1I5GA

Tryparedoxin ii complexed with glutathionylspermidine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
144
structure length
144
Chain Sequence
SGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPSRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN II
publication title Structures of tryparedoxins revealing interaction with trypanothione.
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 42
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1i5gA00
5J41A 1XWAA 4MF7A 1VRSD 3VK9A 3ZTLA 1XCCA 4NV5A 1X0RA 3TKRA 4DSSA 5IOXA 2MMZA 3HZ8A 3CSJA 3KXOA 3QMXA 1U87A 3GH6A 3QR6A 5ECOB 3FR9A 4TW5A 2OKAA 2P0GA 1BG5A 1VF2A 5JCGA 2HT9A 3G7YA 1SYRA 3VURA 3KM6A 3E3EA 2FUG2 1S3CA 2WCIA 5IMAA 2A2RA 3Q74A 3VLNA 2GT5A 2WB9A 3UVHA 2ON5A 6GSVA 2C0DA 1XBSA 3H1NA 1TJDA 1UA5A 2NBSA 2IWTA 4EE0A 2B5YA 5IIZA 2FA8A 4ZL7A 2EIRA 1ZCPA 1A23A 5KN3A 1X5CA 4N30A 5JCUA 5F05A 4XS6A 2Z9SA 1K0AA 5LNKe 1TK0B 1SK2A 1UVZA 2WFCA 4RI7A 3FY7A 3GUSA 5CNWA 3Q18A 3ED3A 3LWAA 5AIXA 1YF1A 1JZOA 3HXSA 1T1VA 2JACA 4Q5QA 2H70A 2R2JA 1GH2A 3ERFA 3GSSA 3LG6A 4K1FA 3J7Yk 2IFQB 4HJMA 4PQIA 3RHCA 2DMLA 1U3IA 5E59A 1NHOA 1GUKA 5COHA 4ZB6A 4IELA 1GTAA 4EL1A 3GTUB 4N10A 4WKWA 1G6WA 1TK5B 4ZBAA 1OC8A 3IXRA 2M46A 4XRDA 4F0CA 14GSA 2HRFA 1NHYA 5H5QA 5LCZA 1PSQA 5ECMB 4LL4B 1AAZA 1O8XA 4ECBA 4GSTA 2VLVA 3DXBA 3KGKA 2LKUA 2QC7A 3UOMA 4IKHA 1TRVA 2C0GA 3I6AA 4NMUA 1FO5A 4LMWA 4L5LA 3KJYA 2HXKA 5FWGA 3VWUA 1WWJA 1Z9HA 2VD0A 2LNTA 3E9JB 4RI6A 4XHMA 2GQKA 5CYYA 4KX4A 3TJKA 2A2SA 3GNJA 4TXVA 4GF0A 1G7EA 3GRXA 2VL3A 1AXDA 1EZKA 2FGXA 3D21A 3W8JA 1GSQA 9GSSA 1T4ZA 2XHFA 1YY7A 1MDIA 4L0WA 3GIXA 4KH7A 5DCHA 2FWHA 2K9FA 5DJLA 2IMDA 3C1SA 1C72A 1QK8A 1SJ6A 7GSSA 3NOFA 2IJYA 1A2MA 2LJRA 4MMMA 4F82A 3IV4A 2CQ9A 1GP1A 4V1Ap 3TKSE 4OD7A 5J4UA 2G0FA 5B6NA 1T00A 2OJLA 4IHUA 4MZBA 3RAZA 1SKSB 1TRWA 5FT3A 4TRXA 4J56E 4L0UA 3KD0A 2L4CA 1N2AA 3WD6A 4NXIA 2PVOC 5GAND 2AJQB 5H5RA 1A0FA 2AB6A 2E7PA 4ECIA 2JZTA 3KP9A 5ECSA 4DSRA 2VCVA 2OE3A 2HZEA 2FY6A 2RUFA 5F0GA 4BA7A 1V2AA 3VWWA 2VL9A 2R4VA 1F6MC 4JR6A 1ERWA 1JZWA 2O85A 4KSMA 4F2IA 1T7PB 2BJXA 3RPPA 4YQUA 4I97A 2J23A 2OE0A 1X5DA 2V32A 3TGZA 3UMAA 4ECCA 1O73A 3M0FA 3D22A 1LBKA 3UVTA 5EY6A 3EYTA 4OO4A 2XPEA 4MJAA 1EOHA 4ZB8A 3EE2A 1PQNA 2TRCP 1YQ1A 2KHPA 2VL2C 4JRRA 1YJ6A 4PXOA 3ZMLA 1ABAA 2GQMA 5D96A 1YDKA 4TN8A 4POMA 5KN1A 1GSDA 1MD3A 2H72A 2F8FA 4HEA2 5D93A 2F8AA 4WR5A 1PKWA 1RK4A 1FOVA 5AIVA 2DBCA 2CX3A 4MABA 3SBCA 1T3BA 2JSZA 3HJOA 3IC4A 4GWRA 4N11A 3HYPA 5DQSA 4IQAA 1X5EA 3QCPA 17GSA 4I6XA 2B5XA 1KTEA 3EU4A 2HZEB 2P31A 1SD8A 5J9CA 1PX7A 3R2QA 2PWJA 2MMNA 4OCEA 3QFAC 1GSFA 4I2TA 2YV7A 4AGSA 2CAQA 3L9VA 3GKMA 2I9HA 5A4UA 1YEPA 4HS1A 3APQA 4MH3A 1WPIA 4LMVA 1M9AA 1O85A 3GX8A 2C0FA 2H30A 2LTKA 1K0BA 4TR1A 3SWLA 1TRUA 5G1KA 2OE1A 2YNXA 3F6DA 3QDNA 3CMIA 5F07A 11GSA 2F3MA 4FYUA 2REMA 5KN2A 2DJJA 3ZVJD 5INYA 1GNWA 18GSA 2VO4A 2PU9C 1TU8A 5D8IA 2L5LA 2ON7A 5J3RA 4HU9A 1XW5A 3QD9A 4TKYA 2TRXA 3HVXA 5ECHB 2GZYA 1PGTA 3H8QA 3L4NA 1XVQA 2C80A 5LD0A 2AAWA 4ISDA 2WGRA 2H1AA 3C1RA 1EEJA 1Z6NA 2J9HA 1RW1A 1JZRA 1USBA 2H1BA 2R5GA 5CRDA 3KCMA 4E8EA 3HA9A 5ABRA 3WT1A 5DJMA 1W4VA 1ML6A 4DEJA 3F6FA 4EF0A 3GL3A 1RQMA 2V1MA 4TR1B 3KTLA 2YCDA 2YN1A 4HQSA 3F63A 2HYXA 3A2WA 1YKCA 4YAPA 1M2AA 3LFLA 4KCAA 4EXJA 3FR6A 1AC1A 4ZILA 4MJCA 2V6OA 5KEJA 1WOUA 5IMDA 4KNDA 3C73A 3UEMA 3VI5A 5IQYA 3J7Yb 3LYPA 3FYGA 2YANA 3CYNA 2WS2A 1LJRA 2VLUA 4NAXA 4PURA 3WT2A 1SKWB 5GSSA 1AQWA 2H74A 2B7KA 4OFTA 1QXHA 2I1UA 1QGVA 3KMOA 2L4QA 4PQ1A 1HNBA 3PINA 5ELGA 1OKTA 1SL2B 4TVEA 1XOAA 2DLXA 2OBKA 4WF4A 1BX9A 4QL9A 5B7CA 1PX6A 3JCML 1Y6EA 4K6XA 1GTUA 2I4AA 3VWXA 5ID2A 3GHAA 2TIRA 2N5AA 3EINA 4KAEA 3O6TA 4WF5A 1TKDB 3IDVA 1O6JA 1TXXA 5G1LA 4DSQA 1V57A 2VUPA 3FZAA 4ML1A 3TCOA 1THXA 3MWHA 4WXTA 2NDOA 3NZNA 1GTIA 4ZBDA 5EVOA 1XWKA 5H5SA 5ELAA 3O3TA 2H73A 1VF4A 2OA7A 3CRUA 4XTSA 1GLQA 1DUGA 2H1DA 1AQVA 4NPBA 1NSWA 1EOGA 1K0CA 1A2JA 2YWMA 3A2VA 1ZGNA 2LRNA 2PGTA 1XPVA 2ZUPA 3WGXA 4KDYA 3O76A 3VWVA 4G10A 3UBLA 4O32A 5D9VA 4ZXGA 5ID2B 2YJHA 1G7OA 1H4OA 3TJFA 3LXZA 3G9BA 3S9FA 2X8CA 3WGDA 3DIEA 2YZUA 4KGIA 4V2MA 3ZIJA 3HZ4A 2X8GA 2MYGA 2P5QA 4DSSB 2NTOA 1XWBA 3VFIA 1PD21 1GLPA 2LRTA 1VF1A 3RDWA 3LGCA 3KZQA 4PX1A 3ZFBA 3FZ4A 4GSNA 1ZZYA 3P8WA 3TRPA 3U5RE 5IO2A 4ZL8A 2GZZA 2LNSA 2DC5A 3GH9A 4KDXA 2GZPA 2K6VA 3F3RA 2CX4A 5ECPB 2B1KA 2IMKA 1UN2A 3ZLPA 2YWIA 4EC0A 1J0FA 2MBSA 2L59A 3KP8A 4Z7XA 3LYKA 2DJ3A 3DD3A 3CSHA 3A2XA 4ZBBA 1WP0A 2YWNA 2H71A 3Q19A 4MPGA 5IMCA 5CRWA 1EV4A 2BTOT 5CO3A 3F3QA 2H01A 3CBUA 16GSA 2B1LA 2E2GA 2IIYA 2VOCA 1PMTA 3LEFA 1YKAA 3GMFA 3QAGA 4Q5NA 3VPTA 4JR4A 3QOUA 2MMOA 5HR1A 1FW1A 2LQQA 4K7NA 5C04A 3ERGA 4H86A 2VCZA 4EKZA 3W8SA 1K3OA 4HQZA 1K0DA 4OCFA 2L5OA 2V2GA 5AGYA 2DJ1A 2LSTA 2LRCA 3HY2A 1AIUA 5HQPA 3ISOA 3EVIA 2LUSA 1V58A 2GSRA 3IRAA 4AF2A 3DYRA 4PUAA 4XS4A 4XCSA 2MMAA 4RUVA 5DQYA 1M0UA 1GTBA 1SL0B 1M99A 1EWXA 4IJ3A 2CV4A 3IHQA 4K0NA 1HNAA 1M2DA 2FD3A 1PL1A 2GTUA 4KUNA 3M9KA 4GCIA 1XZOA 2H75A 5EL8A 1B4QA 1PRXA 2DSAA 1EGRA 3KTBA 4LA1A 2X8HA 3MNGA 1G0TA 3H4KA 2OACA 1GSUA 1EGOA 3CRTA 3GA4A 4HJ2A 4ID0A 2H76A 1FHEA 3IBHA 2C4JA 3IA1A 1SYXA 4MH2A 4X1UA 3L0HA 4EO3A 3ME7A 1XWCA 1ZOFA 4HDEA 1R7HA 5EPFA 1WE0A 1TDIA 3F4RA 2C8UA 1XFLA 5DVBA 3UARA 3F9UA 2X64A 1XVWA 5HR2A 3IK9A 5JWRB 2BMXA 1OVNA 2B7JA 2KP2A 2R37A 2H6YA 3BD2A 4PQHA 2K8SA 3F0IA 4KCEA 2C3QA 4NWYA 2LS5A 5A4VA 2LV3A 5IPHA 2RUEA 3BCIA 3HVVA 1NW2A 2CAIA 20GSA 4MLYA 1T8EB 4EDYA 1EP7A 4PNGA 3RBTA 2PBJA 2O8VB 3TJBA 2GSTA 3FK8A 5IO0A 4KA0A 3GKXA 2DIZA 2B5EA 2RM5A 3CXGA 5DDLA 2K8VA 3PH9A 1MD4A 2HRNA 2ZNMA 2D2ZA 1ON4A 3M3MA 2CVDA 1MEKA 3CTFA 3G7JA 6GSTA 3EWLA 3GURA 3U6VA 4GXZA 4X43A 5KN0A 1ERVA 2WRTA 2RM6A 2I3YA 4TXOA 2QKEA 1HNCA 1XW6A 2WULA 1BQ7A 4NV2A 1F9MA 3OR5A 3IK7A 4GLTA 2KLXA 1GSSA 2FWGA 3IAS2 1O7UA 4IP6A 5CP1A 2HLSA 5HFIA 4K9ZA 1V98A 1LU4A 3VI7A 3F4TA 5E4WA 2CVKA 1KBNA 3GSTA 1NM3A 3M1GA 2PN8A 1JZDA 3P7XA 5GSTA 2PERA 1FVKA 2H6XA 2GQLA 3C8EA 4EUYA 5IPGA 3L9UA 1FAAA 5C00A 5DBQA 3QAWA 1GL8A 10GSA 4KSOA 2A4VA 5IOWA 3LORA 5B8AA 1Q4JA 4WBRD 2H6ZA 3LXTA 4IS0A 2DJKA 2V6KA 2YWOA 2JSYA 2H1GA 4I2UA 3WGEA 3HD5A 4OMVA 1GSEA 5FHIA 4EDZA 1ACVA 4TXOB 3L78A 4IP1A 1F2EA 2C3TA 4WEYA 2MBTA 4MPFA 5J9BA 1ILOA 5B8BA 4TR4A 4V1Ag 2VAFA 1MTCA 3UBKA 3E0UA 3PGTA 3G7IA 1U88A 3TB2A 3US3A 5ENUA 1SJZA 1OE8A 3ZL5A 2M72A 4RQRA 1U6TA 1XXUA 3BCKA 4CDOA 1EP8A 1GUMA 2LEGA 2N5BA 4TR3A 2LJKA 4QQ7A 2ALBA 3FZ5A 1TI3A 1F37A 1W89A 4P3YB 2E2MA 1AQXA 3MAKA 5CAXA 4K2DA 2O89A 2N5FA 3QPMA 5ECRB 1BAYA 2YZHA 3IPZA 5DCGA 3NIVA 1ZL9A 3APSA 3LJRA 2ES7A 3TDGA 1DBYA 4O7HA 2VL2A 4GRFA 4MCUA 4KW6A 1XOBA 1TTZA 3TKSA 2IMFA 2L6DA 2K18A 1A8YA 3EMPA 2HSHA 4YAVA 3ZFLA 2EIQA 12GSA 2E0QA 1YF0A 3MSZA 3HJMA 3I69A 1OKDA 2O87A 4IJIA 1IYIA 1O8WA 6GSWA 5G5FA 5D9TA 2YPMA 3FEUA 3IE3A 1KEBA 4EVMA 4HUAA 3FHKA 1R5PA 1SU9A 4YQVA 4BWSA 4JEDA 1JFUA 5AN1A 2F51A 3P2AA 4OFMA 4IGJA 3TRXA 1EEMA 1PN9A 2JZSA 1I9DA 4MZCA 3GN3A 1AUCA 1PKZA 2VD1A 3DVXA 2ZCTA 3ERWA 2L6CA 2DJ0A 3I43A 22GSA 1B8XA 6GSXA 4L5OA 1V9WA 1TRSA 5G31A 2OBIA 3F8UA 3C7MA 5HFGA 1A24A 2H66A 13GSA 4O5RA 1E2YA 2IMEA 3N9JA 2IFQA 3A3TA 3D4TA 3HHVA 4J2FA 1OC9A 1O81A 4MJBA 4MF5A 1ZMAA 3CTGA 3FW2A 2C3NA 4ZIJA 3HVSA 4ACSA 5IM9A 3MDKA 3GV1A 3GTUA 4BL7A 3QFBC 3ZZXA 4E8HA 1G6YA 2AYTA 2EIOA 4FYBA 3EMXA 3KEBA 2G2QA 4TR0A 2WZ9A 1Z7RA 3BOAA 1FB0A 4OWYA 5ECQB 3AY8A 2YP6A 1Z3EA 1VF3A 2HI7A 2GS3A 2M80A 3DRNA 1QQ2A 2PMTA 1M9BA 5IMVA 4PNFA 1A2LA 1ERTA 3TKPA 4GSSA 3Q6OA 4F0BA 2NPBA 4G2EA 1HQOA 1URMA 4XS1A 2I81A 3ZIVA 4POLA 4D73A 4OO5A 2HSYA 1CQGA 1OC9B 1A8LA 3W6GA 2GT6A 1F3BA 3ZRDA 2WDUA 3CSIA 2JU5A 1YZXA 1BEDA 4WBJA 1N8JA 6GSYA 3APOA 2H0HA 5ECKB 2RIIA 2XBQA 4DVCA 5CRGA 1GRXA 1U3AA 1B9XC 2X99A 2AHEA 1CQHA 4AJ8A 2VLTA 2H8LA 1FB6A 5L71A 3ZITA 2RLIA 3D4MA 3DEXA 1OC3A 3H93A 2XC2A 1TK8B 2KP1A 8GSSA 3N5OA 3D5JA 5ECLB 2IPAA 2PPTA 3GL5A 1Y25A 3IOSA 3UL3A 3D0ZA 2R6KA 2LQOA 1SK1A 1TI1A 5A5KA 5JWOB 4FYCA 4D73B 5J5NA 2XBIA 4F9ZA 3EU3A 1K0OA 4ECJA 2C1YA 4CHSA 2IL3A 4J57E 4TOPA 3RPNA 1ST9A 1VGLA 3TOTA 2IMIA 2NVLA 2FLSA 4PUFC 5JWQB 1GULA 2GSQA 4ML6A 1THOA 2MZCA 2H19A 1DE1A 3TRQA 2AV4A 4AJ6A 2HNLA 5ECIB 4HZ4A 1F3AA 2CT6A 2CZ2A 2VCTA 1E6BA 1V40A 4XRAA 3PR8A 4BPYA 1Q98A 2GLRA 4G9HA 4L8EA 5G30A 3L9SA 2H0IA 2V41A 5GZZB 4GTUA 3EURA 4BVYA 2GGTA 4QL7A 1R5AA 1YEXA 2VIMA 2CVBA 2R3XA 4XS4B 1SD9A 1FG4A 1UC7A 4MK3A 4XIHA 2HZFA 3ZVJA 1HYUA 4Q5FA 2B6MA 4YH2A 4MDCA 5AISA 4K8MA 2VM1A 4V2LA 3DWVA 4FO5A 5G2ZA 2QSIA 1TW9A 1Z6MA 3D6IA 4KDUA 1SJIA 1HD2A 4FH8A 2JADA 1PL2A 3BBYA 3LQ7A 4JU5A 5HFKA 2FCHA 2KUCA 4K7OA 3ZMKA 2PVQA 2DIYA 5D9WA 5IMFA 5CREA 3TKSC 4JBBA 3DMLA 2HE3A 2L57A 5HR0A 2VM2A 3KMNA 4HOJA 5HR3A 2F9SA 4YQMA 3FKFA 4IQ1A 4IVFA 2O7KA 5DAKA 2YV9A 3F4SA 1SENA 5G5EA 4CW9A 3ME8A 3DGQA 4ZL9A 1JLWA 1DE2A 1WMJA 2YOIA 3IR4A 2WJUA 4FIWA 5DALA 3GKKA 1XW9A 1SK0A 3UIWA 2CA8A 1I5GA 1WJKA 4KE3A 2FWFA 2IN3A 3KIJA 4ILFA 3HJPA 1Z5YE 1S3DA 4JZQA 3I9V2 4LLRA 2KOKA 2VCWA 1ZYQB 1J9BA 1WRYA 3GFKA 1QUWA 5F06A 1ZYEA 5D9XA 3WYWA 5A4WA 4POBA 1TP9A 3QAVA 3BJ5A 4WR4A 1IYHA 2FWEA 5JCWA 1JLVA 2H0GA 4NHWA 2FNOA 4V2NA 1S3AA 2CZ3A 5DAKB 1DSBA 4OFNA 1Z7PA 3TUEA 1PA3A 1FVJA 1K3YA 4RQXA 3ZREA 2OADA 1BJXA 2AUVA 2YJ7A 4I8BA 1A0RP 1X9WB 2HFDA 1H75A 3FZ9A 5DALB 4AJ7A 3FR3A 3KH9A 3DVWA 3LSZA 4HZ2A 3GX0A 1XWGA 5F8BA 1R26A 1BYEA 1QFNA 4N0ZA 4IW9A 1XIYA 4IBPA 4N0VA 3HCZA 3C71A 1SKRB 3FRCA 1X9SB 4GQFA 4BWQA 3TKQA 1QMVA 1JHBA 3H79A 4LL1B 2JZRA 4BVXA 1M2BA 4X0XA 1R4WA 1GNEA 3K8NA 2DMMA 3TOUA 5D73A 3P90A 4I5QA 5B6MA 5ECNB 2QGVA 5GAPD 1MDJA 2XPDA 4MP4A 3GKNA 4PGTA 3TJJA 3UJ1A 1M7TA 3A5WA 4KB3A 6GSSA 4MA9A 4O92A 2GDRA 1TU7A 2LJAA 3V1WA 1ERUA 3IAM2 1K0NA 4Q5RA 2VCQA 2PUKC 5IMZA 2B3SA 1TOFA 4K0GA 4MF6A 1OYJA 1K0MA 3KH7A 3EC3A 4ULXA 1SL1B 3HKRA 4JE1A 1GWCA 4POKA 4NHZA 1T4YA 3TJGA 4HI7A 1B48A 2GVPA 2GSSA 4F03A 1J08A 4G19A 3DKSA 1MDKA 4GQCA 2EC4A 1K3LA 2P5RA 3VPQA 2JL4A 3ZYWA 1KNGA 3M8NA 4ZB9A 19GSA 1GUHA 3M9JA 1EV9A 4MZWA 4IN0A 2FHEA 1GSYA 2C0EA 3RHBA 1WIKA 5CRHA 1B4PA 4MJEA 1B9YC 4HU7A 6GSUA 1X9MB 3UAPA 1AW9A 1OAZA 3HDCA 2FA4A 1OE7A 2VCXA 4K7IA 4WETA 2DJ2A 3GYKA
