3P2A A;  5KN2 A;  3F6D A;  2RII A;  3IHQ A;  3W6G A;  1YZX A;  4J56 E;  1XXU A;  4HS1 A;  1A2M A;  3GNJ A;  4BVY B;  3DRN A;  2HSH A;  3LOR A;  2HZE B;  2IME A;  1SJZ A;  2A4H A;  1JLV A;  1GTU A;  5ECL B;  1IYI A;  1TI3 A;  2IMI A;  4BWQ A;  4DSS A;  2E0Q A;  4N11 A;  5B6M A;  2YWI A;  4GST A;  3VFI A;  22GS A;  2EIO A;  1OKD A;  6GSU A;  2H6Y A;  1PN0 A;  4G0K A;  2VUP A;  3L78 A;  1GWC A;  2FNO A;  3GYK A;  4EVM A;  4BWS A;  1O85 A;  5KN3 A;  3I69 A;  5CNW A;  1GSF A;  3GKK A;  2H8L A;  2GVP A;  4I8B A;  3KCM A;  2FUG 2;  1Z9H A;  4MZB A;  5LCZ A;  5DAK A;  2CQ9 A;  2VCT A;  2PN8 A;  2O89 A;  2GSQ A;  2VL2 A;  4KSO A;  5FWG A;  2F8F A;  1AC1 A;  3FY7 A;  4QL9 A;  2QKE A;  3EMP A;  2K6V A;  3ZRD A;  3TKS E;  1ZOF A;  1NW2 A;  1TU7 A;  3KP9 A;  5GST A;  1X9W B;  5ECS A;  3KM6 A;  1I9D A;  1A0F A;  2QC7 A;  1F37 A;  4JED A;  1AXD A;  4ML1 A;  1Y6E A;  1A8L A;  3ZTL A;  3P7X A;  4PQI A;  2BTO T;  1O8W A;  4KDX A;  3C8E A;  2EC4 A;  1OE8 A;  2LJK A;  4JR4 A;  4MH3 A;  1B9Y C;  3PPU A;  4GQC A;  4Q5R A;  2GS3 A;  4MJB A;  2HFD A;  2FLS A;  2PER A;  4OO5 A;  4GQF A;  4LA1 A;  1X5D A;  1GLP A;  2GZZ A;  2H72 A;  3IXR A;  1K0B A;  1XW9 A;  2C80 A;  3HD5 A;  2VCZ A;  4PNF A;  3M9K A;  4OFN A;  1A0R P;  1AAZ A;  4EC0 A;  4D73 B;  2PUK C;  1U87 A;  3WGE A;  4MZC A;  1BJX A;  5ECN B;  1Z7P A;  1ML6 A;  3KTB A;  2XHF A;  2LJR A;  4CW9 A;  3J7Y b;  2OE1 A;  5G5E A;  3L9S A;  2OKA A;  1NM3 A;  2O7K A;  1WIK A;  2C8U A;  1YJ6 A;  2LRN A;  1BQ7 A;  4GLT A;  6GSV A;  7GSS A;  1O81 A;  2O85 A;  2LTK A;  3GL5 A;  3IHG A;  4YKF A;  2H1B A;  1SYR A;  1YY7 A;  2A4V A;  4IJ3 A;  2PBJ A;  2ALB A;  4TR3 A;  4ZBB A;  1NSW A;  2R4V A;  4ML6 A;  4AGS A;  4K7N A;  4XS4 A;  2CZ2 A;  2QGV A;  3H1N A;  2HT9 A;  3GIX A;  3QFA C;  1MDI A;  4CHS A;  1XFL A;  2DJK A;  5HQP A;  4MPF A;  6GSS A;  4NWY A;  4KCA A;  1PA3 A;  4E8E A;  3FK8 A;  3GMF A;  1U3A A;  2XC2 A;  2B1L A;  2VM2 A;  1EV4 A;  2VL3 A;  2NDO A;  4GTU A;  2DLX A;  3O76 A;  2GZP A;  2CVD A;  5CRH A;  4BPY A;  4BVX B;  3C7M A;  2RM5 A;  1PX6 A;  5HR0 A;  2ZCT A;  1X9S B;  1PN9 A;  4XRA A;  5ECO B;  4PUR A;  3HVV A;  3IK7 A;  4WBJ A;  2XBQ A;  3I6A A;  5J3R A;  4MMM A;  1TK8 B;  4MK3 A;  1TXX A;  1SD9 A;  2JSZ A;  1SEN A;  2H01 A;  2IMF A;  5D73 A;  5DAL B;  5EPF A;  1K0A A;  2DML A;  10GS A;  2EIR A;  2O8V B;  5IIZ A;  3Q19 A;  2L6C A;  1O8X A;  2H1G A;  1FW1 A;  2R5G A;  4WR5 A;  4EDZ A;  5CRG A;  3IE3 A;  2GQK A;  2LQO A;  2DJ1 A;  4NPB A;  5IPH A;  3UVH A;  1CQH A;  3TGZ A;  3D6I