3D4MA

Glutaredoxin 2 oxidized structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
MVSQETVAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIGGNSDLETLKKNGKLAEILKPVFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin-2, mitochondrial
publication title Structural aspects of the distinct biochemical properties of glutaredoxin 1 and glutaredoxin 2 from Saccharomyces cerevisiae.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2008-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3d4mA00
3DEXA 1YF0A 1SJZA 1WMJA 5ENUA 5G1KA 4KDXA 1R5AA 1B4PA 1AIUA 1W4VA 4D73B 4JBBA 4MABA 3BD2A 1A2JA 2JACA 3EVIA 1PSQA 4KSMA 3A3TA 1LBKA 1T4ZA 2GTUA 2EIQA 4XRDA 3GV1A 3HVVA 2LV3A 4OCFA 1TDIA 3CMIA 4IN0A 3TJGA 4CHSA 5IPGA 1RK4A 4D73A 4TW5A 4EF0A 2X8HA 3DGQA 1J0FA 4MJBA 1Z3EA 1Z7PA 3F4RA 2JL4A 2H0HA 1AW9A 4ISDA 3ME8A 3ZVJA 5KN3A 2V41A 2NPBA 3IC4A 3Q74A 1PN9A 3U6VA 3TUEA 4BWSA 1DE1A 3IAM2 4DEJA 3HVSA 4OFTA 2H75A 1HNAA 1XPVA 2XBQA 2VCWA 2HRNA 1THXA 4K0NA 1JZDA 2P0GA 4MP4A 4IP1A 1RQMA 1PMTA 4XS4B 3NZNA 1WE0A 18GSA 3APSA 5IIZA 4G19A 2HZFA 1FHEA 4V2NA 3ZLPA 4MA9A 3LQ7A 1V58A 2M72A 3ME7A 3ZTLA 3AY8A 1Q4JA 1K0NA 3HA9A 2CZ2A 4HQSA 3FZAA 2HSYA 3HHVA 3O3TA 1XWCA 2CVDA 1GRXA 1GSFA 2CVBA 3KXOA 4XS4A 1GTIA 4IS0A 1B48A 3E3EA 2FHEA 4WR4A 3FHKA 16GSA 2H6YA 3TJJA 2WGRA 2YP6A 4IJ3A 2VLTA 2HSHA 2BMXA 3ZIJA 4IHUA 1GUKA 2GQMA 5D9VA 1K0AA 3ZIVA 4ACSA 1TRSA 2R37A 3A5WA 4YH2A 1AUCA 3KTBA 2IFQB 3RHBA 5ELAA 3ZRDA 2ZNMA 4WR5A 4PNGA 1GSYA 1TTZA 2WCIA 3LSZA 2EIOA 3I69A 2GQKA 4NXIA 3IR4A 3DMLA 3FR9A 3QDNA 1YQ1A 4FYUA 3TRXA 1AXDA 1K0MA 3A2XA 3UVHA 4L5LA 2IFQA 3EINA 1WOUA 4EDYA 3KJYA 1YDKA 1TU8A 3LXTA 2OADA 2FCHA 2L5LA 1TK5B 1J9BA 1VF1A 1S3AA 2DJ3A 3EC3A 2YV7A 1GLQA 2H66A 1XOAA 2YWOA 3TKRA 3IOSA 5H5SA 3GSSA 2G0FA 4BA7A 5AGYA 4WKWA 2PVOC 1ZZYA 3S9FA 3D6IA 1Q98A 3FZ9A 2NTOA 4L5OA 4J57E 3IPZA 2KP1A 4XHMA 4IGJA 4TKYA 5GAPD 4RUVA 5HR1A 5CREA 2RLIA 4L0WA 2OBIA 4YQMA 3DXBA 1N2AA 4PUFC 3KP9A 3QFAC 2AHEA 2CA8A 4ECIA 2L6DA 6GSTA 2PMTA 4MF5A 1AAZA 2XHFA 1SK2A 2XC2A 5IMDA 2HI7A 4XS6A 5CAXA 4OO4A 2IL3A 1IYIA 1GSQA 1O85A 3WT1A 2FLSA 5KN0A 4HZ2A 4IBPA 1W89A 4WETA 4XTSA 2A2RA 