chains in the Genus database with same CATH superfamily
5J41A 1XWAA 4MF7A 1VRSD 3VK9A 3ZTLA 1XCCA 4NV5A 1X0RA 3TKRA 4DSSA 5IOXA 2MMZA 3HZ8A 3CSJA 3KXOA 3QMXA 1U87A 3GH6A 3QR6A 5ECOB 3FR9A 4TW5A 2OKAA 2P0GA 3IC8A 1BG5A 1VF2A 5JCGA 2HT9A 3G7YA 1SYRA 3VURA 3KM6A 3E3EA 2FUG2 1S3CA 2WCIA 5IMAA 2A2RA 3Q74A 3VLNA 2GT5A 1PFOA 4Z2TA 2WB9A 3UVHA 2ON5A 6GSVA 2C0DA 1XBSA 3H1NA 1TJDA 1UA5A 2NBSA 2IWTA 4EE0A 2B5YA 5IIZA 2FA8A 4ZL7A 2EIRA 1ZCPA 1A23A 5KN3A 1X5CA 4N30A 5JCUA 5F05A 4XS6A 1PN0A 2Z9SA 1K0AA 5LNKe 1TK0B 1SK2A 1UVZA 2WFCA 4RI7A 3FY7A 3GUSA 5CNWA 3Q18A 3ED3A 3LWAA 5AIXA 1YF1A 1JZOA 3HXSA 1T1VA 2JACA 4Q5QA 2H70A 2R2JA 1GH2A 3ERFA 3GSSA 3LG6A 4K1FA 3J7Yk 2IFQB 4HJMA 4PQIA 3RHCA 2DMLA 1U3IA 2HRAA 5E59A 1NHOA 1GUKA 5COHA 4ZB6A 4IELA 1GTAA 4EL1A 3GTUB 4N10A 4WKWA 1G6WA 1TK5B 4ZBAA 1OC8A 3IXRA 2M46A 4XRDA 4F0CA 4BIKA 14GSA 2HRFA 1NHYA 5H5QA 5LCZA 1PSQA 3CQFA 5ECMB 4LL4B 1AAZA 1O8XA 4ECBA 4GSTA 2X4AA 2VLVA 3DXBA 3KGKA 2LKUA 2QC7A 3UOMA 4IKHA 1TRVA 2C0GA 3I6AA 4NMUA 1FO5A 4LMWA 4L5LA 3KJYA 2HXKA 5FWGA 4K5SA 3VWUA 1WWJA 1Z9HA 2VD0A 2LNTA 3E9JB 4RI6A 4XHMA 2GQKA 5CYYA 4KX4A 3TJKA 2A2SA 3GNJA 4TXVA 4GF0A 1G7EA 3GRXA 2VL3A 1AXDA 1EZKA 2FGXA 3D21A 3W8JA 1GSQA 9GSSA 1T4ZA 2XHFA 1YY7A 1MDIA 4L0WA 3GIXA 4KH7A 5KOXA 5DCHA 2FWHA 2K9FA 5DJLA 2IMDA 3C1SA 1C72A 3R3EA 1QK8A 1SJ6A 7GSSA 3NOFA 2IJYA 1A2MA 2LJRA 4MMMA 4F82A 5BMUA 3IV4A 2CQ9A 1GP1A 4V1Ap 3TKSE 4OD7A 5J4UA 2G0FA 5B6NA 1T00A 2OJLA 4IHUA 4MZBA 3RAZA 1SKSB 1TRWA 5FT3A 4TRXA 4J56E 4L0UA 4PTSA 3KD0A 2L4CA 1N2AA 3WD6A 4NXIA 2PVOC 5GAND 2AJQB 5H5RA 1A0FA 2AB6A 2E7PA 4ECIA 2JZTA 3KP9A 5ECSA 4DSRA 2VCVA 2OE3A 2HZEA 2FY6A 2RUFA 5F0GA 4BA7A 1V2AA 3VWWA 2VL9A 2R4VA 1F6MC 4Z2UA 4JR6A 1ERWA 1JZWA 2O85A 4KSMA 4F2IA 1T7PB 2BJXA 3RPPA 4YQUA 4I97A 2J23A 2OE0A 1X5DA 2V32A 3TGZA 3UMAA 4ECCA 1O73A 3M0FA 3D22A 1LBKA 3UVTA 5EY6A 3EYTA 4OO4A 2XPEA 4MJAA 1EOHA 4ZB8A 3EE2A 1PQNA 2TRCP 1YQ1A 2KHPA 2VL2C 4JRRA 1YJ6A 4PXOA 3ZMLA 1ABAA 2GQMA 5D96A 1YDKA 3LW9A 4TN8A 4POMA 5KN1A 1GSDA 1MD3A 2H72A 2F8FA 4HEA2 5D93A 2F8AA 4WR5A 1PKWA 1RK4A 4A5PA 1FOVA 5AIVA 2DBCA 2CX3A 4MABA 3SBCA 1T3BA 3A5IA 2JSZA 3HJOA 3IC4A 4GWRA 4N11A 3HYPA 5DQSA 4IQAA 1X5EA 1ZYNA 3HVNA 3QCPA 17GSA 4I6XA 2B5XA 1KTEA 3EU4A 2HZEB 2P31A 1SD8A 5J9CA 2R0GA 1PX7A 3R2QA 2PWJA 2MMNA 4OCEA 3QFAC 1GSFA 4I2TA 2YV7A 4AGSA 2CAQA 3L9VA 3GKMA 2I9HA 5A4UA 1YEPA 4HS1A 3APQA 4MH3A 1WPIA 4LMVA 1M9AA 1O85A 2A2PA 3GX8A 2C0FA 2H30A 2LTKA 1K0BA 4TR1A 3SWLA 1TRUA 4USSA 5G1KA 2OE1A 2YNXA 3F6DA 3QDNA 3CMIA 5F07A 11GSA 2F3MA 4FYUA 2REMA 5KN2A 2DJJA 4O5UA 3ZVJD 5INYA 1GNWA 18GSA 2VO4A 2PU9C 1TU8A 4G0LA 5D8IA 2L5LA 2ON7A 5J3RA 4HU9A 1XW5A 3QD9A 4TKYA 2TRXA 3HVXA 5ECHB 2GZYA 1PGTA 3H8QA 3L4NA 1XVQA 4YKFA 2C80A 5LD0A 2AAWA 4ISDA 2WGRA 2H1AA 3C1RA 1EEJA 1Z6NA 2J9HA 1RW1A 1JZRA 1USBA 2H1BA 2R5GA 5CRDA 3KCMA 4E8EA 3HA9A 5ABRA 3WT1A 5DJMA 1W4VA 1ML6A 4DEJA 3F6FA 4EF0A 3GL3A 1RQMA 2V1MA 4TR1B 3KTLA 2YCDA 2YN1A 4HQSA 3F63A 2HYXA 3A2WA 1YKCA 4YAPA 1M2AA 3LFLA 4KCAA 3IHGA 4EXJA 3FR6A 1AC1A 4ZILA 4MJCA 2V6OA 5KEJA 1WOUA 5IMDA 4KNDA 3C73A 3UEMA 3VI5A 5IQYA 3J7Yb 3LYPA 3FYGA 2YANA 3CYNA 2WS2A 1LJRA 2VLUA 4NAXA 4PURA 3WT2A 1SKWB 5GSSA 1AQWA 2H74A 2B7KA 4OFTA 1QXHA 2I1UA 1QGVA 3KMOA 2L4QA 4PQ1A 1HNBA 3PINA 5ELGA 1OKTA 4YKGA 1SL2B 4TVEA 1XOAA 2DLXA 2OBKA 4WF4A 1BX9A 4QL9A 5B7CA 1PX6A 3JCML 1Y6EA 4K6XA 1GTUA 2I4AA 3VWXA 5ID2A 3GHAA 2TIRA 2N5AA 3EINA 4KAEA 3O6TA 4WF5A 1TKDB 3IDVA 1O6JA 1TXXA 5G1LA 4DSQA 1V57A 2VUPA 3FZAA 4ML1A 3TCOA 1THXA 3MWHA 4WXTA 2NDOA 4EIQA 3NZNA 1GTIA 4ZBDA 5EVOA 1XWKA 5H5SA 5ELAA 3O3TA 2H73A 1VF4A 2OA7A 3CRUA 4XTSA 1GLQA 1DUGA 2H1DA 1AQVA 4NPBA 1NSWA 1EOGA 1K0CA 1A2JA 2YWMA 3A2VA 1ZGNA 2LRNA 2PGTA 3EPTA 1XPVA 2ZUPA 3WGXA 4Z2RA 4KDYA 3O76A 3VWVA 4G10A 3UBLA 4O32A 5D9VA 4ZXGA 5ID2B 2YJHA 1G7OA 1H4OA 3TJFA 3LXZA 3G9BA 3S9FA 5KOWA 2X8CA 3WGDA 3DIEA 2YZUA 4KGIA 4V2MA 3ZIJA 3HZ4A 2X8GA 2MYGA 2P5QA 4DSSB 2NTOA 1XWBA 3VFIA 1PD21 1GLPA 2LRTA 1VF1A 3RDWA 3LGCA 3KZQA 4PX1A 3ZFBA 3FZ4A 4GSNA 1ZZYA 3P8WA 3TRPA 3U5RE 4O5QA 5IO2A 1S3RA 2GZZA 4ZL8A 2QA2A 2LNSA 2DC5A 3GH9A 4KDXA 2GZPA 2K6VA 3F3RA 2CX4A 5ECPB 2B1KA 2IMKA 1UN2A 3ZLPA 2YWIA 4EC0A 1J0FA 2MBSA 2L59A 3KP8A 4Z7XA 3LYKA 2DJ3A 3DD3A 3CSHA 3A2XA 4ZBBA 1WP0A 2YWNA 2H71A 3Q19A 4MPGA 5IMCA 5CRWA 1EV4A 2BTOT 5CO3A 3F3QA 2H01A 3CBUA 16GSA 2B1LA 2E2GA 2IIYA 2VOCA 1PMTA 3LEFA 1YKAA 3GMFA 3QAGA 4Q5NA 4EIPA 3VPTA 4JR4A 3QOUA 2MMOA 5HR1A 1FW1A 2LQQA 4K7NA 5C04A 3ERGA 4H86A 2VCZA 4EKZA 3W8SA 1K3OA 4HQZA 1K0DA 4OCFA 2L5OA 2V2GA 5AGYA 2QA1A 2DJ1A 2LSTA 2LRCA 3HY2A 1AIUA 5HQPA 5BRTA 3ISOA 3EVIA 2LUSA 1V58A 2GSRA 3IRAA 4AF2A 3DYRA 4PUAA 4XS4A 1XG8A 4XCSA 2MMAA 4RUVA 5DQYA 1M0UA 1GTBA 1SL0B 1M99A 1EWXA 4IJ3A 2CV4A 3IHQA 4K0NA 1HNAA 1M2DA 2FD3A 1PL1A 2GTUA 4KUNA 3M9KA 4GCIA 1XZOA 2H75A 5EL8A 1B4QA 1PRXA 2DSAA 1EGRA 3KTBA 4LA1A 2X8HA 3MNGA 1G0TA 3H4KA 2OACA 1GSUA 1EGOA 3CRTA 3GA4A 4HJ2A 4ID0A 2H76A 1FHEA 3IBHA 2C4JA 3IA1A 1SYXA 4MH2A 2A4HA 4X1UA 3L0HA 4EO3A 3ME7A 1XWCA 1ZOFA 4HDEA 1R7HA 5EPFA 1WE0A 1TDIA 3F4RA 2C8UA 1XFLA 5DVBA 3UARA 3F9UA 2X64A 2HRKA 1XVWA 5HR2A 3IK9A 5JWRB 4K5RA 2BMXA 1OVNA 2B7JA 2KP2A 2R37A 2H6YA 3BD2A 4PQHA 2K8SA 3F0IA 4KCEA 2C3QA 4NWYA 2LS5A 5A4VA 2LV3A 5IPHA 2RUEA 3BCIA 3HVVA 1NW2A 2CAIA 20GSA 4MLYA 1T8EB 4EDYA 1EP7A 4PNGA 3RBTA 2PBJA 2O8VB 3TJBA 2GSTA 3FK8A 5IO0A 4KA0A 3GKXA 2DIZA 2B5EA 2RM5A 3CXGA 5DDLA 2K8VA 3PH9A 1MD4A 2HRNA 4G0KA 2ZNMA 2D2ZA 1ON4A 3M3MA 2CVDA 1MEKA 3CTFA 3G7JA 6GSTA 3EWLA 3GURA 3U6VA 4GXZA 4X43A 5KN0A 1ERVA 2WRTA 2RM6A 2I3YA 4TXOA 2QKEA 1HNCA 1XW6A 2WULA 1BQ7A 4NV2A 1F9MA 3OR5A 3IK7A 4GLTA 2KLXA 1GSSA 2FWGA 3IAS2 1O7UA 4IP6A 5CP1A 2HLSA 2R0CA 5HFIA 4K9ZA 1V98A 1LU4A 3VI7A 3F4TA 5E4WA 2CVKA 1KBNA 3GSTA 1NM3A 1M3JA 2PN8A 3M1GA 1JZDA 3P7XA 5GSTA 2PERA 1FVKA 2H6XA 2GQLA 3C8EA 4EUYA 5IPGA 3L9UA 1FAAA 5C00A 5DBQA 3QAWA 1GL8A 10GSA 4KSOA 2A4VA 5IOWA 3LORA 5B8AA 1Q4JA 4WBRD 2H6ZA 3LXTA 2DKHA 4IS0A 2DJKA 2V6KA 2YWOA 2JSYA 2H1GA 4I2UA 3WGEA 3HD5A 4OMVA 1GSEA 5FHIA 4EDZA 1ACVA 4TXOB 3L78A 4IP1A 1F2EA 2C3TA 4CY8A 4WEYA 2MBTA 4MPFA 5J9BA 1ILOA 5B8BA 4TR4A 3MYDA 4KF9A 4V1Ag 2VAFA 1MTCA 3UBKA 3E0UA 3PGTA 3G7IA 1U88A 3TB2A 3US3A 5ENUA 1SJZA 1OE8A 3ZL5A 2M72A 4RQRA 1U6TA 1XXUA 3BCKA 4CDOA 1EP8A 1GUMA 2LEGA 2N5BA 4TR3A 2LJKA 4QQ7A 2ALBA 3FZ5A 1TI3A 1F37A 1W89A 4P3YB 2E2MA 1AQXA 3MAKA 5CAXA 4K2DA 2O89A 2N5FA 3QPMA 5ECRB 1BAYA 2YZHA 3IPZA 5DCGA 3NIVA 1ZL9A 3APSA 3LJRA 2ES7A 3TDGA 1DBYA 4O7HA 2VL2A 4GRFA 4MCUA 4KW6A 1XOBA 1TTZA 3TKSA 2IMFA 2L6DA 2K18A 1A8YA 3EMPA 2HSHA 4YAVA 3ZFLA 2EIQA 12GSA 2E0QA 1YF0A 3MSZA 3HJMA 1FOHA 3I69A 2X49A 1OKDA 2O87A 4IJIA 1IYIA 1O8WA 6GSWA 5G5FA 5D9TA 2YPMA 3FEUA 3IE3A 1KEBA 4EVMA 4HUAA 3FHKA 1R5PA 1SU9A 4YQVA 4BWSA 4JEDA 1JFUA 5AN1A 2F51A 3P2AA 4OFMA 4IGJA 3TRXA 1EEMA 1PN9A 2JZSA 1I9DA 4MZCA 3GN3A 1AUCA 1PKZA 2VD1A 3DVXA 2ZCTA 3ERWA 2L6CA 2DJ0A 3I43A 22GSA 1B8XA 6GSXA 4L5OA 3PPUA 1V9WA 1TRSA 5G31A 2OBIA 1M3IA 3F8UA 3C7MA 5HFGA 1A24A 2H66A 13GSA 4O5RA 1E2YA 2IMEA 3N9JA 2IFQA 3A3TA 3D4TA 3HHVA 4J2FA 1OC9A 1O81A 4MJBA 4MF5A 1ZMAA 3CTGA 3FW2A 2C3NA 4ZIJA 3HVSA 4ACSA 5IM9A 3MDKA 3GV1A 3GTUA 4BL7A 3QFBC 3ZZXA 4E8HA 1G6YA 2AYTA 2EIOA 4FYBA 3EMXA 3KEBA 2G2QA 4TR0A 2WZ9A 1Z7RA 3BOAA 1FB0A 4OWYA 5ECQB 3AY8A 2YP6A 1Z3EA 1VF3A 2HI7A 2GS3A 2M80A 3DRNA 1QQ2A 2PMTA 1M9BA 5IMVA 4PNFA 1A2LA 1ERTA 3TKPA 4GSSA 3Q6OA 2UZ8A 4F0BA 2NPBA 4G2EA 1HQOA 1URMA 4XS1A 2I81A 3ZIVA 4POLA 4D73A 4OO5A 2HSYA 1CQGA 1OC9B 1A8LA 3W6GA 2GT6A 1F3BA 3ZRDA 2WDUA 3CSIA 2JU5A 1YZXA 1BEDA 4WBJA 1N8JA 6GSYA 3APOA 2H0HA 5ECKB 2RIIA 2XBQA 4DVCA 5CRGA 3FMWA 4BL7B 1GRXA 1U3AA 1B9XC 2X99A 2AHEA 2DKIA 1CQHA 4AJ8A 2VLTA 2H8LA 1FB6A 5L71A 3ZITA 2RLIA 3D4MA 3DEXA 1OC3A 3H93A 2XC2A 1TK8B 2KP1A 8GSSA 3N5OA 3D5JA 5ECLB 2IPAA 2PPTA 3GL5A 1Y25A 3IOSA 3UL3A 4ICYA 3D0ZA 2R6KA 2LQOA 1SK1A 1TI1A 5A5KA 5JWOB 4FYCA 4D73B 5J5NA 2XBIA 4F9ZA 3EU3A 1K0OA 4ECJA 2C1YA 4CHSA 2IL3A 4J57E 4TOPA 3RPNA 1ST9A 1VGLA 4HSCX 3TOTA 2IMIA 2NVLA 2FLSA 4PUFC 5JWQB 1GULA 2GSQA 4ML6A 1THOA 2MZCA 2H19A 1DE1A 3TRQA 2AV4A 4AJ6A 2HNLA 5ECIB 4HZ4A 1F3AA 2CT6A 2CZ2A 2VCTA 1E6BA 1V40A 4XRAA 3PR8A 4BPYA 1Q98A 2GLRA 4G9HA 4L8EA 5G30A 3L9SA 2H0IA 2V41A 5GZZB 4GTUA 3EURA 4BVYA 2GGTA 4QL7A 1R5AA 1YEXA 2VIMA 2CVBA 2R3XA 4XS4B 1SD9A 1FG4A 1UC7A 4MK3A 4K2XA 4XIHA 2HZFA 3ZVJA 1HYUA 4Q5FA 2B6MA 4YH2A 4MDCA 5AISA 4K8MA 2VM1A 4V2LA 3DWVA 4FO5A 5G2ZA 2QSIA 1TW9A 1Z6MA 3D6IA 4KDUA 1SJIA 1HD2A 4FH8A 2JADA 1PL2A 3BBYA 3LQ7A 4JU5A 5HFKA 2FCHA 2KUCA 4K7OA 3ZMKA 2PVQA 2DIYA 5D9WA 5IMFA 5CREA 3MIXA 3TKSC 4JBBA 3DMLA 2HE3A 2L57A 5HR0A 2VM2A 4BVYB 3KMNA 4HOJA 5HR3A 