3D4MA

Glutaredoxin 2 oxidized structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
MVSQETVAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILKPVFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin-2, mitochondrial
publication title Structural aspects of the distinct biochemical properties of glutaredoxin 1 and glutaredoxin 2 from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3d4mA00
1ERVA 2LNTA 3CSIA 5AGYA 1GSFA 3GIXA 3GYKA 2LRCA 3M8NA 1TXXA 3ZIVA 3VI7A 3VK9A 4ECJA 3IBHA 1Z3EA 1FO5A 4TVEA 1V9WA 1GUKA 4HZ2A 2VAFA 5ECHB 2JU5A 2VL9A 4NV5A 3HKRA 4RQRA 4Q5RA 1DSBA 1PKZA 3QPMA 3TCOA 4YAVA 1MDJA 2HFDA 1Z9HA 1FB6A 2LEGA 1ON4A 3TGZA 4ULXA 2RM5A 1SK0A 3LYPA 3GX0A 5DQSA 3ZITA 1XCCA 3D22A 3RPNA 4KA0A 2GT6A 3CSHA 4JU5A 2OJLA 3KZQA 1YEXA 1ZYQB 2C8UA 4DSRA 1GSUA 3CRUA 3KJYA 3M9JA 4YQVA 5HR1A 4K7OA 1TOFA 4PXOA 2H72A 1BYEA 3C71A 3P2AA 3F4TA 1TP9A 1IYIA 19GSA 3FZAA 4G19A 3KMNA 1PRXA 4IBPA 4K0GA 2ON5A 2PWJA 3BOAA 2VUPA 7GSSA 2OBKA 4AJ7A 5B6NA 3W8JA 1EP8A 4OO4A 4L8EA 1EGRA 2M46A 4Z7XA 1SJZA 4KE3A 4MPFA 5DCHA 2VLVA 5G31A 2WJUA 2YNXA 1EZKA 1XXUA 3K8NA 2MMNA 3CXGA 2P5QA 4OWYA 3C7MA 1A8YA 1JHBA 2XHFA 5CAXA 4XCSA 1A8LA 2AHEA 3W8SA 3QAWA 1PQNA 4EC0A 1X9SB 4AF2A 4K0NA 2AB6A 3BCKA 3CTGA 3O6TA 2RIIA 2TIRA 2VCWA 2L57A 2CT6A 3DVXA 3D5JA 2VL3A 4DSSB 2WZ9A 3GL5A 2VCTA 1BX9A 1X9MB 3D4MA 4XS4B 1M2BA 3M1GA 2F3MA 4IP6A 4ZIJA 1SYRA 3KM6A 3TJFA 1NHYA 3IPZA 4JRRA 1TK5B 2QGVA 1G0TA 2VD0A 2IPAA 5F05A 3ISOA 1SD8A 4XRDA 1Z6NA 3BBYA 3CMIA 1M2AA 5JCGA 4WR5A 1AW9A 3TOTA 3WD6A 3MDKA 4G2EA 4QL9A 1OC9A 4LL1B 2IFQB 2V41A 3HZ8A 2REMA 5COHA 3IA1A 3L9VA 4V2LA 2I4AA 2EC4A 4LA1A 1TI3A 1SL0B 1A24A 4K7IA 3NIVA 1THXA 2PPTA 3KP8A 3ZRDA 4WKWA 3VWXA 5F0GA 3UMAA 1USBA 2CZ3A 4XRAA 1GUHA 2IMFA 1AUCA 2ON7A 3F9UA 2K6VA 3L0HA 3UBLA 5DVBA 2F9SA 1GSQA 2PMTA 3W6GA 4DSQA 2KHPA 3TKSA 2YV7A 5ECIB 1ZMAA 1R7HA 5DALA 1AC1A 4IHUA 4OMVA 1EP7A 1F9MA 1S3AA 5D73A 1GSEA 1RW1A 3KH9A 1JZDA 4XTSA 3QMXA 3ZREA 4GRFA 2XBQA 1RK4A 3FHKA 2AAWA 3GKMA 4K6XA 3QAVA 1TRSA 4PUAA 1ERWA 3RDWA 1R5PA 2I1UA 1F6MC 3TOUA 5J9CA 4YH2A 1UVZA 2YJHA 3FY7A 2OA7A 1GTBA 4EDZA 3MSZA 4FIWA 4E8HA 3LG6A 1A0RP 1GULA 5C00A 4BA7A 4TR1B 4ZXGA 3UIWA 2WDUA 5G5EA 2VD1A 4MMMA 2HNLA 1K3YA 4TR3A 20GSA 4TR0A 5E4WA 2V32A 2E2GA 4EDYA 1H75A 1M7TA 4X43A 5G30A 3L9UA 4IN0A 3TJGA 1PL2A 1YZXA 4RI7A 5F06A 5IIZA 2HSYA 3M0FA 2YANA 2G0FA 4PX1A 4GF0A 1XWAA 4AGSA 2H6ZA 1K0BA 3CRTA 1M2DA 2RUFA 4F0BA 3HD5A 1K0NA 1YF1A 1VF3A 3GSSA 2MYGA 4OO5A 1XWBA 2F51A 2P5RA 3EWLA 1KBNA 3GV1A 1CQHA 4IGJA 1PD21 2GS3A 3PR8A 4HJ2A 1ZGNA 5JWOB 3M3MA 2KOKA 4ID0A 1B4QA 4MH2A 1O85A 1QMVA 2HRFA 5GSSA 2DJ1A 1T4ZA 4OFMA 4ZL8A 2A4VA 4PURA 2C0FA 1A23A 3F3RA 2C0GA 2C1YA 13GSA 1V58A 3DIEA 5GSTA 1O73A 5G5FA 5KN3A 1A2MA 4N10A 2H6YA 3A3TA 2BJXA 5AIVA 1J08A 4NV2A 1W89A 3TKQA 3PINA 2HRNA 3HYPA 5HFGA 2VCQA 2HSHA 4RQXA 4TXOB 4QL7A 5GZZB 4N11A 3LQ7A 1EV4A 1BEDA 2Z9SA 3ME8A 5CNWA 2MMZA 3IOSA 2PVQA 2GLRA 4ZB6A 4MP4A 5ECPB 1SJIA 4MLYA 1MD4A 1FB0A 1J9BA 1XW5A 2EIQA 2GGTA 1ZOFA 4PQIA 1K3OA 1Q98A 4RUVA 1AIUA 4HOJA 4JR6A 3KCMA 5HR3A 3N9JA 1B9XC 5DBQA 4EVMA 2MBSA 3UVTA 6GSSA 1H4OA 1XWKA 4V2MA 2H76A 3ZFLA 3SBCA 2PU9C 3HCZA 1SYXA 3CYNA 2K9FA 2O8VB 4WEYA 1B9YC 4K1FA 4YAPA 5HR2A 2WB9A 4ZBDA 4N0VA 4V2NA 4IP1A 1ZL9A 2R4VA 5G2ZA 3A2XA 4XIHA 4QQ7A 2JSZA 1T1VA 1EEMA 1TU7A 2OE0A 5IO2A 2N5FA 2C3QA 4Q5NA 2VCZA 5CRWA 2A2RA 2VL2C 1X5DA 2L6DA 3ED3A 3GSTA 1GP1A 3GTUA 2QKEA 2H73A 3FZ9A 3HHVA 5KN0A 4YQUA 2QSIA 1JZOA 2GT5A 1GNEA 3F6DA 2GZZA 3ZZXA 2HZFA 2PBJA 4I8BA 2HZEA 2YZHA 3GFKA 3F4RA 3MAKA 5B7CA 2FD3A 4TRXA 2FLSA 4NHWA 2JSYA 1AQXA 4KGIA 3DVWA 2DSAA 4ZB8A 5IMCA 1BAYA 2DJ0A 1YF0A 1BQ7A 2DMLA 2H70A 1OE7A 4KSMA 1ERTA 1U88A 3F63A 3IRAA 3APOA 1T00A 3WYWA 3HY2A 1PX7A 1OC9B 4L0WA 1XBSA 2K8VA 2VCXA 2VM1A 3P8WA 2FHEA 2IIYA 5D9VA 2TRXA 1I9DA 1OE8A 4BWQA 3EINA 3VLNA 1VRSD 1NM3A 5ELAA 4EUYA 2FA8A 2H71A 18GSA 3LFLA 1M0UA 4G9HA 2GDRA 1X9WB 3J7Yk 1ST9A 1QXHA 3FZ4A 1GNWA 2IMEA 3EMPA 3QR6A 6GSWA 1WE0A 4X1UA 1GTUA 4PQHA 1HNCA 1ILOA 2N5BA 3FR9A 2H6XA 2MZCA 5DALB 4ECBA 1SKWB 2AUVA 4L5OA 4ML1A 2DMMA 1WPIA 5ECKB 4AJ6A 5DQYA 3H1NA 3QD9A 2DLXA 3RBTA 5KEJA 3SWLA 2B6MA 3KIJA 2OE1A 4POKA 3IK7A 1HNAA 1YDKA 2XPDA 3Q19A 3TRQA 5IMZA 1SL2B 2R2JA 4LLRA 5ID2A 1WWJA 4TKYA 4EE0A 3ME7A 1DE2A 3GH6A 3KH7A 1PSQA 4KAEA 5AN1A 2M72A 2X64A 4KCAA 3U5RE 2YZUA 1AQWA 2O87A 1DUGA 1Z7PA 4JR4A 5J41A 2M80A 2H30A 1ZZYA 4HS1A 3QDNA 4PQ1A 5ABRA 2HE3A 1URMA 2O85A 4GQCA 1ERUA 4GQFA 5DJLA 5A5KA 2H0GA 4MK3A 3ERGA 1TKDB 1O6JA 2JACA 1ZYEA 3TB2A 4I97A 2HYXA 3GMFA 4OCEA 1JLWA 3ZL5A 1GWCA 2LSTA 3VPTA 1PL1A 2IN3A 3APQA 5JCWA 1F37A 4GTUA 3E0UA 5E59A 5FT3A 6GSUA 3ERFA 1V57A 2VLTA 4L0UA 4DEJA 3HJMA 3HA9A 4F0CA 5FWGA 5GAND 2FY6A 5B8BA 3ZMLA 5D9XA 2KP1A 1K0DA 3UEMA 3IV4A 4ZL9A 5INYA 4EL1A 1E2YA 1KNGA 5D8IA 1S3DA 2NVLA 3HVSA 3HVVA 2YV9A 5CP1A 2CQ9A 2GSRA 2R37A 1NSWA 1MEKA 4JBBA 4MABA 4ISDA 2R5GA 3HJOA 3IAS2 2LV3A 3FRCA 3VI5A 1FVJA 3F0IA 3BJ5A 3GHAA 6GSVA 5A4VA 2TRCP 3UBKA 3LWAA 4IELA 4WF5A 1V40A 3GKNA 4V1Ag 2L4CA 5DJMA 4GWRA 3DXBA 4HDEA 2CV4A 4GLTA 2CAIA 1J0FA 4Q5QA 4ZILA 4IQ1A 3FK8A 4NPBA 1OAZA 4JE1A 1A2JA 3EURA 5HFKA 1YY7A 4EF0A 2HT9A 1UN2A 3GKKA 5HFIA 5D9WA 2VO4A 4NAXA 3KP9A 2XBIA 4BVYA 4TXVA 3VWVA 3C8EA 2GQMA 4EKZA 4MZWA 3I43A 4MJCA 2YWMA 1N2AA 2LS5A 5ECQB 1SL1B 3G7JA 4BWSA 2R3XA 4KH7A 3FYGA 3G9BA 4MF5A 4TOPA 1R26A 1GTIA 4OCFA 1KEBA 1XW6A 2DIYA 2LUSA 2E2MA 1AQVA 3F4SA 3PH9A 4WBJA 1K3LA 1SK1A 3ZVJA 4YQMA 4FYCA 4KW6A 5EY6A 2G2QA 3KTBA 4IJ3A 4ZB9A 1RQMA 1MD3A 1LU4A 3WGEA 1VF4A 2HXKA 1Q4JA 5A4UA 3I6AA 5H5SA 3TRPA 4FYBA 1TTZA 4HU9A 1PMTA 1XZOA 2B5XA 3LORA 5A4WA 3DMLA 3QCPA 3TKSE 1ML6A 3ZTLA 2X8GA 2LNSA 5IPGA 3UARA 3GNJA 2CA8A 1JFUA 4NMUA 1CQGA 1YKCA 3ZVJD 4N30A 1TRUA 1THOA 1VF2A 3LYKA 1C72A 2NBSA 1GRXA 2CX3A 5DAKA 5HQPA 5ECRB 5ECOB 4F82A 1O81A 2XPEA 4O5RA 3F6FA 2NDOA 2FWEA 1M9AA 4HUAA 2H1BA 4TR1A 1TI1A 2H1GA 1XOAA 4FO5A 3P7XA 3PGTA 3GTUB 1XOBA 4GSTA 1V2AA 2AYTA 3U6VA 2C80A 3OR5A 4J57E 2J23A 2YN1A 2FWHA 2GZPA 1OC8A 1E6BA 1QQ2A 2NTOA 5ECLB 1Y25A 5ECMB 3Q6OA 2X8HA 2BMXA 1U87A 2V2GA 3CTFA 2HZEB 2YJ7A 3APSA 1EOHA 5ECSA 4LMVA 2FCHA 4HEA2 4BPYA 1K0OA 3LGCA 2GSSA 2C3NA 3BD2A 3IXRA 2N5AA 1QK8A 3KTLA 1Z6MA 17GSA 3UOMA 4GSSA 2HLSA 1F2EA 2GQKA 4KDUA 2ZNMA 2FWFA 2EIOA 4D73A 5B8AA 3L4NA 2H8LA 10GSA 1SKSB 2B7KA 3VURA 2JZTA 4ILFA 2YWOA 1TK0B 1FOVA 4K2DA 5AIXA 3TKSC 1OVNA 4IW9A 3US3A 3VFIA 3GH9A 2I81A 1HYUA 3GN3A 2LRNA 2GSTA 2VM2A 1SU9A 3GURA 9GSSA 2DJJA 4MH3A 6GSXA 1AAZA 4ACSA 2DIZA 2BTOT 2LTKA 2GSQA 2R6KA 3GL3A 2YWNA 3EYTA 3QOUA 3HXSA 3IAM2 1A2LA 1K0CA 1GUMA 2LRTA 4TXOA 1TRWA 2YP6A 2C4JA 1WP0A 5KN2A 5DCGA 2EIRA 2YCDA 3DKSA 2DJKA 1GH2A 1DE1A 2V1MA 2E0QA 4EO3A 1YQ1A 1FVKA 3TKPA 3FR6A 2JZSA 4OD7A 1XVWA 1GSSA 1X0RA 1G7EA 2I9HA 4KNDA 3UJ1A 4KCEA 2LJRA 3E9JB 2VLUA 1NHOA 2VIMA 3IC4A 2FNOA 2H74A 4K7NA 2ZUPA 2CVDA 1FW1A 3D6IA 1DBYA 2DJ3A 1PN9A 1G7OA 1PX6A 3HDCA 4CHSA 1FHEA 2OE3A 2MMAA 2OADA 2WGRA 5EL8A 1SK2A 3EU4A 2C0EA 1BG5A 2P31A 2LJAA 2V6KA 3DRNA 4ZL7A 1O7UA 1I5GA 1A0FA 1PKWA 5G1LA 1R4WA 3GUSA 5IOXA 4IVFA 3FR3A 4I2UA 4ZBBA 5C04A 3A5WA 3EMXA 2ZCTA 1IYHA 5F8BA 2YOIA 2B1LA 4HJMA 2PUKC 4JZQA 1JLVA 3KXOA 2CX4A 2WFCA 4CDOA 4I2TA 2WCIA 3O76A 2B1KA 3DEXA 2VCVA 22GSA 1U3IA 4IQAA 4I6XA 1EOGA 2GTUA 3N5OA 2DBCA 4AJ8A 4H86A 1S3CA 1HQOA 3RHCA 2MMOA 4POBA 3MNGA 5D9TA 3ZYWA 2KUCA 1JZRA 4TN8A 3LJRA 1FAAA 4KDYA 2WS2A 1M9BA 5H5RA 1T7PB 1Y6EA 1HD2A 3F3QA 2AJQB 3FKFA 4PNFA 3EVIA 1QFNA 1MDKA 2D2ZA 3GX8A 1UA5A 14GSA 5CRHA 2ES7A 3KGKA 4CW9A 3L9SA 2KP2A 5LNKe 1GLPA 5LCZA 1YEPA 2H01A 3D0ZA 4F03A 5IMAA 5EPFA 1JZWA 5HR0A 2X8CA 3IE3A 3BCIA 2H75A 2E7PA 1XWCA 16GSA 4FH8A 4PNGA 1U3AA 2RM6A 2H1DA 1UC7A 4NHZA 1OC3A 5D93A 2PGTA 3WT2A 1YJ6A 4MJAA 2DC5A 4K8MA 1BJXA 3TKRA 2RUEA 4MA9A 1TRVA 2LQQA 1SENA 4G10A 1X5CA 4HI7A 2ALBA 5G1KA 1YKAA 5IM9A 2O89A 4BL7A 2IMKA 2B5YA 2L6CA 1F3BA 1XVQA 1MDIA 3E3EA 5FHIA 2C0DA 1ACVA 1Z7RA 2WRTA 1EGOA 1AXDA 5JWRB 4DVCA 3NOFA 3LXTA 3Q74A 3O3TA 2JL4A 3EE2A 4F2IA 4LMWA 1WJKA 5ELGA 2AV4A 2KLXA 4PUFC 4MJEA 4NWYA 3A2VA 2GVPA 3QFAC 3J7Yb 1T8EB 3D21A 1T3BA 3EU3A 4K9ZA 1KTEA 2CZ2A 3IHQA 3KMOA 1FG4A 1W4VA 2X99A 2HI7A 2OKAA 8GSSA 3UVHA 5AISA 3LXZA 1OKDA 4XHMA 2K8SA 5IPHA 3TDGA 1WIKA 4ECCA 1OKTA 5IQYA 4XS1A 2VL2A 4MPGA 4KDXA 3TRXA 3RPPA 4DSSA 4JEDA 3RAZA 2NPBA 4KSOA 2JZRA 5DAKB 5IMFA 4PGTA 4XS4A 4O32A 4XS6A 3VPQA 3C1RA 2H1AA 5J5NA 2GQLA 3D4TA 1HNBA 2VOCA 3S9FA 2LKUA 4WBRD 1B4PA 2OACA 3H8QA 5CRDA 1TU8A 5H5QA 2B3SA 5J3RA 3M9KA 3TJJA 2IFQA 1T4YA 2QC7A 1XPVA 2O7KA 1WOUA 6GSTA 1SJ6A 2V6OA 3NZNA 5DDLA 2IMDA 5D96A 3V1WA 1F3AA 3DD3A 4V1Ap 1N8JA 5ECNB 3LEFA 1PGTA 1OYJA 2L5LA 3ZMKA 1WRYA 4WXTA 4KUNA 2L4QA 1VGLA 1ZCPA 1EWXA 1R5AA 1B48A 2I3YA 5EVOA 4LL4B 4GXZA 4GSNA 3A2WA 3QFBC 1EV9A 3I69A 2FGXA 5KN1A 3C73A 3UL3A 2DJ2A 4D73B 1X5EA 4MJBA 5CRGA 2XC2A 4KX4A 4MZBA 2C3TA 5GAPD 5IMVA 4P3YB 3EC3A 1O8WA 4L5LA 4J2FA 4FYUA 2IWTA 4MF7A 4N0ZA 3ERWA 4HQZA 12GSA 4ECIA 5ENUA 3L78A 2IL3A 3IK9A 3AY8A 5CO3A 3H4KA 3CSJA 1GTAA 2P0GA 3HJPA 4X0XA 1LBKA 3ZLPA 2CAQA 4WF4A 3C1SA 3KD0A 3P90A 2B7JA 3GRXA 3VWWA 5L71A 3JCML 5J9BA 1K0MA 3FEUA 3MWHA 1NW2A 5IO0A 1V98A 3H79A 1M99A 2PERA 2H0HA 2A2SA 3I9V2 2JADA 1PA3A 2FUG2 2WULA 1XIYA 4IS0A 3FW2A 3IR4A 2YPMA 1LJRA 4MCUA 4J56E 2K18A 3DGQA 4GCIA 1GL8A 1ABAA 3QAGA 1G6WA 4O7HA 5J4UA 4BVXA 3G7IA 4KB3A 1VF1A 2L5OA 2FWGA 4HU7A 2F8AA 2FA4A 1QUWA 3WGDA 1G6YA 3ZIJA 3GA4A 2LJKA 3LSZA 2CVKA 2F8FA 3VWUA 3GKXA 1WMJA 3HVXA 2LQOA 3DYRA 5CREA 3TJKA 1XWGA 6GSYA 4I5QA 1QGVA 2CVBA 3TJBA 5LD0A 4MZCA 3IDVA 5JCUA 11GSA 2H66A 2L59A 4WR4A 2GZYA 3TUEA 1EEJA 1GSDA 4IJIA 2H19A 1XFLA 3FZ5A 4POLA 2MBTA 3WGXA 1O8XA 3ZFBA 3HZ4A 2H0IA 3WT1A 1SKRB 3H93A 1SD9A 1U6TA 5F07A 4TW5A 2PN8A 5IOWA 2PVOC 1TK8B 1B8XA 2IMIA 1XW9A 4MDCA 2YWIA 1TJDA 3G7YA 4IKHA 3UAPA 2OBIA 4NXIA 1GLQA 3Q18A 5CYYA 4Q5FA 4HZ4A 1Z5YE 3KEBA 4OFTA 2J9HA 1K0AA 4POMA 4RI6A 5IMDA 4F9ZA 4TR4A 4OFNA 2IJYA 4ML6A 4WETA 5JWQB 2B5EA 5B6MA 3DWVA 4MF6A 3R2QA 4EXJA 3CBUA 4E8EA 4O92A 2RLIA 3RHBA 1TDIA 1GSYA 1MTCA 3F8UA 4HQSA 1TW9A 5ID2B 4ZBAA