3F3QA 5ECIB 5ELGA 2FD3A 1USBA 3F6FA 5CRGA 3UBLA 5F07A 3CBUA 3WD6A 1F37A 1S3CA 3PINA 1XZOA 1SK1A 2OKAA 2OE3A 3U5RE 5FWGA 4MDCA 1A8YA 3EU3A 2PBJA 3KD0A 4CW9A 3KGKA 1OKDA 4I6XA 1OE8A 4OFMA 4PQIA 2X99A 4JR6A 4RQXA 3UEMA 3M3MA 4I8BA 1HYUA 2YOIA 2PWJA 2PVQA 3A2WA 5HR3A 1Z6MA 4BPYA 3D4TA 3UJ1A 6GSYA 1MTCA 2O8VB 2DBCA 3F8UA 4EVMA 2HE3A 3L78A 4PURA 2ZUPA 1XW5A 4HJ2A 1VGLA 1R7HA 3TJKA 2MMZA 5EY6A 1K0DA 3EMPA 1ZCPA 5G31A 4MZBA 3M0FA 4DSQA 1E6BA 4G10A 3PR8A 1O6JA 2MBSA 4TR0A 4OWYA 4ZXGA 5KN2A 2H30A 5H5RA 4I2TA 1TOFA 1SYXA 4V1Ag 2FWHA 1Z9HA 4TXOB 1MDKA 2CT6A 3W6GA 3Q6OA 2N5FA 3FZ5A 3P8WA 2H1DA 4LA1A 2R5GA 2VO4A 4XIHA 4BVYA 5DQYA 2FA8A 2O89A 3GURA 1PD21 2LNSA 2L4QA 3KIJA 1K3LA 1QXHA 1FG4A 1ST9A 4JU5A 4MH3A 2OA7A 4TXOA 1ACVA 4HJMA 2I4AA 3ZL5A 2N5AA 2D2ZA 3HXSA 3N9JA 1PL1A 1EOGA 3QMXA 1ILOA 3K8NA 3NIVA 3H8QA 1YKCA 5CRWA 2EIRA 17GSA 2H6ZA 5ID2B 2C4JA 4FIWA 4PNFA 2Z9SA 5ECQB 4TRXA 2VL3A 4JE1A 1EGRA 1V98A 3H4KA 4GQFA 3LXZA 1ON4A 5IOXA 2JZRA 1F3BA 4P3YB 2H1BA 8GSSA 2RIIA 1R26A 5D96A 2GSSA 4O5RA 5ID2A 4JZQA 1WIKA 4EDZA 2J23A 3MSZA 4IQAA 1A0RP 2REMA 4BWQA 4MJCA 5HQPA 3FKFA 3SWLA 4I5QA 3ZZXA 2H0IA 5ECMB 4ZILA 3HZ4A 4MPFA 4IQ1A 4KA0A 1SU9A 4O32A 2J9HA 3VLNA 4KDYA 2H1GA 3TOTA 22GSA 4K8MA 1Z7RA 5G30A 4GCIA 5EPFA 1UN2A 5C00A 2JSYA 2LRNA 2C8UA 2YZUA 1U3IA 2FA4A 2YZHA 5ECRB 3ERGA 3M1GA 5J9CA 1JZRA 2LTKA 1YEPA 2CV4A 1FAAA 3CRTA 4JRRA 4RQRA 2AV4A 2CZ3A 5G5FA 2WS2A 3CYNA 2PUKC 2VD0A 3GX0A 1GNEA 3GNJA 4GF0A 3H93A 4NWYA 2LNTA 3DVXA 1KBNA 2YWNA 1F3AA 2GT5A 3FYGA 1WP0A 3FR6A 5JWRB 4Q5RA 1A23A 2V6KA 1QK8A 1EOHA 1TRUA 4MLYA 2C3NA 2DIYA 2HLSA 1JLVA 1KEBA 3I6AA 1EWXA 4BL7A 2F51A 2DIZA 3NOFA 5IMCA 5J4UA 5ECOB 1DSBA 3APOA 1R5PA 3VPQA 3HVXA 2P5RA 2PGTA 4KDUA 4DVCA 4LL4B 3WGDA 1B9XC 1UC7A 2DJ1A 2VCZA 3MNGA 3GRXA 1XWBA 1V2AA 5GZZB 5CRHA 4HUAA 11GSA 1K3OA 1O8WA 1GH2A 4ID0A 3KMNA 3VWUA 5AISA 3L4NA 1AQWA 4JR4A 4L0UA 1V40A 4Z7XA 2C0FA 4FYBA 3ISOA 3GKXA 5D8IA 2IMKA 3HJMA 2YJ7A 2GQLA 3F4SA 2ES7A 1OC8A 1JZWA 3FR3A 2IPAA 1PX7A 3I43A 1T7PB 4G2EA 2YWMA 3VI7A 4YAPA 2C80A 2GT6A 3RPNA 4PGTA 3TKSC 5DQSA 4OD7A 3P7XA 2WZ9A 4YQVA 1X9MB 2XPDA 4BVXA 1GUMA 4ZL8A 3VI5A 1EEJA 3W8JA 