2F9SA 4YQMA 3FKFA 4IQ1A 4IVFA 2O7KA 5DAKA 2YV9A 3F4SA 1SENA 5G5EA 4CW9A 3ME8A 3DGQA 4ZL9A 1JLWA 1DE2A 1WMJA 2YOIA 1ZYPA 3IR4A 2WJUA 4FIWA 5DALA 3GKKA 1XW9A 1SK0A 3UIWA 2CA8A 1I5GA 1WJKA 4KE3A 2FWFA 2IN3A 3KIJA 4ILFA 3HJPA 1Z5YE 1S3DA 4JZQA 3I9V2 4LLRA 2KOKA 2VCWA 1ZYQB 1J9BA 1WRYA 3GFKA 1QUWA 5F06A 1ZYEA 5D9XA 3WYWA 5A4WA 4POBA 1TP9A 3QAVA 3BJ5A 4WR4A 1IYHA 4G0IA 2FWEA 5JCWA 1JLVA 2H0GA 4NHWA 2FNOA 4V2NA 1S3AA 2CZ3A 5DAKB 1DSBA 4OFNA 1Z7PA 3TUEA 1PA3A 1FVJA 1K3YA 4RQXA 3ZREA 2HSMA 2OADA 1BJXA 2AUVA 2YJ7A 4I8BA 1A0RP 1X9WB 2HFDA 1H75A 3FZ9A 5DALB 4MNNA 4AJ7A 3FR3A 3KH9A 3DVWA 3LSZA 4HZ2A 3GX0A 1XWGA 5F8BA 1R26A 1BYEA 1QFNA 4N0ZA 4IW9A 1XIYA 4IBPA 4N0VA 3HCZA 3C71A 1SKRB 3FRCA 4FQUA 4GQFA 1X9SB 4BWQA 3TKQA 1QMVA 1JHBA 3H79A 4LL1B 2JZRA 4BVXA 1M2BA 4X0XA 1R4WA 1GNEA 3K8NA 2DMMA 3TOUA 3P90A 5D73A 4I5QA 5B6MA 5ECNB 2QGVA 5GAPD 1MDJA 2XPDA 4MP4A 3GKNA 4PGTA 3TJJA 3UJ1A 1M7TA 3A5WA 4KB3A 6GSSA 4MA9A 4O92A 2GDRA 1TU7A 2LJAA 3V1WA 1ERUA 3IAM2 1K0NA 4Q5RA 2VCQA 2PUKC 5IMZA 2B3SA 4X4JA 1TOFA 4K0GA 4MF6A 1OYJA 1K0MA 3KH7A 3EC3A 4ULXA 1SL1B 3HKRA 4JE1A 1GWCA 4POKA 4NHZA 1T4YA 3TJGA 4HI7A 1B48A 2GVPA 2GSSA 4F03A 1J08A 4G19A 3DKSA 1MDKA 4GQCA 2EC4A 1K3LA 2P5RA 3VPQA 2JL4A 3ZYWA 1KNGA 3M8NA 4ZB9A 19GSA 1GUHA 3M9JA 1EV9A 4CY6A 4MZWA 2R0PA 4IN0A 2FHEA 1GSYA 2C0EA 3RHBA 4BVXB 1WIKA 5CRHA 1B4PA 4MJEA 1B9YC 4HU7A 6GSUA 1X9MB 3UAPA 1AW9A 1OAZA 3HDCA 2FA4A 1OE7A 2VCXA 4K7IA 4WETA 2DJ2A 3GYKA
chains in the Genus database with same CATH topology
5J41A 1XWAA 4MF7A 1VRSD 3VK9A 3ZTLA 1XCCA 4NV5A 1X0RA 3TKRA 4DSSA 5IOXA 2MMZA 3HZ8A 3CSJA 3KXOA 3QMXA 1U87A 3GH6A 3QR6A 5ECOB 3FR9A 4TW5A 2OKAA 2P0GA 3IC8A 1BG5A 1VF2A 5JCGA 2HT9A 3G7YA 1SYRA 3VURA 3KM6A 3E3EA 2FUG2 1S3CA 2WCIA 5IMAA 2A2RA 3Q74A 3VLNA 2GT5A 4Z2TA 2WB9A 3UVHA 2ON5A 6GSVA 2C0DA 1XBSA 3H1NA 1TJDA 1UA5A 2NBSA 2IWTA 4EE0A 2B5YA 5IIZA 2FA8A 4ZL7A 2EIRA 1ZCPA 1A23A 5KN3A 1X5CA 4N30A 5JCUA 5F05A 4XS6A 1PN0A 2Z9SA 1K0AA 5LNKe 1TK0B 1SK2A 1UVZA 2WFCA 4RI7A 3FY7A 3GUSA 5CNWA 3Q18A 3ED3A 3LWAA 5AIXA 1YF1A 1JZOA 3HXSA 1T1VA 2JACA 4Q5QA 2H70A 2R2JA 1GH2A 3ERFA 3GSSA 3LG6A 4K1FA 3J7Yk 2IFQB 4HJMA 4PQIA 3RHCA 2DMLA 1U3IA 2HRAA 5E59A 1NHOA 1GUKA 5COHA 4ZB6A 4IELA 1GTAA 4EL1A 3GTUB 4N10A 4WKWA 1G6WA 1TK5B 4ZBAA 1OC8A 3IXRA 2M46A 4XRDA 4F0CA 14GSA 2HRFA 1NHYA 5H5QA 5LCZA 1PSQA 5ECMB 4LL4B 1AAZA 1O8XA 4ECBA 4GSTA 2X4AA 2VLVA 3DXBA 3KGKA 2LKUA 2QC7A 3UOMA 4IKHA 1TRVA 2C0GA 3I6AA 4NMUA 1FO5A 4LMWA 4L5LA 3KJYA 2HXKA 5FWGA 4K5SA 3VWUA 1WWJA 1Z9HA 2VD0A 2LNTA 3E9JB 4RI6A 4XHMA 2GQKA 5CYYA 4KX4A 3TJKA 2A2SA 3GNJA 4TXVA 4GF0A 1G7EA 3GRXA 2VL3A 1AXDA 1EZKA 2FGXA 3D21A 3W8JA 1GSQA 9GSSA 1T4ZA 2XHFA 1YY7A 1MDIA 4L0WA 3GIXA 4KH7A 5KOXA 5DCHA 2FWHA 2K9FA 5DJLA 2IMDA 3C1SA 1C72A 3R3EA 1QK8A 1SJ6A 7GSSA 3NOFA 2IJYA 1A2MA 2LJRA 4MMMA 4F82A 5BMUA 3IV4A 2CQ9A 1GP1A 4V1Ap 3TKSE 4OD7A 5J4UA 2G0FA 5B6NA 1T00A 2OJLA 4IHUA 4MZBA 3RAZA 1SKSB 1TRWA 5FT3A 4TRXA 4J56E 4L0UA 4PTSA 3KD0A 2L4CA 1N2AA 3WD6A 4NXIA 2PVOC 5GAND 2AJQB 5H5RA 1A0FA 2AB6A 2E7PA 4ECIA 2JZTA 3KP9A 5ECSA 4DSRA 2VCVA 2OE3A 2HZEA 2FY6A 2RUFA 5F0GA 4BA7A 1V2AA 3VWWA 2VL9A 2R4VA 1F6MC 4Z2UA 4JR6A 1ERWA 1JZWA 2O85A 4KSMA 4F2IA 1T7PB 2BJXA 3RPPA 4YQUA 4I97A 2J23A 2OE0A 1X5DA 2V32A 3TGZA 3UMAA 4ECCA 1O73A 3M0FA 3D22A 1LBKA 3UVTA 5EY6A 3EYTA 4OO4A 2XPEA 4MJAA 1EOHA 4ZB8A 3EE2A 1PQNA 2TRCP 1YQ1A 2KHPA 2VL2C 4JRRA 1YJ6A 4PXOA 3ZMLA 1ABAA 2GQMA 5D96A 1YDKA 3LW9A 4TN8A 4POMA 5KN1A 1GSDA 1MD3A 2H72A 2F8FA 4HEA2 5D93A 2F8AA 4WR5A 1PKWA 1RK4A 4A5PA 1FOVA 5AIVA 2DBCA 2CX3A 4MABA 3SBCA 1T3BA 3A5IA 2JSZA 3HJOA 3IC4A 4GWRA 4N11A 3HYPA 5DQSA 4IQAA 1X5EA 1ZYNA 3QCPA 17GSA 4I6XA 2B5XA 1KTEA 3EU4A 2HZEB 2P31A 1SD8A 5J9CA 2R0GA 1PX7A 3R2QA 2PWJA 2MMNA 4OCEA 3QFAC 1GSFA 4I2TA 2YV7A 4AGSA 2CAQA 3L9VA 3GKMA 2I9HA 5A4UA 1YEPA 4HS1A 3APQA 4MH3A 1WPIA 4LMVA 1M9AA 1O85A 2A2PA 3GX8A 2C0FA 2H30A 2LTKA 1K0BA 4TR1A 3SWLA 1TRUA 4USSA 5G1KA 2OE1A 2YNXA 3F6DA 3QDNA 3CMIA 5F07A 11GSA 2F3MA 4FYUA 2REMA 5KN2A 2DJJA 4O5UA 3ZVJD 5INYA 1GNWA 18GSA 2VO4A 2PU9C 1TU8A 4G0LA 5D8IA 2L5LA 2ON7A 5J3RA 4HU9A 1XW5A 3QD9A 4TKYA 2TRXA 3HVXA 5ECHB 2GZYA 1PGTA 3H8QA 3L4NA 1XVQA 4YKFA 2C80A 5LD0A 2AAWA 4ISDA 2WGRA 2H1AA 3C1RA 1EEJA 1Z6NA 2J9HA 1RW1A 1JZRA 1USBA 2H1BA 2R5GA 5CRDA 3KCMA 4E8EA 3HA9A 5ABRA 3WT1A 5DJMA 1W4VA 1ML6A 4DEJA 3F6FA 4EF0A 3GL3A 1RQMA 2V1MA 4TR1B 3KTLA 2YCDA 2YN1A 4HQSA 3F63A 2HYXA 3A2WA 1YKCA 4YAPA 1M2AA 3LFLA 4KCAA 3IHGA 4EXJA 3FR6A 1AC1A 4ZILA 4MJCA 2V6OA 5KEJA 1WOUA 5IMDA 4KNDA 3C73A 3UEMA 3VI5A 5IQYA 3J7Yb 3LYPA 3FYGA 2YANA 3CYNA 2WS2A 1LJRA 2VLUA 4NAXA 4PURA 3WT2A 1SKWB 5GSSA 1AQWA 2H74A 2B7KA 4OFTA 1QXHA 2I1UA 1QGVA 3KMOA 2L4QA 4PQ1A 1HNBA 3PINA 5ELGA 1OKTA 4YKGA 1SL2B 4TVEA 1XOAA 2DLXA 2OBKA 4WF4A 1BX9A 4QL9A 5B7CA 1PX6A 3JCML 1Y6EA 4K6XA 1GTUA 2I4AA 3VWXA 5ID2A 3GHAA 2TIRA 2N5AA 3EINA 4KAEA 3O6TA 4WF5A 1TKDB 3IDVA 1O6JA 1TXXA 5G1LA 4DSQA 1V57A 2VUPA 3FZAA 4ML1A 3TCOA 1THXA 3MWHA 4WXTA 2NDOA 4EIQA 3NZNA 1GTIA 4ZBDA 5EVOA 1XWKA 5H5SA 5ELAA 3O3TA 2H73A 1VF4A 2OA7A 3CRUA 4XTSA 1GLQA 1DUGA 2H1DA 1AQVA 4NPBA 1NSWA 1EOGA 1K0CA 1A2JA 2YWMA 3A2VA 1ZGNA 2LRNA 2PGTA 3EPTA 1XPVA 2ZUPA 3WGXA 4Z2RA 4KDYA 3O76A 3VWVA 4G10A 3UBLA 4O32A 5D9VA 4ZXGA 5ID2B 2YJHA 1G7OA 1H4OA 3TJFA 3LXZA 3G9BA 3S9FA 5KOWA 2X8CA 3WGDA 3DIEA 2YZUA 4KGIA 4V2MA 3ZIJA 3HZ4A 2X8GA 2MYGA 2P5QA 4DSSB 2NTOA 1XWBA 3VFIA 1PD21 1GLPA 2LRTA 1VF1A 3RDWA 3LGCA 3KZQA 4PX1A 3ZFBA 3FZ4A 4GSNA 1ZZYA 3P8WA 3TRPA 3U5RE 4O5QA 5IO2A 4ZL8A 2GZZA 2QA2A 2LNSA 2DC5A 3GH9A 4KDXA 2GZPA 2K6VA 3F3RA 2CX4A 5ECPB 2B1KA 2IMKA 1UN2A 3ZLPA 2YWIA 4EC0A 1J0FA 2MBSA 2L59A 3KP8A 4Z7XA 3LYKA 2DJ3A 3DD3A 3CSHA 3A2XA 4ZBBA 1WP0A 2YWNA 2H71A 3Q19A 4MPGA 5IMCA 5CRWA 1EV4A 2BTOT 5CO3A 3F3QA 2H01A 3CBUA 16GSA 2B1LA 2E2GA 2IIYA 2VOCA 1PMTA 3LEFA 1YKAA 3GMFA 3QAGA 4Q5NA 4EIPA 3VPTA 4JR4A 3QOUA 2MMOA 5HR1A 1FW1A 2LQQA 4K7NA 5C04A 3ERGA 4H86A 2VCZA 4EKZA 3W8SA 1K3OA 4HQZA 1K0DA 4OCFA 2L5OA 2V2GA 5AGYA 2QA1A 2DJ1A 2LSTA 2LRCA 3HY2A 1AIUA 5HQPA 5BRTA 3ISOA 3EVIA 2LUSA 1V58A 2GSRA 3IRAA 4AF2A 3DYRA 4PUAA 4XS4A 4XCSA 2MMAA 4RUVA 5DQYA 1M0UA 1GTBA 1SL0B 1M99A 1EWXA 4IJ3A 2CV4A 3IHQA 4K0NA 1HNAA 1M2DA 2FD3A 1PL1A 2GTUA 4KUNA 3M9KA 4GCIA 1XZOA 2H75A 5EL8A 1B4QA 1PRXA 2DSAA 1EGRA 3KTBA 4LA1A 2X8HA 3MNGA 1G0TA 3H4KA 2OACA 1GSUA 1EGOA 3CRTA 3GA4A 4HJ2A 4ID0A 2H76A 1FHEA 3IBHA 2C4JA 3IA1A 1SYXA 4MH2A 2A4HA 4X1UA 3L0HA 4EO3A 3ME7A 1XWCA 1ZOFA 4HDEA 1R7HA 5EPFA 1WE0A 1TDIA 3F4RA 2C8UA 1XFLA 5DVBA 3UARA 3F9UA 2X64A 2HRKA 1XVWA 5HR2A 3IK9A 5JWRB 4K5RA 2BMXA 1OVNA 2B7JA 2KP2A 2R37A 2H6YA 3BD2A 4PQHA 2K8SA 3F0IA 4KCEA 2C3QA 4NWYA 2LS5A 5A4VA 2LV3A 5IPHA 2RUEA 3BCIA 3HVVA 1NW2A 2CAIA 20GSA 4MLYA 1T8EB 4EDYA 1EP7A 4PNGA 3RBTA 2PBJA 2O8VB 3TJBA 2GSTA 3FK8A 5IO0A 4KA0A 3GKXA 2DIZA 2B5EA 2RM5A 3CXGA 5DDLA 2K8VA 3PH9A 1MD4A 2HRNA 4G0KA 2ZNMA 2D2ZA 1ON4A 3M3MA 2CVDA 1MEKA 3CTFA 3G7JA 6GSTA 3EWLA 3GURA 3U6VA 4GXZA 4X43A 5KN0A 1ERVA 2WRTA 2RM6A 2I3YA 4TXOA 2QKEA 1HNCA 1XW6A 2WULA 1BQ7A 4NV2A 1F9MA 3OR5A 3IK7A 4GLTA 2KLXA 1GSSA 2FWGA 3IAS2 1O7UA 4IP6A 5CP1A 2HLSA 2R0CA 5HFIA 4K9ZA 1V98A 1LU4A 3VI7A 3F4TA 5E4WA 2CVKA 1KBNA 3GSTA 1NM3A 3M1GA 2PN8A 1JZDA 3P7XA 5GSTA 2PERA 1FVKA 2H6XA 2GQLA 3C8EA 4EUYA 5IPGA 3L9UA 1FAAA 5C00A 5DBQA 3QAWA 1GL8A 10GSA 4KSOA 2A4VA 5IOWA 3LORA 5B8AA 1Q4JA 4WBRD 2H6ZA 3LXTA 2DKHA 4IS0A 2DJKA 2V6KA 2YWOA 2JSYA 2H1GA 4I2UA 3WGEA 3HD5A 4OMVA 1GSEA 5FHIA 4EDZA 1ACVA 4TXOB 3L78A 4IP1A 1F2EA 2C3TA 4CY8A 4WEYA 2MBTA 4MPFA 5J9BA 1ILOA 5B8BA 4TR4A 3MYDA 4KF9A 4V1Ag 2VAFA 1MTCA 3UBKA 3E0UA 3PGTA 3G7IA 1U88A 3TB2A 3US3A 5ENUA 1SJZA 1OE8A 3ZL5A 2M72A 4RQRA 1U6TA 1XXUA 3BCKA 4CDOA 1EP8A 1GUMA 2LEGA 2N5BA 4TR3A 2LJKA 4QQ7A 2ALBA 3FZ5A 1TI3A 1F37A 1W89A 4P3YB 2E2MA 1AQXA 3MAKA 5CAXA 4K2DA 2O89A 2N5FA 3QPMA 5ECRB 1BAYA 2YZHA 3IPZA 5DCGA 3NIVA 1ZL9A 3APSA 3LJRA 2ES7A 3TDGA 1DBYA 4O7HA 2VL2A 4GRFA 4MCUA 4KW6A 1XOBA 1TTZA 3TKSA 2IMFA 2L6DA 2K18A 1A8YA 3EMPA 2HSHA 4YAVA 3ZFLA 2EIQA 12GSA 2E0QA 1YF0A 3MSZA 3HJMA 1FOHA 3I69A 2X49A 1OKDA 2O87A 4IJIA 1IYIA 1O8WA 6GSWA 5G5FA 5D9TA 2YPMA 3FEUA 3IE3A 1KEBA 4EVMA 4HUAA 3FHKA 1R5PA 1SU9A 4YQVA 4BWSA 4JEDA 1JFUA 5AN1A 2F51A 3P2AA 4OFMA 4IGJA 3TRXA 1EEMA 1PN9A 2JZSA 1I9DA 4MZCA 3GN3A 1AUCA 1PKZA 2VD1A 3DVXA 2ZCTA 3ERWA 2L6CA 2DJ0A 3I43A 22GSA 1B8XA 6GSXA 4L5OA 3PPUA 1V9WA 1TRSA 5G31A 2OBIA 3F8UA 3C7MA 5HFGA 1A24A 2H66A 13GSA 4O5RA 1E2YA 2IMEA 3N9JA 2IFQA 3A3TA 3D4TA 3HHVA 4J2FA 1OC9A 1O81A 4MJBA 4MF5A 1ZMAA 3CTGA 3FW2A 2C3NA 4ZIJA 3HVSA 4ACSA 5IM9A 3MDKA 3GV1A 3GTUA 4BL7A 3QFBC 3ZZXA 4E8HA 1G6YA 2AYTA 2EIOA 4FYBA 3EMXA 3KEBA 2G2QA 4TR0A 2WZ9A 1Z7RA 3BOAA 1FB0A 4OWYA 5ECQB 3AY8A 2YP6A 1Z3EA 1VF3A 2HI7A 2GS3A 2M80A 3DRNA 1QQ2A 2PMTA 1M9BA 5IMVA 4PNFA 1A2LA 1ERTA 3TKPA 4GSSA 3Q6OA 2UZ8A 4F0BA 2NPBA 4G2EA 1HQOA 1URMA 4XS1A 2I81A 3ZIVA 4POLA 4D73A 4OO5A 2HSYA 1CQGA 1OC9B 1A8LA 3W6GA 2GT6A 1F3BA 3ZRDA 2WDUA 3CSIA 2JU5A 1YZXA 1BEDA 4WBJA 1N8JA 6GSYA 3APOA 2H0HA 5ECKB 2RIIA 2XBQA 4DVCA 5CRGA 3FMWA 4BL7B 1GRXA 1U3AA 1B9XC 2X99A 2AHEA 2DKIA 1CQHA 4AJ8A 2VLTA 2H8LA 1FB6A 5L71A 3ZITA 2RLIA 3D4MA 3DEXA 1OC3A 3H93A 2XC2A 1TK8B 2KP1A 8GSSA 3N5OA 3D5JA 5ECLB 2IPAA 2PPTA 3GL5A 1Y25A 3IOSA 3UL3A 4ICYA 3D0ZA 2R6KA 2LQOA 1SK1A 1TI1A 5A5KA 5JWOB 4FYCA 4D73B 5J5NA 2XBIA 4F9ZA 3EU3A 1K0OA 4ECJA 2C1YA 4CHSA 2IL3A 4J57E 