A;  4NHW A;  3MYD A;  2GQM A;  1G6Y A;  3GL3 A;  2JZR A;  1M0U A;  5A5K A;  2CX3 A;  4KF9 A;  2V2G A;  3EU4 A;  3UL3 A;  4PUA A;  4HJM A;  3M9J A;  4RI7 A;  2DMM A;  4YQV A;  4WKW A;  2MMA A;  3LXT A;  1EEM A;  2OAD A;  3KMO A;  3LGC A;  5IMA A;  2X99 A;  2GDR A;  3PIN A;  4FYU A;  5ELG A;  4YQM A;  3VWV A;  1TOF A;  1WOU A;  3EMX A;  4ZBA A;  5J9B A;  20GS A;  3FMW A;  4J57 E;  5D9W A;  1TK5 B;  5ECP B;  3L4N A;  2HRN A;  5AGY A;  2FWE A;  1B4P A;  4TN8 A;  2VLV A;  6GSW A;  1M2B A;  2YPM A;  4MLY A;  1S3A A;  1GSU A;  1TRW A;  4BL7 B;  2TRX A;  3IC8 A;  1TJD A;  2LV3 A;  1PGT A;  4K9Z A;  4MA9 A;  1O73 A;  1BED A;  2F3M A;  6GST A;  1HQO A;  3M1G A;  1TP9 A;  3TUE A;  5IMD A;  2B5Y A;  3G7I A;  2OA7 A;  2WRT A;  3ZIJ A;  1H4O A;  2B3S A;  1RK4 A;  5DDL A;  4D73 A;  5G30 A;  3CRU A;  1PSQ A;  2RM6 A;  3Q18 A;  4ISD A;  4LL4 B;  2GQL A;  3KXO A;  3ZFB A;  1B48 A;  4L5L A;  2DJ3 A;  1V40 A;  3BBY A;  4GSS A;  4NMU A;  1QMV A;  3TKS A;  2DIZ A;  3QAV A;  3SBC A;  3L0H A;  3PH9 A;  4PNG A;  4HU7 A;  5DCG A;  1T8E B;  4K0G A;  4N30 A;  4EIQ A;  2OBK A;  2ZNM A;  4MF5 A;  3IA1 A;  2ZUP A;  1XWC A;  5J4U A;  3FZ9 A;  2DSA A;  3QDN A;  3VI7 A;  3JCM L;  3GH6 A;  3H8Q A;  1AQV A;  1ON4 A;  3F9U A;  1K0D A;  1QQ2 A;  1M2A A;  3FKF A;  3WYW A;  3US3 A;  2C0D A;  4EUY A;  4JR6 A;  4G19 A;  2E2G A;  5B7C A;  3FR6 A;  1M9B A;  5E4W A;  4PUF C;  3D22 A;  1R26 A;  2I1U A;  3KD0 A;  2DJJ A;  2H1D A;  3GTU B;  5ECI B;  5JCU A;  1XPV A;  3GA4 A;  1S3D A;  3RHB A;  4F0C A;  3LQ7 A;  2O87 A;  4NV5 A;  1GNW A;  4KB3 A;  4O92 A;  3TOT A;  4TVE A;  3DML A;  2IWT A;  5B6N A;  3IPZ A;  4V1A g;  2CAQ A;  2YWO A;  4J2F A;  1NHO A;  2RUE A;  3VI5 A;  3VLN A;  3U5R E;  2JAC A;  3GRX A;  1YDK A;  4TR4 A;  4XIH A;  3APQ A;  2WDU A;  2B7K A;  3F4S A;  4O5U A;  3VPT A;  1Q98 A;  2MMN A;  2R3X A;  4XTS A;  5D8I A;  3L9V A;  1RQM A;  4EKZ A;  1QXH A;  2L4Q A;  2K8S A;  5EY6 A;  5J5N A;  1FG4 A;  4O5R A;  3HA9 A;  2PGT A;  3P8W A;  2R2J A;  1THX A;  3IR4 A;  1Z6N A;  3TKQ A;  1A23 A;  2M46 A;  3TJK A;  2VD0 A;  3FZ4 A;  2PU9 C;  2E2M A;  2L57 A;  2FA8 A;  2IFQ B;  4V2M A;  4MNN A;  1PMT A;  1JZO A;  4ZBD A;  2VLT A;  2JZT A;  4TR0 A;  2P0G A;  1EZK A;  1VF1 A;  2V41 A;  2IPA A;  3GKX A;  2IL3 A;  1JFU A;  4AJ6 A;  4Z7X A;  2VAF A;  2YNX A;  2C3Q A;  1SYX A;  4IJI A;  4MJA A;  3UIW A;  4POK A;  4BL7 A;  2FY6 A;  4FYB A;  2L5O A;  4NHZ A;  4DSR A;  4YAV A;  3LWA A;  4HU9 A;  2FD3 A;  1G7E A;  2V6O A;  5IMV A;  5A4W A;  2HZF A;  1K0C A;  2HRK A;  