1VF4A 3D22A 4V2MA 2B6MA 3QAGA 3GUSA 2TIRA 3WGXA 3FEUA 3W8SA 1Y25A 1Z5YE 5J5NA 2VLVA 1GL8A 4HDEA 2H70A 2PERA 4RI6A 3GKNA 2B7JA 3IRAA 3O6TA 3PH9A 5HFGA 2VL2A 4MJEA 4KB3A 5A4VA 4KAEA 3F9UA 1H4OA 2F9SA 3TKSA 1M2DA 2R4VA 3VWWA 5CNWA 2O85A 1FVKA 2ON7A 4K6XA 4J2FA 2HZEB 3E9JB 3EYTA 1OC3A 2I3YA 1PA3A 1RW1A 1F2EA 3KMOA 2E0QA 3GKKA 4POMA 4EE0A 1XIYA 14GSA 1PKWA 1XOBA 4AJ6A 2HZEA 2VAFA 1XVWA 2YN1A 1U87A 1VF2A 4WBJA 3TJBA 3H1NA 2A2SA 2EC4A 3G7YA 3ZYWA 4MJAA 4GWRA 1URMA 3GMFA 2B3SA 3D5JA 3J7Yk 4HZ4A 4KE3A 3F0IA 4AGSA 2DJ2A 5CYYA 3CXGA 2LRCA 1GTAA 3G7JA 1NSWA 2GSRA 1OYJA 3MDKA 2WDUA 2MZCA 4MZCA 2VOCA 4PXOA 2IJYA 2IWTA 1QFNA 2G2QA 5DBQA 3ZMKA 4TOPA 1DBYA 2K9FA 4HU9A 3C8EA 3HD5A 3TKSE 1XW9A 5B8BA 3BCKA 1MDJA 1A2MA 2JZTA 4MK3A 2YANA 1H75A 3FZ4A 2DLXA 3V1WA 5IPHA 1AC1A 4POKA 5F06A 2DMMA 4POBA 2L5OA 3VWXA 1ERWA 2V2GA 2RM5A 3APQA 2R3XA 4NPBA 2B5EA 4GSSA 1G0TA 5IMAA 2YPMA 1EV4A 2VLUA 1WPIA 4ML1A 3ZREA 2LSTA 1X5EA 1LJRA 3US3A 3LJRA 3RPPA 2C3TA 5B8AA 3H79A 2R6KA 4I2UA 1MD4A 2R2JA 1SD9A 2GZYA 3ERWA 4GSTA 3HKRA 3IBHA 5ECNB 2VCTA 2C0GA 2DJKA 2HYXA 1B8XA 2NDOA 6GSUA 4K2DA 3WYWA 3KEBA 3IA1A 3VURA 1MD3A 3P2AA 2HRFA 1GSSA 1K0CA 1GSUA 2M46A 4YQUA 1IYHA 2VD1A 5IM9A 12GSA 1BAYA 5FHIA 3VFIA 1CQHA 4NHZA 3LFLA 2LUSA 4PQHA 4EXJA 5IOWA 1GWCA 1S3DA 1EP8A 1YF1A 3HDCA 4IW9A 1T8EB 1M2BA 3L0HA 1SKWB 2KHPA 2O87A 1TXXA 1TRWA 4F0BA 3TRPA 5ECKB 1SL0B 1O7UA 2L4CA 2MMOA 2LQQA 2E2GA 2H71A 5IQYA 1SKSB 5KEJA 5JWQB 5ECSA 5G2ZA 5GSTA 1FVJA 1BQ7A 3GFKA 2QC7A 2RUFA 3WGEA 3CSHA 4NHWA 2NVLA 1HQOA 1J08A 1E2YA 1WJKA 1B9YC 2IIYA 4MF6A 2N5BA 4RI7A 4IKHA 1GSEA 20GSA 4IELA 5DVBA 2GS3A 3HZ8A 4OCEA 4PQ1A 3IHQA 3VK9A 1PKZA 2VCVA 2OJLA 2LJAA 4ZL7A 13GSA 2PU9C 3RHCA 5L71A 2FGXA 5G5EA 2V32A 2L57A 4KUNA 1ZYEA 2B1KA 2QSIA 3GSTA 3EE2A 4GQCA 3KCMA 4WF5A 2C0DA 4HEA2 4AJ8A 1YJ6A 1ZMAA 5ABRA 1QGVA 3QAWA 3QPMA 3C73A 1JFUA 1QUWA 3KP8A 3LGCA 4X0XA 1DUGA 1WRYA 1PGTA 2TRCP 4NV2A 6GSSA 1A24A 3IXRA 1XXUA 1WWJA 3IE3A 2VCXA 1X9WB 3ZITA 2CQ9A 4E8HA 2FY6A 3C7MA 2K6VA 4GRFA 1CQGA 4POLA 4OO5A 2E2MA 3FW2A 3UARA 4ZBBA 2MBTA 1Z6NA 3MWHA 4NV5A 2CX4A 2DJ0A 3DVWA 2HFDA 3GH6A 2H19A 3IAS2 3LWAA 5IMFA 1PX6A 3IDVA 4HI7A 