4TOPA 3RPNA 1ST9A 1VGLA 3TOTA 2IMIA 2NVLA 2FLSA 4PUFC 5JWQB 1GULA 2GSQA 4ML6A 1THOA 2MZCA 2H19A 1DE1A 3TRQA 2AV4A 4AJ6A 2HNLA 5ECIB 4HZ4A 1F3AA 2CT6A 2CZ2A 2VCTA 1E6BA 1V40A 4XRAA 3PR8A 4BPYA 1Q98A 2GLRA 4G9HA 4L8EA 5G30A 3L9SA 2H0IA 2V41A 5GZZB 4GTUA 3EURA 4BVYA 2GGTA 4QL7A 1R5AA 1YEXA 2VIMA 2CVBA 2R3XA 4XS4B 1SD9A 1FG4A 1UC7A 4MK3A 4K2XA 4XIHA 2HZFA 3ZVJA 1HYUA 4Q5FA 2B6MA 4YH2A 4MDCA 5AISA 4K8MA 2VM1A 4V2LA 3DWVA 4FO5A 5G2ZA 2QSIA 1TW9A 1Z6MA 3D6IA 4KDUA 1SJIA 1HD2A 4FH8A 2JADA 1PL2A 3BBYA 3LQ7A 4JU5A 5HFKA 2FCHA 2KUCA 4K7OA 3ZMKA 2PVQA 2DIYA 5D9WA 5IMFA 5CREA 3MIXA 3TKSC 4JBBA 3DMLA 2HE3A 2L57A 5HR0A 2VM2A 4BVYB 3KMNA 4HOJA 5HR3A 2F9SA 4YQMA 3FKFA 4IQ1A 4IVFA 2O7KA 5DAKA 2YV9A 3F4SA 1SENA 5G5EA 4CW9A 3ME8A 3DGQA 4ZL9A 1JLWA 1DE2A 1WMJA 2YOIA 1ZYPA 3IR4A 2WJUA 4FIWA 5DALA 3GKKA 1XW9A 1SK0A 3UIWA 2CA8A 1I5GA 1WJKA 4KE3A 2FWFA 2IN3A 3KIJA 4ILFA 3HJPA 1Z5YE 1S3DA 4JZQA 3I9V2 4LLRA 2KOKA 2VCWA 1ZYQB 1J9BA 1WRYA 3GFKA 1QUWA 5F06A 1ZYEA 5D9XA 3WYWA 5A4WA 4POBA 1TP9A 3QAVA 3BJ5A 4WR4A 1IYHA 4G0IA 2FWEA 5JCWA 1JLVA 2H0GA 4NHWA 2FNOA 4V2NA 1S3AA 2CZ3A 5DAKB 1DSBA 4OFNA 1Z7PA 3TUEA 1PA3A 1FVJA 1K3YA 4RQXA 3ZREA 2HSMA 2OADA 1BJXA 2AUVA 2YJ7A 4I8BA 1A0RP 1X9WB 2HFDA 1H75A 3FZ9A 5DALB 4MNNA 4AJ7A 3FR3A 3KH9A 3DVWA 3LSZA 4HZ2A 3GX0A 1XWGA 5F8BA 1R26A 1BYEA 1QFNA 4N0ZA 4IW9A 1XIYA 4IBPA 4N0VA 3HCZA 3C71A 1SKRB 3FRCA 4FQUA 4GQFA 1X9SB 4BWQA 3TKQA 1QMVA 1JHBA 3H79A 4LL1B 2JZRA 4BVXA 1M2BA 4X0XA 1R4WA 1GNEA 3K8NA 2DMMA 3TOUA 5D73A 3P90A 4I5QA 5B6MA 5ECNB 2QGVA 5GAPD 1MDJA 2XPDA 4MP4A 3GKNA 4PGTA 3TJJA 3UJ1A 1M7TA 3A5WA 4KB3A 6GSSA 4MA9A 4O92A 2GDRA 1TU7A 2LJAA 3V1WA 1ERUA 3IAM2 1K0NA 4Q5RA 2VCQA 2PUKC 5IMZA 2B3SA 4X4JA 1TOFA 4K0GA 4MF6A 1OYJA 1K0MA 3KH7A 3EC3A 4ULXA 1SL1B 3HKRA 4JE1A 1GWCA 4POKA 4NHZA 1T4YA 3TJGA 4HI7A 1B48A 2GVPA 2GSSA 4F03A 1J08A 4G19A 3DKSA 1MDKA 4GQCA 2EC4A 1K3LA 2P5RA 3VPQA 2JL4A 3ZYWA 1KNGA 3M8NA 4ZB9A 19GSA 1GUHA 3M9JA 1EV9A 4CY6A 4MZWA 2R0PA 4IN0A 2FHEA 1GSYA 2C0EA 3RHBA 4BVXB 1WIKA 5CRHA 1B4PA 4MJEA 1B9YC 4HU7A 6GSUA 1X9MB 3UAPA 1AW9A 1OAZA 3HDCA 2FA4A 1OE7A 2VCXA 4K7IA 4WETA 2DJ2A 3GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J41 A;  1XWA A;  4MF7 A;  1VRS D;  3VK9 A;  3ZTL A;  1XCC A;  4NV5 A;  1X0R A;  3TKR A;  4DSS A;  5IOX A;  2MMZ A;  3HZ8 A;  3CSJ A;  3KXO A;  3QMX A;  1U87 A;  3GH6 A;  3QR6 A;  5ECO B;  3FR9 A;  4TW5 A;  2OKA A;  2P0G A;  1BG5 A;  1VF2 A;  5JCG A;  2HT9 A;  3G7Y A;  1SYR A;  3VUR A;  3KM6 A;  3E3E A;  2FUG 2;  1S3C A;  2WCI A;  5IMA A;  2A2R A;  3Q74 A;  3VLN A;  2GT5 A;  2WB9 A;  3UVH A;  2ON5 A;  6GSV A;  2C0D A;  1XBS A;  3H1N A;  1TJD A;  1UA5 A;  2NBS A;  2IWT A;  4EE0 A;  2B5Y A;  5IIZ A;  2FA8 A;  4ZL7 A;  2EIR A;  1ZCP A;  1A23 A;  5KN3 A;  1X5C A;  4N30 A;  5JCU A;  5F05 A;  4XS6 A;  2Z9S A;  1K0A A;  5LNK e;  1TK0 B;  1SK2 A;  1UVZ A;  2WFC A;  4RI7 A;  3FY7 A;  3GUS A;  5CNW A;  3Q18 A;  3ED3 A;  3LWA A;  5AIX A;  1YF1 A;  1JZO A;  3HXS A;  1T1V A;  2JAC A;  4Q5Q A;  2H70 A;  2R2J A;  1GH2 A;  3ERF A;  3GSS A;  3LG6 A;  4K1F A;  3J7Y k;  2IFQ B;  4HJM A;  4PQI A;  3RHC A;  2DML A;  1U3I A;  5E59 A;  1NHO A;  1GUK A;  5COH A;  4ZB6 A;  4IEL A;  1GTA A;  4EL1 A;  3GTU B;  4N10 A;  4WKW A;  1G6W A;  1TK5 B;  4ZBA A;  1OC8 A;  3IXR A;  2M46 A;  4XRD A;  4F0C A;  14GS A;  2HRF A;  1NHY A;  5H5Q A;  5LCZ A;  1PSQ A;  5ECM B;  4LL4 B;  1AAZ A;  1O8X A;  4ECB A;  4GST A;  2VLV A;  3DXB A;  3KGK A;  2LKU A;  2QC7 A;  3UOM A;  4IKH A;  1TRV A;  2C0G A;  3I6A A;  4NMU A;  1FO5 A;  4LMW A;  4L5L A;  3KJY A;  2HXK A;  5FWG A;  3VWU A;  1WWJ A;  1Z9H A;  2VD0 A;  2LNT A;  3E9J B;  4RI6 A;  4XHM A;  2GQK A;  5CYY A;  4KX4 A;  3TJK A;  2A2S A;  3GNJ A;  4TXV A;  4GF0 A;  1G7E A;  3GRX A;  2VL3 A;  1AXD A;  1EZK A;  2FGX A;  3D21 A;  3W8J A;  1GSQ A;  9GSS A;  1T4Z A;  2XHF A;  1YY7 A;  1MDI A;  4L0W A;  3GIX A;  4KH7 A;  5DCH A;  2FWH A;  2K9F A;  5DJL A;  2IMD A;  3C1S A;  1C72 A;  1QK8 A;  1SJ6 A;  7GSS A;  3NOF A;  2IJY A;  1A2M A;  2LJR A;  4MMM A;  4F82 A;  3IV4 A;  2CQ9 A;  1GP1 A;  4V1A p;  3TKS E;  4OD7 A;  5J4U A;  2G0F A;  5B6N A;  1T00 A;  2OJL A;  4IHU A;  4MZB A;  3RAZ A;  1SKS B;  1TRW A;  5FT3 A;  4TRX A;  4J56 E;  4L0U A;  3KD0 A;  2L4C A;  1N2A A;  3WD6 A;  4NXI A;  2PVO C;  5GAN D;  2AJQ B;  5H5R A;  1A0F A;  2AB6 A;  2E7P A;  4ECI A;  2JZT A;  3KP9 A;  5ECS A;  4DSR A;  2VCV A;  2OE3 A;  2HZE A;  2FY6 A;  2RUF A;  5F0G A;  4BA7 A;  1V2A A;  3VWW A;  2VL9 A;  2R4V A;  1F6M C;  4JR6 A;  1ERW A;  1JZW A;  2O85 A;  4KSM A;  4F2I A;  1T7P B;  2BJX A;  3RPP A;  4YQU A;  4I97 A;  2J23 A;  2OE0 A;  1X5D A;  2V32 A;  3TGZ A;  3UMA A;  4ECC A;  1O73 A;  3M0F A;  3D22 A;  1LBK A;  3UVT A;  5EY6 A;  3EYT A;  4OO4 A;  2XPE A;  4MJA A;  1EOH A;  4ZB8 A;  3EE2 A;  1PQN A;  2TRC P;  1YQ1 A;  2KHP A;  2VL2 C;  4JRR A;  1YJ6 A;  4PXO A;  3ZML A;  1ABA A;  2GQM A;  5D96 A;  1YDK A;  4TN8 A;  4POM A;  5KN1 A;  1GSD A;  1MD3 A;  2H72 A;  2F8F A;  4HEA 2;  5D93 A;  2F8A A;  4WR5 A;  1PKW A;  1RK4 A;  1FOV A;  5AIV A;  2DBC A;  2CX3 A;  4MAB A;  3SBC A;  1T3B A;  2JSZ A;  3HJO A;  3IC4 A;  4GWR A;  4N11 A;  3HYP A;  5DQS A;  4IQA A;  1X5E A;  3QCP A;  17GS A;  4I6X A;  2B5X A;  1KTE A;  3EU4 A;  2HZE B;  2P31 A;  1SD8 A;  5J9C A;  1PX7 A;  3R2Q A;  2PWJ A;  2MMN A;  4OCE A;  3QFA C;  1GSF A;  4I2T A;  2YV7 A;  4AGS A;  2CAQ A;  3L9V A;  3GKM A;  2I9H A;  5A4U A;  1YEP A;  4HS1 A;  3APQ A;  4MH3 A;  1WPI A;  4LMV A;  1M9A A;  1O85 A;  3GX8 A;  2C0F A;  2H30 A;  2LTK A;  1K0B A;  4TR1 A;  3SWL A;  1TRU A;  5G1K A;  2OE1 A;  2YNX A;  3F6D A;  3QDN A;  3CMI A;  5F07 A;  11GS A;  2F3M A;  4FYU A;  2REM A;  5KN2 A;  2DJJ A;  3ZVJ D;  5INY A;  1GNW A;  18GS A;  2VO4 A;  2PU9 C;  1TU8 A;  5D8I A;  2L5L A;  2ON7 A;  5J3R A;  4HU9 A;  1XW5 A;  3QD9 A;  4TKY A;  2TRX A;  3HVX A;  5ECH B;  2GZY A;  1PGT A;  3H8Q A;  3L4N A;  1XVQ A;  2C80 A;  5LD0 A;  2AAW A;  4ISD A;  2WGR A;  2H1A A;  3C1R A;  1EEJ A;  1Z6N A;  2J9H A;  1RW1 A;  1JZR A;  1USB A;  2H1B A;  2R5G A;  5CRD A;  3KCM A;  4E8E A;  3HA9 A;  5ABR A;  3WT1 A;  5DJM A;  1W4V A;  1ML6 A;  4DEJ A;  3F6F A;  4EF0 A;  3GL3 A;  1RQM A;  2V1M A;  4TR1 B;  3KTL A;  2YCD A;  2YN1 A;  4HQS A;  3F63 A;  2HYX A;  3A2W A;  1YKC A;  4YAP A;  1M2A A;  3LFL A;  4KCA A;  4EXJ A;  3FR6 A;  1AC1 A;  4ZIL A;  4MJC A;  2V6O A;  5KEJ A;  1WOU A;  5IMD A;  4KND A;  3C73 A;  3UEM A;  3VI5 A;  5IQY A;  3J7Y b;  3LYP A;  3FYG A;  2YAN A;  3CYN A;  2WS2 A;  1LJR A;  2VLU A;  4NAX A;  4PUR A;  3WT2 A;  1SKW B;  5GSS A;  1AQW A;  2H74 A;  2B7K A;  4OFT A;  1QXH A;  2I1U A;  1QGV A;  3KMO A;  2L4Q A;  4PQ1 A;  1HNB A;  3PIN A;  5ELG A;  1OKT A;  1SL2 B;  4TVE A;  1XOA A;  2DLX A;  2OBK A;  4WF4 A;  1BX9 A;  4QL9 A;  5B7C A;  1PX6 A;  3JCM L;  1Y6E A;  4K6X A;  1GTU A;  2I4A A;  3VWX A;  5ID2 A;  3GHA A;  2TIR A;  2N5A A;  3EIN A;  4KAE A;  3O6T A;  4WF5 A;  1TKD B;  3IDV A;  1O6J A;  1TXX A;  5G1L A;  4DSQ A;  1V57 A;  2VUP A;  3FZA A;  4ML1 A;  3TCO A;  1THX A;  3MWH A;  4WXT A;  2NDO A;  3NZN A;  1GTI A;  4ZBD A;  5EVO A;  1XWK A;  5H5S A;  5ELA A;  3O3T A;  2H73 A;  1VF4 A;  2OA7 A;  3CRU A;  4XTS A;  1GLQ A;  1DUG A;  2H1D A;  1AQV A;  4NPB A;  1NSW A;  1EOG A;  1K0C A;  1A2J A;  2YWM A;  3A2V A;  1ZGN A;  2LRN A;  2PGT A;  1XPV A;  2ZUP A;  3WGX A;  4KDY A;  3O76 A;  3VWV A;  4G10 A;  3UBL A;  4O32 A;  5D9V A;  4ZXG A;  5ID2 B;  2YJH A;  1G7O A;  1H4O A;  3TJF A;  3LXZ A;  3G9B A;  3S9F A;  2X8C A;  3WGD A;  3DIE A;  2YZU A;  4KGI A;  4V2M A;  3ZIJ A;  3HZ4 A;  2X8G A;  2MYG A;  2P5Q A;  4DSS B;  2NTO A;  1XWB A;  3VFI A;  1PD2 1;  1GLP A;  2LRT A;  1VF1 A;  3RDW A;  3LGC A;  3KZQ A;  4PX1 A;  3ZFB A;  3FZ4 A;  4GSN A;  1ZZY A;  3P8W A;  3TRP A;  3U5R E;  5IO2 A;  4ZL8 A;  2GZZ A;  2LNS A;  2DC5 A;  3GH9 A;  4KDX A;  2GZP A;  2K6V A;  3F3R A;  2CX4 A;  5ECP B;  2B1K A;  2IMK A;  1UN2 A;  3ZLP A;  2YWI A;  4EC0 A;  1J0F A;  2MBS A;  2L59 A;  3KP8 A;  4Z7X A;  3LYK A;  2DJ3 A;  3DD3 A;  3CSH A;  3A2X A;  4ZBB A;  1WP0 A;  2YWN A;  2H71 A;  3Q19 A;  4MPG A;  5IMC A;  5CRW A;  1EV4 A;  2BTO T;  5CO3 A;  3F3Q A;  2H01 A;  3CBU A;  16GS A;  2B1L A;  2E2G A;  2IIY A;  2VOC A;  1PMT A;  3LEF A;  1YKA A;  3GMF A;  3QAG A;  4Q5N A;  3VPT A;  4JR4 A;  3QOU A;  2MMO A;  5HR1 A;  1FW1 A;  2LQQ A;  4K7N A;  5C04 A;  3ERG A;  4H86 A;  2VCZ A;  4EKZ A;  3W8S A;  1K3O A;  4HQZ A;  1K0D A;  4OCF A;  2L5O A;  2V2G A;  5AGY A;  2DJ1 A;  2LST A;  2LRC A;  3HY2 A;  1AIU A;  5HQP A;  3ISO A;  3EVI A;  2LUS A;  1V58 A;  2GSR A;  3IRA A;  4AF2 A;  3DYR A;  4PUA A;  4XS4 A;  4XCS A;  2MMA A;  4RUV A;  5DQY A;  1M0U A;  1GTB A;  1SL0 B;  1M99 A;  1EWX A;  4IJ3 A;  2CV4 A;  3IHQ A;  4K0N A;  1HNA A;  1M2D A;  2FD3 A;  1PL1 A;  2GTU A;  4KUN A;  3M9K A;  4GCI A;  1XZO A;  2H75 A;  5EL8 A;  1B4Q A;  1PRX A;  2DSA A;  1EGR A;  3KTB A;  4LA1 A;  2X8H A;  3MNG A;  1G0T A;  3H4K A;  2OAC A;  1GSU A;  1EGO A;  3CRT A;  3GA4 A;  4HJ2 A;  4ID0 A;  2H76 A;  1FHE A;  3IBH A;  2C4J A;  3IA1 A;  1SYX A;  4MH2 A;  4X1U A;  3L0H A;  4EO3 A;  3ME7 A;  1XWC A;  1ZOF A;  4HDE A;  1R7H A;  5EPF A;  1WE0 A;  1TDI A;  3F4R A;  2C8U A;  1XFL A;  5DVB