chains in the Genus database with same CATH superfamily
1ERVA 2LNTA 3CSIA 5AGYA 1GSFA 3GIXA 3GYKA 2LRCA 3M8NA 1TXXA 3ZIVA 3VI7A 3VK9A 4ECJA 3IBHA 1Z3EA 1FO5A 4TVEA 1V9WA 1GUKA 4HZ2A 2VAFA 5ECHB 2JU5A 2VL9A 4NV5A 3HKRA 4RQRA 4Q5RA 1DSBA 1PKZA 3QPMA 3TCOA 4YAVA 1MDJA 2HFDA 1Z9HA 1FB6A 2LEGA 1ON4A 3TGZA 4ULXA 2RM5A 1SK0A 3LYPA 3GX0A 5DQSA 3ZITA 1XCCA 3D22A 3RPNA 4KA0A 1ZYPA 2GT6A 3CSHA 4JU5A 4BIKA 2OJLA 3KZQA 1YEXA 1ZYQB 2C8UA 4DSRA 1GSUA 3CRUA 3KJYA 3M9JA 4YQVA 5HR1A 4K7OA 1TOFA 4PXOA 2H72A 1BYEA 4BL7B 3C71A 3P2AA 3F4TA 1TP9A 4K2XA 1IYIA 19GSA 3FZAA 4G19A 3KMNA 1PRXA 4IBPA 4K0GA 2ON5A 2PWJA 3BOAA 2VUPA 7GSSA 2OBKA 4AJ7A 5B6NA 3W8JA 1EP8A 4OO4A 4L8EA 1EGRA 2M46A 4Z7XA 1SJZA 4KE3A 4MPFA 5DCHA 1ZYNA 2VLVA 5G31A 2WJUA 2YNXA 1EZKA 1XXUA 3K8NA 2MMNA 3MYDA 3CXGA 2P5QA 4OWYA 3C7MA 1A8YA 1JHBA 2XHFA 5CAXA 4XCSA 1A8LA 2AHEA 3W8SA 3QAWA 1PQNA 4EC0A 2DKHA 2R0CA 1X9SB 4AF2A 4K0NA 2AB6A 3BCKA 3CTGA 3O6TA 2RIIA 2TIRA 2VCWA 2L57A 2CT6A 3DVXA 3D5JA 2VL3A 4DSSB 2WZ9A 3GL5A 2VCTA 1BX9A 1X9MB 3D4MA 4XS4B 1M2BA 3M1GA 2F3MA 4IP6A 4ZIJA 1SYRA 3KM6A 3TJFA 1NHYA 3IPZA 4JRRA 1TK5B 2QGVA 1G0TA 2VD0A 2IPAA 5F05A 1M3IA 3ISOA 1SD8A 4XRDA 1Z6NA 3BBYA 3CMIA 1M2AA 5JCGA 4WR5A 1AW9A 3TOTA 3WD6A 3MDKA 4G2EA 4QL9A 1OC9A 4LL1B 2IFQB 2V41A 3HZ8A 2REMA 5COHA 3IA1A 3L9VA 4V2LA 2I4AA 4O5QA 2EC4A 4LA1A 1TI3A 1SL0B 1A24A 4K7IA 3NIVA 1THXA 2PPTA 3KP8A 3ZRDA 4WKWA 3VWXA 5F0GA 3UMAA 3EPTA 1USBA 2CZ3A 4XRAA 1GUHA 2IMFA 1AUCA 2ON7A 3F9UA 2K6VA 3L0HA 3UBLA 5DVBA 2F9SA 1GSQA 2PMTA 3W6GA 4DSQA 2KHPA 3TKSA 2YV7A 5ECIB 1ZMAA 1R7HA 5DALA 1AC1A 4IHUA 4OMVA 1EP7A 1F9MA 1S3AA 4YKGA 5D73A 1GSEA 1RW1A 3KH9A 1JZDA 4XTSA 3QMXA 3ZREA 4GRFA 2XBQA 1RK4A 3FHKA 2AAWA 3GKMA 4K6XA 2A4HA 3QAVA 1TRSA 4PUAA 1ERWA 3RDWA 1R5PA 2I1UA 1F6MC 3TOUA 5J9CA 4YH2A 1UVZA 2YJHA 3FY7A 2OA7A 1GTBA 4EDZA 3MSZA 4FIWA 4E8HA 3LG6A 4Z2TA 1A0RP 1GULA 5C00A 4BA7A 4TR1B 4ZXGA 3UIWA 2WDUA 5G5EA 2VD1A 4MMMA 2HNLA 1K3YA 4TR3A 20GSA 4TR0A 5E4WA 2V32A 2E2GA 4EDYA 1H75A 1M7TA 4X43A 5G30A 3L9UA 4IN0A 3TJGA 1PL2A 1YZXA 4RI7A 5F06A 5IIZA 2HSYA 3M0FA 2YANA 2G0FA 4PX1A 4BVXB 4GF0A 1XWAA 4AGSA 2H6ZA 1K0BA 3CRTA 1M2DA 2RUFA 4F0BA 3HD5A 1K0NA 1YF1A 1VF3A 3GSSA 2MYGA 4OO5A 1XWBA 4A5PA 2F51A 2P5RA 3EWLA 1KBNA 3GV1A 1CQHA 4IGJA 1PD21 2GS3A 3PR8A 4HJ2A 1ZGNA 5JWOB 3M3MA 2KOKA 4ID0A 1B4QA 4MH2A 1O85A 1QMVA 2HRFA 5GSSA 2DJ1A 1T4ZA 4OFMA 4ZL8A 2A4VA 4PURA 2C0FA 1A23A 3F3RA 2C0GA 2C1YA 13GSA 1V58A 3DIEA 5GSTA 1O73A 5G5FA 5KN3A 1A2MA 4N10A 2H6YA 3A3TA 2BJXA 5AIVA 1J08A 4NV2A 1W89A 3TKQA 3PINA 2HRNA 3HYPA 5HFGA 2VCQA 2HSHA 4RQXA 4TXOB 4QL7A 5GZZB 4N11A 3LQ7A 1EV4A 1BEDA 2Z9SA 3ME8A 2HRKA 5CNWA 2MMZA 3IOSA 2PVQA 2GLRA 4ZB6A 4MP4A 5ECPB 1SJIA 2HSMA 4MLYA 1MD4A 1FB0A 3FMWA 1J9BA 1XW5A 2EIQA 2GGTA 1ZOFA 4PQIA 1K3OA 1Q98A 4RUVA 1AIUA 4HOJA 4JR6A 3KCMA 5HR3A 3N9JA 1B9XC 5DBQA 4EVMA 2MBSA 3UVTA 6GSSA 1H4OA 1XWKA 4V2MA 3PPUA 2H76A 2A2PA 3ZFLA 3SBCA 2PU9C 3HCZA 1SYXA 3CYNA 2K9FA 1FOHA 2O8VB 4WEYA 1B9YC 4K1FA 4YAPA 5HR2A 4G0KA 3IC8A 2WB9A 4ZBDA 4N0VA 4V2NA 4IP1A 1ZL9A 2R4VA 5G2ZA 3A2XA 4XIHA 4QQ7A 2JSZA 1T1VA 1EEMA 1TU7A 3HVNA 2OE0A 5IO2A 2N5FA 2C3QA 4Q5NA 1S3RA 2VCZA 5CRWA 2A2RA 2VL2C 1X5DA 2L6DA 3ED3A 3GSTA 1GP1A 3GTUA 2QKEA 2H73A 3FZ9A 3HHVA 5KN0A 4YQUA 4CY8A 2QSIA 1JZOA 2GT5A 1GNEA 3F6DA 2GZZA 3ZZXA 2HZFA 2PBJA 4I8BA 2HZEA 2YZHA 3GFKA 3F4RA 3MIXA 3MAKA 5B7CA 2FD3A 4TRXA 2FLSA 4NHWA 2JSYA 1AQXA 4KGIA 3DVWA 2DSAA 4ZB8A 5IMCA 1BAYA 2DJ0A 1YF0A 1BQ7A 2DMLA 2H70A 1OE7A 4KSMA 1ERTA 1U88A 3F63A 3IRAA 3APOA 1T00A 3WYWA 3HY2A 1PX7A 1OC9B 4L0WA 1XBSA 2K8VA 2VCXA 2VM1A 3P8WA 2FHEA 2IIYA 5D9VA 2TRXA 1I9DA 1OE8A 4BWQA 3EINA 3VLNA 1VRSD 1NM3A 5ELAA 4EUYA 2FA8A 2H71A 18GSA 3LFLA 1M0UA 4G9HA 2GDRA 1XG8A 1X9WB 3J7Yk 1ST9A 1QXHA 3FZ4A 1GNWA 2IMEA 3EMPA 3QR6A 6GSWA 1WE0A 4X1UA 1GTUA 4PQHA 1HNCA 1ILOA 2N5BA 3FR9A 2H6XA 2MZCA 5DALB 4ECBA 1SKWB 2AUVA 4L5OA 4ML1A 2DMMA 1WPIA 5ECKB 4AJ6A 5DQYA 3H1NA 3QD9A 2DLXA 3RBTA 5KEJA 3SWLA 2B6MA 3KIJA 2OE1A 4POKA 3IK7A 1HNAA 1YDKA 2XPDA 3Q19A 3TRQA 5IMZA 1SL2B 2R2JA 4LLRA 5ID2A 3CQFA 1WWJA 4TKYA 4EE0A 3ME7A 1DE2A 3GH6A 3KH7A 1PSQA 4KAEA 5AN1A 2M72A 2X64A 4KCAA 3U5RE 2YZUA 1AQWA 2O87A 1DUGA 1Z7PA 4JR4A 5J41A 2M80A 2H30A 1ZZYA 4HS1A 3QDNA 4PQ1A 5ABRA 2HE3A 1URMA 2O85A 4GQCA 1ERUA 4GQFA 5DJLA 5A5KA 2H0GA 4MK3A 3ERGA 1TKDB 1O6JA 2JACA 1ZYEA 3TB2A 4I97A 2HYXA 3GMFA 4OCEA 1JLWA 3ZL5A 1GWCA 2LSTA 3VPTA 1PL1A 2IN3A 3APQA 5JCWA 1F37A 4GTUA 3E0UA 5E59A 5FT3A 6GSUA 3ERFA 1V57A 2VLTA 4L0UA 4DEJA 3HJMA 3HA9A 4F0CA 5FWGA 5GAND 2FY6A 5B8BA 3ZMLA 5D9XA 2KP1A 1K0DA 3UEMA 3IV4A 4ZL9A 5INYA 4EL1A 1E2YA 1KNGA 5D8IA 1S3DA 2NVLA 3HVSA 3HVVA 2YV9A 5CP1A 2DKIA 2CQ9A 2GSRA 2R37A 2R0GA 1NSWA 1MEKA 4JBBA 4MABA 4ISDA 2R5GA 3HJOA 3IAS2 2LV3A 2R0PA 3FRCA 3VI5A 1FVJA 3F0IA 3BJ5A 3GHAA 6GSVA 5A4VA 2TRCP 3UBKA 3LWAA 4IELA 4WF5A 1V40A 3GKNA 4V1Ag 2L4CA 5DJMA 4GWRA 3DXBA 4HDEA 4HSCX 2CV4A 4GLTA 2CAIA 1J0FA 4X4JA 4Q5QA 4ZILA 4IQ1A 3A5IA 3FK8A 4NPBA 1OAZA 4JE1A 1A2JA 3EURA 5HFKA 1YY7A 4FQUA 4EF0A 2HT9A 1UN2A 3GKKA 5HFIA 5D9WA 2VO4A 4NAXA 3KP9A 2XBIA 4BVYA 4TXVA 3VWVA 3C8EA 2GQMA 4EKZA 4MZWA 3I43A 4MJCA 2YWMA 1N2AA 2LS5A 5ECQB 1SL1B 3G7JA 4BWSA 2R3XA 4KH7A 3FYGA 3G9BA 4MF5A 4TOPA 1R26A 1GTIA 4OCFA 1KEBA 1XW6A 2DIYA 2LUSA 2E2MA 1PN0A 1AQVA 3F4SA 3PH9A 4WBJA 1K3LA 1SK1A 3ZVJA 4YQMA 4FYCA 4KW6A 5EY6A 2G2QA 3KTBA 4IJ3A 4ZB9A 1RQMA 1MD3A 1LU4A 3WGEA 1VF4A 2HXKA 1Q4JA 5A4UA 3I6AA 5H5SA 3TRPA 4FYBA 1TTZA 4HU9A 1PMTA 1XZOA 2B5XA 3LORA 5A4WA 3DMLA 3QCPA 3TKSE 1ML6A 3ZTLA 2X8GA 2LNSA 5IPGA 3UARA 3GNJA 2CA8A 1JFUA 4NMUA 1CQGA 1YKCA 3ZVJD 4N30A 1TRUA 1THOA 1VF2A 3LYKA 1C72A 2NBSA 1GRXA 2CX3A 5DAKA 5HQPA 5ECRB 5ECOB 4Z2RA 4F82A 1O81A 2XPEA 4O5RA 3F6FA 2NDOA 2FWEA 1M9AA 4HUAA 2H1BA 4TR1A 1TI1A 2H1GA 1XOAA 4FO5A 3P7XA 3PGTA 3GTUB 1XOBA 4GSTA 1V2AA 2AYTA 3U6VA 2C80A 3OR5A 4J57E 2J23A 2YN1A 2FWHA 2GZPA 1OC8A 1E6BA 1QQ2A 2NTOA 5ECLB 1Y25A 5ECMB 3Q6OA 2X8HA 2BMXA 1U87A 2V2GA 3CTFA 2HZEB 5KOWA 2YJ7A 3APSA 1EOHA 5ECSA 4LMVA 2FCHA 4HEA2 4BPYA 1K0OA 4USSA 3LGCA 2GSSA 2C3NA 3BD2A 3IXRA 2N5AA 1QK8A 3KTLA 1Z6MA 17GSA 3UOMA 4GSSA 2HLSA 1F2EA 4G0IA 2GQKA 4KDUA 2ZNMA 2FWFA 2EIOA 4D73A 5B8AA 3L4NA 2H8LA 10GSA 1SKSB 2B7KA 3VURA 2JZTA 4ILFA 2YWOA 1TK0B 1FOVA 4K2DA 5AIXA 3TKSC 1OVNA 4IW9A 3US3A 3VFIA 3GH9A 2I81A 1HYUA 3GN3A 2LRNA 2GSTA 2VM2A 1SU9A 3GURA 5KOXA 9GSSA 2DJJA 4MH3A 6GSXA 1AAZA 4ACSA 2DIZA 2BTOT 2LTKA 2GSQA 2R6KA 3GL3A 2YWNA 3EYTA 3QOUA 3HXSA 3IAM2 1A2LA 1K0CA 2X4AA 1GUMA 2LRTA 4TXOA 1TRWA 2YP6A 2C4JA 1WP0A 2X49A 5KN2A 5DCGA 2EIRA 2YCDA 3DKSA 2DJKA 1GH2A 1DE1A 2V1MA 2E0QA 4EO3A 1YQ1A 1FVKA 3TKPA 3FR6A 2JZSA 4OD7A 1XVWA 1GSSA 1X0RA 1G7EA 2I9HA 4KNDA 3UJ1A 4KCEA 2LJRA 3E9JB 2VLUA 1NHOA 4PTSA 2VIMA 3IC4A 2FNOA 2H74A 4K7NA 2ZUPA 2CVDA 1FW1A 4ICYA 3D6IA 1DBYA 2DJ3A 1PN9A 1G7OA 1PX6A 3HDCA 4CHSA 1FHEA 2OE3A 2MMAA 2OADA 2WGRA 5EL8A 1SK2A 3EU4A 2C0EA 1BG5A 2P31A 2LJAA 2V6KA 3DRNA 4ZL7A 1O7UA 1I5GA 1A0FA 1PKWA 5G1LA 1R4WA 3GUSA 5IOXA 4IVFA 3FR3A 4I2UA 4ZBBA 5C04A 3A5WA 3EMXA 2ZCTA 4K5SA 1IYHA 5F8BA 2YOIA 2B1LA 4HJMA 2PUKC 4JZQA 1JLVA 3KXOA 2CX4A 2WFCA 4CDOA 4I2TA 2HRAA 2WCIA 4EIPA 3O76A 2B1KA 3DEXA 2VCVA 22GSA 1U3IA 4IQAA 4I6XA 1EOGA 2GTUA 3N5OA 2DBCA 4AJ8A 4H86A 1S3CA 1HQOA 3RHCA 2MMOA 4POBA 3MNGA 5D9TA 3ZYWA 2KUCA 4K5RA 1JZRA 4TN8A 3LJRA 1FAAA 4KDYA 2WS2A 1M9BA 5H5RA 3LW9A 1T7PB 1Y6EA 1HD2A 3F3QA 2AJQB 3FKFA 4PNFA 3EVIA 1QFNA 1MDKA 2D2ZA 3GX8A 1UA5A 14GSA 5CRHA 2ES7A 3KGKA 4CW9A 3L9SA 2KP2A 5LNKe 1GLPA 5LCZA 1YEPA 2H01A 3D0ZA 4F03A 5IMAA 5EPFA 1JZWA 5HR0A 2X8CA 3IE3A 3BCIA 2H75A 2E7PA 1XWCA 16GSA 4FH8A 4PNGA 1U3AA 2RM6A 2H1DA 1UC7A 4BVYB 4NHZA 1OC3A 5D93A 2PGTA 3WT2A 1YJ6A 4MJAA 2DC5A 4K8MA 1BJXA 3TKRA 2RUEA 4MA9A 1TRVA 2LQQA 1SENA 4G10A 1X5CA 4HI7A 4EIQA 2ALBA 5G1KA 1YKAA 5IM9A 2O89A 4BL7A 2IMKA 2B5YA 2L6CA 1F3BA 1XVQA 1MDIA 3E3EA 5FHIA 4Z2UA 2C0DA 1ACVA 1Z7RA 2WRTA 1EGOA 1AXDA 5JWRB 4DVCA 3NOFA 3LXTA 5BMUA 3Q74A 3O3TA 2JL4A 3EE2A 4F2IA 4LMWA 1PFOA 1WJKA 5ELGA 2AV4A 2KLXA 4PUFC 4MJEA 4NWYA 3A2VA 2GVPA 3QFAC 3J7Yb 1T8EB 3D21A 1T3BA 3EU3A 4MNNA 4K9ZA 1KTEA 2CZ2A 3IHQA 3KMOA 4YKFA 1FG4A 1W4VA 2X99A 2HI7A 2OKAA 8GSSA 3UVHA 3R3EA 5AISA 3LXZA 1OKDA 4XHMA 2K8SA 5IPHA 3TDGA 1WIKA 4ECCA 1OKTA 5IQYA 4XS1A 2VL2A 4MPGA 4KDXA 3TRXA 3RPPA 4DSSA 4JEDA 2QA1A 3RAZA 2NPBA 4KSOA 2JZRA 5DAKB 5IMFA 4PGTA 4XS4A 4O32A 4XS6A 3VPQA 3C1RA 2H1AA 5J5NA 4CY6A 2GQLA 3D4TA 1HNBA 2VOCA 3S9FA 2LKUA 4WBRD 1B4PA 2OACA 3H8QA 5CRDA 1TU8A 5H5QA 2B3SA 5J3RA 3M9KA 3TJJA 2IFQA 1T4YA 2QC7A 1XPVA 2O7KA 1WOUA 6GSTA 1SJ6A 2V6OA 3NZNA 5DDLA 2IMDA 5D96A 3V1WA 1F3AA 3DD3A 4V1Ap 1N8JA 5ECNB 3LEFA 1PGTA 1OYJA 2L5LA 3ZMKA 1WRYA 4WXTA 4KUNA 4O5UA 