1VRSD 1FB6A 2ALBA 2LQOA 1TK0B 4K0GA 1PRXA 2CAQA 5D9TA 5B7CA 1TKDB 3C71A 4X1UA 2X64A 3GYKA 2AAWA 3GTUB 1T4YA 4Q5FA 1VF3A 1HD2A 2C1YA 4FO5A 3BCIA 2L59A 1B4QA 1U3AA 2OBKA 2F8AA 4N10A 2H8LA 1X5DA 3GTUA 5E59A 1GNWA 3TOUA 4N0ZA 1C72A 5LD0A 3UBKA 1AQXA 4TN8A 3IV4A 3WT2A 4LL1B 4PUAA 4IVFA 1ML6A 5ECPB 2OE1A 1ERUA 2DC5A 2B7KA 5D93A 4O7HA 1O81A 5A4WA 4V1Ap 4WEYA 2FUG2 2WULA 5GAND 3DYRA 2GZZA 5HR2A 2K8VA 3ZFLA 1ZYQB 1SJIA 5B6NA 5COHA 1BG5A 7GSSA 2LJRA 1T1VA 3HJPA 1YZXA 1M9AA 3O76A 6GSXA 4WXTA 5CRDA 2OACA 1X5CA 2IN3A 1A2LA 2K18A 4XCSA 2HT9A 1M99A 4XRAA 2DSAA 5F05A 1OAZA 5A5KA 2FNOA 2KLXA 4ZB8A 4K1FA 3UAPA 3UIWA 4YAVA 4G9HA 3TCOA 4E8EA 1F6MC 3TJFA 1XFLA 2VCQA 2I1UA 2C0EA 1ZL9A 2VL2C 3GH9A 1TW9A 4AF2A 1SK0A 5ECHB 4KCEA 3VWVA 3TKPA 2JZSA 3EURA 3UL3A 1KNGA 1TJDA 1U6TA 2HXKA 3FK8A 19GSA 4ZB9A 4F03A 2P5QA 4DSSB 2H0GA 2JADA 4Q5NA 1EV9A 10GSA 3E0UA 1TU7A 3KH9A 4GSNA 4IJIA 1GUHA 3RAZA 1SD8A 4KH7A 3FRCA 2AB6A 4F82A 3DKSA 3KH7A 4DSSA 3UOMA 4ULXA 4EKZA 2F8FA 1ZGNA 2LKUA 1M7TA 4KSOA 4H86A 2GDRA 1OE7A 1TI3A 2GZPA 3IK9A 2YNXA 2P31A 3EU4A 1HNBA 1QQ2A 3D21A 5DCGA 2KP2A 4GLTA 5LNKe 1NHOA 2H72A 4NAXA 4K7OA 3KTLA 1V57A 4KNDA 1GULA 5IO0A 4JEDA 1SENA 4MH2A 3TRQA 4ZBAA 2CAIA 3C1RA 4FH8A 5H5QA 1FW1A 2XBIA 5KN1A 3Q18A 5D73A 1BX9A 5DJMA 3LYPA 1SL1B 2O7KA 1ZOFA 3OR5A 4L8EA 3TB2A 2I9HA 4I97A 4CDOA 2WJUA 3CSJA 5F8BA 1FB0A 2VL9A 2H74A 2H73A 1MDIA 4KCAA 2IMEA 2LEGA 2KOKA 1FOVA 3LEFA 3KM6A 2K8SA 1SYRA 3EWLA 4IP6A 9GSSA 4DSRA 2YV9A 2F3MA 1XCCA 1GTUA 2E7PA 2IMDA 5A4UA 4EL1A 4ILFA 1O8XA 2C3QA 3M9JA 3QD9A 4K7NA 3TKQA 4ECCA 1X9SB 2GLRA 1R4WA 3HCZA 2V1MA 2YWIA 4HU7A 2OE0A 2ON5A 1JHBA 3M9KA 4OFNA 3TGZA 4J56E 3JCML 3GL3A 4ECBA 1TI1A 1EEMA 4X43A 5CP1A 1NM3A 4V2LA 3LYKA 4XS1A 2DJJA 1T00A 2B5YA 1THOA 3HYPA 4F2IA 3ERFA 3RDWA 1NW2A 3DRNA 5LCZA 4LMWA 1X0RA 1XW6A 1Y6EA 2CX3A 3VPTA 1OKTA 5DCHA 3QFBC 1BYEA 5JCGA 5ECLB 4NMUA 1XWAA 3FY7A 5CO3A 1TK8B 3A2VA 1I5GA 1UVZA 3F63A 2X8GA 4WBRD 1EP7A 2TRXA 1G6WA 4HS1A 5FT3A 2FWEA 5C04A 3GX8A 3DD3A 3DWVA 2YCDA 1QMVA 5EVOA 4LLRA 2MYGA 4MPGA 4AJ7A 5AIVA 3MAKA 1TRVA 2MMAA 3GIXA 4QL7A 2M80A 4ZBDA 2H6XA 2IMIA 1F9MA 1AQVA 4TVEA 4ZB6A 3P90A 4N11A 1XWGA 