A;  3UAR A;  3F9U A;  2X64 A;  1XVW A;  5HR2 A;  3IK9 A;  5JWR B;  2BMX A;  1OVN A;  2B7J A;  2KP2 A;  2R37 A;  2H6Y A;  3BD2 A;  4PQH A;  2K8S A;  3F0I A;  4KCE A;  2C3Q A;  4NWY A;  2LS5 A;  5A4V A;  2LV3 A;  5IPH A;  2RUE A;  3BCI A;  3HVV A;  1NW2 A;  2CAI A;  20GS A;  4MLY A;  1T8E B;  4EDY A;  1EP7 A;  4PNG A;  3RBT A;  2PBJ A;  2O8V B;  3TJB A;  2GST A;  3FK8 A;  5IO0 A;  4KA0 A;  3GKX A;  2DIZ A;  2B5E A;  2RM5 A;  3CXG A;  5DDL A;  2K8V A;  3PH9 A;  1MD4 A;  2HRN A;  2ZNM A;  2D2Z A;  1ON4 A;  3M3M A;  2CVD A;  1MEK A;  3CTF A;  3G7J A;  6GST A;  3EWL A;  3GUR A;  3U6V A;  4GXZ A;  4X43 A;  5KN0 A;  1ERV A;  2WRT A;  2RM6 A;  2I3Y A;  4TXO A;  2QKE A;  1HNC A;  1XW6 A;  2WUL A;  1BQ7 A;  4NV2 A;  1F9M A;  3OR5 A;  3IK7 A;  4GLT A;  2KLX A;  1GSS A;  2FWG A;  3IAS 2;  1O7U A;  4IP6 A;  5CP1 A;  2HLS A;  5HFI A;  4K9Z A;  1V98 A;  1LU4 A;  3VI7 A;  3F4T A;  5E4W A;  2CVK A;  1KBN A;  3GST A;  1NM3 A;  3M1G A;  2PN8 A;  1JZD A;  3P7X A;  5GST A;  2PER A;  1FVK A;  2H6X A;  2GQL A;  3C8E A;  4EUY A;  5IPG A;  3L9U A;  1FAA A;  5C00 A;  5DBQ A;  3QAW A;  1GL8 A;  10GS A;  4KSO A;  2A4V A;  5IOW A;  3LOR A;  5B8A A;  1Q4J A;  4WBR D;  2H6Z A;  3LXT A;  4IS0 A;  2DJK A;  2V6K A;  2YWO A;  2JSY A;  2H1G A;  4I2U A;  3WGE A;  3HD5 A;  4OMV A;  1GSE A;  5FHI A;  4EDZ A;  1ACV A;  4TXO B;  3L78 A;  4IP1 A;  1F2E A;  2C3T A;  4WEY A;  2MBT A;  4MPF A;  5J9B A;  1ILO A;  5B8B A;  4TR4 A;  4V1A g;  2VAF A;  1MTC A;  3UBK A;  3E0U A;  3PGT A;  3G7I A;  1U88 A;  3TB2 A;  3US3 A;  5ENU A;  1SJZ A;  1OE8 A;  3ZL5 A;  2M72 A;  4RQR A;  1U6T A;  1XXU A;  3BCK A;  4CDO A;  1EP8 A;  1GUM A;  2LEG A;  2N5B A;  4TR3 A;  2LJK A;  4QQ7 A;  2ALB A;  3FZ5 A;  1TI3 A;  1F37 A;  1W89 A;  4P3Y B;  2E2M A;  1AQX A;  3MAK A;  5CAX A;  4K2D A;  2O89 A;  2N5F A;  3QPM A;  5ECR B;  1BAY A;  2YZH A;  3IPZ A;  5DCG A;  3NIV A;  1ZL9 A;  3APS A;  3LJR A;  2ES7 A;  3TDG A;  1DBY A;  4O7H A;  2VL2 A;  4GRF A;  4MCU A;  4KW6 A;  1XOB A;  1TTZ A;  3TKS A;  2IMF A;  2L6D A;  2K18 A;  1A8Y A;  3EMP A;  2HSH A;  4YAV A;  3ZFL A;  2EIQ A;  12GS A;  2E0Q A;  1YF0 A;  3MSZ A;  3HJM A;  3I69 A;  1OKD A;  2O87 A;  4IJI A;  1IYI A;  1O8W A;  6GSW A;  5G5F A;  5D9T A;  2YPM A;  3FEU A;  3IE3 A;  1KEB A;  4EVM A;  4HUA A;  3FHK A;  1R5P A;  1SU9 A;  4YQV A;  4BWS A;  4JED A;  1JFU A;  5AN1 A;  2F51 A;  3P2A A;  4OFM A;  4IGJ A;  3TRX A;  1EEM A;  1PN9 A;  2JZS A;  1I9D A;  4MZC A;  3GN3 A;  1AUC A;  1PKZ A;  2VD1 A;  3DVX A;  2ZCT A;  3ERW A;  2L6C A;  2DJ0 A;  3I43 A;  22GS A;  1B8X A;  6GSX A;  4L5O A;  1V9W A;  1TRS A;  5G31 A;  2OBI A;  3F8U A;  3C7M A;  5HFG A;  1A24 A;  2H66 A;  13GS A;  4O5R A;  1E2Y A;  2IME A;  3N9J A;  2IFQ A;  3A3T A;  3D4T A;  3HHV A;  4J2F A;  1OC9 A;  1O81 A;  4MJB A;  4MF5 A;  1ZMA A;  3CTG A;  3FW2 A;  2C3N A;  4ZIJ A;  3HVS A;  4ACS A;  5IM9 A;  3MDK A;  3GV1 A;  3GTU A;  4BL7 A;  3QFB C;  3ZZX A;  4E8H A;  1G6Y A;  2AYT A;  2EIO A;  4FYB A;  3EMX A;  3KEB A;  2G2Q A;  4TR0 A;  2WZ9 A;  1Z7R A;  3BOA A;  1FB0 A;  4OWY A;  5ECQ B;  3AY8 A;  2YP6 A;  1Z3E A;  1VF3 A;  2HI7 A;  2GS3 A;  2M80 A;  3DRN A;  1QQ2 A;  2PMT A;  1M9B A;  5IMV A;  4PNF A;  1A2L A;  1ERT A;  3TKP A;  4GSS A;  3Q6O A;  4F0B A;  2NPB A;  4G2E A;  1HQO A;  1URM A;  4XS1 A;  2I81 A;  3ZIV A;  4POL A;  4D73 A;  4OO5 A;  2HSY A;  1CQG A;  1OC9 B;  1A8L A;  3W6G A;  2GT6 A;  1F3B A;  3ZRD A;  2WDU A;  3CSI A;  2JU5 A;  1YZX A;  1BED A;  4WBJ A;  1N8J A;  6GSY A;  3APO A;  2H0H A;  5ECK B;  2RII A;  2XBQ A;  4DVC A;  5CRG A;  1GRX A;  1U3A A;  1B9X C;  2X99 A;  2AHE A;  1CQH A;  4AJ8 A;  2VLT A;  2H8L A;  1FB6 A;  5L71 A;  3ZIT A;  2RLI A;  3D4M A;  3DEX A;  1OC3 A;  3H93 A;  2XC2 A;  1TK8 B;  2KP1 A;  8GSS A;  3N5O A;  3D5J A;  5ECL B;  2IPA A;  2PPT A;  3GL5 A;  1Y25 A;  3IOS A;  3UL3 A;  3D0Z A;  2R6K A;  2LQO A;  1SK1 A;  1TI1 A;  5A5K A;  5JWO B;  4FYC A;  4D73 B;  5J5N A;  2XBI A;  4F9Z A;  3EU3 A;  1K0O A;  4ECJ A;  2C1Y A;  4CHS A;  2IL3 A;  4J57 E;  4TOP A;  3RPN A;  1ST9 A;  1VGL A;  3TOT A;  2IMI A;  2NVL A;  2FLS A;  4PUF C;  5JWQ B;  1GUL A;  2GSQ A;  4ML6 A;  1THO A;  2MZC A;  2H19 A;  1DE1 A;  3TRQ A;  2AV4 A;  4AJ6 A;  2HNL A;  5ECI B;  4HZ4 A;  1F3A A;  2CT6 A;  2CZ2 A;  2VCT A;  1E6B A;  1V40 A;  4XRA A;  3PR8 A;  4BPY A;  1Q98 A;  2GLR A;  4G9H A;  4L8E A;  5G30 A;  3L9S A;  2H0I A;  2V41 A;  5GZZ B;  4GTU A;  3EUR A;  4BVY A;  2GGT A;  4QL7 A;  1R5A A;  1YEX A;  2VIM A;  2CVB A;  2R3X A;  4XS4 B;  1SD9 A;  1FG4 A;  1UC7 A;  4MK3 A;  4XIH A;  2HZF A;  3ZVJ A;  1HYU A;  4Q5F A;  2B6M A;  4YH2 A;  4MDC A;  5AIS A;  4K8M A;  2VM1 A;  4V2L A;  3DWV A;  4FO5 A;  5G2Z A;  2QSI A;  1TW9 A;  1Z6M A;  3D6I A;  4KDU A;  1SJI A;  1HD2 A;  4FH8 A;  2JAD A;  1PL2 A;  3BBY A;  3LQ7 A;  4JU5 A;  5HFK A;  2FCH A;  2KUC A;  4K7O A;  3ZMK A;  2PVQ A;  2DIY A;  5D9W A;  5IMF A;  5CRE A;  3TKS C;  4JBB A;  3DML A;  2HE3 A;  2L57 A;  5HR0 A;  2VM2 A;  3KMN A;  4HOJ A;  5HR3 A;  2F9S A;  4YQM A;  3FKF A;  4IQ1 A;  4IVF A;  2O7K A;  5DAK A;  2YV9 A;  3F4S A;  1SEN A;  5G5E A;  4CW9 A;  3ME8 A;  3DGQ A;  4ZL9 A;  1JLW A;  1DE2 A;  1WMJ A;  2YOI A;  3IR4 A;  2WJU A;  4FIW A;  5DAL A;  3GKK A;  1XW9 A;  1SK0 A;  3UIW A;  2CA8 A;  1I5G A;  1WJK A;  4KE3 A;  2FWF A;  2IN3 A;  3KIJ A;  4ILF A;  3HJP A;  1Z5Y E;  1S3D A;  4JZQ A;  3I9V 2;  4LLR A;  2KOK A;  2VCW A;  1ZYQ B;  1J9B A;  1WRY A;  3GFK A;  1QUW A;  5F06 A;  1ZYE A;  5D9X A;  3WYW A;  5A4W A;  4POB A;  1TP9 A;  3QAV A;  3BJ5 A;  4WR4 A;  1IYH A;  2FWE A;  5JCW A;  1JLV A;  2H0G A;  4NHW A;  2FNO A;  4V2N A;  1S3A A;  2CZ3 A;  5DAK B;  1DSB A;  4OFN A;  1Z7P A;  3TUE A;  1PA3 A;  1FVJ A;  1K3Y A;  4RQX A;  3ZRE A;  2OAD A;  1BJX A;  2AUV A;  2YJ7 A;  4I8B A;  1A0R P;  1X9W B;  2HFD A;  1H75 A;  3FZ9 A;  5DAL B;  4AJ7 A;  3FR3 A;  3KH9 A;  3DVW A;  3LSZ A;  4HZ2 A;  3GX0 A;  1XWG A;  5F8B A;  1R26 A;  1BYE A;  1QFN A;  4N0Z A;  4IW9 A;  1XIY A;  4IBP A;  4N0V A;  3HCZ A;  3C71 A;  1SKR B;  3FRC A;  1X9S B;  4GQF A;  4BWQ A;  3TKQ A;  1QMV A;  1JHB A;  3H79 A;  4LL1 B;  2JZR A;  4BVX A;  1M2B A;  4X0X A;  1R4W A;  1GNE A;  3K8N A;  2DMM A;  3TOU A;  5D73 A;  3P90 A;  4I5Q A;  5B6M A;  5ECN B;  2QGV A;  5GAP D;  1MDJ A;  2XPD A;  4MP4 A;  3GKN A;  4PGT A;  3TJJ A;  3UJ1 A;  1M7T A;  3A5W A;  4KB3 A;  6GSS A;  4MA9 A;  4O92 A;  2GDR A;  1TU7 A;  2LJA A;  3V1W A;  1ERU A;  3IAM 2;  1K0N A;  4Q5R A;  2VCQ A;  2PUK C;  5IMZ A;  2B3S A;  1TOF A;  4K0G A;  4MF6 A;  1OYJ A;  1K0M A;  3KH7 A;  3EC3 A;  4ULX A;  1SL1 B;  3HKR A;  4JE1 A;  1GWC A;  4POK A;  4NHZ A;  1T4Y A;  3TJG A;  4HI7 A;  1B48 A;  2GVP A;  2GSS A;  4F03 A;  1J08 A;  4G19 A;  3DKS A;  1MDK A;  4GQC A;  2EC4 A;  1K3L A;  2P5R A;  3VPQ A;  2JL4 A;  3ZYW A;  1KNG A;  3M8N A;  4ZB9 A;  19GS A;  1GUH A;  3M9J A;  1EV9 A;  4MZW A;  4IN0 A;  2FHE A;  1GSY A;  2C0E A;  3RHB A;  1WIK A;  5CRH A;  1B4P A;  4MJE A;  1B9Y C;  4HU7 A;  6GSU A;  1X9M B;  3UAP A;  1AW9 A;  1OAZ A;  3HDC A;  2FA4 A;  1OE7 A;  2VCX A;  4K7I A;  4WET A;  2DJ2 A;  3GYK A; 
#chains in the Genus database with same CATH topology
 5J41 A;  1XWA A;  4MF7 A;  1VRS D;  3VK9 A;  3ZTL A;  1XCC A;  4NV5 A;  1X0R A;  3TKR A;  4DSS A;  5IOX A;  2MMZ A;  3HZ8 A;  3CSJ A;  3KXO A;  3QMX A;  1U87 A;  3GH6 A;  3QR6 A;  5ECO B;  3FR9 A;  4TW5 A;  2OKA A;  2P0G A;  3IC8 A;  1BG5 A;  1VF2 A;  5JCG A;  2HT9 A;  3G7Y A;  1SYR A;  3VUR A;  3KM6 A;  3E3E A;  2FUG 2;  1S3C A;  2WCI A;  5IMA A;  2A2R A;  3Q74 A;  3VLN A;  2GT5 A;  1PFO A;  4Z2T A;  2WB9 A;  3UVH A;  2ON5 A;  6GSV A;  2C0D A;  1XBS A;  3H1N A;  1TJD A;  1UA5 A;  2NBS A;  2IWT A;  4EE0 A;  2B5Y A;  5IIZ A;  2FA8 A;  4ZL7 A;  2EIR A;  1ZCP A;  1A23 A;  5KN3 A;  1X5C A;  4N30 A;  5JCU A;  5F05 A;  4XS6 A;  1PN0 A;  2Z9S A;  1K0A A;  5LNK e;  1TK0 B;  1SK2 A;  1UVZ A;  2WFC A;  4RI7 A;  3FY7 A;  3GUS A;  5CNW A;  3Q18 A;  3ED3 A;  3LWA A;  5AIX A;  1YF1 A;  1JZO A;  3HXS A;  1T1V A;  2JAC A;  4Q5Q A;  2H70 A;  2R2J A;  1GH2 A;  3ERF A;  3GSS A;  3LG6 A;  4K1F A;  3J7Y k;  2IFQ B;  4HJM A;  4PQI A;  3RHC A;  2DML A;  1U3I A;  2HRA A;  5E59 A;  1NHO A;  1GUK A;  5COH A;  4ZB6 A;  4IEL A;  1GTA A;  4EL1 A;  3GTU B;  4N10 A;  4WKW A;  1G6W A;  1TK5 B;  4ZBA A;  1OC8 A;  3IXR A;  2M46 A;  4XRD A;  4F0C A;  4BIK A;  14GS A;  2HRF A;  1NHY A;  5H5Q A;  5LCZ A;  1PSQ A;  3CQF A;  5ECM B;  4LL4 B;  1AAZ A;  1O8X A;  4ECB A;  4GST A;  2X4A A;  2VLV A;  3DXB A;  3KGK A;  2LKU A;  2QC7 A;  3UOM A;  4IKH A;  1TRV A;  2C0G A;  3I6A A;  4NMU A;  1FO5 A;  4LMW A;  4L5L A;  3KJY A;  2HXK A;  5FWG A;  4K5S A;  3VWU A;  1WWJ A;  1Z9H A;  2VD0 A;  2LNT A;  3E9J B;  4RI6 A;  4XHM A;  2GQK A;  5CYY A;  4KX4 A;  3TJK A;  2A2S A;  3GNJ A;  4TXV A;  4GF0 A;  1G7E A;  3GRX A;  2VL3 A;  1AXD A;  1EZK A;  2FGX A;  3D21 A;  3W8J A;  1GSQ A;  9GSS A;  1T4Z A;  2XHF A;  1YY7 A;  1MDI A;  4L0W A;  3GIX A;  4KH7 A;  5KOX A;  5DCH A;  2FWH A;  2K9F A;  5DJL A;  2IMD A;  3C1S A;  1C72 A;  3R3E A;  1QK8 A;  1SJ6 A;  7GSS A;  3NOF A;  2IJY A;  1A2M A;  2LJR A;  4MMM A;  4F82 A;  5BMU A;  3IV4 A;  2CQ9 A;  1GP1 A;  4V1A p;  3TKS E;  