2L4QA 1VGLA 1ZCPA 1EWXA 1R5AA 1B48A 2I3YA 5EVOA 4LL4B 4GXZA 4GSNA 3A2WA 3QFBC 1EV9A 3I69A 2FGXA 5KN1A 3C73A 3UL3A 2DJ2A 1M3JA 4D73B 1X5EA 4MJBA 5CRGA 2XC2A 4KX4A 4MZBA 2C3TA 5GAPD 5IMVA 4P3YB 3EC3A 1O8WA 4L5LA 4J2FA 4FYUA 2IWTA 4MF7A 4N0ZA 3ERWA 4HQZA 3IHGA 12GSA 4ECIA 5ENUA 3L78A 2IL3A 3IK9A 3AY8A 5CO3A 3H4KA 3CSJA 1GTAA 2P0GA 3HJPA 4X0XA 1LBKA 3ZLPA 2CAQA 4WF4A 3C1SA 3KD0A 3P90A 2B7JA 3GRXA 3VWWA 5L71A 3JCML 5J9BA 1K0MA 3FEUA 3MWHA 1NW2A 5IO0A 1V98A 3H79A 1M99A 2PERA 2H0HA 2A2SA 3I9V2 2JADA 1PA3A 2FUG2 2WULA 1XIYA 4IS0A 3FW2A 3IR4A 2QA2A 2YPMA 1LJRA 4MCUA 4J56E 2K18A 3DGQA 4GCIA 1GL8A 1ABAA 3QAGA 1G6WA 4O7HA 5J4UA 4BVXA 3G7IA 4KB3A 1VF1A 2L5OA 2FWGA 4HU7A 2F8AA 2FA4A 1QUWA 3WGDA 1G6YA 3ZIJA 3GA4A 2LJKA 3LSZA 2CVKA 2F8FA 3VWUA 3GKXA 1WMJA 2UZ8A 3HVXA 2LQOA 3DYRA 5CREA 3TJKA 4G0LA 1XWGA 6GSYA 4I5QA 1QGVA 2CVBA 3TJBA 5LD0A 4MZCA 3IDVA 5JCUA 11GSA 2H66A 2L59A 4WR4A 4KF9A 2GZYA 3TUEA 1EEJA 1GSDA 4IJIA 5BRTA 2H19A 1XFLA 3FZ5A 4POLA 2MBTA 3WGXA 1O8XA 3ZFBA 3HZ4A 2H0IA 3WT1A 1SKRB 3H93A 1SD9A 1U6TA 5F07A 4TW5A 2PN8A 5IOWA 2PVOC 1TK8B 1B8XA 2IMIA 1XW9A 4MDCA 2YWIA 1TJDA 3G7YA 4IKHA 3UAPA 2OBIA 4NXIA 1GLQA 3Q18A 5CYYA 4Q5FA 4HZ4A 1Z5YE 3KEBA 4OFTA 2J9HA 1K0AA 4POMA 4RI6A 5IMDA 4F9ZA 4TR4A 4OFNA 2IJYA 4ML6A 4WETA 5JWQB 2B5EA 5B6MA 3DWVA 4MF6A 3R2QA 4EXJA 3CBUA 4E8EA 4O92A 2RLIA 3RHBA 1TDIA 1GSYA 1MTCA 3F8UA 4HQSA 1TW9A 5ID2B 4ZBAA
chains in the Genus database with same CATH topology
1ERVA 2LNTA 3CSIA 5AGYA 1GSFA 3GIXA 3GYKA 2LRCA 3M8NA 1TXXA 3ZIVA 3VI7A 3VK9A 4ECJA 3IBHA 1Z3EA 1FO5A 4TVEA 1V9WA 1GUKA 4HZ2A 2VAFA 5ECHB 2JU5A 2VL9A 4NV5A 3HKRA 4RQRA 4Q5RA 1DSBA 1PKZA 3QPMA 3TCOA 4YAVA 1MDJA 2HFDA 1Z9HA 1FB6A 2LEGA 1ON4A 3TGZA 4ULXA 2RM5A 1SK0A 3LYPA 3GX0A 5DQSA 3ZITA 1XCCA 3D22A 3RPNA 4KA0A 1ZYPA 2GT6A 3CSHA 4JU5A 2OJLA 3KZQA 1YEXA 1ZYQB 2C8UA 4DSRA 1GSUA 3CRUA 3KJYA 3M9JA 4YQVA 5HR1A 4K7OA 1TOFA 4PXOA 2H72A 1BYEA 4BL7B 3C71A 3P2AA 3F4TA 1TP9A 4K2XA 1IYIA 19GSA 3FZAA 4G19A 3KMNA 1PRXA 4IBPA 4K0GA 2ON5A 2PWJA 3BOAA 2VUPA 7GSSA 2OBKA 4AJ7A 5B6NA 3W8JA 1EP8A 4OO4A 4L8EA 1EGRA 2M46A 4Z7XA 1SJZA 4KE3A 4MPFA 5DCHA 1ZYNA 2VLVA 5G31A 2WJUA 2YNXA 1EZKA 1XXUA 3K8NA 2MMNA 3MYDA 3CXGA 2P5QA 4OWYA 3C7MA 1A8YA 1JHBA 2XHFA 5CAXA 4XCSA 1A8LA 2AHEA 3W8SA 3QAWA 1PQNA 4EC0A 2DKHA 2R0CA 1X9SB 4AF2A 4K0NA 2AB6A 3BCKA 3CTGA 3O6TA 2RIIA 2TIRA 2VCWA 2L57A 2CT6A 3DVXA 3D5JA 2VL3A 4DSSB 2WZ9A 3GL5A 2VCTA 1BX9A 1X9MB 3D4MA 4XS4B 1M2BA 3M1GA 2F3MA 4IP6A 4ZIJA 1SYRA 3KM6A 3TJFA 1NHYA 3IPZA 4JRRA 1TK5B 2QGVA 1G0TA 2VD0A 2IPAA 5F05A 3ISOA 1SD8A 4XRDA 1Z6NA 3BBYA 3CMIA 1M2AA 5JCGA 4WR5A 1AW9A 3TOTA 3WD6A 3MDKA 4G2EA 4QL9A 1OC9A 4LL1B 2IFQB 2V41A 3HZ8A 2REMA 5COHA 3IA1A 3L9VA 4V2LA 2I4AA 4O5QA 2EC4A 4LA1A 1TI3A 1SL0B 1A24A 4K7IA 3NIVA 1THXA 2PPTA 3KP8A 3ZRDA 4WKWA 3VWXA 5F0GA 3UMAA 3EPTA 1USBA 2CZ3A 4XRAA 1GUHA 2IMFA 1AUCA 2ON7A 3F9UA 2K6VA 3L0HA 3UBLA 5DVBA 2F9SA 1GSQA 2PMTA 3W6GA 4DSQA 2KHPA 3TKSA 2YV7A 5ECIB 1ZMAA 1R7HA 5DALA 1AC1A 4IHUA 4OMVA 1EP7A 1F9MA 1S3AA 4YKGA 5D73A 1GSEA 1RW1A 3KH9A 1JZDA 4XTSA 3QMXA 3ZREA 4GRFA 2XBQA 1RK4A 3FHKA 2AAWA 3GKMA 4K6XA 2A4HA 3QAVA 1TRSA 4PUAA 1ERWA 3RDWA 1R5PA 2I1UA 1F6MC 3TOUA 5J9CA 4YH2A 1UVZA 2YJHA 3FY7A 2OA7A 1GTBA 4EDZA 3MSZA 4FIWA 4E8HA 3LG6A 4Z2TA 1A0RP 1GULA 5C00A 4BA7A 4TR1B 4ZXGA 3UIWA 2WDUA 5G5EA 2VD1A 4MMMA 2HNLA 1K3YA 4TR3A 20GSA 4TR0A 5E4WA 2V32A 2E2GA 4EDYA 1H75A 1M7TA 4X43A 5G30A 3L9UA 4IN0A 3TJGA 1PL2A 1YZXA 4RI7A 5F06A 5IIZA 2HSYA 3M0FA 2YANA 2G0FA 4PX1A 4BVXB 4GF0A 1XWAA 4AGSA 2H6ZA 1K0BA 3CRTA 1M2DA 2RUFA 4F0BA 3HD5A 1K0NA 1YF1A 1VF3A 3GSSA 2MYGA 4OO5A 1XWBA 4A5PA 2F51A 2P5RA 3EWLA 1KBNA 3GV1A 1CQHA 4IGJA 1PD21 2GS3A 3PR8A 4HJ2A 1ZGNA 5JWOB 3M3MA 2KOKA 4ID0A 1B4QA 4MH2A 1O85A 1QMVA 2HRFA 5GSSA 2DJ1A 1T4ZA 4OFMA 4ZL8A 2A4VA 4PURA 2C0FA 1A23A 3F3RA 2C0GA 2C1YA 13GSA 1V58A 3DIEA 5GSTA 1O73A 5G5FA 5KN3A 1A2MA 4N10A 2H6YA 3A3TA 2BJXA 5AIVA 1J08A 4NV2A 1W89A 3TKQA 3PINA 2HRNA 3HYPA 5HFGA 2VCQA 2HSHA 4RQXA 4TXOB 4QL7A 5GZZB 4N11A 3LQ7A 1EV4A 1BEDA 2Z9SA 3ME8A 2HRKA 5CNWA 2MMZA 3IOSA 2PVQA 2GLRA 4ZB6A 4MP4A 5ECPB 1SJIA 2HSMA 4MLYA 1MD4A 1FB0A 3FMWA 1J9BA 1XW5A 2EIQA 2GGTA 1ZOFA 4PQIA 1K3OA 1Q98A 4RUVA 1AIUA 4HOJA 4JR6A 3KCMA 5HR3A 3N9JA 1B9XC 5DBQA 4EVMA 2MBSA 3UVTA 6GSSA 1H4OA 1XWKA 4V2MA 3PPUA 2H76A 2A2PA 3ZFLA 3SBCA 2PU9C 3HCZA 1SYXA 3CYNA 2K9FA 1FOHA 2O8VB 4WEYA 1B9YC 4K1FA 4YAPA 5HR2A 4G0KA 3IC8A 2WB9A 4ZBDA 4N0VA 4V2NA 4IP1A 1ZL9A 2R4VA 5G2ZA 3A2XA 4XIHA 4QQ7A 2JSZA 1T1VA 1EEMA 1TU7A 2OE0A 5IO2A 2N5FA 2C3QA 4Q5NA 2VCZA 5CRWA 2A2RA 2VL2C 1X5DA 2L6DA 3ED3A 3GSTA 1GP1A 3GTUA 2QKEA 2H73A 3FZ9A 3HHVA 5KN0A 4YQUA 4CY8A 2QSIA 1JZOA 2GT5A 1GNEA 3F6DA 2GZZA 3ZZXA 2HZFA 2PBJA 4I8BA 2HZEA 2YZHA 3GFKA 3F4RA 3MIXA 3MAKA 5B7CA 2FD3A 4TRXA 2FLSA 4NHWA 2JSYA 1AQXA 4KGIA 3DVWA 2DSAA 4ZB8A 5IMCA 1BAYA 2DJ0A 1YF0A 1BQ7A 2DMLA 2H70A 1OE7A 4KSMA 1ERTA 1U88A 3F63A 3IRAA 3APOA 1T00A 3WYWA 3HY2A 1PX7A 1OC9B 4L0WA 1XBSA 2K8VA 2VCXA 2VM1A 3P8WA 2FHEA 2IIYA 5D9VA 2TRXA 1I9DA 1OE8A 4BWQA 3EINA 3VLNA 1VRSD 1NM3A 5ELAA 4EUYA 2FA8A 2H71A 18GSA 3LFLA 1M0UA 4G9HA 2GDRA 1X9WB 3J7Yk 1ST9A 1QXHA 3FZ4A 1GNWA 2IMEA 3EMPA 3QR6A 6GSWA 1WE0A 4X1UA 1GTUA 4PQHA 1HNCA 1ILOA 2N5BA 3FR9A 2H6XA 2MZCA 5DALB 4ECBA 1SKWB 2AUVA 4L5OA 4ML1A 2DMMA 1WPIA 5ECKB 4AJ6A 5DQYA 3H1NA 3QD9A 2DLXA 3RBTA 5KEJA 3SWLA 2B6MA 3KIJA 2OE1A 4POKA 3IK7A 1HNAA 1YDKA 2XPDA 3Q19A 3TRQA 5IMZA 1SL2B 2R2JA 4LLRA 5ID2A 1WWJA 4TKYA 4EE0A 3ME7A 1DE2A 3GH6A 3KH7A 1PSQA 4KAEA 5AN1A 2M72A 2X64A 4KCAA 3U5RE 2YZUA 1AQWA 2O87A 1DUGA 1Z7PA 4JR4A 5J41A 2M80A 2H30A 1ZZYA 4HS1A 3QDNA 4PQ1A 5ABRA 2HE3A 1URMA 2O85A 4GQCA 1ERUA 4GQFA 5DJLA 5A5KA 2H0GA 4MK3A 3ERGA 1TKDB 1O6JA 2JACA 1ZYEA 3TB2A 4I97A 2HYXA 3GMFA 4OCEA 1JLWA 3ZL5A 1GWCA 2LSTA 3VPTA 1PL1A 2IN3A 3APQA 5JCWA 1F37A 4GTUA 3E0UA 5E59A 5FT3A 6GSUA 3ERFA 1V57A 2VLTA 4L0UA 4DEJA 3HJMA 3HA9A 4F0CA 5FWGA 5GAND 2FY6A 5B8BA 3ZMLA 5D9XA 2KP1A 1K0DA 3UEMA 3IV4A 4ZL9A 5INYA 4EL1A 1E2YA 1KNGA 5D8IA 1S3DA 2NVLA 3HVSA 3HVVA 2YV9A 5CP1A 2DKIA 2CQ9A 2GSRA 2R37A 2R0GA 1NSWA 1MEKA 4JBBA 4MABA 4ISDA 2R5GA 3HJOA 3IAS2 2LV3A 2R0PA 3FRCA 3VI5A 1FVJA 3F0IA 3BJ5A 3GHAA 6GSVA 5A4VA 2TRCP 3UBKA 3LWAA 4IELA 4WF5A 1V40A 3GKNA 4V1Ag 2L4CA 5DJMA 4GWRA 3DXBA 4HDEA 2CV4A 4GLTA 2CAIA 1J0FA 4X4JA 4Q5QA 4ZILA 4IQ1A 3A5IA 3FK8A 4NPBA 1OAZA 4JE1A 1A2JA 3EURA 5HFKA 1YY7A 4FQUA 4EF0A 2HT9A 1UN2A 3GKKA 5HFIA 5D9WA 2VO4A 4NAXA 3KP9A 2XBIA 4BVYA 4TXVA 3VWVA 3C8EA 2GQMA 4EKZA 4MZWA 3I43A 4MJCA 2YWMA 1N2AA 2LS5A 5ECQB 1SL1B 3G7JA 4BWSA 2R3XA 4KH7A 3FYGA 3G9BA 4MF5A 4TOPA 1R26A 1GTIA 4OCFA 1KEBA 1XW6A 2DIYA 2LUSA 2E2MA 1PN0A 1AQVA 3F4SA 3PH9A 4WBJA 1K3LA 1SK1A 3ZVJA 4YQMA 4FYCA 4KW6A 5EY6A 2G2QA 3KTBA 4IJ3A 4ZB9A 1RQMA 1MD3A 1LU4A 3WGEA 1VF4A 2HXKA 1Q4JA 5A4UA 3I6AA 5H5SA 3TRPA 4FYBA 1TTZA 4HU9A 1PMTA 1XZOA 2B5XA 3LORA 5A4WA 3DMLA 3QCPA 3TKSE 1ML6A 3ZTLA 2X8GA 2LNSA 5IPGA 3UARA 3GNJA 2CA8A 1JFUA 4NMUA 1CQGA 1YKCA 3ZVJD 4N30A 1TRUA 1THOA 1VF2A 3LYKA 1C72A 2NBSA 1GRXA 2CX3A 5DAKA 5HQPA 5ECRB 5ECOB 4Z2RA 4F82A 1O81A 2XPEA 4O5RA 3F6FA 2NDOA 2FWEA 1M9AA 4HUAA 2H1BA 4TR1A 1TI1A 2H1GA 1XOAA 4FO5A 3P7XA 3PGTA 3GTUB 1XOBA 4GSTA 1V2AA 2AYTA 3U6VA 2C80A 3OR5A 4J57E 2J23A 2YN1A 2FWHA 2GZPA 1OC8A 1E6BA 1QQ2A 2NTOA 5ECLB 1Y25A 5ECMB 3Q6OA 2X8HA 2BMXA 1U87A 2V2GA 3CTFA 2HZEB 5KOWA 2YJ7A 3APSA 1EOHA 5ECSA 4LMVA 2FCHA 4HEA2 4BPYA 1K0OA 4USSA 3LGCA 2GSSA 2C3NA 3BD2A 3IXRA 2N5AA 1QK8A 3KTLA 1Z6MA 17GSA 3UOMA 4GSSA 2HLSA 1F2EA 4G0IA 2GQKA 4KDUA 2ZNMA 2FWFA 2EIOA 4D73A 5B8AA 3L4NA 2H8LA 10GSA 1SKSB 2B7KA 3VURA 2JZTA 4ILFA 2YWOA 1TK0B 1FOVA 4K2DA 5AIXA 3TKSC 1OVNA 4IW9A 3US3A 3VFIA 3GH9A 2I81A 1HYUA 3GN3A 2LRNA 2GSTA 2VM2A 1SU9A 3GURA 5KOXA 9GSSA 2DJJA 4MH3A 6GSXA 1AAZA 4ACSA 2DIZA 2BTOT 2LTKA 2GSQA 2R6KA 3GL3A 2YWNA 3EYTA 3QOUA 3HXSA 3IAM2 1A2LA 1K0CA 2X4AA 1GUMA 2LRTA 4TXOA 1TRWA 2YP6A 2C4JA 1WP0A 2X49A 5KN2A 5DCGA 2EIRA 2YCDA 3DKSA 2DJKA 1GH2A 1DE1A 2V1MA 2E0QA 4EO3A 1YQ1A 1FVKA 3TKPA 3FR6A 2JZSA 4OD7A 1XVWA 1GSSA 1X0RA 1G7EA 2I9HA 4KNDA 3UJ1A 4KCEA 2LJRA 3E9JB 2VLUA 1NHOA 4PTSA 2VIMA 3IC4A 2FNOA 2H74A 4K7NA 2ZUPA 2CVDA 1FW1A 4ICYA 3D6IA 1DBYA 2DJ3A 1PN9A 1G7OA 1PX6A 3HDCA 4CHSA 1FHEA 2OE3A 2MMAA 2OADA 2WGRA 5EL8A 1SK2A 3EU4A 2C0EA 1BG5A 2P31A 2LJAA 2V6KA 3DRNA 4ZL7A 1O7UA 1I5GA 1A0FA 1PKWA 5G1LA 1R4WA 3GUSA 5IOXA 4IVFA 3FR3A 4I2UA 4ZBBA 5C04A 3A5WA 3EMXA 2ZCTA 4K5SA 1IYHA 5F8BA 2YOIA 2B1LA 4HJMA 2PUKC 4JZQA 1JLVA 3KXOA 2CX4A 2WFCA 4CDOA 4I2TA 2HRAA 2WCIA 4EIPA 3O76A 2B1KA 3DEXA 2VCVA 22GSA 1U3IA 4IQAA 4I6XA 1EOGA 2GTUA 3N5OA 2DBCA 4AJ8A 4H86A 1S3CA 1HQOA 3RHCA 2MMOA 4POBA 3MNGA 5D9TA 3ZYWA 2KUCA 4K5RA 1JZRA 4TN8A 3LJRA 1FAAA 4KDYA 2WS2A 1M9BA 5H5RA 3LW9A 1T7PB 1Y6EA 1HD2A 3F3QA 2AJQB 3FKFA 4PNFA 3EVIA 1QFNA 1MDKA 2D2ZA 3GX8A 1UA5A 14GSA 5CRHA 2ES7A 3KGKA 4CW9A 3L9SA 2KP2A 5LNKe 1GLPA 5LCZA 1YEPA 2H01A 3D0ZA 4F03A 5IMAA 5EPFA 1JZWA 5HR0A 2X8CA 3IE3A 3BCIA 2H75A 2E7PA 1XWCA 16GSA 4FH8A 4PNGA 1U3AA 2RM6A 2H1DA 1UC7A 4BVYB 4NHZA 1OC3A 5D93A 2PGTA 3WT2A 1YJ6A 4MJAA 2DC5A 4K8MA 1BJXA 3TKRA 2RUEA 4MA9A 1TRVA 2LQQA 1SENA 4G10A 1X5CA 4HI7A 4EIQA 2ALBA 5G1KA 1YKAA 5IM9A 2O89A 4BL7A 2IMKA 2B5YA 2L6CA 1F3BA 1XVQA 1MDIA 3E3EA 5FHIA 4Z2UA 2C0DA 1ACVA 1Z7RA 2WRTA 1EGOA 1AXDA 5JWRB 4DVCA 3NOFA 3LXTA 5BMUA 3Q74A 3O3TA 2JL4A 3EE2A 4F2IA 4LMWA 1WJKA 