2VM2A 3SBCA 2LJKA 4KW6A 2VUPA 1T3BA 2JSZA 3LG6A 1G7EA 5J9BA 1LU4A 1KTEA 4HQZA 5IMZA 2PN8A 3QCPA 4O92A 2IMFA 2FWGA 3IK7A 1OVNA 2L6CA 1EGOA 4F0CA 2LS5A 5EL8A 2X8CA 1XVQA 2H1AA 1K3YA 4ZL9A 5HFIA 2AUVA 4ECJA 6GSVA 2ZCTA 1MEKA 3BBYA 3GL5A 5DAKB 1JZOA 4EUYA 3L9VA 4F9ZA 2H76A 3L9SA 2VM1A 2B5XA 3L9UA 2A4VA 2V6OA 3RBTA 1ERTA 1O73A 4K7IA 2CVKA 2WB9A 1ABAA 1SKRB 2JU5A 1TP9A 4TR1B 5DAKA 5J41A 4MF7A 5F0GA 1UA5A 3QR6A 4ML6A 4N30A 5D9XA 3G9BA 5DALB 3ZFBA 5B6MA 4EO3A 1K0OA 5JWOB 3PGTA 2GSQA 5HR0A 4QQ7A 2GSTA 3UMAA 1HNCA 4PX1A 3ED3A 2MMNA 4OMVA 4TR1A 3ZVJD 1SJ6A 5INYA 2RM6A 2I81A 5HFKA 5DALA 3EMXA 5DDLA 1M2AA 3CTFA 1PL2A 2BTOT 2AJQB 2HNLA 4KGIA 3F6DA 1YY7A 3D0ZA 3G7IA 5AN1A 4HOJA 3J7Yb 2VIMA 4Q5QA 2QKEA 3C1SA 2WFCA 4GTUA 4TXVA 1PQNA 3N5OA 4K9ZA 1GP1A 2GVPA 1EZKA 1M9BA 3R2QA 6GSWA 5J3RA 1GTBA 3GA4A 3QAVA 4MZWA 4N0VA 1YEXA 4MMMA 4MCUA 1JLWA 1FO5A 5AIXA 2FWFA 3CTGA 5E4WA 5GSSA 2BJXA 3BOAA 4QL9A 3CSIA 2YJHA 1U88A 3HJOA 1GLPA 3UVTA 2H01A 2QGVA 2NBSA 4LMVA 5G1LA 5JCUA 3TDGA 3F4TA 2RUEA 1SL2B 1K0BA 2DMLA 4EC0A 1OC9B 3GKMA 4GXZA 1GSDA 1XWKA 2AYTA 3M8NA 5IO2A 3HY2A 4WF4A 1N8JA 1ERVA 1G7OA 2GGTA 1G6YA 3BJ5A 1XBSA 1BJXA 3F3RA 4KX4A 2PPTA 2XPEA 2LRTA 5D9WA 3QOUA 4ZIJA 1YKAA 3ZMLA 5JCWA 1OC9A 3D4MA 4TR3A 1DE2A 1M0UA 1BEDA 3Q19A 3GN3A 4TR4A 2WRTA 4FYCA 1NHYA 1A8LA 3KZQA 2B1LA 5DJLA 1I9DA 1V9WA 3LORA 5IMVA 2KUCA 3DIEA 3GHAA 3I9V2 3CRUA 1A0FA
chains in the Genus database with same CATH superfamily
3DEXA 1YF0A 1SJZA 1WMJA 5ENUA 5G1KA 4KDXA 1R5AA 1B4PA 1AIUA 1W4VA 4D73B 4JBBA 4MABA 3BD2A 1A2JA 2JACA 3EVIA 1PSQA 4KSMA 3A3TA 1LBKA 1T4ZA 4G0IA 2GTUA 2EIQA 4XRDA 3GV1A 3HVVA 2LV3A 4OCFA 1TDIA 3CMIA 4IN0A 3TJGA 4CHSA 5IPGA 1RK4A 4D73A 4TW5A 4EF0A 2X8HA 3DGQA 1J0FA 4MJBA 1Z3EA 1Z7PA 3F4RA 2JL4A 2H0HA 1AW9A 4ISDA 3ME8A 3ZVJA 5KN3A 2V41A 2NPBA 3IC4A 3Q74A 1PN9A 3U6VA 3TUEA 4BWSA 1DE1A 3IAM2 4DEJA 3HVSA 4BVXB 4OFTA 2H75A 1HNAA 1XPVA 2XBQA 2VCWA 2X4AA 2HRNA 1THXA 4K0NA 1JZDA 2P0GA 4MP4A 4IP1A 1RQMA 1PMTA 4XS4B 3NZNA 1WE0A 18GSA 3APSA 5IIZA 4G19A 2HZFA 1FHEA 4V2NA 3ZLPA 4MA9A 3LQ7A 1V58A 2M72A 3ME7A 3ZTLA 3AY8A 1Q4JA 1K0NA 3HA9A 2CZ2A 4HQSA 3FZAA 2HSYA 3HHVA 3O3TA 