1VRS D;  3UBL A;  1JZR A;  3D21 A;  4KE3 A;  4OFT A;  1EV9 A;  2XPE A;  2C0G A;  4IS0 A;  3MNG A;  4G0I A;  4GCI A;  1AQW A;  2R37 A;  1ZMA A;  1SD8 A;  1G7O A;  2OE0 A;  4K5R A;  3HJP A;  4BA7 A;  1W4V A;  3ERG A;  4Q5Q A;  4Z2R A;  1FVJ A;  4V2N A;  2B1K A;  1FB6 A;  1GSE A;  4HZ4 A;  1GSD A;  3LEF A;  1T00 A;  2H6Z A;  4CY8 A;  4G10 A;  4TXO B;  2WJU A;  2IMD A;  1SK0 A;  1M7T A;  3TRX A;  2QSI A;  1JHB A;  4TXV A;  3BJ5 A;  4IN0 A;  1J08 A;  1OYJ A;  2WZ9 A;  2YJ7 A;  2DIY A;  4XCS A;  5HR2 A;  4YH2 A;  3CBU A;  2X8C A;  4IP1 A;  4EF0 A;  4F03 A;  1SL0 B;  2CAI A;  3C1R A;  4H86 A;  1MD4 A;  2CT6 A;  3DD3 A;  1XIY A;  3D4M A;  3HHV A;  4I5Q A;  3Q74 A;  2VOC A;  3GV1 A;  2DKH A;  1ILO A;  5LD0 A;  4EIP A;  1MEK A;  3F4R A;  2K18 A;  1V2A A;  1N2A A;  1OC9 B;  2F8A A;  5A4U A;  2P5R A;  3ZVJ A;  4CY6 A;  3OR5 A;  3N5O A;  1LJR A;  2RLI A;  1K0N A;  2X8H A;  1YF1 A;  3QPM A;  3TKP A;  1Z5Y E;  2VCW A;  1V98 A;  3UVT A;  4XRD A;  2NPB A;  5ECM B;  3M0F A;  1PX7 A;  3C1S A;  1YF0 A;  1M99 A;  2C1Y A;  2V32 A;  2LUS A;  3W8S A;  4POL A;  3AY8 A;  3KH9 A;  5HFI A;  3NZN A;  3GUR A;  4PQH A;  4ECC A;  1GNE A;  5EVO A;  1ACV A;  2PPT A;  1MTC A;  2LEG A;  5DBQ A;  2FWH A;  3HCZ A;  5HFG A;  2AB6 A;  3LXZ A;  5F07 A;  1YQ1 A;  4I2U A;  2I81 A;  5KEJ A;  2P5Q A;  3VPQ A;  1SK1 A;  2P31 A;  4L8E A;  4LMW A;  4I97 A;  5ELA A;  4IQ1 A;  2HYX A;  1USB A;  2B7J A;  2C3N A;  1WMJ A;  2AUV A;  2TIR A;  5AIS A;  3ME7 A;  5GZZ B;  2H74 A;  2L5L A;  3W8J A;  1GLQ A;  3ERF A;  3G7J A;  12GS A;  3GN3 A;  3R2Q A;  2FGX A;  3UBK A;  1ZL9 A;  4F82 A;  2V1M A;  3HVX A;  3D4T A;  3H4K A;  2LKU A;  1YEP A;  1XWA A;  5ID2 A;  3IDV A;  1PL1 A;  3VK9 A;  5CRW A;  3RAZ A;  4FYC A;  4XS6 A;  3BOA A;  4X1U A;  6GSX A;  2R0P A;  3IAS 2;  2B5X A;  2H66 A;  5DVB A;  5IMF A;  5AIV A;  5EL8 A;  5CP1 A;  3EYT A;  1J9B A;  1DSB A;  1BAY A;  5IMZ A;  4FQU A;  1JLW A;  3UAP A;  2WUL A;  3EVI A;  2CVB A;  4KDU A;  5D9T A;  5LNK e;  1A2J A;  3D0Z A;  4BVY A;  5D93 A;  4WET A;  1O6J A;  2HZE A;  2X8G A;  4AF2 A;  1Z6M A;  3LG6 A;  3ZZX A;  4ZB8 A;  3ERW A;  4ZIJ A;  2YV9 A;  4NAX A;  3Q6O A;  3MIX A;  1S3C A;  3EUR A;  4G9H A;  3ZIV A;  5ECQ B;  3RPN A;  4A5P A;  3KIJ A;  4XHM A;  3NOF A;  2A2R A;  3APO A;  5J9C A;  3BD2 A;  3KTL A;  3TJB A;  4OD7 A;  2JU5 A;  4HQS A;  4EXJ A;  2JZS A;  2M72 A;  3PR8 A;  2ES7 A;  3H79 A;  3LW9 A;  2HE3 A;  4Z2U A;  4K8M A;  1EGO A;  4TOP A;  1OKT A;  5BRT A;  5ENU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...