5ELGA 2AV4A 2KLXA 4PUFC 4MJEA 4NWYA 3A2VA 2GVPA 3QFAC 3J7Yb 1T8EB 3D21A 1T3BA 3EU3A 4MNNA 4K9ZA 1KTEA 2CZ2A 3IHQA 3KMOA 4YKFA 1FG4A 1W4VA 2X99A 2HI7A 2OKAA 8GSSA 3UVHA 3R3EA 5AISA 3LXZA 1OKDA 4XHMA 2K8SA 5IPHA 3TDGA 1WIKA 4ECCA 1OKTA 5IQYA 4XS1A 2VL2A 4MPGA 4KDXA 3TRXA 3RPPA 4DSSA 4JEDA 2QA1A 3RAZA 2NPBA 4KSOA 2JZRA 5DAKB 5IMFA 4PGTA 4XS4A 4O32A 4XS6A 3VPQA 3C1RA 2H1AA 5J5NA 4CY6A 2GQLA 3D4TA 1HNBA 2VOCA 3S9FA 2LKUA 4WBRD 1B4PA 2OACA 3H8QA 5CRDA 1TU8A 5H5QA 2B3SA 5J3RA 3M9KA 3TJJA 2IFQA 1T4YA 2QC7A 1XPVA 2O7KA 1WOUA 6GSTA 1SJ6A 2V6OA 3NZNA 5DDLA 2IMDA 5D96A 3V1WA 1F3AA 3DD3A 4V1Ap 1N8JA 5ECNB 3LEFA 1PGTA 1OYJA 2L5LA 3ZMKA 1WRYA 4WXTA 4KUNA 4O5UA 2L4QA 1VGLA 1ZCPA 1EWXA 1R5AA 1B48A 2I3YA 5EVOA 4LL4B 4GXZA 4GSNA 3A2WA 3QFBC 1EV9A 3I69A 2FGXA 5KN1A 3C73A 3UL3A 2DJ2A 4D73B 1X5EA 4MJBA 5CRGA 2XC2A 4KX4A 4MZBA 2C3TA 5GAPD 5IMVA 4P3YB 3EC3A 1O8WA 4L5LA 4J2FA 4FYUA 2IWTA 4MF7A 4N0ZA 3ERWA 4HQZA 3IHGA 12GSA 4ECIA 5ENUA 3L78A 2IL3A 3IK9A 3AY8A 5CO3A 3H4KA 3CSJA 1GTAA 2P0GA 3HJPA 4X0XA 1LBKA 3ZLPA 2CAQA 4WF4A 3C1SA 3KD0A 3P90A 2B7JA 3GRXA 3VWWA 5L71A 3JCML 5J9BA 1K0MA 3FEUA 3MWHA 1NW2A 5IO0A 1V98A 3H79A 1M99A 2PERA 2H0HA 2A2SA 3I9V2 2JADA 1PA3A 2FUG2 2WULA 1XIYA 4IS0A 3FW2A 3IR4A 2QA2A 2YPMA 1LJRA 4MCUA 4J56E 2K18A 3DGQA 4GCIA 1GL8A 1ABAA 3QAGA 1G6WA 4O7HA 5J4UA 4BVXA 3G7IA 4KB3A 1VF1A 2L5OA 2FWGA 4HU7A 2F8AA 2FA4A 1QUWA 3WGDA 1G6YA 3ZIJA 3GA4A 2LJKA 3LSZA 2CVKA 2F8FA 3VWUA 3GKXA 1WMJA 2UZ8A 3HVXA 2LQOA 3DYRA 5CREA 3TJKA 4G0LA 1XWGA 6GSYA 4I5QA 1QGVA 2CVBA 3TJBA 5LD0A 4MZCA 3IDVA 5JCUA 11GSA 2H66A 2L59A 4WR4A 4KF9A 2GZYA 3TUEA 1EEJA 1GSDA 4IJIA 5BRTA 2H19A 1XFLA 3FZ5A 4POLA 2MBTA 3WGXA 1O8XA 3ZFBA 3HZ4A 2H0IA 3WT1A 1SKRB 3H93A 1SD9A 1U6TA 5F07A 4TW5A 2PN8A 5IOWA 2PVOC 1TK8B 1B8XA 2IMIA 1XW9A 4MDCA 2YWIA 1TJDA 3G7YA 4IKHA 3UAPA 2OBIA 4NXIA 1GLQA 3Q18A 5CYYA 4Q5FA 4HZ4A 1Z5YE 3KEBA 4OFTA 2J9HA 1K0AA 4POMA 4RI6A 5IMDA 4F9ZA 4TR4A 4OFNA 2IJYA 4ML6A 4WETA 5JWQB 2B5EA 5B6MA 3DWVA 4MF6A 3R2QA 4EXJA 3CBUA 4E8EA 4O92A 2RLIA 3RHBA 1TDIA 1GSYA 1MTCA 3F8UA 4HQSA 1TW9A 5ID2B 4ZBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERV A;  2LNT A;  3CSI A;  5AGY A;  1GSF A;  3GIX A;  3GYK A;  2LRC A;  3M8N A;  1TXX A;  3ZIV A;  3VI7 A;  3VK9 A;  4ECJ A;  3IBH A;  1Z3E A;  1FO5 A;  4TVE A;  1V9W A;  1GUK A;  4HZ2 A;  2VAF A;  5ECH B;  2JU5 A;  2VL9 A;  4NV5 A;  3HKR A;  4RQR A;  4Q5R A;  1DSB A;  1PKZ A;  3QPM A;  3TCO A;  4YAV A;  1MDJ A;  2HFD A;  1Z9H A;  1FB6 A;  2LEG A;  1ON4 A;  3TGZ A;  4ULX A;  2RM5 A;  1SK0 A;  3LYP A;  3GX0 A;  5DQS A;  3ZIT A;  1XCC A;  3D22 A;  3RPN A;  4KA0 A;  2GT6 A;  3CSH A;  4JU5 A;  2OJL A;  3KZQ A;  1YEX A;  1ZYQ B;  2C8U A;  4DSR A;  1GSU A;  3CRU A;  3KJY A;  3M9J A;  4YQV A;  5HR1 A;  4K7O A;  1TOF A;  4PXO A;  2H72 A;  1BYE A;  3C71 A;  3P2A A;  3F4T A;  1TP9 A;  1IYI A;  19GS A;  3FZA A;  4G19 A;  3KMN A;  1PRX A;  4IBP A;  4K0G A;  2ON5 A;  2PWJ A;  3BOA A;  2VUP A;  7GSS A;  2OBK A;  4AJ7 A;  5B6N A;  3W8J A;  1EP8 A;  4OO4 A;  4L8E A;  1EGR A;  2M46 A;  4Z7X A;  1SJZ A;  4KE3 A;  4MPF A;  5DCH A;  2VLV A;  5G31 A;  2WJU A;  2YNX A;  1EZK A;  1XXU A;  3K8N A;  2MMN A;  3CXG A;  2P5Q A;  4OWY A;  3C7M A;  1A8Y A;  1JHB A;  2XHF A;  5CAX A;  4XCS A;  1A8L A;  2AHE A;  3W8S A;  3QAW A;  1PQN A;  4EC0 A;  1X9S B;  4AF2 A;  4K0N A;  2AB6 A;  3BCK A;  3CTG A;  3O6T A;  2RII A;  2TIR A;  2VCW A;  2L57 A;  2CT6 A;  3DVX A;  3D5J A;  2VL3 A;  4DSS B;  2WZ9 A;  3GL5 A;  2VCT A;  1BX9 A;  1X9M B;  3D4M A;  4XS4 B;  1M2B A;  3M1G A;  2F3M A;  4IP6 A;  4ZIJ A;  1SYR A;  3KM6 A;  3TJF A;  1NHY A;  3IPZ A;  4JRR A;  1TK5 B;  2QGV A;  1G0T A;  2VD0 A;  2IPA A;  5F05 A;  3ISO A;  1SD8 A;  4XRD A;  1Z6N A;  3BBY A;  3CMI A;  1M2A A;  5JCG A;  4WR5 A;  1AW9 A;  3TOT A;  3WD6 A;  3MDK A;  4G2E A;  4QL9 A;  1OC9 A;  4LL1 B;  2IFQ B;  2V41 A;  3HZ8 A;  2REM A;  5COH A;  3IA1 A;  3L9V A;  4V2L A;  2I4A A;  2EC4 A;  4LA1 A;  1TI3 A;  1SL0 B;  1A24 A;  4K7I A;  3NIV A;  1THX A;  2PPT A;  3KP8 A;  3ZRD A;  4WKW A;  3VWX A;  5F0G A;  3UMA A;  1USB A;  2CZ3 A;  4XRA A;  1GUH A;  2IMF A;  1AUC A;  2ON7 A;  3F9U A;  2K6V A;  3L0H A;  3UBL A;  5DVB A;  2F9S A;  1GSQ A;  2PMT A;  3W6G A;  4DSQ A;  2KHP A;  3TKS A;  2YV7 A;  5ECI B;  1ZMA A;  1R7H A;  5DAL A;  1AC1 A;  4IHU A;  4OMV A;  1EP7 A;  1F9M A;  1S3A A;  5D73 A;  1GSE A;  1RW1 A;  3KH9 A;  1JZD A;  4XTS A;  3QMX A;  3ZRE A;  4GRF A;  2XBQ A;  1RK4 A;  3FHK A;  2AAW A;  3GKM A;  4K6X A;  3QAV A;  1TRS A;  4PUA A;  1ERW A;  3RDW A;  1R5P A;  2I1U A;  1F6M C;  3TOU A;  5J9C A;  4YH2 A;  1UVZ A;  2YJH A;  3FY7 A;  2OA7 A;  1GTB A;  4EDZ A;  3MSZ A;  4FIW A;  4E8H A;  3LG6 A;  1A0R P;  1GUL A;  5C00 A;  4BA7 A;  4TR1 B;  4ZXG A;  3UIW A;  2WDU A;  5G5E A;  2VD1 A;  4MMM A;  2HNL A;  1K3Y A;  4TR3 A;  20GS A;  4TR0 A;  5E4W A;  2V32 A;  2E2G A;  4EDY A;  1H75 A;  1M7T A;  4X43 A;  5G30 A;  3L9U A;  4IN0 A;  3TJG A;  1PL2 A;  1YZX A;  4RI7 A;  5F06 A;  5IIZ A;  2HSY A;  3M0F A;  2YAN A;  2G0F A;  4PX1 A;  4GF0 A;  1XWA A;  4AGS A;  2H6Z A;  1K0B A;  3CRT A;  1M2D A;  2RUF A;  4F0B A;  3HD5 A;  1K0N A;  1YF1 A;  1VF3 A;  3GSS A;  2MYG A;  4OO5 A;  1XWB A;  2F51 A;  2P5R A;  3EWL A;  1KBN A;  3GV1 A;  1CQH A;  4IGJ A;  1PD2 1;  2GS3 A;  3PR8 A;  4HJ2 A;  1ZGN A;  5JWO B;  3M3M A;  2KOK A;  4ID0 A;  1B4Q A;  4MH2 A;  1O85 A;  1QMV A;  2HRF A;  5GSS A;  2DJ1 A;  1T4Z A;  4OFM A;  4ZL8 A;  2A4V A;  4PUR A;  2C0F A;  1A23 A;  3F3R A;  2C0G A;  2C1Y A;  13GS A;  1V58 A;  3DIE A;  5GST A;  1O73 A;  5G5F A;  5KN3 A;  1A2M A;  4N10 A;  2H6Y A;  3A3T A;  2BJX A;  5AIV A;  1J08 A;  4NV2 A;  1W89 A;  3TKQ A;  3PIN A;  2HRN A;  3HYP A;  5HFG A;  2VCQ A;  2HSH A;  4RQX A;  4TXO B;  4QL7 A;  5GZZ B;  4N11 A;  3LQ7 A;  1EV4 A;  1BED A;  2Z9S A;  3ME8 A;  5CNW A;  2MMZ A;  3IOS A;  2PVQ A;  2GLR A;  4ZB6 A;  4MP4 A;  5ECP B;  1SJI A;  4MLY A;  1MD4 A;  1FB0 A;  1J9B A;  1XW5 A;  2EIQ A;  2GGT A;  1ZOF A;  4PQI A;  1K3O A;  1Q98 A;  4RUV A;  1AIU A;  4HOJ A;  4JR6 A;  3KCM A;  5HR3 A;  3N9J A;  1B9X C;  5DBQ A;  4EVM A;  2MBS A;  3UVT A;  6GSS A;  1H4O A;  1XWK A;  4V2M A;  2H76 A;  3ZFL A;  3SBC A;  2PU9 C;  3HCZ A;  1SYX A;  3CYN A;  2K9F A;  2O8V B;  4WEY A;  1B9Y C;  4K1F A;  4YAP A;  5HR2 A;  2WB9 A;  4ZBD A;  4N0V A;  4V2N A;  4IP1 A;  1ZL9 A;  2R4V A;  5G2Z A;  3A2X A;  4XIH A;  4QQ7 A;  2JSZ A;  1T1V A;  1EEM A;  1TU7 A;  2OE0 A;  5IO2 A;  2N5F A;  2C3Q A;  4Q5N A;  2VCZ A;  5CRW A;  2A2R A;  2VL2 C;  1X5D A;  2L6D A;  3ED3 A;  3GST A;  1GP1 A;  3GTU A;  2QKE A;  2H73 A;  3FZ9 A;  3HHV A;  5KN0 A;  4YQU A;  2QSI A;  1JZO A;  2GT5 A;  1GNE A;  3F6D A;  2GZZ A;  3ZZX A;  2HZF A;  2PBJ A;  4I8B A;  2HZE A;  2YZH A;  3GFK A;  3F4R A;  3MAK A;  5B7C A;  2FD3 A;  4TRX A;  2FLS A;  4NHW A;  2JSY A;  1AQX A;  4KGI A;  3DVW A;  2DSA A;  4ZB8 A;  5IMC A;  1BAY A;  2DJ0 A;  1YF0 A;  1BQ7 A;  2DML A;  2H70 A;  1OE7 A;  4KSM A;  1ERT A;  1U88 A;  3F63 A;  3IRA A;  3APO A;  1T00 A;  3WYW A;  3HY2 A;  1PX7 A;  1OC9 B;  4L0W A;  1XBS A;  2K8V A;  2VCX A;  2VM1 A;  3P8W A;  2FHE A;  2IIY A;  5D9V A;  2TRX A;  1I9D A;  1OE8 A;  4BWQ A;  3EIN A;  3VLN A;  1VRS D;  1NM3 A;  5ELA A;  4EUY A;  2FA8 A;  2H71 A;  18GS A;  3LFL A;  1M0U A;  4G9H A;  2GDR A;  1X9W B;  3J7Y k;  1ST9 A;  1QXH A;  3FZ4 A;  1GNW A;  2IME A;  3EMP A;  3QR6 A;  6GSW A;  1WE0 A;  4X1U A;  1GTU A;  4PQH A;  1HNC A;  1ILO A;  2N5B A;  3FR9 A;  2H6X A;  2MZC A;  5DAL B;  4ECB A;  1SKW B;  2AUV A;  4L5O A;  4ML1 A;  2DMM A;  1WPI A;  5ECK B;  4AJ6 A;  5DQY A;  3H1N A;  3QD9 A;  2DLX A;  3RBT A;  5KEJ A;  3SWL A;  2B6M A;  3KIJ A;  2OE1 A;  4POK A;  3IK7 A;  1HNA A;  1YDK A;  2XPD A;  3Q19 A;  3TRQ A;  5IMZ A;  1SL2 B;  2R2J A;  4LLR A;  5ID2 A;  1WWJ A;  4TKY A;  4EE0 A;  3ME7 A;  1DE2 A;  3GH6 A;  3KH7 A;  1PSQ A;  4KAE A;  5AN1 A;  2M72 A;  2X64 A;  4KCA A;  3U5R E;  2YZU A;  1AQW A;  2O87 A;  1DUG A;  1Z7P A;  4JR4 A;  5J41 A;  2M80 A;  2H30 A;  1ZZY A;  4HS1 A;  3QDN A;  4PQ1 A;  5ABR A;  2HE3 A;  1URM A;  2O85 A;  4GQC A;  1ERU A;  4GQF A;  5DJL A;  5A5K A;  2H0G A;  4MK3 A;  3ERG A;  1TKD B;  1O6J A;  2JAC A;  1ZYE A;  3TB2 A;  4I97 A;  2HYX A;  3GMF A;  4OCE A;  1JLW A;  3ZL5 A;  1GWC A;  2LST A;  3VPT A;  1PL1 A;  2IN3 A;  3APQ A;  5JCW A;  1F37 A;  4GTU A;  3E0U A;  5E59 A;  5FT3 A;  6GSU A;  3ERF A;  1V57 A;  2VLT A;  4L0U A;  4DEJ A;  3HJM A;  3HA9 A;  4F0C A;  5FWG A;  5GAN D;  2FY6 A;  5B8B A;  3ZML A;  5D9X A;  2KP1 A;  1K0D A;  3UEM A;  3IV4 A;  4ZL9 A;  5INY A;  4EL1 A;  1E2Y A;  1KNG A;  5D8I A;  1S3D A;  2NVL A;  3HVS A;  3HVV A;  2YV9 A;  5CP1 A;  2CQ9 A;  2GSR A;  2R37 A;  1NSW A;  1MEK A;  4JBB A;  4MAB A;  4ISD A;  2R5G A;  3HJO A;  3IAS 2;  2LV3 A;  3FRC A;  3VI5 A;  1FVJ A;  3F0I A;  3BJ5 A;  3GHA A;  6GSV A;  5A4V A;  2TRC P;  3UBK A;  3LWA A;  4IEL A;  4WF5 A;  1V40 A;  3GKN A;  4V1A g;  2L4C A;  5DJM A;  4GWR A;  3DXB A;  4HDE A;  2CV4 A;  4GLT A;  2CAI A;  1J0F A;  4Q5Q A;  4ZIL A;  4IQ1 A;  3FK8 A;  4NPB A;  1OAZ A;  4JE1 A;  1A2J A;  3EUR A;  5HFK A;  1YY7 A;  4EF0 A;  2HT9 A;  1UN2 A;  3GKK A;  5HFI A;  5D9W A;  2VO4 A;  4NAX A;  3KP9 A;  2XBI A;  