4OD7 A;  5J4U A;  2G0F A;  5B6N A;  1T00 A;  2OJL A;  4IHU A;  4MZB A;  3RAZ A;  1SKS B;  1TRW A;  5FT3 A;  4TRX A;  4J56 E;  4L0U A;  4PTS A;  3KD0 A;  2L4C A;  1N2A A;  3WD6 A;  4NXI A;  2PVO C;  5GAN D;  2AJQ B;  5H5R A;  1A0F A;  2AB6 A;  2E7P A;  4ECI A;  2JZT A;  3KP9 A;  5ECS A;  4DSR A;  2VCV A;  2OE3 A;  2HZE A;  2FY6 A;  2RUF A;  5F0G A;  4BA7 A;  1V2A A;  3VWW A;  2VL9 A;  2R4V A;  1F6M C;  4Z2U A;  4JR6 A;  1ERW A;  1JZW A;  2O85 A;  4KSM A;  4F2I A;  1T7P B;  2BJX A;  3RPP A;  4YQU A;  4I97 A;  2J23 A;  2OE0 A;  1X5D A;  2V32 A;  3TGZ A;  3UMA A;  4ECC A;  1O73 A;  3M0F A;  3D22 A;  1LBK A;  3UVT A;  5EY6 A;  3EYT A;  4OO4 A;  2XPE A;  4MJA A;  1EOH A;  4ZB8 A;  3EE2 A;  1PQN A;  2TRC P;  1YQ1 A;  2KHP A;  2VL2 C;  4JRR A;  1YJ6 A;  4PXO A;  3ZML A;  1ABA A;  2GQM A;  5D96 A;  1YDK A;  3LW9 A;  4TN8 A;  4POM A;  5KN1 A;  1GSD A;  1MD3 A;  2H72 A;  2F8F A;  4HEA 2;  5D93 A;  2F8A A;  4WR5 A;  1PKW A;  1RK4 A;  4A5P A;  1FOV A;  5AIV A;  2DBC A;  2CX3 A;  4MAB A;  3SBC A;  1T3B A;  3A5I A;  2JSZ A;  3HJO A;  3IC4 A;  4GWR A;  4N11 A;  3HYP A;  5DQS A;  4IQA A;  1X5E A;  1ZYN A;  3HVN A;  3QCP A;  17GS A;  4I6X A;  2B5X A;  1KTE A;  3EU4 A;  2HZE B;  2P31 A;  1SD8 A;  5J9C A;  2R0G A;  1PX7 A;  3R2Q A;  2PWJ A;  2MMN A;  4OCE A;  3QFA C;  1GSF A;  4I2T A;  2YV7 A;  4AGS A;  2CAQ A;  3L9V A;  3GKM A;  2I9H A;  5A4U A;  1YEP A;  4HS1 A;  3APQ A;  4MH3 A;  1WPI A;  4LMV A;  1M9A A;  1O85 A;  2A2P A;  3GX8 A;  2C0F A;  2H30 A;  2LTK A;  1K0B A;  4TR1 A;  3SWL A;  1TRU A;  4USS A;  5G1K A;  2OE1 A;  2YNX A;  3F6D A;  3QDN A;  3CMI A;  5F07 A;  11GS A;  2F3M A;  4FYU A;  2REM A;  5KN2 A;  2DJJ A;  4O5U A;  3ZVJ D;  5INY A;  1GNW A;  18GS A;  2VO4 A;  2PU9 C;  1TU8 A;  4G0L A;  5D8I A;  2L5L A;  2ON7 A;  5J3R A;  4HU9 A;  1XW5 A;  3QD9 A;  4TKY A;  2TRX A;  3HVX A;  5ECH B;  2GZY A;  1PGT A;  3H8Q A;  3L4N A;  1XVQ A;  4YKF A;  2C80 A;  5LD0 A;  2AAW A;  4ISD A;  2WGR A;  2H1A A;  3C1R A;  1EEJ A;  1Z6N A;  2J9H A;  1RW1 A;  1JZR A;  1USB A;  2H1B A;  2R5G A;  5CRD A;  3KCM A;  4E8E A;  3HA9 A;  5ABR A;  3WT1 A;  5DJM A;  1W4V A;  1ML6 A;  4DEJ A;  3F6F A;  4EF0 A;  3GL3 A;  1RQM A;  2V1M A;  4TR1 B;  3KTL A;  2YCD A;  2YN1 A;  4HQS A;  3F63 A;  2HYX A;  3A2W A;  1YKC A;  4YAP A;  1M2A A;  3LFL A;  4KCA A;  3IHG A;  4EXJ A;  3FR6 A;  1AC1 A;  4ZIL A;  4MJC A;  2V6O A;  5KEJ A;  1WOU A;  5IMD A;  4KND A;  3C73 A;  3UEM A;  3VI5 A;  5IQY A;  3J7Y b;  3LYP A;  3FYG A;  2YAN A;  3CYN A;  2WS2 A;  1LJR A;  2VLU A;  4NAX A;  4PUR A;  3WT2 A;  1SKW B;  5GSS A;  1AQW A;  2H74 A;  2B7K A;  4OFT A;  1QXH A;  2I1U A;  1QGV A;  3KMO A;  2L4Q A;  4PQ1 A;  1HNB A;  3PIN A;  5ELG A;  1OKT A;  4YKG A;  1SL2 B;  4TVE A;  1XOA A;  2DLX A;  2OBK A;  4WF4 A;  1BX9 A;  4QL9 A;  5B7C A;  1PX6 A;  3JCM L;  1Y6E A;  4K6X A;  1GTU A;  2I4A A;  3VWX A;  5ID2 A;  3GHA A;  2TIR A;  2N5A A;  3EIN A;  4KAE A;  3O6T A;  4WF5 A;  1TKD B;  3IDV A;  1O6J A;  1TXX A;  5G1L A;  4DSQ A;  1V57 A;  2VUP A;  3FZA A;  4ML1 A;  3TCO A;  1THX A;  3MWH A;  4WXT A;  2NDO A;  4EIQ A;  3NZN A;  1GTI A;  4ZBD A;  5EVO A;  1XWK A;  5H5S A;  5ELA A;  3O3T A;  2H73 A;  1VF4 A;  2OA7 A;  3CRU A;  4XTS A;  1GLQ A;  1DUG A;  2H1D A;  1AQV A;  4NPB A;  1NSW A;  1EOG A;  1K0C A;  1A2J A;  2YWM A;  3A2V A;  1ZGN A;  2LRN A;  2PGT A;  3EPT A;  1XPV A;  2ZUP A;  3WGX A;  4Z2R A;  4KDY A;  3O76 A;  3VWV A;  4G10 A;  3UBL A;  4O32 A;  5D9V A;  4ZXG A;  5ID2 B;  2YJH A;  1G7O A;  1H4O A;  3TJF A;  3LXZ A;  3G9B A;  3S9F A;  5KOW A;  2X8C A;  3WGD A;  3DIE A;  2YZU A;  4KGI A;  4V2M A;  3ZIJ A;  3HZ4 A;  2X8G A;  2MYG A;  2P5Q A;  4DSS B;  2NTO A;  1XWB A;  3VFI A;  1PD2 1;  1GLP A;  2LRT A;  1VF1 A;  3RDW A;  3LGC A;  3KZQ A;  4PX1 A;  3ZFB A;  3FZ4 A;  4GSN A;  1ZZY A;  3P8W A;  3TRP A;  3U5R E;  4O5Q A;  5IO2 A;  1S3R A;  2GZZ A;  4ZL8 A;  2QA2 A;  2LNS A;  2DC5 A;  3GH9 A;  4KDX A;  2GZP A;  2K6V A;  3F3R A;  2CX4 A;  5ECP B;  2B1K A;  2IMK A;  1UN2 A;  3ZLP A;  2YWI A;  4EC0 A;  1J0F A;  2MBS A;  2L59 A;  3KP8 A;  4Z7X A;  3LYK A;  2DJ3 A;  3DD3 A;  3CSH A;  3A2X A;  4ZBB A;  1WP0 A;  2YWN A;  2H71 A;  3Q19 A;  4MPG A;  5IMC A;  5CRW A;  1EV4 A;  2BTO T;  5CO3 A;  3F3Q A;  2H01 A;  3CBU A;  16GS A;  2B1L A;  2E2G A;  2IIY A;  2VOC A;  1PMT A;  3LEF A;  1YKA A;  3GMF A;  3QAG A;  4Q5N A;  4EIP A;  3VPT A;  4JR4 A;  3QOU A;  2MMO A;  5HR1 A;  1FW1 A;  2LQQ A;  4K7N A;  5C04 A;  3ERG A;  4H86 A;  2VCZ A;  4EKZ A;  3W8S A;  1K3O A;  4HQZ A;  1K0D A;  4OCF A;  2L5O A;  2V2G A;  5AGY A;  2QA1 A;  2DJ1 A;  2LST A;  2LRC A;  3HY2 A;  1AIU A;  5HQP A;  5BRT A;  3ISO A;  3EVI A;  2LUS A;  1V58 A;  2GSR A;  3IRA A;  4AF2 A;  3DYR A;  4PUA A;  4XS4 A;  1XG8 A;  4XCS A;  2MMA A;  4RUV A;  5DQY A;  1M0U A;  1GTB A;  1SL0 B;  1M99 A;  1EWX A;  4IJ3 A;  2CV4 A;  3IHQ A;  4K0N A;  1HNA A;  1M2D A;  2FD3 A;  1PL1 A;  2GTU A;  4KUN A;  3M9K A;  4GCI A;  1XZO A;  2H75 A;  5EL8 A;  1B4Q A;  1PRX A;  2DSA A;  1EGR A;  3KTB A;  4LA1 A;  2X8H A;  3MNG A;  1G0T A;  3H4K A;  2OAC A;  1GSU A;  1EGO A;  3CRT A;  3GA4 A;  4HJ2 A;  4ID0 A;  2H76 A;  1FHE A;  3IBH A;  2C4J A;  3IA1 A;  1SYX A;  4MH2 A;  2A4H A;  4X1U A;  3L0H A;  4EO3 A;  3ME7 A;  1XWC A;  1ZOF A;  4HDE A;  1R7H A;  5EPF A;  1WE0 A;  1TDI A;  3F4R A;  2C8U A;  1XFL A;  5DVB A;  3UAR A;  3F9U A;  2X64 A;  2HRK A;  1XVW A;  5HR2 A;  3IK9 A;  5JWR B;  4K5R A;  2BMX A;  1OVN A;  2B7J A;  2KP2 A;  2R37 A;  2H6Y A;  3BD2 A;  4PQH A;  2K8S A;  3F0I A;  4KCE A;  2C3Q A;  4NWY A;  2LS5 A;  5A4V A;  2LV3 A;  5IPH A;  2RUE A;  3BCI A;  3HVV A;  1NW2 A;  2CAI A;  20GS A;  4MLY A;  1T8E B;  4EDY A;  1EP7 A;  4PNG A;  3RBT A;  2PBJ A;  2O8V B;  3TJB A;  2GST A;  3FK8 A;  5IO0 A;  4KA0 A;  3GKX A;  2DIZ A;  2B5E A;  2RM5 A;  3CXG A;  5DDL A;  2K8V A;  3PH9 A;  1MD4 A;  2HRN A;  4G0K A;  2ZNM A;  2D2Z A;  1ON4 A;  3M3M A;  2CVD A;  1MEK A;  3CTF A;  3G7J A;  6GST A;  3EWL A;  3GUR A;  3U6V A;  4GXZ A;  4X43 A;  5KN0 A;  1ERV A;  2WRT A;  2RM6 A;  2I3Y A;  4TXO A;  2QKE A;  1HNC A;  1XW6 A;  2WUL A;  1BQ7 A;  4NV2 A;  1F9M A;  3OR5 A;  3IK7 A;  4GLT A;  2KLX A;  1GSS A;  2FWG A;  3IAS 2;  1O7U A;  4IP6 A;  5CP1 A;  2HLS A;  2R0C A;  5HFI A;  4K9Z A;  1V98 A;  1LU4 A;  3VI7 A;  3F4T A;  5E4W A;  2CVK A;  1KBN A;  3GST A;  1NM3 A;  1M3J A;  2PN8 A;  3M1G A;  1JZD A;  3P7X A;  5GST A;  2PER A;  1FVK A;  2H6X A;  2GQL A;  3C8E A;  4EUY A;  5IPG A;  3L9U A;  1FAA A;  5C00 A;  5DBQ A;  3QAW A;  1GL8 A;  10GS A;  4KSO A;  2A4V A;  5IOW A;  3LOR A;  5B8A A;  1Q4J A;  4WBR D;  2H6Z A;  3LXT A;  2DKH A;  4IS0 A;  2DJK A;  2V6K A;  2YWO A;  2JSY A;  2H1G A;  4I2U A;  3WGE A;  3HD5 A;  4OMV A;  1GSE A;  5FHI A;  4EDZ A;  1ACV A;  4TXO B;  3L78 A;  4IP1 A;  1F2E A;  2C3T A;  4CY8 A;  4WEY A;  2MBT A;  4MPF A;  5J9B A;  1ILO A;  5B8B A;  4TR4 A;  3MYD A;  4KF9 A;  4V1A g;  2VAF A;  1MTC A;  3UBK A;  3E0U A;  3PGT A;  3G7I A;  1U88 A;  3TB2 A;  3US3 A;  5ENU A;  1SJZ A;  1OE8 A;  3ZL5 A;  2M72 A;  4RQR A;  1U6T A;  1XXU A;  3BCK A;  4CDO A;  1EP8 A;  1GUM A;  2LEG A;  2N5B A;  4TR3 A;  2LJK A;  4QQ7 A;  2ALB A;  3FZ5 A;  1TI3 A;  1F37 A;  1W89 A;  4P3Y B;  2E2M A;  1AQX A;  3MAK A;  5CAX A;  4K2D A;  2O89 A;  2N5F A;  3QPM A;  5ECR B;  1BAY A;  2YZH A;  3IPZ A;  5DCG A;  3NIV A;  1ZL9 A;  3APS A;  3LJR A;  2ES7 A;  3TDG A;  1DBY A;  4O7H A;  2VL2 A;  4GRF A;  4MCU A;  4KW6 A;  1XOB A;  1TTZ A;  3TKS A;  2IMF A;  2L6D A;  2K18 A;  1A8Y A;  3EMP A;  2HSH A;  4YAV A;  3ZFL A;  2EIQ A;  12GS A;  2E0Q A;  1YF0 A;  3MSZ A;  3HJM A;  1FOH A;  3I69 A;  2X49 A;  1OKD A;  2O87 A;  4IJI A;  1IYI A;  1O8W A;  6GSW A;  5G5F A;  5D9T A;  2YPM A;  3FEU A;  3IE3 A;  1KEB A;  4EVM A;  4HUA A;  3FHK A;  1R5P A;  1SU9 A;  4YQV A;  4BWS A;  4JED A;  1JFU A;  5AN1 A;  2F51 A;  3P2A A;  4OFM A;  4IGJ A;  3TRX A;  1EEM A;  1PN9 A;  2JZS A;  1I9D A;  4MZC A;  3GN3 A;  1AUC A;  1PKZ A;  2VD1 A;  3DVX A;  2ZCT A;  3ERW A;  2L6C A;  2DJ0 A;  3I43 A;  22GS A;  1B8X A;  6GSX A;  4L5O A;  3PPU A;  1V9W A;  1TRS A;  5G31 A;  2OBI A;  1M3I A;  3F8U A;  3C7M A;  5HFG A;  1A24 A;  2H66 A;  13GS A;  4O5R A;  1E2Y A;  2IME A;  3N9J A;  2IFQ A;  3A3T A;  3D4T A;  3HHV A;  4J2F A;  1OC9 A;  1O81 A;  4MJB A;  4MF5 A;  1ZMA A;  3CTG A;  3FW2 A;  2C3N A;  4ZIJ A;  3HVS A;  4ACS A;  5IM9 A;  3MDK A;  3GV1 A;  3GTU A;  4BL7 A;  3QFB C;  3ZZX A;  4E8H A;  1G6Y A;  2AYT A;  2EIO A;  4FYB A;  3EMX A;  3KEB A;  2G2Q A;  4TR0 A;  2WZ9 A;  1Z7R A;  3BOA A;  1FB0 A;  4OWY A;  5ECQ B;  3AY8 A;  2YP6 A;  1Z3E A;  1VF3 A;  2HI7 A;  2GS3 A;  2M80 A;  3DRN A;  1QQ2 A;  2PMT A;  1M9B A;  5IMV A;  4PNF A;  1A2L A;  1ERT A;  3TKP A;  4GSS A;  3Q6O A;  2UZ8 A;  4F0B A;  2NPB A;  4G2E A;  1HQO A;  1URM A;  4XS1 A;  2I81 A;  3ZIV A;  4POL A;  4D73 A;  4OO5 A;  2HSY A;  1CQG A;  1OC9 B;  1A8L A;  3W6G A;  2GT6 A;  1F3B A;  3ZRD A;  2WDU A;  3CSI A;  2JU5 A;  1YZX A;  1BED A;  4WBJ A;  1N8J A;  6GSY A;  3APO A;  2H0H A;  5ECK B;  2RII A;  2XBQ A;  4DVC A;  5CRG A;  3FMW A;  4BL7 B;  1GRX A;  1U3A A;  1B9X C;  2X99 A;  2AHE A;  2DKI A;  1CQH A;  4AJ8 A;  2VLT A;  2H8L A;  