1XWCA 2CVDA 1GRXA 1GSFA 2CVBA 3KXOA 4XS4A 1GTIA 4IS0A 1B48A 3E3EA 4K2XA 2FHEA 3HVNA 4WR4A 3FHKA 16GSA 2QA1A 2H6YA 3TJJA 2WGRA 2YP6A 4IJ3A 2VLTA 2HSHA 2BMXA 3ZIJA 4IHUA 1GUKA 2GQMA 5D9VA 1K0AA 3ZIVA 4ACSA 1TRSA 2R37A 3A5WA 4YH2A 1AUCA 3KTBA 2IFQB 4Z2UA 3RHBA 5ELAA 3ZRDA 2ZNMA 4WR5A 4PNGA 1GSYA 1TTZA 2WCIA 3LSZA 2EIOA 3I69A 2GQKA 4NXIA 3IR4A 3DMLA 3FR9A 3QDNA 1YQ1A 4FYUA 3TRXA 1AXDA 1K0MA 4EIQA 3A2XA 3UVHA 4L5LA 2IFQA 3EINA 1WOUA 4EDYA 3KJYA 1YDKA 1TU8A 3LXTA 2OADA 2FCHA 2L5LA 1TK5B 1J9BA 1VF1A 1S3AA 2DJ3A 3EC3A 2YV7A 1GLQA 2H66A 1XOAA 2YWOA 3TKRA 3IOSA 5H5SA 3GSSA 2G0FA 4BA7A 5AGYA 4WKWA 2PVOC 1ZZYA 3S9FA 3D6IA 1Q98A 3FZ9A 2NTOA 4L5OA 4J57E 3IPZA 2KP1A 4XHMA 4IGJA 4TKYA 5GAPD 4RUVA 5HR1A 4O5UA 5CREA 2RLIA 4L0WA 2OBIA 4YQMA 3DXBA 1N2AA 4PUFC 3KP9A 3QFAC 2AHEA 2CA8A 4ECIA 2L6DA 6GSTA 2PMTA 4MF5A 1AAZA 2XHFA 1SK2A 2XC2A 5IMDA 2HI7A 4XS6A 5CAXA 4OO4A 4Z2RA 2IL3A 1IYIA 1GSQA 1O85A 3WT1A 2FLSA 5KN0A 4HZ2A 4IBPA 1W89A 4WETA 4XTSA 2A2RA 3F3QA 5ECIB 5ELGA 2FD3A 1USBA 3F6FA 5CRGA 1FOHA 3UBLA 5F07A 3CBUA 3WD6A 1F37A 1S3CA 3PINA 1XZOA 1SK1A 2OKAA 2OE3A 2HRKA 3U5RE 5FWGA 4MDCA 1A8YA 3EU3A 2PBJA 3KD0A 4CW9A 3KGKA 1OKDA 4I6XA 1OE8A 4OFMA 4PQIA 1S3RA 2X99A 4JR6A 4RQXA 3UEMA 3M3MA 4I8BA 1HYUA 2YOIA 2PWJA 2PVQA 3A2WA 5HR3A 1Z6MA 4BPYA 3D4TA 3UJ1A 6GSYA 1MTCA 2O8VB 2DBCA 3F8UA 4EVMA 2HE3A 3L78A 4PURA 2ZUPA 1XW5A 4HJ2A 1VGLA 1R7HA 3TJKA 2MMZA 5EY6A 1K0DA 3EMPA 1ZCPA 5G31A 4MZBA 3M0FA 4DSQA 1E6BA 4G10A 3PR8A 1O6JA 2MBSA 4TR0A 4OWYA 4ZXGA 4BVYB 5KN2A 2H30A 5H5RA 4I2TA 1TOFA 1SYXA 4V1Ag 2FWHA 1Z9HA 4TXOB 1MDKA 2CT6A 3W6GA 3Q6OA 2N5FA 3FZ5A 3P8WA 2H1DA 4LA1A 2R5GA 2VO4A 4XIHA 4BVYA 5DQYA 2FA8A 2O89A 3GURA 1PD21 2LNSA 2L4QA 3KIJA 3MIXA 1K3LA 1QXHA 1FG4A 1ST9A 4JU5A 4MH3A 2OA7A 4TXOA 1ACVA 4HJMA 2I4AA 3ZL5A 2N5AA 2D2ZA 3HXSA 3N9JA 1PL1A 1EOGA 3QMXA 1ILOA 3K8NA 3NIVA 3H8QA 1YKCA 5CRWA 2EIRA 17GSA 2H6ZA 5ID2B 2C4JA 4FIWA 4PNFA 2Z9SA 5ECQB 4HSCX 4TRXA 2VL3A 4JE1A 1EGRA 1V98A 3H4KA 4GQFA 3LXZA 1ON4A 5IOXA 2JZRA 1F3BA 4P3YB 2H1BA 8GSSA 2RIIA 1R26A 5D96A 2GSSA 4O5RA 5ID2A 4JZQA 1WIKA 4EDZA 2J23A 3MSZA 3MYDA 4IQAA 1A0RP 2REMA 4BWQA 4MJCA 5HQPA 3FKFA 4G0LA 