4BVY A;  4TXV A;  3VWV A;  3C8E A;  2GQM A;  4EKZ A;  4MZW A;  3I43 A;  4MJC A;  2YWM A;  1N2A A;  2LS5 A;  5ECQ B;  1SL1 B;  3G7J A;  4BWS A;  2R3X A;  4KH7 A;  3FYG A;  3G9B A;  4MF5 A;  4TOP A;  1R26 A;  1GTI A;  4OCF A;  1KEB A;  1XW6 A;  2DIY A;  2LUS A;  2E2M A;  1AQV A;  3F4S A;  3PH9 A;  4WBJ A;  1K3L A;  1SK1 A;  3ZVJ A;  4YQM A;  4FYC A;  4KW6 A;  5EY6 A;  2G2Q A;  3KTB A;  4IJ3 A;  4ZB9 A;  1RQM A;  1MD3 A;  1LU4 A;  3WGE A;  1VF4 A;  2HXK A;  1Q4J A;  5A4U A;  3I6A A;  5H5S A;  3TRP A;  4FYB A;  1TTZ A;  4HU9 A;  1PMT A;  1XZO A;  2B5X A;  3LOR A;  5A4W A;  3DML A;  3QCP A;  3TKS E;  1ML6 A;  3ZTL A;  2X8G A;  2LNS A;  5IPG A;  3UAR A;  3GNJ A;  2CA8 A;  1JFU A;  4NMU A;  1CQG A;  1YKC A;  3ZVJ D;  4N30 A;  1TRU A;  1THO A;  1VF2 A;  3LYK A;  1C72 A;  2NBS A;  1GRX A;  2CX3 A;  5DAK A;  5HQP A;  5ECR B;  5ECO B;  4F82 A;  1O81 A;  2XPE A;  4O5R A;  3F6F A;  2NDO A;  2FWE A;  1M9A A;  4HUA A;  2H1B A;  4TR1 A;  1TI1 A;  2H1G A;  1XOA A;  4FO5 A;  3P7X A;  3PGT A;  3GTU B;  1XOB A;  4GST A;  1V2A A;  2AYT A;  3U6V A;  2C80 A;  3OR5 A;  4J57 E;  2J23 A;  2YN1 A;  2FWH A;  2GZP A;  1OC8 A;  1E6B A;  1QQ2 A;  2NTO A;  5ECL B;  1Y25 A;  5ECM B;  3Q6O A;  2X8H A;  2BMX A;  1U87 A;  2V2G A;  3CTF A;  2HZE B;  2YJ7 A;  3APS A;  1EOH A;  5ECS A;  4LMV A;  2FCH A;  4HEA 2;  4BPY A;  1K0O A;  3LGC A;  2GSS A;  2C3N A;  3BD2 A;  3IXR A;  2N5A A;  1QK8 A;  3KTL A;  1Z6M A;  17GS A;  3UOM A;  4GSS A;  2HLS A;  1F2E A;  2GQK A;  4KDU A;  2ZNM A;  2FWF A;  2EIO A;  4D73 A;  5B8A A;  3L4N A;  2H8L A;  10GS A;  1SKS B;  2B7K A;  3VUR A;  2JZT A;  4ILF A;  2YWO A;  1TK0 B;  1FOV A;  4K2D A;  5AIX A;  3TKS C;  1OVN A;  4IW9 A;  3US3 A;  3VFI A;  3GH9 A;  2I81 A;  1HYU A;  3GN3 A;  2LRN A;  2GST A;  2VM2 A;  1SU9 A;  3GUR A;  9GSS A;  2DJJ A;  4MH3 A;  6GSX A;  1AAZ A;  4ACS A;  2DIZ A;  2BTO T;  2LTK A;  2GSQ A;  2R6K A;  3GL3 A;  2YWN A;  3EYT A;  3QOU A;  3HXS A;  3IAM 2;  1A2L A;  1K0C A;  1GUM A;  2LRT A;  4TXO A;  1TRW A;  2YP6 A;  2C4J A;  1WP0 A;  5KN2 A;  5DCG A;  2EIR A;  2YCD A;  3DKS A;  2DJK A;  1GH2 A;  1DE1 A;  2V1M A;  2E0Q A;  4EO3 A;  1YQ1 A;  1FVK A;  3TKP A;  3FR6 A;  2JZS A;  4OD7 A;  1XVW A;  1GSS A;  1X0R A;  1G7E A;  2I9H A;  4KND A;  3UJ1 A;  4KCE A;  2LJR A;  3E9J B;  2VLU A;  1NHO A;  2VIM A;  3IC4 A;  2FNO A;  2H74 A;  4K7N A;  2ZUP A;  2CVD A;  1FW1 A;  3D6I A;  1DBY A;  2DJ3 A;  1PN9 A;  1G7O A;  1PX6 A;  3HDC A;  4CHS A;  1FHE A;  2OE3 A;  2MMA A;  2OAD A;  2WGR A;  5EL8 A;  1SK2 A;  3EU4 A;  2C0E A;  1BG5 A;  2P31 A;  2LJA A;  2V6K A;  3DRN A;  4ZL7 A;  1O7U A;  1I5G A;  1A0F A;  1PKW A;  5G1L A;  1R4W A;  3GUS A;  5IOX A;  4IVF A;  3FR3 A;  4I2U A;  4ZBB A;  5C04 A;  3A5W A;  3EMX A;  2ZCT A;  1IYH A;  5F8B A;  2YOI A;  2B1L A;  4HJM A;  2PUK C;  4JZQ A;  1JLV A;  3KXO A;  2CX4 A;  2WFC A;  4CDO A;  4I2T A;  2WCI A;  3O76 A;  2B1K A;  3DEX A;  2VCV A;  22GS A;  1U3I A;  4IQA A;  4I6X A;  1EOG A;  2GTU A;  3N5O A;  2DBC A;  4AJ8 A;  4H86 A;  1S3C A;  1HQO A;  3RHC A;  2MMO A;  4POB A;  3MNG A;  5D9T A;  3ZYW A;  2KUC A;  1JZR A;  4TN8 A;  3LJR A;  1FAA A;  4KDY A;  2WS2 A;  1M9B A;  5H5R A;  1T7P B;  1Y6E A;  1HD2 A;  3F3Q A;  2AJQ B;  3FKF A;  4PNF A;  3EVI A;  1QFN A;  1MDK A;  2D2Z A;  3GX8 A;  1UA5 A;  14GS A;  5CRH A;  2ES7 A;  3KGK A;  4CW9 A;  3L9S A;  2KP2 A;  5LNK e;  1GLP A;  5LCZ A;  1YEP A;  2H01 A;  3D0Z A;  4F03 A;  5IMA A;  5EPF A;  1JZW A;  5HR0 A;  2X8C A;  3IE3 A;  3BCI A;  2H75 A;  2E7P A;  1XWC A;  16GS A;  4FH8 A;  4PNG A;  1U3A A;  2RM6 A;  2H1D A;  1UC7 A;  4NHZ A;  1OC3 A;  5D93 A;  2PGT A;  3WT2 A;  1YJ6 A;  4MJA A;  2DC5 A;  4K8M A;  1BJX A;  3TKR A;  2RUE A;  4MA9 A;  1TRV A;  2LQQ A;  1SEN A;  4G10 A;  1X5C A;  4HI7 A;  2ALB A;  5G1K A;  1YKA A;  5IM9 A;  2O89 A;  4BL7 A;  2IMK A;  2B5Y A;  2L6C A;  1F3B A;  1XVQ A;  1MDI A;  3E3E A;  5FHI A;  2C0D A;  1ACV A;  1Z7R A;  2WRT A;  1EGO A;  1AXD A;  5JWR B;  4DVC A;  3NOF A;  3LXT A;  3Q74 A;  3O3T A;  2JL4 A;  3EE2 A;  4F2I A;  4LMW A;  1WJK A;  5ELG A;  2AV4 A;  2KLX A;  4PUF C;  4MJE A;  4NWY A;  3A2V A;  2GVP A;  3QFA C;  3J7Y b;  1T8E B;  3D21 A;  1T3B A;  3EU3 A;  4K9Z A;  1KTE A;  2CZ2 A;  3IHQ A;  3KMO A;  1FG4 A;  1W4V A;  2X99 A;  2HI7 A;  2OKA A;  8GSS A;  3UVH A;  5AIS A;  3LXZ A;  1OKD A;  4XHM A;  2K8S A;  5IPH A;  3TDG A;  1WIK A;  4ECC A;  1OKT A;  5IQY A;  4XS1 A;  2VL2 A;  4MPG A;  4KDX A;  3TRX A;  3RPP A;  4DSS A;  4JED A;  3RAZ A;  2NPB A;  4KSO A;  2JZR A;  5DAK B;  5IMF A;  4PGT A;  4XS4 A;  4O32 A;  4XS6 A;  3VPQ A;  3C1R A;  2H1A A;  5J5N A;  2GQL A;  3D4T A;  1HNB A;  2VOC A;  3S9F A;  2LKU A;  4WBR D;  1B4P A;  2OAC A;  3H8Q A;  5CRD A;  1TU8 A;  5H5Q A;  2B3S A;  5J3R A;  3M9K A;  3TJJ A;  2IFQ A;  1T4Y A;  2QC7 A;  1XPV A;  2O7K A;  1WOU A;  6GST A;  1SJ6 A;  2V6O A;  3NZN A;  5DDL A;  2IMD A;  5D96 A;  3V1W A;  1F3A A;  3DD3 A;  4V1A p;  1N8J A;  5ECN B;  3LEF A;  1PGT A;  1OYJ A;  2L5L A;  3ZMK A;  1WRY A;  4WXT A;  4KUN A;  2L4Q A;  1VGL A;  1ZCP A;  1EWX A;  1R5A A;  1B48 A;  2I3Y A;  5EVO A;  4LL4 B;  4GXZ A;  4GSN A;  3A2W A;  3QFB C;  1EV9 A;  3I69 A;  2FGX A;  5KN1 A;  3C73 A;  3UL3 A;  2DJ2 A;  4D73 B;  1X5E A;  4MJB A;  5CRG A;  2XC2 A;  4KX4 A;  4MZB A;  2C3T A;  5GAP D;  5IMV A;  4P3Y B;  3EC3 A;  1O8W A;  4L5L A;  4J2F A;  4FYU A;  2IWT A;  4MF7 A;  4N0Z A;  3ERW A;  4HQZ A;  12GS A;  4ECI A;  5ENU A;  3L78 A;  2IL3 A;  3IK9 A;  3AY8 A;  5CO3 A;  3H4K A;  3CSJ A;  1GTA A;  2P0G A;  3HJP A;  4X0X A;  1LBK A;  3ZLP A;  2CAQ A;  4WF4 A;  3C1S A;  3KD0 A;  3P90 A;  2B7J A;  3GRX A;  3VWW A;  5L71 A;  3JCM L;  5J9B A;  1K0M A;  3FEU A;  3MWH A;  1NW2 A;  5IO0 A;  1V98 A;  3H79 A;  1M99 A;  2PER A;  2H0H A;  2A2S A;  3I9V 2;  2JAD A;  1PA3 A;  2FUG 2;  2WUL A;  1XIY A;  4IS0 A;  3FW2 A;  3IR4 A;  2YPM A;  1LJR A;  4MCU A;  4J56 E;  2K18 A;  3DGQ A;  4GCI A;  1GL8 A;  1ABA A;  3QAG A;  1G6W A;  4O7H A;  5J4U A;  4BVX A;  3G7I A;  4KB3 A;  1VF1 A;  2L5O A;  2FWG A;  4HU7 A;  2F8A A;  2FA4 A;  1QUW A;  3WGD A;  1G6Y A;  3ZIJ A;  3GA4 A;  2LJK A;  3LSZ A;  2CVK A;  2F8F A;  3VWU A;  3GKX A;  1WMJ A;  3HVX A;  2LQO A;  3DYR A;  5CRE A;  3TJK A;  1XWG A;  6GSY A;  4I5Q A;  1QGV A;  2CVB A;  3TJB A;  5LD0 A;  4MZC A;  3IDV A;  5JCU A;  11GS A;  2H66 A;  2L59 A;  4WR4 A;  2GZY A;  3TUE A;  1EEJ A;  1GSD A;  4IJI A;  2H19 A;  1XFL A;  3FZ5 A;  4POL A;  2MBT A;  3WGX A;  1O8X A;  3ZFB A;  3HZ4 A;  2H0I A;  3WT1 A;  1SKR B;  3H93 A;  1SD9 A;  1U6T A;  5F07 A;  4TW5 A;  2PN8 A;  5IOW A;  2PVO C;  1TK8 B;  1B8X A;  2IMI A;  1XW9 A;  4MDC A;  2YWI A;  1TJD A;  3G7Y A;  4IKH A;  3UAP A;  2OBI A;  4NXI A;  1GLQ A;  3Q18 A;  5CYY A;  4Q5F A;  4HZ4 A;  1Z5Y E;  3KEB A;  4OFT A;  2J9H A;  1K0A A;  4POM A;  4RI6 A;  5IMD A;  4F9Z A;  4TR4 A;  4OFN A;  2IJY A;  4ML6 A;  4WET A;  5JWQ B;  2B5E A;  5B6M A;  3DWV A;  4MF6 A;  3R2Q A;  4EXJ A;  3CBU A;  4E8E A;  4O92 A;  2RLI A;  3RHB A;  1TDI A;  1GSY A;  1MTC A;  3F8U A;  4HQS A;  1TW9 A;  5ID2 B;  4ZBA A; 
#chains in the Genus database with same CATH topology
 1ERV A;  2LNT A;  3CSI A;  5AGY A;  1GSF A;  3GIX A;  3GYK A;  2LRC A;  3M8N A;  1TXX A;  3ZIV A;  3VI7 A;  3VK9 A;  4ECJ A;  3IBH A;  1Z3E A;  1FO5 A;  4TVE A;  1V9W A;  1GUK A;  4HZ2 A;  2VAF A;  5ECH B;  2JU5 A;  2VL9 A;  4NV5 A;  3HKR A;  4RQR A;  4Q5R A;  1DSB A;  1PKZ A;  3QPM A;  3TCO A;  4YAV A;  1MDJ A;  2HFD A;  1Z9H A;  1FB6 A;  2LEG A;  1ON4 A;  3TGZ A;  4ULX A;  2RM5 A;  1SK0 A;  3LYP A;  3GX0 A;  5DQS A;  3ZIT A;  1XCC A;  3D22 A;  3RPN A;  4KA0 A;  1ZYP A;  2GT6 A;  3CSH A;  4JU5 A;  4BIK A;  2OJL A;  3KZQ A;  1YEX A;  1ZYQ B;  2C8U A;  4DSR A;  1GSU A;  3CRU A;  3KJY A;  3M9J A;  4YQV A;  5HR1 A;  4K7O A;  1TOF A;  4PXO A;  2H72 A;  1BYE A;  4BL7 B;  3C71 A;  3P2A A;  3F4T A;  1TP9 A;  4K2X A;  1IYI A;  19GS A;  3FZA A;  4G19 A;  3KMN A;  1PRX A;  4IBP A;  4K0G A;  2ON5 A;  2PWJ A;  3BOA A;  2VUP A;  7GSS A;  2OBK A;  4AJ7 A;  5B6N A;  3W8J A;  1EP8 A;  4OO4 A;  4L8E A;  1EGR A;  2M46 A;  4Z7X A;  1SJZ A;  4KE3 A;  4MPF A;  5DCH A;  1ZYN A;  2VLV A;  5G31 A;  2WJU A;  2YNX A;  1EZK A;  1XXU A;  3K8N A;  2MMN A;  3MYD A;  3CXG A;  2P5Q A;  4OWY A;  3C7M A;  1A8Y A;  1JHB A;  2XHF A;  5CAX A;  4XCS A;  1A8L A;  2AHE A;  3W8S A;  3QAW A;  1PQN A;  4EC0 A;  2DKH A;  2R0C A;  1X9S B;  4AF2 A;  4K0N A;  2AB6 A;  3BCK A;  3CTG A;  3O6T A;  2RII A;  2TIR A;  2VCW A;  2L57 A;  2CT6 A;  3DVX A;  3D5J A;  2VL3 A;  4DSS B;  2WZ9 A;  3GL5 A;  2VCT A;  1BX9 A;  1X9M B;  3D4M A;  4XS4 B;  1M2B A;  3M1G A;  2F3M A;  4IP6 A;  4ZIJ A;  1SYR A;  3KM6 A;  3TJF A;  1NHY A;  3IPZ A;  4JRR A;  1TK5 B;  2QGV A;  1G0T A;  2VD0 A;  2IPA A;  5F05 A;  1M3I A;  3ISO A;  1SD8 A;  4XRD A;  1Z6N A;  3BBY A;  3CMI A;  1M2A A;  5JCG A;  4WR5 A;  1AW9 A;  3TOT A;  3WD6 A;  3MDK A;  4G2E A;  4QL9 A;  1OC9 A;  4LL1 B;  2IFQ B;  2V41 A;  3HZ8 A;  2REM A;  5COH A;  3IA1 A;  3L9V A;  4V2L A;  2I4A A;  4O5Q A;  2EC4 A;  4LA1 A;  1TI3 A;  1SL0 B;  1A24 A;  4K7I A;  3NIV A;  1THX A;  2PPT A;  3KP8 A;  3ZRD A;  4WKW A;  3VWX A;  5F0G A;  3UMA A;  3EPT A;  1USB A;  