1FB6 A;  5L71 A;  3ZIT A;  2RLI A;  3D4M A;  3DEX A;  1OC3 A;  3H93 A;  2XC2 A;  1TK8 B;  2KP1 A;  8GSS A;  3N5O A;  3D5J A;  5ECL B;  2IPA A;  2PPT A;  3GL5 A;  1Y25 A;  3IOS A;  3UL3 A;  4ICY A;  3D0Z A;  2R6K A;  2LQO A;  1SK1 A;  1TI1 A;  5A5K A;  5JWO B;  4FYC A;  4D73 B;  5J5N A;  2XBI A;  4F9Z A;  3EU3 A;  1K0O A;  4ECJ A;  2C1Y A;  4CHS A;  2IL3 A;  4J57 E;  4TOP A;  3RPN A;  1ST9 A;  1VGL A;  4HSC X;  3TOT A;  2IMI A;  2NVL A;  2FLS A;  4PUF C;  5JWQ B;  1GUL A;  2GSQ A;  4ML6 A;  1THO A;  2MZC A;  2H19 A;  1DE1 A;  3TRQ A;  2AV4 A;  4AJ6 A;  2HNL A;  5ECI B;  4HZ4 A;  1F3A A;  2CT6 A;  2CZ2 A;  2VCT A;  1E6B A;  1V40 A;  4XRA A;  3PR8 A;  4BPY A;  1Q98 A;  2GLR A;  4G9H A;  4L8E A;  5G30 A;  3L9S A;  2H0I A;  2V41 A;  5GZZ B;  4GTU A;  3EUR A;  4BVY A;  2GGT A;  4QL7 A;  1R5A A;  1YEX A;  2VIM A;  2CVB A;  2R3X A;  4XS4 B;  1SD9 A;  1FG4 A;  1UC7 A;  4MK3 A;  4K2X A;  4XIH A;  2HZF A;  3ZVJ A;  1HYU A;  4Q5F A;  2B6M A;  4YH2 A;  4MDC A;  5AIS A;  4K8M A;  2VM1 A;  4V2L A;  3DWV A;  4FO5 A;  5G2Z A;  2QSI A;  1TW9 A;  1Z6M A;  3D6I A;  4KDU A;  1SJI A;  1HD2 A;  4FH8 A;  2JAD A;  1PL2 A;  3BBY A;  3LQ7 A;  4JU5 A;  5HFK A;  2FCH A;  2KUC A;  4K7O A;  3ZMK A;  2PVQ A;  2DIY A;  5D9W A;  5IMF A;  5CRE A;  3MIX A;  3TKS C;  4JBB A;  3DML A;  2HE3 A;  2L57 A;  5HR0 A;  2VM2 A;  4BVY B;  3KMN A;  4HOJ A;  5HR3 A;  2F9S A;  4YQM A;  3FKF A;  4IQ1 A;  4IVF A;  2O7K A;  5DAK A;  2YV9 A;  3F4S A;  1SEN A;  5G5E A;  4CW9 A;  3ME8 A;  3DGQ A;  4ZL9 A;  1JLW A;  1DE2 A;  1WMJ A;  2YOI A;  1ZYP A;  3IR4 A;  2WJU A;  4FIW A;  5DAL A;  3GKK A;  1XW9 A;  1SK0 A;  3UIW A;  2CA8 A;  1I5G A;  1WJK A;  4KE3 A;  2FWF A;  2IN3 A;  3KIJ A;  4ILF A;  3HJP A;  1Z5Y E;  1S3D A;  4JZQ A;  3I9V 2;  4LLR A;  2KOK A;  2VCW A;  1ZYQ B;  1J9B A;  1WRY A;  3GFK A;  1QUW A;  5F06 A;  1ZYE A;  5D9X A;  3WYW A;  5A4W A;  4POB A;  1TP9 A;  3QAV A;  3BJ5 A;  4WR4 A;  1IYH A;  4G0I A;  2FWE A;  5JCW A;  1JLV A;  2H0G A;  4NHW A;  2FNO A;  4V2N A;  1S3A A;  2CZ3 A;  5DAK B;  1DSB A;  4OFN A;  1Z7P A;  3TUE A;  1PA3 A;  1FVJ A;  1K3Y A;  4RQX A;  3ZRE A;  2HSM A;  2OAD A;  1BJX A;  2AUV A;  2YJ7 A;  4I8B A;  1A0R P;  1X9W B;  2HFD A;  1H75 A;  3FZ9 A;  5DAL B;  4MNN A;  4AJ7 A;  3FR3 A;  3KH9 A;  3DVW A;  3LSZ A;  4HZ2 A;  3GX0 A;  1XWG A;  5F8B A;  1R26 A;  1BYE A;  1QFN A;  4N0Z A;  4IW9 A;  1XIY A;  4IBP A;  4N0V A;  3HCZ A;  3C71 A;  1SKR B;  3FRC A;  4FQU A;  4GQF A;  1X9S B;  4BWQ A;  3TKQ A;  1QMV A;  1JHB A;  3H79 A;  4LL1 B;  2JZR A;  4BVX A;  1M2B A;  4X0X A;  1R4W A;  1GNE A;  3K8N A;  2DMM A;  3TOU A;  3P90 A;  5D73 A;  4I5Q A;  5B6M A;  5ECN B;  2QGV A;  5GAP D;  1MDJ A;  2XPD A;  4MP4 A;  3GKN A;  4PGT A;  3TJJ A;  3UJ1 A;  1M7T A;  3A5W A;  4KB3 A;  6GSS A;  4MA9 A;  4O92 A;  2GDR A;  1TU7 A;  2LJA A;  3V1W A;  1ERU A;  3IAM 2;  1K0N A;  4Q5R A;  2VCQ A;  2PUK C;  5IMZ A;  2B3S A;  4X4J A;  1TOF A;  4K0G A;  4MF6 A;  1OYJ A;  1K0M A;  3KH7 A;  3EC3 A;  4ULX A;  1SL1 B;  3HKR A;  4JE1 A;  1GWC A;  4POK A;  4NHZ A;  1T4Y A;  3TJG A;  4HI7 A;  1B48 A;  2GVP A;  2GSS A;  4F03 A;  1J08 A;  4G19 A;  3DKS A;  1MDK A;  4GQC A;  2EC4 A;  1K3L A;  2P5R A;  3VPQ A;  2JL4 A;  3ZYW A;  1KNG A;  3M8N A;  4ZB9 A;  19GS A;  1GUH A;  3M9J A;  1EV9 A;  4CY6 A;  4MZW A;  2R0P A;  4IN0 A;  2FHE A;  1GSY A;  2C0E A;  3RHB A;  4BVX B;  1WIK A;  5CRH A;  1B4P A;  4MJE A;  1B9Y C;  4HU7 A;  6GSU A;  1X9M B;  3UAP A;  1AW9 A;  1OAZ A;  3HDC A;  2FA4 A;  1OE7 A;  2VCX A;  4K7I A;  4WET A;  2DJ2 A;  3GYK A; 
#chains in the Genus database with same CATH homology
 5J41 A;  1XWA A;  4MF7 A;  1VRS D;  3VK9 A;  3ZTL A;  1XCC A;  4NV5 A;  1X0R A;  3TKR A;  4DSS A;  5IOX A;  2MMZ A;  3HZ8 A;  3CSJ A;  3KXO A;  3QMX A;  1U87 A;  3GH6 A;  3QR6 A;  5ECO B;  3FR9 A;  4TW5 A;  2OKA A;  2P0G A;  3IC8 A;  1BG5 A;  1VF2 A;  5JCG A;  2HT9 A;  3G7Y A;  1SYR A;  3VUR A;  3KM6 A;  3E3E A;  2FUG 2;  1S3C A;  2WCI A;  5IMA A;  2A2R A;  3Q74 A;  3VLN A;  2GT5 A;  4Z2T A;  2WB9 A;  3UVH A;  2ON5 A;  6GSV A;  2C0D A;  1XBS A;  3H1N A;  1TJD A;  1UA5 A;  2NBS A;  2IWT A;  4EE0 A;  2B5Y A;  5IIZ A;  2FA8 A;  4ZL7 A;  2EIR A;  1ZCP A;  1A23 A;  5KN3 A;  1X5C A;  4N30 A;  5JCU A;  5F05 A;  4XS6 A;  1PN0 A;  2Z9S A;  1K0A A;  5LNK e;  1TK0 B;  1SK2 A;  1UVZ A;  2WFC A;  4RI7 A;  3FY7 A;  3GUS A;  5CNW A;  3Q18 A;  3ED3 A;  3LWA A;  5AIX A;  1YF1 A;  1JZO A;  3HXS A;  1T1V A;  2JAC A;  4Q5Q A;  2H70 A;  2R2J A;  1GH2 A;  3ERF A;  3GSS A;  3LG6 A;  4K1F A;  3J7Y k;  2IFQ B;  4HJM A;  4PQI A;  3RHC A;  2DML A;  1U3I A;  2HRA A;  5E59 A;  1NHO A;  1GUK A;  5COH A;  4ZB6 A;  4IEL A;  1GTA A;  4EL1 A;  3GTU B;  4N10 A;  4WKW A;  1G6W A;  1TK5 B;  4ZBA A;  1OC8 A;  3IXR A;  2M46 A;  4XRD A;  4F0C A;  14GS A;  2HRF A;  1NHY A;  5H5Q A;  5LCZ A;  1PSQ A;  5ECM B;  4LL4 B;  1AAZ A;  1O8X A;  4ECB A;  4GST A;  2X4A A;  2VLV A;  3DXB A;  3KGK A;  2LKU A;  2QC7 A;  3UOM A;  4IKH A;  1TRV A;  2C0G A;  3I6A A;  4NMU A;  1FO5 A;  4LMW A;  4L5L A;  3KJY A;  2HXK A;  5FWG A;  4K5S A;  3VWU A;  1WWJ A;  1Z9H A;  2VD0 A;  2LNT A;  3E9J B;  4RI6 A;  4XHM A;  2GQK A;  5CYY A;  4KX4 A;  3TJK A;  2A2S A;  3GNJ A;  4TXV A;  4GF0 A;  1G7E A;  3GRX A;  2VL3 A;  1AXD A;  1EZK A;  2FGX A;  3D21 A;  3W8J A;  1GSQ A;  9GSS A;  1T4Z A;  2XHF A;  1YY7 A;  1MDI A;  4L0W A;  3GIX A;  4KH7 A;  5KOX A;  5DCH A;  2FWH A;  2K9F A;  5DJL A;  2IMD A;  3C1S A;  1C72 A;  3R3E A;  1QK8 A;  1SJ6 A;  7GSS A;  3NOF A;  2IJY A;  1A2M A;  2LJR A;  4MMM A;  4F82 A;  5BMU A;  3IV4 A;  2CQ9 A;  1GP1 A;  4V1A p;  3TKS E;  4OD7 A;  5J4U A;  2G0F A;  5B6N A;  1T00 A;  2OJL A;  4IHU A;  4MZB A;  3RAZ A;  1SKS B;  1TRW A;  5FT3 A;  4TRX A;  4J56 E;  4L0U A;  4PTS A;  3KD0 A;  2L4C A;  1N2A A;  3WD6 A;  4NXI A;  2PVO C;  5GAN D;  2AJQ B;  5H5R A;  1A0F A;  2AB6 A;  2E7P A;  4ECI A;  2JZT A;  3KP9 A;  5ECS A;  4DSR A;  2VCV A;  2OE3 A;  2HZE A;  2FY6 A;  2RUF A;  5F0G A;  4BA7 A;  1V2A A;  3VWW A;  2VL9 A;  2R4V A;  1F6M C;  4Z2U A;  4JR6 A;  1ERW A;  1JZW A;  2O85 A;  4KSM A;  4F2I A;  1T7P B;  2BJX A;  3RPP A;  4YQU A;  4I97 A;  2J23 A;  2OE0 A;  1X5D A;  2V32 A;  3TGZ A;  3UMA A;  4ECC A;  1O73 A;  3M0F A;  3D22 A;  1LBK A;  3UVT A;  5EY6 A;  3EYT A;  4OO4 A;  2XPE A;  4MJA A;  1EOH A;  4ZB8 A;  3EE2 A;  1PQN A;  2TRC P;  1YQ1 A;  2KHP A;  2VL2 C;  4JRR A;  1YJ6 A;  4PXO A;  3ZML A;  1ABA A;  2GQM A;  5D96 A;  1YDK A;  3LW9 A;  4TN8 A;  4POM A;  5KN1 A;  1GSD A;  1MD3 A;  2H72 A;  2F8F A;  4HEA 2;  5D93 A;  2F8A A;  4WR5 A;  1PKW A;  1RK4 A;  4A5P A;  1FOV A;  5AIV A;  2DBC A;  2CX3 A;  4MAB A;  3SBC A;  1T3B A;  3A5I A;  2JSZ A;  3HJO A;  3IC4 A;  4GWR A;  4N11 A;  3HYP A;  5DQS A;  4IQA A;  1X5E A;  1ZYN A;  3QCP A;  17GS A;  4I6X A;  2B5X A;  1KTE A;  3EU4 A;  2HZE B;  2P31 A;  1SD8 A;  5J9C A;  2R0G A;  1PX7 A;  3R2Q A;  2PWJ A;  2MMN A;  4OCE A;  3QFA C;  1GSF A;  4I2T A;  2YV7 A;  4AGS A;  2CAQ A;  3L9V A;  3GKM A;  2I9H A;  5A4U A;  1YEP A;  4HS1 A;  3APQ A;  4MH3 A;  1WPI A;  4LMV A;  1M9A A;  1O85 A;  2A2P A;  3GX8 A;  2C0F A;  2H30 A;  2LTK A;  1K0B A;  4TR1 A;  3SWL A;  1TRU A;  4USS A;  5G1K A;  2OE1 A;  2YNX A;  3F6D A;  3QDN A;  3CMI A;  5F07 A;  11GS A;  2F3M A;  4FYU A;  2REM A;  5KN2 A;  2DJJ A;  4O5U A;  3ZVJ D;  5INY A;  1GNW A;  18GS A;  2VO4 A;  2PU9 C;  1TU8 A;  4G0L A;  5D8I A;  2L5L A;  2ON7 A;  5J3R A;  4HU9 A;  1XW5 A;  3QD9 A;  4TKY A;  2TRX A;  3HVX A;  5ECH B;  2GZY A;  1PGT A;  3H8Q A;  3L4N A;  1XVQ A;  4YKF A;  2C80 A;  5LD0 A;  2AAW A;  4ISD A;  2WGR A;  2H1A A;  3C1R A;  1EEJ A;  1Z6N A;  2J9H A;  1RW1 A;  1JZR A;  1USB A;  2H1B A;  2R5G A;  5CRD A;  3KCM A;  4E8E A;  3HA9 A;  5ABR A;  3WT1 A;  5DJM A;  1W4V A;  1ML6 A;  4DEJ A;  3F6F A;  4EF0 A;  3GL3 A;  1RQM A;  2V1M A;  4TR1 B;  3KTL A;  2YCD A;  2YN1 A;  4HQS A;  3F63 A;  2HYX A;  3A2W A;  1YKC A;  4YAP A;  1M2A A;  3LFL A;  4KCA A;  3IHG A;  4EXJ A;  3FR6 A;  1AC1 A;  4ZIL A;  4MJC A;  2V6O A;  5KEJ A;  1WOU A;  5IMD A;  4KND A;  3C73 A;  3UEM A;  3VI5 A;  5IQY A;  3J7Y b;  3LYP A;  3FYG A;  2YAN A;  3CYN A;  2WS2 A;  1LJR A;  2VLU A;  4NAX A;  4PUR A;  3WT2 A;  1SKW B;  5GSS A;  1AQW A;  2H74 A;  2B7K A;  4OFT A;  1QXH A;  2I1U A;  1QGV A;  3KMO A;  2L4Q A;  4PQ1 A;  1HNB A;  3PIN A;  5ELG A;  1OKT A;  4YKG A;  1SL2 B;  4TVE A;  1XOA A;  2DLX A;  2OBK A;  4WF4 A;  1BX9 A;  4QL9 A;  5B7C A;  1PX6 A;  3JCM L;  1Y6E A;  4K6X A;  1GTU A;  2I4A A;  3VWX A;  5ID2 A;  3GHA A;  2TIR A;  2N5A A;  3EIN A;  4KAE A;  3O6T A;  4WF5 A;  1TKD B;  3IDV A;  1O6J A;  1TXX A;  5G1L A;  4DSQ A;  1V57 A;  2VUP A;  3FZA A;  4ML1 A;  3TCO A;  1THX A;  3MWH A;  4WXT A;  2NDO A;  4EIQ A;  3NZN A;  1GTI A;  4ZBD A;  5EVO A;  1XWK A;  5H5S A;  5ELA A;  3O3T A;  2H73 A;  1VF4 A;  2OA7 A;  3CRU A;  4XTS A;  1GLQ A;  1DUG A;  2H1D A;  1AQV A;  4NPB A;  1NSW A;  1EOG A;  1K0C A;  1A2J A;  2YWM A;  3A2V A;  1ZGN A;  2LRN A;  2PGT A;  3EPT A;  1XPV A;  2ZUP A;  3WGX A;  4Z2R A;  4KDY A;  3O76 A;  3VWV A;  4G10 A;  3UBL A;  4O32 A;  5D9V A;  4ZXG A;  5ID2 B;  2YJH A;  1G7O A;  1H4O A;  3TJF A;  3LXZ A;  3G9B A;  3S9F A;  5KOW