3SWLA 4I5QA 3ZZXA 2H0IA 5ECMB 4ZILA 3HZ4A 4MPFA 4IQ1A 4KA0A 1SU9A 4O32A 2J9HA 3VLNA 4KDYA 2H1GA 3TOTA 22GSA 4K8MA 1Z7RA 5G30A 4GCIA 5EPFA 1UN2A 5C00A 2JSYA 2LRNA 2C8UA 2YZUA 1U3IA 2FA4A 2YZHA 5ECRB 4BIKA 3ERGA 3M1GA 5J9CA 1JZRA 2LTKA 1YEPA 2CV4A 1FAAA 3CRTA 4JRRA 4RQRA 2AV4A 2CZ3A 5G5FA 2WS2A 3CYNA 2PUKC 2VD0A 3GX0A 1GNEA 3GNJA 4GF0A 2X49A 3H93A 4NWYA 2LNTA 3DVXA 1KBNA 4BL7B 2YWNA 1F3AA 2GT5A 3FYGA 1WP0A 3FR6A 5JWRB 4Q5RA 1A23A 2V6KA 1QK8A 1EOHA 1TRUA 4MLYA 2C3NA 3A5IA 2DIYA 2HLSA 1JLVA 1KEBA 4FQUA 3I6AA 1EWXA 4BL7A 2F51A 2DIZA 3NOFA 5IMCA 5J4UA 5ECOB 1DSBA 3APOA 1R5PA 2A4HA 3VPQA 3HVXA 2P5RA 2PGTA 4KDUA 4DVCA 4LL4B 3WGDA 1B9XC 1UC7A 2DJ1A 2VCZA 3MNGA 3GRXA 1XWBA 1V2AA 5GZZB 4Z2TA 5CRHA 4HUAA 11GSA 1K3OA 1O8WA 1GH2A 4ID0A 3KMNA 3VWUA 5AISA 3L4NA 1AQWA 4JR4A 4L0UA 1V40A 4Z7XA 2C0FA 4FYBA 3ISOA 3GKXA 5D8IA 2IMKA 3HJMA 2YJ7A 2GQLA 3F4SA 2ES7A 1OC8A 1JZWA 3FR3A 2IPAA 1PX7A 3I43A 1T7PB 4G2EA 2YWMA 3VI7A 4YAPA 1PN0A 2C80A 2GT6A 4CY8A 3RPNA 4PGTA 4X4JA 3TKSC 5DQSA 4OD7A 3P7XA 2WZ9A 4YQVA 1X9MB 2XPDA 4BVXA 1GUMA 4ZL8A 3VI5A 1EEJA 3W8JA 1VF4A 3D22A 4V2MA 2B6MA 3QAGA 3GUSA 2TIRA 3WGXA 3FEUA 3W8SA 1Y25A 1Z5YE 5J5NA 2VLVA 1GL8A 4HDEA 4A5PA 2H70A 2PERA 4RI6A 3GKNA 2B7JA 3IRAA 3O6TA 3PH9A 5HFGA 2VL2A 4MJEA 4K5RA 4KB3A 5A4VA 4KAEA 3F9UA 1H4OA 2F9SA 3TKSA 1M2DA 2HSMA 2R4VA 3VWWA 5CNWA 2O85A 1FVKA 2ON7A 4K6XA 4J2FA 2HZEB 3E9JB 3EYTA 1OC3A 2I3YA 1PA3A 1RW1A 1F2EA 3KMOA 2E0QA 3GKKA 4POMA 4EE0A 1XIYA 14GSA 1PKWA 1XOBA 4AJ6A 2HZEA 2VAFA 1XVWA 2YN1A 1U87A 1VF2A 4WBJA 3TJBA 2R0CA 3H1NA 2A2SA 2EC4A 3G7YA 3ZYWA 4MJAA 4GWRA 1URMA 3GMFA 2B3SA 3D5JA 3J7Yk 1PFOA 4HZ4A 4KE3A 3F0IA 4AGSA 2DJ2A 5CYYA 3CXGA 2LRCA 1GTAA 3G7JA 1NSWA 2GSRA 1OYJA 3MDKA 2WDUA 2MZCA 4MZCA 2VOCA 4PXOA 2IJYA 2IWTA 4MNNA 1QFNA 2G2QA 5DBQA 3ZMKA 4TOPA 1DBYA 2K9FA 4HU9A 3C8EA 3HD5A 3TKSE 1XW9A 5B8BA 3BCKA 1MDJA 1A2MA 2JZTA 4MK3A 2YANA 1H75A 3FZ4A 2DLXA 3V1WA 5IPHA 1AC1A 4POKA 5F06A 2DMMA 4POBA 2R0GA 2L5OA 3VWXA 1ERWA 2V2GA 2RM5A 3APQA 2R3XA 4NPBA 2B5EA 4GSSA 1G0TA 5IMAA 2YPMA 5KOXA 1EV4A 2VLUA 1WPIA 4ML1A 3ZREA 2LSTA 1X5EA 1LJRA 3US3A 3LJRA 3RPPA 2C3TA 5B8AA 3H79A 2R6KA 4I2UA 