2CZ3 A;  4XRA A;  1GUH A;  2IMF A;  1AUC A;  2ON7 A;  3F9U A;  2K6V A;  3L0H A;  3UBL A;  5DVB A;  2F9S A;  1GSQ A;  2PMT A;  3W6G A;  4DSQ A;  2KHP A;  3TKS A;  2YV7 A;  5ECI B;  1ZMA A;  1R7H A;  5DAL A;  1AC1 A;  4IHU A;  4OMV A;  1EP7 A;  1F9M A;  1S3A A;  4YKG A;  5D73 A;  1GSE A;  1RW1 A;  3KH9 A;  1JZD A;  4XTS A;  3QMX A;  3ZRE A;  4GRF A;  2XBQ A;  1RK4 A;  3FHK A;  2AAW A;  3GKM A;  4K6X A;  2A4H A;  3QAV A;  1TRS A;  4PUA A;  1ERW A;  3RDW A;  1R5P A;  2I1U A;  1F6M C;  3TOU A;  5J9C A;  4YH2 A;  1UVZ A;  2YJH A;  3FY7 A;  2OA7 A;  1GTB A;  4EDZ A;  3MSZ A;  4FIW A;  4E8H A;  3LG6 A;  4Z2T A;  1A0R P;  1GUL A;  5C00 A;  4BA7 A;  4TR1 B;  4ZXG A;  3UIW A;  2WDU A;  5G5E A;  2VD1 A;  4MMM A;  2HNL A;  1K3Y A;  4TR3 A;  20GS A;  4TR0 A;  5E4W A;  2V32 A;  2E2G A;  4EDY A;  1H75 A;  1M7T A;  4X43 A;  5G30 A;  3L9U A;  4IN0 A;  3TJG A;  1PL2 A;  1YZX A;  4RI7 A;  5F06 A;  5IIZ A;  2HSY A;  3M0F A;  2YAN A;  2G0F A;  4PX1 A;  4BVX B;  4GF0 A;  1XWA A;  4AGS A;  2H6Z A;  1K0B A;  3CRT A;  1M2D A;  2RUF A;  4F0B A;  3HD5 A;  1K0N A;  1YF1 A;  1VF3 A;  3GSS A;  2MYG A;  4OO5 A;  1XWB A;  4A5P A;  2F51 A;  2P5R A;  3EWL A;  1KBN A;  3GV1 A;  1CQH A;  4IGJ A;  1PD2 1;  2GS3 A;  3PR8 A;  4HJ2 A;  1ZGN A;  5JWO B;  3M3M A;  2KOK A;  4ID0 A;  1B4Q A;  4MH2 A;  1O85 A;  1QMV A;  2HRF A;  5GSS A;  2DJ1 A;  1T4Z A;  4OFM A;  4ZL8 A;  2A4V A;  4PUR A;  2C0F A;  1A23 A;  3F3R A;  2C0G A;  2C1Y A;  13GS A;  1V58 A;  3DIE A;  5GST A;  1O73 A;  5G5F A;  5KN3 A;  1A2M A;  4N10 A;  2H6Y A;  3A3T A;  2BJX A;  5AIV A;  1J08 A;  4NV2 A;  1W89 A;  3TKQ A;  3PIN A;  2HRN A;  3HYP A;  5HFG A;  2VCQ A;  2HSH A;  4RQX A;  4TXO B;  4QL7 A;  5GZZ B;  4N11 A;  3LQ7 A;  1EV4 A;  1BED A;  2Z9S A;  3ME8 A;  2HRK A;  5CNW A;  2MMZ A;  3IOS A;  2PVQ A;  2GLR A;  4ZB6 A;  4MP4 A;  5ECP B;  1SJI A;  2HSM A;  4MLY A;  1MD4 A;  1FB0 A;  3FMW A;  1J9B A;  1XW5 A;  2EIQ A;  2GGT A;  1ZOF A;  4PQI A;  1K3O A;  1Q98 A;  4RUV A;  1AIU A;  4HOJ A;  4JR6 A;  3KCM A;  5HR3 A;  3N9J A;  1B9X C;  5DBQ A;  4EVM A;  2MBS A;  3UVT A;  6GSS A;  1H4O A;  1XWK A;  4V2M A;  3PPU A;  2H76 A;  2A2P A;  3ZFL A;  3SBC A;  2PU9 C;  3HCZ A;  1SYX A;  3CYN A;  2K9F A;  1FOH A;  2O8V B;  4WEY A;  1B9Y C;  4K1F A;  4YAP A;  5HR2 A;  4G0K A;  3IC8 A;  2WB9 A;  4ZBD A;  4N0V A;  4V2N A;  4IP1 A;  1ZL9 A;  2R4V A;  5G2Z A;  3A2X A;  4XIH A;  4QQ7 A;  2JSZ A;  1T1V A;  1EEM A;  1TU7 A;  3HVN A;  2OE0 A;  5IO2 A;  2N5F A;  2C3Q A;  4Q5N A;  1S3R A;  2VCZ A;  5CRW A;  2A2R A;  2VL2 C;  1X5D A;  2L6D A;  3ED3 A;  3GST A;  1GP1 A;  3GTU A;  2QKE A;  2H73 A;  3FZ9 A;  3HHV A;  5KN0 A;  4YQU A;  4CY8 A;  2QSI A;  1JZO A;  2GT5 A;  1GNE A;  3F6D A;  2GZZ A;  3ZZX A;  2HZF A;  2PBJ A;  4I8B A;  2HZE A;  2YZH A;  3GFK A;  3F4R A;  3MIX A;  3MAK A;  5B7C A;  2FD3 A;  4TRX A;  2FLS A;  4NHW A;  2JSY A;  1AQX A;  4KGI A;  3DVW A;  2DSA A;  4ZB8 A;  5IMC A;  1BAY A;  2DJ0 A;  1YF0 A;  1BQ7 A;  2DML A;  2H70 A;  1OE7 A;  4KSM A;  1ERT A;  1U88 A;  3F63 A;  3IRA A;  3APO A;  1T00 A;  3WYW A;  3HY2 A;  1PX7 A;  1OC9 B;  4L0W A;  1XBS A;  2K8V A;  2VCX A;  2VM1 A;  3P8W A;  2FHE A;  2IIY A;  5D9V A;  2TRX A;  1I9D A;  1OE8 A;  4BWQ A;  3EIN A;  3VLN A;  1VRS D;  1NM3 A;  5ELA A;  4EUY A;  2FA8 A;  2H71 A;  18GS A;  3LFL A;  1M0U A;  4G9H A;  2GDR A;  1XG8 A;  1X9W B;  3J7Y k;  1ST9 A;  1QXH A;  3FZ4 A;  1GNW A;  2IME A;  3EMP A;  3QR6 A;  6GSW A;  1WE0 A;  4X1U A;  1GTU A;  4PQH A;  1HNC A;  1ILO A;  2N5B A;  3FR9 A;  2H6X A;  2MZC A;  5DAL B;  4ECB A;  1SKW B;  2AUV A;  4L5O A;  4ML1 A;  2DMM A;  1WPI A;  5ECK B;  4AJ6 A;  5DQY A;  3H1N A;  3QD9 A;  2DLX A;  3RBT A;  5KEJ A;  3SWL A;  2B6M A;  3KIJ A;  2OE1 A;  4POK A;  3IK7 A;  1HNA A;  1YDK A;  2XPD A;  3Q19 A;  3TRQ A;  5IMZ A;  1SL2 B;  2R2J A;  4LLR A;  5ID2 A;  3CQF A;  1WWJ A;  4TKY A;  4EE0 A;  3ME7 A;  1DE2 A;  3GH6 A;  3KH7 A;  1PSQ A;  4KAE A;  5AN1 A;  2M72 A;  2X64 A;  4KCA A;  3U5R E;  2YZU A;  1AQW A;  2O87 A;  1DUG A;  1Z7P A;  4JR4 A;  5J41 A;  2M80 A;  2H30 A;  1ZZY A;  4HS1 A;  3QDN A;  4PQ1 A;  5ABR A;  2HE3 A;  1URM A;  2O85 A;  4GQC A;  1ERU A;  4GQF A;  5DJL A;  5A5K A;  2H0G A;  4MK3 A;  3ERG A;  1TKD B;  1O6J A;  2JAC A;  1ZYE A;  3TB2 A;  4I97 A;  2HYX A;  3GMF A;  4OCE A;  1JLW A;  3ZL5 A;  1GWC A;  2LST A;  3VPT A;  1PL1 A;  2IN3 A;  3APQ A;  5JCW A;  1F37 A;  4GTU A;  3E0U A;  5E59 A;  5FT3 A;  6GSU A;  3ERF A;  1V57 A;  2VLT A;  4L0U A;  4DEJ A;  3HJM A;  3HA9 A;  4F0C A;  5FWG A;  5GAN D;  2FY6 A;  5B8B A;  3ZML A;  5D9X A;  2KP1 A;  1K0D A;  3UEM A;  3IV4 A;  4ZL9 A;  5INY A;  4EL1 A;  1E2Y A;  1KNG A;  5D8I A;  1S3D A;  2NVL A;  3HVS A;  3HVV A;  2YV9 A;  5CP1 A;  2DKI A;  2CQ9 A;  2GSR A;  2R37 A;  2R0G A;  1NSW A;  1MEK A;  4JBB A;  4MAB A;  4ISD A;  2R5G A;  3HJO A;  3IAS 2;  2LV3 A;  2R0P A;  3FRC A;  3VI5 A;  1FVJ A;  3F0I A;  3BJ5 A;  3GHA A;  6GSV A;  5A4V A;  2TRC P;  3UBK A;  3LWA A;  4IEL A;  4WF5 A;  1V40 A;  3GKN A;  4V1A g;  2L4C A;  5DJM A;  4GWR A;  3DXB A;  4HDE A;  4HSC X;  2CV4 A;  4GLT A;  2CAI A;  1J0F A;  4X4J A;  4Q5Q A;  4ZIL A;  4IQ1 A;  3A5I A;  3FK8 A;  4NPB A;  1OAZ A;  4JE1 A;  1A2J A;  3EUR A;  5HFK A;  1YY7 A;  4FQU A;  4EF0 A;  2HT9 A;  1UN2 A;  3GKK A;  5HFI A;  5D9W A;  2VO4 A;  4NAX A;  3KP9 A;  2XBI A;  4BVY A;  4TXV A;  3VWV A;  3C8E A;  2GQM A;  4EKZ A;  4MZW A;  3I43 A;  4MJC A;  2YWM A;  1N2A A;  2LS5 A;  5ECQ B;  1SL1 B;  3G7J A;  4BWS A;  2R3X A;  4KH7 A;  3FYG A;  3G9B A;  4MF5 A;  4TOP A;  1R26 A;  1GTI A;  4OCF A;  1KEB A;  1XW6 A;  2DIY A;  2LUS A;  2E2M A;  1PN0 A;  1AQV A;  3F4S A;  3PH9 A;  4WBJ A;  1K3L A;  1SK1 A;  3ZVJ A;  4YQM A;  4FYC A;  4KW6 A;  5EY6 A;  2G2Q A;  3KTB A;  4IJ3 A;  4ZB9 A;  1RQM A;  1MD3 A;  1LU4 A;  3WGE A;  1VF4 A;  2HXK A;  1Q4J A;  5A4U A;  3I6A A;  5H5S A;  3TRP A;  4FYB A;  1TTZ A;  4HU9 A;  1PMT A;  1XZO A;  2B5X A;  3LOR A;  5A4W A;  3DML A;  3QCP A;  3TKS E;  1ML6 A;  3ZTL A;  2X8G A;  2LNS A;  5IPG A;  3UAR A;  3GNJ A;  2CA8 A;  1JFU A;  4NMU A;  1CQG A;  1YKC A;  3ZVJ D;  4N30 A;  1TRU A;  1THO A;  1VF2 A;  3LYK A;  1C72 A;  2NBS A;  1GRX A;  2CX3 A;  5DAK A;  5HQP A;  5ECR B;  5ECO B;  4Z2R A;  4F82 A;  1O81 A;  2XPE A;  4O5R A;  3F6F A;  2NDO A;  2FWE A;  1M9A A;  4HUA A;  2H1B A;  4TR1 A;  1TI1 A;  2H1G A;  1XOA A;  4FO5 A;  3P7X A;  3PGT A;  3GTU B;  1XOB A;  4GST A;  1V2A A;  2AYT A;  3U6V A;  2C80 A;  3OR5 A;  4J57 E;  2J23 A;  2YN1 A;  2FWH A;  2GZP A;  1OC8 A;  1E6B A;  1QQ2 A;  2NTO A;  5ECL B;  1Y25 A;  5ECM B;  3Q6O A;  2X8H A;  2BMX A;  1U87 A;  2V2G A;  3CTF A;  2HZE B;  5KOW A;  2YJ7 A;  3APS A;  1EOH A;  5ECS A;  4LMV A;  2FCH A;  4HEA 2;  4BPY A;  1K0O A;  4USS A;  3LGC A;  2GSS A;  2C3N A;  3BD2 A;  3IXR A;  2N5A A;  1QK8 A;  3KTL A;  1Z6M A;  17GS A;  3UOM A;  4GSS A;  2HLS A;  1F2E A;  4G0I A;  2GQK A;  4KDU A;  2ZNM A;  2FWF A;  2EIO A;  4D73 A;  5B8A A;  3L4N A;  2H8L A;  10GS A;  1SKS B;  2B7K A;  3VUR A;  2JZT A;  4ILF A;  2YWO A;  1TK0 B;  1FOV A;  4K2D A;  5AIX A;  3TKS C;  1OVN A;  4IW9 A;  3US3 A;  3VFI A;  3GH9 A;  2I81 A;  1HYU A;  3GN3 A;  2LRN A;  2GST A;  2VM2 A;  1SU9 A;  3GUR A;  5KOX A;  9GSS A;  2DJJ A;  4MH3 A;  6GSX A;  1AAZ A;  4ACS A;  2DIZ A;  2BTO T;  2LTK A;  2GSQ A;  2R6K A;  3GL3 A;  2YWN A;  3EYT A;  3QOU A;  3HXS A;  3IAM 2;  1A2L A;  1K0C A;  2X4A A;  1GUM A;  2LRT A;  4TXO A;  1TRW A;  2YP6 A;  2C4J A;  1WP0 A;  2X49 A;  5KN2 A;  5DCG A;  2EIR A;  2YCD A;  3DKS A;  2DJK A;  1GH2 A;  1DE1 A;  2V1M A;  2E0Q A;  4EO3 A;  1YQ1 A;  1FVK A;  3TKP A;  3FR6 A;  2JZS A;  4OD7 A;  1XVW A;  1GSS A;  1X0R A;  1G7E A;  2I9H A;  4KND A;  3UJ1 A;  4KCE A;  2LJR A;  3E9J B;  2VLU A;  1NHO A;  4PTS A;  2VIM A;  3IC4 A;  2FNO A;  2H74 A;  4K7N A;  2ZUP A;  2CVD A;  1FW1 A;  4ICY A;  3D6I A;  1DBY A;  2DJ3 A;  1PN9 A;  1G7O A;  1PX6 A;  3HDC A;  4CHS A;  1FHE A;  2OE3 A;  2MMA A;  2OAD A;  2WGR A;  5EL8 A;  1SK2 A;  3EU4 A;  2C0E A;  1BG5 A;  2P31 A;  2LJA A;  2V6K A;  3DRN A;  4ZL7 A;  1O7U A;  1I5G A;  1A0F A;  1PKW A;  5G1L A;  1R4W A;  3GUS A;  5IOX A;  4IVF A;  3FR3 A;  4I2U A;  4ZBB A;  5C04 A;  3A5W A;  3EMX A;  2ZCT A;  4K5S A;  1IYH A;  5F8B A;  2YOI A;  2B1L A;  4HJM A;  2PUK C;  4JZQ A;  1JLV A;  3KXO A;  2CX4 A;  2WFC A;  4CDO A;  4I2T A;  2HRA A;  2WCI A;  4EIP A;  3O76 A;  2B1K A;  3DEX A;  2VCV A;  22GS A;  1U3I A;  4IQA A;  4I6X A;  1EOG A;  2GTU A;  3N5O A;  2DBC A;  4AJ8 A;  4H86 A;  1S3C A;  1HQO A;  3RHC A;  2MMO A;  4POB A;  3MNG A;  5D9T A;  3ZYW A;  2KUC A;  4K5R A;  1JZR A;  4TN8 A;  3LJR A;  1FAA A;  4KDY A;  2WS2 A;  1M9B A;  5H5R A;  3LW9 A;  1T7P B;  1Y6E A;  1HD2 A;  3F3Q A;  2AJQ B;  3FKF A;  4PNF A;  3EVI A;  1QFN A;  1MDK A;  2D2Z A;  3GX8 A;  1UA5 A;  14GS A;  5CRH A;  2ES7 A;  3KGK A;  4CW9 A;  3L9S A;  2KP2 A;  5LNK e;  1GLP A;  5LCZ A;  1YEP A;  2H01 A;  3D0Z A;  4F03 A;  5IMA A;  5EPF A;  1JZW A;  5HR0 A;  2X8C A;  3IE3 A;  3BCI A;  2H75 A;  2E7P A;  1XWC A;  16GS A;  4FH8 A;  4PNG A;  1U3A A;  2RM6 A;  2H1D A;  1UC7 A;  4BVY B;  4NHZ A;  1OC3 A;  5D93 A;  2PGT A;  3WT2 A;  1YJ6 A;  4MJA A;  2DC5 A;  