A;  2X8C A;  3WGD A;  3DIE A;  2YZU A;  4KGI A;  4V2M A;  3ZIJ A;  3HZ4 A;  2X8G A;  2MYG A;  2P5Q A;  4DSS B;  2NTO A;  1XWB A;  3VFI A;  1PD2 1;  1GLP A;  2LRT A;  1VF1 A;  3RDW A;  3LGC A;  3KZQ A;  4PX1 A;  3ZFB A;  3FZ4 A;  4GSN A;  1ZZY A;  3P8W A;  3TRP A;  3U5R E;  4O5Q A;  5IO2 A;  4ZL8 A;  2GZZ A;  2QA2 A;  2LNS A;  2DC5 A;  3GH9 A;  4KDX A;  2GZP A;  2K6V A;  3F3R A;  2CX4 A;  5ECP B;  2B1K A;  2IMK A;  1UN2 A;  3ZLP A;  2YWI A;  4EC0 A;  1J0F A;  2MBS A;  2L59 A;  3KP8 A;  4Z7X A;  3LYK A;  2DJ3 A;  3DD3 A;  3CSH A;  3A2X A;  4ZBB A;  1WP0 A;  2YWN A;  2H71 A;  3Q19 A;  4MPG A;  5IMC A;  5CRW A;  1EV4 A;  2BTO T;  5CO3 A;  3F3Q A;  2H01 A;  3CBU A;  16GS A;  2B1L A;  2E2G A;  2IIY A;  2VOC A;  1PMT A;  3LEF A;  1YKA A;  3GMF A;  3QAG A;  4Q5N A;  4EIP A;  3VPT A;  4JR4 A;  3QOU A;  2MMO A;  5HR1 A;  1FW1 A;  2LQQ A;  4K7N A;  5C04 A;  3ERG A;  4H86 A;  2VCZ A;  4EKZ A;  3W8S A;  1K3O A;  4HQZ A;  1K0D A;  4OCF A;  2L5O A;  2V2G A;  5AGY A;  2QA1 A;  2DJ1 A;  2LST A;  2LRC A;  3HY2 A;  1AIU A;  5HQP A;  5BRT A;  3ISO A;  3EVI A;  2LUS A;  1V58 A;  2GSR A;  3IRA A;  4AF2 A;  3DYR A;  4PUA A;  4XS4 A;  4XCS A;  2MMA A;  4RUV A;  5DQY A;  1M0U A;  1GTB A;  1SL0 B;  1M99 A;  1EWX A;  4IJ3 A;  2CV4 A;  3IHQ A;  4K0N A;  1HNA A;  1M2D A;  2FD3 A;  1PL1 A;  2GTU A;  4KUN A;  3M9K A;  4GCI A;  1XZO A;  2H75 A;  5EL8 A;  1B4Q A;  1PRX A;  2DSA A;  1EGR A;  3KTB A;  4LA1 A;  2X8H A;  3MNG A;  1G0T A;  3H4K A;  2OAC A;  1GSU A;  1EGO A;  3CRT A;  3GA4 A;  4HJ2 A;  4ID0 A;  2H76 A;  1FHE A;  3IBH A;  2C4J A;  3IA1 A;  1SYX A;  4MH2 A;  2A4H A;  4X1U A;  3L0H A;  4EO3 A;  3ME7 A;  1XWC A;  1ZOF A;  4HDE A;  1R7H A;  5EPF A;  1WE0 A;  1TDI A;  3F4R A;  2C8U A;  1XFL A;  5DVB A;  3UAR A;  3F9U A;  2X64 A;  2HRK A;  1XVW A;  5HR2 A;  3IK9 A;  5JWR B;  4K5R A;  2BMX A;  1OVN A;  2B7J A;  2KP2 A;  2R37 A;  2H6Y A;  3BD2 A;  4PQH A;  2K8S A;  3F0I A;  4KCE A;  2C3Q A;  4NWY A;  2LS5 A;  5A4V A;  2LV3 A;  5IPH A;  2RUE A;  3BCI A;  3HVV A;  1NW2 A;  2CAI A;  20GS A;  4MLY A;  1T8E B;  4EDY A;  1EP7 A;  4PNG A;  3RBT A;  2PBJ A;  2O8V B;  3TJB A;  2GST A;  3FK8 A;  5IO0 A;  4KA0 A;  3GKX A;  2DIZ A;  2B5E A;  2RM5 A;  3CXG A;  5DDL A;  2K8V A;  3PH9 A;  1MD4 A;  2HRN A;  4G0K A;  2ZNM A;  2D2Z A;  1ON4 A;  3M3M A;  2CVD A;  1MEK A;  3CTF A;  3G7J A;  6GST A;  3EWL A;  3GUR A;  3U6V A;  4GXZ A;  4X43 A;  5KN0 A;  1ERV A;  2WRT A;  2RM6 A;  2I3Y A;  4TXO A;  2QKE A;  1HNC A;  1XW6 A;  2WUL A;  1BQ7 A;  4NV2 A;  1F9M A;  3OR5 A;  3IK7 A;  4GLT A;  2KLX A;  1GSS A;  2FWG A;  3IAS 2;  1O7U A;  4IP6 A;  5CP1 A;  2HLS A;  2R0C A;  5HFI A;  4K9Z A;  1V98 A;  1LU4 A;  3VI7 A;  3F4T A;  5E4W A;  2CVK A;  1KBN A;  3GST A;  1NM3 A;  3M1G A;  2PN8 A;  1JZD A;  3P7X A;  5GST A;  2PER A;  1FVK A;  2H6X A;  2GQL A;  3C8E A;  4EUY A;  5IPG A;  3L9U A;  1FAA A;  5C00 A;  5DBQ A;  3QAW A;  1GL8 A;  10GS A;  4KSO A;  2A4V A;  5IOW A;  3LOR A;  5B8A A;  1Q4J A;  4WBR D;  2H6Z A;  3LXT A;  2DKH A;  4IS0 A;  2DJK A;  2V6K A;  2YWO A;  2JSY A;  2H1G A;  4I2U A;  3WGE A;  3HD5 A;  4OMV A;  1GSE A;  5FHI A;  4EDZ A;  1ACV A;  4TXO B;  3L78 A;  4IP1 A;  1F2E A;  2C3T A;  4CY8 A;  4WEY A;  2MBT A;  4MPF A;  5J9B A;  1ILO A;  5B8B A;  4TR4 A;  3MYD A;  4KF9 A;  4V1A g;  2VAF A;  1MTC A;  3UBK A;  3E0U A;  3PGT A;  3G7I A;  1U88 A;  3TB2 A;  3US3 A;  5ENU A;  1SJZ A;  1OE8 A;  3ZL5 A;  2M72 A;  4RQR A;  1U6T A;  1XXU A;  3BCK A;  4CDO A;  1EP8 A;  1GUM A;  2LEG A;  2N5B A;  4TR3 A;  2LJK A;  4QQ7 A;  2ALB A;  3FZ5 A;  1TI3 A;  1F37 A;  1W89 A;  4P3Y B;  2E2M A;  1AQX A;  3MAK A;  5CAX A;  4K2D A;  2O89 A;  2N5F A;  3QPM A;  5ECR B;  1BAY A;  2YZH A;  3IPZ A;  5DCG A;  3NIV A;  1ZL9 A;  3APS A;  3LJR A;  2ES7 A;  3TDG A;  1DBY A;  4O7H A;  2VL2 A;  4GRF A;  4MCU A;  4KW6 A;  1XOB A;  1TTZ A;  3TKS A;  2IMF A;  2L6D A;  2K18 A;  1A8Y A;  3EMP A;  2HSH A;  4YAV A;  3ZFL A;  2EIQ A;  12GS A;  2E0Q A;  1YF0 A;  3MSZ A;  3HJM A;  1FOH A;  3I69 A;  2X49 A;  1OKD A;  2O87 A;  4IJI A;  1IYI A;  1O8W A;  6GSW A;  5G5F A;  5D9T A;  2YPM A;  3FEU A;  3IE3 A;  1KEB A;  4EVM A;  4HUA A;  3FHK A;  1R5P A;  1SU9 A;  4YQV A;  4BWS A;  4JED A;  1JFU A;  5AN1 A;  2F51 A;  3P2A A;  4OFM A;  4IGJ A;  3TRX A;  1EEM A;  1PN9 A;  2JZS A;  1I9D A;  4MZC A;  3GN3 A;  1AUC A;  1PKZ A;  2VD1 A;  3DVX A;  2ZCT A;  3ERW A;  2L6C A;  2DJ0 A;  3I43 A;  22GS A;  1B8X A;  6GSX A;  4L5O A;  3PPU A;  1V9W A;  1TRS A;  5G31 A;  2OBI A;  3F8U A;  3C7M A;  5HFG A;  1A24 A;  2H66 A;  13GS A;  4O5R A;  1E2Y A;  2IME A;  3N9J A;  2IFQ A;  3A3T A;  3D4T A;  3HHV A;  4J2F A;  1OC9 A;  1O81 A;  4MJB A;  4MF5 A;  1ZMA A;  3CTG A;  3FW2 A;  2C3N A;  4ZIJ A;  3HVS A;  4ACS A;  5IM9 A;  3MDK A;  3GV1 A;  3GTU A;  4BL7 A;  3QFB C;  3ZZX A;  4E8H A;  1G6Y A;  2AYT A;  2EIO A;  4FYB A;  3EMX A;  3KEB A;  2G2Q A;  4TR0 A;  2WZ9 A;  1Z7R A;  3BOA A;  1FB0 A;  4OWY A;  5ECQ B;  3AY8 A;  2YP6 A;  1Z3E A;  1VF3 A;  2HI7 A;  2GS3 A;  2M80 A;  3DRN A;  1QQ2 A;  2PMT A;  1M9B A;  5IMV A;  4PNF A;  1A2L A;  1ERT A;  3TKP A;  4GSS A;  3Q6O A;  2UZ8 A;  4F0B A;  2NPB A;  4G2E A;  1HQO A;  1URM A;  4XS1 A;  2I81 A;  3ZIV A;  4POL A;  4D73 A;  4OO5 A;  2HSY A;  1CQG A;  1OC9 B;  1A8L A;  3W6G A;  2GT6 A;  1F3B A;  3ZRD A;  2WDU A;  3CSI A;  2JU5 A;  1YZX A;  1BED A;  4WBJ A;  1N8J A;  6GSY A;  3APO A;  2H0H A;  5ECK B;  2RII A;  2XBQ A;  4DVC A;  5CRG A;  3FMW A;  4BL7 B;  1GRX A;  1U3A A;  1B9X C;  2X99 A;  2AHE A;  2DKI A;  1CQH A;  4AJ8 A;  2VLT A;  2H8L A;  1FB6 A;  5L71 A;  3ZIT A;  2RLI A;  3D4M A;  3DEX A;  1OC3 A;  3H93 A;  2XC2 A;  1TK8 B;  2KP1 A;  8GSS A;  3N5O A;  3D5J A;  5ECL B;  2IPA A;  2PPT A;  3GL5 A;  1Y25 A;  3IOS A;  3UL3 A;  4ICY A;  3D0Z A;  2R6K A;  2LQO A;  1SK1 A;  1TI1 A;  5A5K A;  5JWO B;  4FYC A;  4D73 B;  5J5N A;  2XBI A;  4F9Z A;  3EU3 A;  1K0O A;  4ECJ A;  2C1Y A;  4CHS A;  2IL3 A;  4J57 E;  4TOP A;  3RPN A;  1ST9 A;  1VGL A;  3TOT A;  2IMI A;  2NVL A;  2FLS A;  4PUF C;  5JWQ B;  1GUL A;  2GSQ A;  4ML6 A;  1THO A;  2MZC A;  2H19 A;  1DE1 A;  3TRQ A;  2AV4 A;  4AJ6 A;  2HNL A;  5ECI B;  4HZ4 A;  1F3A A;  2CT6 A;  2CZ2 A;  2VCT A;  1E6B A;  1V40 A;  4XRA A;  3PR8 A;  4BPY A;  1Q98 A;  2GLR A;  4G9H A;  4L8E A;  5G30 A;  3L9S A;  2H0I A;  2V41 A;  5GZZ B;  4GTU A;  3EUR A;  4BVY A;  2GGT A;  4QL7 A;  1R5A A;  1YEX A;  2VIM A;  2CVB A;  2R3X A;  4XS4 B;  1SD9 A;  1FG4 A;  1UC7 A;  4MK3 A;  4K2X A;  4XIH A;  2HZF A;  3ZVJ A;  1HYU A;  4Q5F A;  2B6M A;  4YH2 A;  4MDC A;  5AIS A;  4K8M A;  2VM1 A;  4V2L A;  3DWV A;  4FO5 A;  5G2Z A;  2QSI A;  1TW9 A;  1Z6M A;  3D6I A;  4KDU A;  1SJI A;  1HD2 A;  4FH8 A;  2JAD A;  1PL2 A;  3BBY A;  3LQ7 A;  4JU5 A;  5HFK A;  2FCH A;  2KUC A;  4K7O A;  3ZMK A;  2PVQ A;  2DIY A;  5D9W A;  5IMF A;  5CRE A;  3MIX A;  3TKS C;  4JBB A;  3DML A;  2HE3 A;  2L57 A;  5HR0 A;  2VM2 A;  4BVY B;  3KMN A;  4HOJ A;  5HR3 A;  2F9S A;  4YQM A;  3FKF A;  4IQ1 A;  4IVF A;  2O7K A;  5DAK A;  2YV9 A;  3F4S A;  1SEN A;  5G5E A;  4CW9 A;  3ME8 A;  3DGQ A;  4ZL9 A;  1JLW A;  1DE2 A;  1WMJ A;  2YOI A;  1ZYP A;  3IR4 A;  2WJU A;  4FIW A;  5DAL A;  3GKK A;  1XW9 A;  1SK0 A;  3UIW A;  2CA8 A;  1I5G A;  1WJK A;  4KE3 A;  2FWF A;  2IN3 A;  3KIJ A;  4ILF A;  3HJP A;  1Z5Y E;  1S3D A;  4JZQ A;  3I9V 2;  4LLR A;  2KOK A;  2VCW A;  1ZYQ B;  1J9B A;  1WRY A;  3GFK A;  1QUW A;  5F06 A;  1ZYE A;  5D9X A;  3WYW A;  5A4W A;  4POB A;  1TP9 A;  3QAV A;  3BJ5 A;  4WR4 A;  1IYH A;  4G0I A;  2FWE A;  5JCW A;  1JLV A;  2H0G A;  4NHW A;  2FNO A;  4V2N A;  1S3A A;  2CZ3 A;  5DAK B;  1DSB A;  4OFN A;  1Z7P A;  3TUE A;  1PA3 A;  1FVJ A;  1K3Y A;  4RQX A;  3ZRE A;  2HSM A;  2OAD A;  1BJX A;  2AUV A;  2YJ7 A;  4I8B A;  1A0R P;  1X9W B;  2HFD A;  1H75 A;  3FZ9 A;  5DAL B;  4MNN A;  4AJ7 A;  3FR3 A;  3KH9 A;  3DVW A;  3LSZ A;  4HZ2 A;  3GX0 A;  1XWG A;  5F8B A;  1R26 A;  1BYE A;  1QFN A;  4N0Z A;  4IW9 A;  1XIY A;  4IBP A;  4N0V A;  3HCZ A;  3C71 A;  1SKR B;  3FRC A;  4FQU A;  4GQF A;  1X9S B;  4BWQ A;  3TKQ A;  1QMV A;  1JHB A;  3H79 A;  4LL1 B;  2JZR A;  4BVX A;  1M2B A;  4X0X A;  1R4W A;  1GNE A;  3K8N A;  2DMM A;  3TOU A;  5D73 A;  3P90 A;  4I5Q A;  5B6M A;  5ECN B;  2QGV A;  5GAP D;  1MDJ A;  2XPD A;  4MP4 A;  3GKN A;  4PGT A;  3TJJ A;  3UJ1 A;  1M7T A;  3A5W A;  4KB3 A;  6GSS A;  4MA9 A;  4O92 A;  2GDR A;  1TU7 A;  2LJA A;  3V1W A;  1ERU A;  3IAM 2;  1K0N A;  4Q5R A;  2VCQ A;  2PUK C;  5IMZ A;  2B3S A;  4X4J A;  1TOF A;  4K0G A;  4MF6 A;  1OYJ A;  1K0M A;  3KH7 A;  3EC3 A;  4ULX A;  1SL1 B;  3HKR A;  4JE1 A;  1GWC A;  4POK A;  4NHZ A;  1T4Y A;  3TJG A;  4HI7 A;  1B48 A;  2GVP A;  2GSS A;  4F03 A;  1J08 A;  4G19 A;  3DKS A;  1MDK A;  4GQC A;  2EC4 A;  1K3L A;  2P5R A;  3VPQ A;  2JL4 A;  3ZYW A;  1KNG A;  3M8N A;  4ZB9 A;  19GS A;  1GUH A;  3M9J A;  1EV9 A;  4CY6 A;  4MZW A;  2R0P A;  4IN0 A;  2FHE A;  1GSY A;  2C0E A;  3RHB A;  4BVX B;  1WIK A;  5CRH A;  1B4P A;  4MJE A;  1B9Y C;  4HU7 A;  6GSU A;  1X9M B;  3UAP A;  1AW9 A;  1OAZ A;  3HDC A;  2FA4 A;  1OE7 A;  2VCX A;  4K7I A;  4WET A;  2DJ2 A;  3GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...