4K8M A;  1BJX A;  3TKR A;  2RUE A;  4MA9 A;  1TRV A;  2LQQ A;  1SEN A;  4G10 A;  1X5C A;  4HI7 A;  4EIQ A;  2ALB A;  5G1K A;  1YKA A;  5IM9 A;  2O89 A;  4BL7 A;  2IMK A;  2B5Y A;  2L6C A;  1F3B A;  1XVQ A;  1MDI A;  3E3E A;  5FHI A;  4Z2U A;  2C0D A;  1ACV A;  1Z7R A;  2WRT A;  1EGO A;  1AXD A;  5JWR B;  4DVC A;  3NOF A;  3LXT A;  5BMU A;  3Q74 A;  3O3T A;  2JL4 A;  3EE2 A;  4F2I A;  4LMW A;  1PFO A;  1WJK A;  5ELG A;  2AV4 A;  2KLX A;  4PUF C;  4MJE A;  4NWY A;  3A2V A;  2GVP A;  3QFA C;  3J7Y b;  1T8E B;  3D21 A;  1T3B A;  3EU3 A;  4MNN A;  4K9Z A;  1KTE A;  2CZ2 A;  3IHQ A;  3KMO A;  4YKF A;  1FG4 A;  1W4V A;  2X99 A;  2HI7 A;  2OKA A;  8GSS A;  3UVH A;  3R3E A;  5AIS A;  3LXZ A;  1OKD A;  4XHM A;  2K8S A;  5IPH A;  3TDG A;  1WIK A;  4ECC A;  1OKT A;  5IQY A;  4XS1 A;  2VL2 A;  4MPG A;  4KDX A;  3TRX A;  3RPP A;  4DSS A;  4JED A;  2QA1 A;  3RAZ A;  2NPB A;  4KSO A;  2JZR A;  5DAK B;  5IMF A;  4PGT A;  4XS4 A;  4O32 A;  4XS6 A;  3VPQ A;  3C1R A;  2H1A A;  5J5N A;  4CY6 A;  2GQL A;  3D4T A;  1HNB A;  2VOC A;  3S9F A;  2LKU A;  4WBR D;  1B4P A;  2OAC A;  3H8Q A;  5CRD A;  1TU8 A;  5H5Q A;  2B3S A;  5J3R A;  3M9K A;  3TJJ A;  2IFQ A;  1T4Y A;  2QC7 A;  1XPV A;  2O7K A;  1WOU A;  6GST A;  1SJ6 A;  2V6O A;  3NZN A;  5DDL A;  2IMD A;  5D96 A;  3V1W A;  1F3A A;  3DD3 A;  4V1A p;  1N8J A;  5ECN B;  3LEF A;  1PGT A;  1OYJ A;  2L5L A;  3ZMK A;  1WRY A;  4WXT A;  4KUN A;  4O5U A;  2L4Q A;  1VGL A;  1ZCP A;  1EWX A;  1R5A A;  1B48 A;  2I3Y A;  5EVO A;  4LL4 B;  4GXZ A;  4GSN A;  3A2W A;  3QFB C;  1EV9 A;  3I69 A;  2FGX A;  5KN1 A;  3C73 A;  3UL3 A;  2DJ2 A;  1M3J A;  4D73 B;  1X5E A;  4MJB A;  5CRG A;  2XC2 A;  4KX4 A;  4MZB A;  2C3T A;  5GAP D;  5IMV A;  4P3Y B;  3EC3 A;  1O8W A;  4L5L A;  4J2F A;  4FYU A;  2IWT A;  4MF7 A;  4N0Z A;  3ERW A;  4HQZ A;  3IHG A;  12GS A;  4ECI A;  5ENU A;  3L78 A;  2IL3 A;  3IK9 A;  3AY8 A;  5CO3 A;  3H4K A;  3CSJ A;  1GTA A;  2P0G A;  3HJP A;  4X0X A;  1LBK A;  3ZLP A;  2CAQ A;  4WF4 A;  3C1S A;  3KD0 A;  3P90 A;  2B7J A;  3GRX A;  3VWW A;  5L71 A;  3JCM L;  5J9B A;  1K0M A;  3FEU A;  3MWH A;  1NW2 A;  5IO0 A;  1V98 A;  3H79 A;  1M99 A;  2PER A;  2H0H A;  2A2S A;  3I9V 2;  2JAD A;  1PA3 A;  2FUG 2;  2WUL A;  1XIY A;  4IS0 A;  3FW2 A;  3IR4 A;  2QA2 A;  2YPM A;  1LJR A;  4MCU A;  4J56 E;  2K18 A;  3DGQ A;  4GCI A;  1GL8 A;  1ABA A;  3QAG A;  1G6W A;  4O7H A;  5J4U A;  4BVX A;  3G7I A;  4KB3 A;  1VF1 A;  2L5O A;  2FWG A;  4HU7 A;  2F8A A;  2FA4 A;  1QUW A;  3WGD A;  1G6Y A;  3ZIJ A;  3GA4 A;  2LJK A;  3LSZ A;  2CVK A;  2F8F A;  3VWU A;  3GKX A;  1WMJ A;  2UZ8 A;  3HVX A;  2LQO A;  3DYR A;  5CRE A;  3TJK A;  4G0L A;  1XWG A;  6GSY A;  4I5Q A;  1QGV A;  2CVB A;  3TJB A;  5LD0 A;  4MZC A;  3IDV A;  5JCU A;  11GS A;  2H66 A;  2L59 A;  4WR4 A;  4KF9 A;  2GZY A;  3TUE A;  1EEJ A;  1GSD A;  4IJI A;  5BRT A;  2H19 A;  1XFL A;  3FZ5 A;  4POL A;  2MBT A;  3WGX A;  1O8X A;  3ZFB A;  3HZ4 A;  2H0I A;  3WT1 A;  1SKR B;  3H93 A;  1SD9 A;  1U6T A;  5F07 A;  4TW5 A;  2PN8 A;  5IOW A;  2PVO C;  1TK8 B;  1B8X A;  2IMI A;  1XW9 A;  4MDC A;  2YWI A;  1TJD A;  3G7Y A;  4IKH A;  3UAP A;  2OBI A;  4NXI A;  1GLQ A;  3Q18 A;  5CYY A;  4Q5F A;  4HZ4 A;  1Z5Y E;  3KEB A;  4OFT A;  2J9H A;  1K0A A;  4POM A;  4RI6 A;  5IMD A;  4F9Z A;  4TR4 A;  4OFN A;  2IJY A;  4ML6 A;  4WET A;  5JWQ B;  2B5E A;  5B6M A;  3DWV A;  4MF6 A;  3R2Q A;  4EXJ A;  3CBU A;  4E8E A;  4O92 A;  2RLI A;  3RHB A;  1TDI A;  1GSY A;  1MTC A;  3F8U A;  4HQS A;  1TW9 A;  5ID2 B;  4ZBA A; 
#chains in the Genus database with same CATH homology
 1ERV A;  2LNT A;  3CSI A;  5AGY A;  1GSF A;  3GIX A;  3GYK A;  2LRC A;  3M8N A;  1TXX A;  3ZIV A;  3VI7 A;  3VK9 A;  4ECJ A;  3IBH A;  1Z3E A;  1FO5 A;  4TVE A;  1V9W A;  1GUK A;  4HZ2 A;  2VAF A;  5ECH B;  2JU5 A;  2VL9 A;  4NV5 A;  3HKR A;  4RQR A;  4Q5R A;  1DSB A;  1PKZ A;  3QPM A;  3TCO A;  4YAV A;  1MDJ A;  2HFD A;  1Z9H A;  1FB6 A;  2LEG A;  1ON4 A;  3TGZ A;  4ULX A;  2RM5 A;  1SK0 A;  3LYP A;  3GX0 A;  5DQS A;  3ZIT A;  1XCC A;  3D22 A;  3RPN A;  4KA0 A;  1ZYP A;  2GT6 A;  3CSH A;  4JU5 A;  2OJL A;  3KZQ A;  1YEX A;  1ZYQ B;  2C8U A;  4DSR A;  1GSU A;  3CRU A;  3KJY A;  3M9J A;  4YQV A;  5HR1 A;  4K7O A;  1TOF A;  4PXO A;  2H72 A;  1BYE A;  4BL7 B;  3C71 A;  3P2A A;  3F4T A;  1TP9 A;  4K2X A;  1IYI A;  19GS A;  3FZA A;  4G19 A;  3KMN A;  1PRX A;  4IBP A;  4K0G A;  2ON5 A;  2PWJ A;  3BOA A;  2VUP A;  7GSS A;  2OBK A;  4AJ7 A;  5B6N A;  3W8J A;  1EP8 A;  4OO4 A;  4L8E A;  1EGR A;  2M46 A;  4Z7X A;  1SJZ A;  4KE3 A;  4MPF A;  5DCH A;  1ZYN A;  2VLV A;  5G31 A;  2WJU A;  2YNX A;  1EZK A;  1XXU A;  3K8N A;  2MMN A;  3MYD A;  3CXG A;  2P5Q A;  4OWY A;  3C7M A;  1A8Y A;  1JHB A;  2XHF A;  5CAX A;  4XCS A;  1A8L A;  2AHE A;  3W8S A;  3QAW A;  1PQN A;  4EC0 A;  2DKH A;  2R0C A;  1X9S B;  4AF2 A;  4K0N A;  2AB6 A;  3BCK A;  3CTG A;  3O6T A;  2RII A;  2TIR A;  2VCW A;  2L57 A;  2CT6 A;  3DVX A;  3D5J A;  2VL3 A;  4DSS B;  2WZ9 A;  3GL5 A;  2VCT A;  1BX9 A;  1X9M B;  3D4M A;  4XS4 B;  1M2B A;  3M1G A;  2F3M A;  4IP6 A;  4ZIJ A;  1SYR A;  3KM6 A;  3TJF A;  1NHY A;  3IPZ A;  4JRR A;  1TK5 B;  2QGV A;  1G0T A;  2VD0 A;  2IPA A;  5F05 A;  3ISO A;  1SD8 A;  4XRD A;  1Z6N A;  3BBY A;  3CMI A;  1M2A A;  5JCG A;  4WR5 A;  1AW9 A;  3TOT A;  3WD6 A;  3MDK A;  4G2E A;  4QL9 A;  1OC9 A;  4LL1 B;  2IFQ B;  2V41 A;  3HZ8 A;  2REM A;  5COH A;  3IA1 A;  3L9V A;  4V2L A;  2I4A A;  4O5Q A;  2EC4 A;  4LA1 A;  1TI3 A;  1SL0 B;  1A24 A;  4K7I A;  3NIV A;  1THX A;  2PPT A;  3KP8 A;  3ZRD A;  4WKW A;  3VWX A;  5F0G A;  3UMA A;  3EPT A;  1USB A;  2CZ3 A;  4XRA A;  1GUH A;  2IMF A;  1AUC A;  2ON7 A;  3F9U A;  2K6V A;  3L0H A;  3UBL A;  5DVB A;  2F9S A;  1GSQ A;  2PMT A;  3W6G A;  4DSQ A;  2KHP A;  3TKS A;  2YV7 A;  5ECI B;  1ZMA A;  1R7H A;  5DAL A;  1AC1 A;  4IHU A;  4OMV A;  1EP7 A;  1F9M A;  1S3A A;  4YKG A;  5D73 A;  1GSE A;  1RW1 A;  3KH9 A;  1JZD A;  4XTS A;  3QMX A;  3ZRE A;  4GRF A;  2XBQ A;  1RK4 A;  3FHK A;  2AAW A;  3GKM A;  4K6X A;  2A4H A;  3QAV A;  1TRS A;  4PUA A;  1ERW A;  3RDW A;  1R5P A;  2I1U A;  1F6M C;  3TOU A;  5J9C A;  4YH2 A;  1UVZ A;  2YJH A;  3FY7 A;  2OA7 A;  1GTB A;  4EDZ A;  3MSZ A;  4FIW A;  4E8H A;  3LG6 A;  4Z2T A;  1A0R P;  1GUL A;  5C00 A;  4BA7 A;  4TR1 B;  4ZXG A;  3UIW A;  2WDU A;  5G5E A;  2VD1 A;  4MMM A;  2HNL A;  1K3Y A;  4TR3 A;  20GS A;  4TR0 A;  5E4W A;  2V32 A;  2E2G A;  4EDY A;  1H75 A;  1M7T A;  4X43 A;  5G30 A;  3L9U A;  4IN0 A;  3TJG A;  1PL2 A;  1YZX A;  4RI7 A;  5F06 A;  5IIZ A;  2HSY A;  3M0F A;  2YAN A;  2G0F A;  4PX1 A;  4BVX B;  4GF0 A;  1XWA A;  4AGS A;  2H6Z A;  1K0B A;  3CRT A;  1M2D A;  2RUF A;  4F0B A;  3HD5 A;  1K0N A;  1YF1 A;  1VF3 A;  3GSS A;  2MYG A;  4OO5 A;  1XWB A;  4A5P A;  2F51 A;  2P5R A;  3EWL A;  1KBN A;  3GV1 A;  1CQH A;  4IGJ A;  1PD2 1;  2GS3 A;  3PR8 A;  4HJ2 A;  1ZGN A;  5JWO B;  3M3M A;  2KOK A;  4ID0 A;  1B4Q A;  4MH2 A;  1O85 A;  1QMV A;  2HRF A;  5GSS A;  2DJ1 A;  1T4Z A;  4OFM A;  4ZL8 A;  2A4V A;  4PUR A;  2C0F A;  1A23 A;  3F3R A;  2C0G A;  2C1Y A;  13GS A;  1V58 A;  3DIE A;  5GST A;  1O73 A;  5G5F A;  5KN3 A;  1A2M A;  4N10 A;  2H6Y A;  3A3T A;  2BJX A;  5AIV A;  1J08 A;  4NV2 A;  1W89 A;  3TKQ A;  3PIN A;  2HRN A;  3HYP A;  5HFG A;  2VCQ A;  2HSH A;  4RQX A;  4TXO B;  4QL7 A;  5GZZ B;  4N11 A;  3LQ7 A;  1EV4 A;  1BED A;  2Z9S A;  3ME8 A;  2HRK A;  5CNW A;  2MMZ A;  3IOS A;  2PVQ A;  2GLR A;  4ZB6 A;  4MP4 A;  5ECP B;  1SJI A;  2HSM A;  4MLY A;  1MD4 A;  1FB0 A;  3FMW A;  1J9B A;  1XW5 A;  2EIQ A;  2GGT A;  1ZOF A;  4PQI A;  1K3O A;  1Q98 A;  4RUV A;  1AIU A;  4HOJ A;  4JR6 A;  3KCM A;  5HR3 A;  3N9J A;  1B9X C;  5DBQ A;  4EVM A;  2MBS A;  3UVT A;  6GSS A;  1H4O A;  1XWK A;  4V2M A;  3PPU A;  2H76 A;  2A2P A;  3ZFL A;  3SBC A;  2PU9 C;  3HCZ A;  1SYX A;  3CYN A;  2K9F A;  1FOH A;  2O8V B;  4WEY A;  1B9Y C;  4K1F A;  4YAP A;  5HR2 A;  4G0K A;  3IC8 A;  2WB9 A;  4ZBD A;  4N0V A;  4V2N A;  4IP1 A;  1ZL9 A;  2R4V A;  5G2Z A;  3A2X A;  4XIH A;  4QQ7 A;  2JSZ A;  1T1V A;  1EEM A;  1TU7 A;  2OE0 A;  5IO2 A;  2N5F A;  2C3Q A;  4Q5N A;  2VCZ A;  5CRW A;  2A2R A;  2VL2 C;  1X5D A;  2L6D A;  3ED3 A;  3GST A;  1GP1 A;  3GTU A;  2QKE A;  2H73 A;  3FZ9 A;  3HHV A;  5KN0 A;  4YQU A;  4CY8 A;  2QSI A;  1JZO A;  2GT5 A;  1GNE A;  3F6D A;  2GZZ A;  3ZZX A;  2HZF A;  2PBJ A;  4I8B A;  2HZE A;  2YZH A;  3GFK A;  3F4R A;  3MIX A;  3MAK A;  5B7C A;  2FD3 A;  4TRX A;  2FLS A;  4NHW A;  2JSY A;  1AQX A;  4KGI A;  3DVW A;  2DSA A;  4ZB8 A;  5IMC A;  1BAY A;  2DJ0 A;  1YF0 A;  1BQ7 A;  2DML A;  2H70 A;  1OE7 A;  4KSM A;  1ERT A;  1U88 A;  3F63 A;  3IRA A;  3APO A;  1T00 A;  3WYW A;  3HY2 A;  1PX7 A;  1OC9 B;  4L0W A;  1XBS A;  2K8V A;  2VCX A;  2VM1 A;  3P8W A;  2FHE A;  2IIY A;  5D9V A;  2TRX A;  1I9D A;  1OE8 A;  4BWQ A;  3EIN A;  3VLN A;  1VRS D;  1NM3 A;  5ELA A;  4EUY A;  2FA8 A;  2H71 A;  18GS A;  3LFL A;  1M0U A;  4G9H A;  2GDR A;  1X9W B;  3J7Y k;  1ST9 A;  1QXH A;  3FZ4 A;  1GNW A;  2IME A;  3EMP A;  3QR6 A;  6GSW A;  1WE0 A;  4X1U A;  1GTU A;  4PQH A;  1HNC A;  1ILO A;  2N5B A;  3FR9 A;  2H6X A;  2MZC A;  5DAL B;  4ECB A;  1SKW B;  2AUV A;  4L5O A;  4ML1 A;  2DMM A;  1WPI A;  5ECK B;  4AJ6 A;  5DQY A;  3H1N A;  3QD9 A;  2DLX A;  3RBT A;  5KEJ A;  3SWL A;  2B6M A;  3KIJ A;  2OE1 A;  4POK A;  3IK7 A;  1HNA A;  1YDK A;  2XPD A;  3Q19 A;  3TRQ A;  5IMZ A;  1SL2 B;  2R2J A;  4LLR A;  5ID2 A;  1WWJ A;  4TKY A;  4EE0 A;  3ME7 A;  1DE2 A;  3GH6 A;  3KH7 A;  1PSQ A;  4KAE A;  5AN1 A;  2M72 A;  2X64 A;  4KCA A;  3U5R E;  2YZU A;  1AQW A;  2O87 A;  1DUG A;  1Z7P A;  4JR4 A;  5J41 A;  2M80 A;  2H30 A;  1ZZY A;  4HS1 A;  3QDN A;  4PQ1 A;  5ABR A;  2HE3 A;  1URM A;  2O85 A;  4GQC A;  1ERU A;  4GQF A;  5DJL A;  5A5K A;  2H0G A;  4MK3 A;  3ERG A;  1TKD B;  1O6J A;  2JAC A;  1ZYE A;  3TB2 A;  4I97 A;  2HYX A;  3GMF A;  4OCE A;  1JLW A;  3ZL5 A;  1GWC A;  2LST A;  3VPT A;  1PL1 A;  2IN3 A;  3APQ A;  5JCW A;  1F37 A;  4GTU A;  3E0U A;  5E59 A;  5FT3 A;  6GSU A;  3ERF A;  1V57 A;  2VLT A;  4L0U A;  4DEJ A;  3HJM A;  3HA9 A;  4F0C A;  5FWG A;  5GAN D;  2FY6 A;  5B8B A;  3ZML A;  5D9X A;  2KP1 A;  1K0D A;  3UEM A;  3IV4 A;  4ZL9 A;  5INY A;  4EL1 A;  1E2Y A;  1KNG A;  5D8I A;  1S3D A;  2NVL A;  3HVS A;  3HVV A;  2YV9 A;  5CP1 A;  2DKI A;  2CQ9 A;  2GSR A;  2R37 A;  2R0G A;  1NSW A;  1MEK A;  4JBB A;  4MAB A;  4ISD A;  2R5G A;  3HJO A;  3IAS 2;  2LV3 A;  2R0P A;  3FRC A;  3VI5 A;  1FVJ A;  3F0I A;  3BJ5 A;  3GHA A;  6GSV A;  5A4V A;  2TRC P;  3UBK A;  3LWA A;  4IEL A;  4WF5 A;  1V40 A;  3GKN A;  4V1A g;  2L4C A;  5DJM A;  4GWR A;  3DXB A;  4HDE A;  2CV4 A;  4GLT A;  2CAI A;  1J0F A;  4X4J A;  4Q5Q A;  4ZIL A;  4IQ1 A;  3A5I A;  3FK8 A;  4NPB A;  1OAZ A;  4JE1 A;  1A2J A;  3EUR A;  5HFK A;  1YY7 A;  4FQU A;  4EF0 A;  2HT9 A;  1UN2 A;  3GKK A;  5HFI A;  5D9W A;  2VO4 A;  4NAX A;  3KP9 A;  2XBI A;  4BVY A;  4TXV A;  3VWV A;  3C8E A;  2GQM A;  4EKZ A;  4MZW A;  3I43 A;  4MJC A;  2YWM A;  1N2A A;  2LS5 A;  5ECQ B;  1SL1 B;  3G7J A;  4BWS A;  2R3X A;  4KH7 A;  3FYG A;  3G9B A;  4MF5 A;  4TOP A;  1R26 A;  1GTI A;  4OCF A;  1KEB A;  1XW6 A;  2DIY A;  2LUS A;  2E2M A;  1PN0 A;  1AQV A;  3F4S A;  3PH9 A;  4WBJ A;  1K3L A;  1SK1 A;  3ZVJ A;  4YQM A;  4FYC A;  4KW6 A;  5EY6 A;  2G2Q A;  3KTB A;  4IJ3 A;  4ZB9 A;  1RQM A;  1MD3 A;  1LU4 A;  3WGE A;  1VF4 A;  2HXK A;  1Q4J A;  5A4U A;  3I6A A;  5H5S A;  3TRP A;  4FYB A;  1TTZ A;  4HU9 A;  1PMT A;  1XZO A;  2B5X A;  3LOR A;  5A4W A;  3DML A;  3QCP A;  3TKS E;  1ML6 A;  3ZTL A;  2X8G A;  2LNS A;  5IPG A;  3UAR A;  3GNJ A;  2CA8 A;  1JFU A;  4NMU A;  1CQG A;  1YKC A;  3ZVJ D;  4N30 A;  1TRU A;  1THO A;  1VF2 A;  3LYK A;  1C72 A;  2NBS A;  1GRX A;  2CX3 A;  5DAK A;  5HQP A;  5ECR B;  5ECO B;  4Z2R A;  4F82 A;  1O81 A;  2XPE A;  4O5R A;  3F6F A;  2NDO A;  2FWE A;  1M9A A;  4HUA A;  2H1B A;  4TR1 A;  1TI1 A;  2H1G A;  1XOA A;  4FO5 A;  3P7X A;  3PGT A;  3GTU B;  1XOB A;  4GST A;  1V2A A;  2AYT A;  3U6V A;  2C80 A;  3OR5 A;  4J57 E;  2J23 A;  2YN1 A;  2FWH A;  2GZP A;  1OC8 A;  1E6B A;  1QQ2 A;  2NTO A;  5ECL B;  1Y25 A;  5ECM B;  3Q6O A;  2X8H A;  2BMX A;  1U87 A;  2V2G A;  3CTF A;  2HZE B;  5KOW A;  2YJ7 A;  3APS A;  1EOH A;  5ECS A;  4LMV A;  2FCH A;  4HEA 2;  4BPY A;  1K0O A;  4USS A;  3LGC A;  2GSS A;  2C3N A;  3BD2 A;  3IXR A;  2N5A A;  1QK8 A;  3KTL A;  1Z6M A;  17GS A;  3UOM A;  4GSS A;  2HLS A;  1F2E A;  4G0I A;  2GQK A;  4KDU A;  2ZNM A;  2FWF A;  2EIO A;  4D73 A;  5B8A A;  3L4N A;  2H8L A;  10GS A;  1SKS B;  2B7K A;  3VUR A;  2JZT A;  4ILF A;  2YWO A;  1TK0 B;  1FOV A;  4K2D A;  5AIX A;  3TKS C;  1OVN A;  4IW9 A;  3US3 A;  3VFI A;  3GH9 A;  2I81 A;  1HYU A;  3GN3 A;  2LRN A;  2GST A;  2VM2 A;  1SU9 A;  3GUR A;  5KOX A;  9GSS A;  2DJJ A;  4MH3 A;  6GSX A;  1AAZ A;  4ACS A;  2DIZ A;  2BTO T;  2LTK A;  2GSQ A;  2R6K A;  3GL3 A;  2YWN A;  3EYT A;  3QOU A;  3HXS A;  3IAM 2;  1A2L A;  1K0C A;  2X4A A;  1GUM A;  2LRT A;  4TXO A;  1TRW A;  2YP6 A;  2C4J A;  1WP0 A;  2X49 A;  5KN2 A;  5DCG A;  2EIR A;  2YCD A;  3DKS A;  2DJK A;  1GH2 A;  1DE1 A;  2V1M A;  2E0Q A;  4EO3 A;  1YQ1 A;  1FVK A;  3TKP A;  3FR6 A;  2JZS A;  4OD7 A;  1XVW A;  1GSS A;  1X0R A;  1G7E A;  2I9H A;  4KND A;  3UJ1 A;  4KCE A;  2LJR A;  3E9J B;  2VLU A;  1NHO A;  4PTS A;  2VIM A;  3IC4 A;  2FNO A;  2H74 A;  4K7N A;  2ZUP A;  2CVD A;  1FW1 A;  4ICY A;  3D6I A;  1DBY A;  2DJ3 A;  1PN9 A;  1G7O A;  1PX6 A;  3HDC A;  4CHS A;  1FHE A;  2OE3 A;  2MMA A;  2OAD A;  2WGR A;  5EL8 A;  1SK2 A;  3EU4 A;  2C0E A;  1BG5 A;  2P31 A;  2LJA A;  2V6K A;  3DRN A;  4ZL7 A;  1O7U A;  1I5G A;  1A0F A;  1PKW A;  5G1L A;  1R4W A;  3GUS A;  5IOX A;  4IVF A;  3FR3 A;  4I2U A;  4ZBB A;  5C04 A;  3A5W A;  3EMX A;  2ZCT A;  4K5S A;  1IYH A;  5F8B A;  2YOI A;  2B1L A;  4HJM A;  2PUK C;  4JZQ A;  1JLV A;  3KXO A;  2CX4 A;  2WFC A;  4CDO A;  4I2T A;  2HRA A;  2WCI A;  4EIP A;  3O76 A;  2B1K A;  3DEX A;  2VCV A;  22GS A;  1U3I A;  4IQA A;  4I6X A;  1EOG A;  2GTU A;  3N5O A;  2DBC A;  4AJ8 A;  4H86 A;  1S3C A;  1HQO A;  3RHC A;  2MMO A;  4POB A;  3MNG A;  5D9T A;  3ZYW A;  2KUC A;  4K5R A;  1JZR A;  4TN8 A;  3LJR A;  1FAA A;  4KDY A;  2WS2 A;  1M9B A;  5H5R A;  3LW9 A;  1T7P B;  1Y6E A;  1HD2 A;  3F3Q A;  2AJQ B;  3FKF A;  4PNF A;  3EVI A;  1QFN A;  1MDK A;  2D2Z A;  3GX8 A;  1UA5 A;  14GS A;  5CRH A;  2ES7 A;  3KGK A;  4CW9 A;  3L9S A;  2KP2 A;  5LNK e;  1GLP A;  5LCZ A;  1YEP A;  2H01 A;  3D0Z A;  4F03 A;  5IMA A;  5EPF A;  1JZW A;  5HR0 A;  2X8C A;  3IE3 A;  3BCI A;  2H75 A;  2E7P A;  1XWC A;  16GS A;  4FH8 A;  4PNG A;  1U3A A;  2RM6 A;  2H1D A;  1UC7 A;  4BVY B;  4NHZ A;  1OC3 A;  5D93 A;  2PGT A;  3WT2 A;  1YJ6 A;  4MJA A;  2DC5 A;  4K8M A;  1BJX A;  3TKR A;  2RUE A;  4MA9 A;  1TRV A;  2LQQ A;  1SEN A;  4G10 A;  1X5C A;  4HI7 A;  4EIQ A;  2ALB A;  5G1K A;  1YKA A;  5IM9 A;  2O89 A;  4BL7 A;  2IMK A;  2B5Y A;  2L6C A;  1F3B A;  1XVQ A;  1MDI A;  3E3E A;  5FHI A;  4Z2U A;  2C0D A;  1ACV A;  1Z7R A;  2WRT A;  1EGO A;  1AXD A;  5JWR B;  4DVC A;  3NOF A;  3LXT A;  5BMU A;  3Q74 A;  3O3T A;  2JL4 A;  3EE2 A;  4F2I A;  4LMW A;  1WJK A;  5ELG A;  2AV4 A;  2KLX A;  4PUF C;  4MJE A;  4NWY A;  3A2V A;  2GVP A;  3QFA C;  3J7Y b;  1T8E B;  3D21 A;  1T3B A;  3EU3 A;  4MNN A;  4K9Z A;  1KTE A;  2CZ2 A;  3IHQ A;  3KMO A;  4YKF A;  1FG4 A;  1W4V A;  2X99 A;  2HI7 A;  2OKA A;  8GSS A;  3UVH A;  3R3E A;  5AIS A;  3LXZ A;  1OKD A;  4XHM A;  2K8S A;  5IPH A;  3TDG A;  1WIK A;  4ECC A;  1OKT A;  5IQY A;  4XS1 A;  2VL2 A;  4MPG A;  4KDX A;  3TRX A;  3RPP A;  4DSS A;  4JED A;  2QA1 A;  3RAZ A;  2NPB A;  4KSO A;  2JZR A;  5DAK B;  5IMF A;  4PGT A;  4XS4 A;  4O32 A;  4XS6 A;  3VPQ A;  3C1R A;  2H1A A;  5J5N A;  4CY6 A;  2GQL A;  3D4T A;  1HNB A;  2VOC A;  3S9F A;  2LKU A;  4WBR D;  1B4P A;  2OAC A;  3H8Q A;  5CRD A;  1TU8 A;  5H5Q A;  2B3S A;  5J3R A;  3M9K A;  3TJJ A;  2IFQ A;  1T4Y A;  2QC7 A;  1XPV A;  2O7K A;  1WOU A;  6GST A;  1SJ6 A;  2V6O A;  3NZN A;  5DDL A;  2IMD A;  5D96 A;  3V1W A;  1F3A A;  3DD3 A;  4V1A p;  1N8J A;  5ECN B;  3LEF A;  1PGT A;  1OYJ A;  2L5L A;  3ZMK A;  1WRY A;  4WXT A;  4KUN A;  4O5U A;  2L4Q A;  1VGL A;  1ZCP A;  1EWX A;  1R5A A;  1B48 A;  2I3Y A;  5EVO A;  4LL4 B;  4GXZ A;  4GSN A;  3A2W A;  3QFB C;  1EV9 A;  3I69 A;  2FGX A;  5KN1 A;  3C73 A;  3UL3 A;  2DJ2 A;  4D73 B;  1X5E A;  4MJB A;  5CRG A;  2XC2 A;  4KX4 A;  4MZB A;  2C3T A;  5GAP D;  5IMV A;  4P3Y B;  3EC3 A;  1O8W A;  4L5L A;  4J2F A;  4FYU A;  2IWT A;  4MF7 A;  4N0Z A;  3ERW A;  4HQZ A;  3IHG A;  12GS A;  4ECI A;  5ENU A;  3L78 A;  2IL3 A;  3IK9 A;  3AY8 A;  5CO3 A;  3H4K A;  3CSJ A;  1GTA A;  2P0G A;  3HJP A;  4X0X A;  1LBK A;  3ZLP A;  2CAQ A;  4WF4 A;  3C1S A;  3KD0 A;  3P90 A;  2B7J A;  3GRX A;  3VWW A;  5L71 A;  3JCM L;  5J9B A;  1K0M A;  3FEU A;  3MWH A;  1NW2 A;  5IO0 A;  1V98 A;  3H79 A;  1M99 A;  2PER A;  2H0H A;  2A2S A;  3I9V 2;  2JAD A;  1PA3 A;  2FUG 2;  2WUL A;  1XIY A;  4IS0 A;  3FW2 A;  3IR4 A;  2QA2 A;  2YPM A;  1LJR A;  4MCU A;  4J56 E;  2K18 A;  3DGQ A;  4GCI A;  1GL8 A;  1ABA A;  3QAG A;  1G6W A;  4O7H A;  5J4U A;  4BVX A;  3G7I A;  4KB3 A;  1VF1 A;  2L5O A;  2FWG A;  4HU7 A;  2F8A A;  2FA4 A;  1QUW A;  3WGD A;  1G6Y A;  3ZIJ A;  3GA4 A;  2LJK A;  3LSZ A;  2CVK A;  2F8F A;  3VWU A;  3GKX A;  1WMJ A;  2UZ8 A;  3HVX A;  2LQO A;  3DYR A;  5CRE A;  3TJK A;  4G0L A;  1XWG A;  6GSY A;  4I5Q A;  1QGV A;  2CVB A;  3TJB A;  5LD0 A;  4MZC A;  3IDV A;  5JCU A;  11GS A;  2H66 A;  2L59 A;  4WR4 A;  4KF9 A;  2GZY A;  3TUE A;  1EEJ A;  1GSD A;  4IJI A;  5BRT A;  2H19 A;  1XFL A;  3FZ5 A;  4POL A;  2MBT A;  3WGX A;  1O8X A;  3ZFB A;  3HZ4 A;  2H0I A;  3WT1 A;  1SKR B;  3H93 A;  1SD9 A;  1U6T A;  5F07 A;  4TW5 A;  2PN8 A;  5IOW A;  2PVO C;  1TK8 B;  1B8X A;  2IMI A;  1XW9 A;  4MDC A;  2YWI A;  1TJD A;  3G7Y A;  4IKH A;  3UAP A;  2OBI A;  4NXI A;  1GLQ A;  3Q18 A;  5CYY A;  4Q5F A;  4HZ4 A;  1Z5Y E;  3KEB A;  4OFT A;  2J9H A;  1K0A A;  4POM A;  4RI6 A;  5IMD A;  4F9Z A;  4TR4 A;  4OFN A;  2IJY A;  4ML6 A;  4WET A;  5JWQ B;  2B5E A;  5B6M A;  3DWV A;  4MF6 A;  3R2Q A;  4EXJ A;  3CBU A;  4E8E A;  4O92 A;  2RLI A;  3RHB A;  1TDI A;  1GSY A;  1MTC A;  3F8U A;  4HQS A;  1TW9 A;  5ID2 B;  4ZBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...