1MD4A 2R2JA 1SD9A 2GZYA 3ERWA 4GSTA 3HKRA 3IBHA 5ECNB 2VCTA 2C0GA 2DJKA 2HYXA 1B8XA 2NDOA 6GSUA 4K2DA 3WYWA 3KEBA 3IA1A 3VURA 1MD3A 3P2AA 2HRFA 1GSSA 1K0CA 1GSUA 2M46A 4YQUA 1IYHA 2VD1A 5IM9A 12GSA 1BAYA 5FHIA 3VFIA 1CQHA 4NHZA 3LFLA 2LUSA 4PQHA 4EXJA 5IOWA 1GWCA 1S3DA 1EP8A 1YF1A 3HDCA 4IW9A 1T8EB 1M2BA 3L0HA 1SKWB 2KHPA 2O87A 1TXXA 1TRWA 4F0BA 3TRPA 5ECKB 1SL0B 1O7UA 2L4CA 2MMOA 2LQQA 2E2GA 2H71A 5IQYA 1SKSB 5KEJA 5JWQB 5ECSA 5G2ZA 5GSTA 1FVJA 1BQ7A 3GFKA 2QC7A 2RUFA 3WGEA 3CSHA 4NHWA 2NVLA 1HQOA 1J08A 1E2YA 1WJKA 1B9YC 2IIYA 4MF6A 2N5BA 4RI7A 4IKHA 1GSEA 20GSA 3LW9A 4IELA 2GS3A 4YKFA 5DVBA 3HZ8A 4OCEA 4PQ1A 3IHQA 3R3EA 3VK9A 1PKZA 2VCVA 2OJLA 2LJAA 4ZL7A 13GSA 2PU9C 3RHCA 5L71A 2FGXA 5G5EA 2V32A 2L57A 4KUNA 1ZYEA 2B1KA 2QSIA 3GSTA 4O5QA 3EE2A 4GQCA 3KCMA 4WF5A 2C0DA 4HEA2 4AJ8A 1YJ6A 1ZMAA 5ABRA 1QGVA 3QAWA 3QPMA 3C73A 1JFUA 1QUWA 3KP8A 3LGCA 4X0XA 3IC8A 1DUGA 1WRYA 1PGTA 2TRCP 4NV2A 6GSSA 1A24A 3IXRA 1XXUA 1WWJA 3IE3A 2VCXA 1X9WB 3ZITA 2CQ9A 4E8HA 2FY6A 3C7MA 2K6VA 4GRFA 1CQGA 4POLA 4OO5A 2E2MA 3FW2A 3UARA 4ZBBA 2MBTA 1Z6NA 3MWHA 4NV5A 2CX4A 2DJ0A 3DVWA 2HFDA 3GH6A 2H19A 3IAS2 3LWAA 5IMFA 1PX6A 3IDVA 4HI7A 1VRSD 1FB6A 2ALBA 2LQOA 1TK0B 4K0GA 1PRXA 2CAQA 5D9TA 5B7CA 1TKDB 3C71A 4X1UA 2X64A 3GYKA 2AAWA 3GTUB 1T4YA 4Q5FA 1VF3A 1HD2A 2C1YA 4FO5A 3BCIA 2L59A 1B4QA 1U3AA 2OBKA 2F8AA 4N10A 2H8LA 4ICYA 1X5DA 3GTUA 5E59A 1GNWA 3TOUA 4N0ZA 1C72A 5LD0A 3UBKA 1AQXA 4TN8A 3IV4A 3WT2A 4LL1B 4PUAA 4IVFA 1ML6A 5ECPB 2OE1A 1ERUA 2DC5A 2B7KA 5D93A 4O7HA 1O81A 5A4WA 4V1Ap 4WEYA 2FUG2 2WULA 5GAND 3DYRA 2GZZA 5HR2A 2K8VA 4G0KA 3ZFLA 1ZYQB 1SJIA 5B6NA 5COHA 1M3JA 1BG5A 7GSSA 2LJRA 1T1VA 3HJPA 1YZXA 1M9AA 3O76A 6GSXA 4WXTA 5CRDA 2OACA 1X5CA 2IN3A 1XG8A 1A2LA 2K18A 4XCSA 2HT9A 1M99A 4XRAA 3FMWA 2DSAA 5F05A 1OAZA 5A5KA 2FNOA 2KLXA 4ZB8A 2UZ8A 4K1FA 3UAPA 3UIWA 4YAVA 4G9HA 3TCOA 4E8EA 1F6MC 2A2PA 3TJFA 1XFLA 2VCQA 2I1UA 2C0EA 1ZL9A 2VL2C 3GH9A 1TW9A 4AF2A 1SK0A 5ECHB 4KCEA 3VWVA 3TKPA 3EPTA 2JZSA 3EURA 3UL3A 1KNGA 5KOWA 1TJDA 1U6TA 2HXKA 3FK8A 19GSA 4ZB9A 4F03A 2P5QA 4DSSB 2H0GA 2JADA 4Q5NA 1EV9A 10GSA 3E0UA 1TU7A 3KH9A 4GSNA 4IJIA 1GUHA 3RAZA 1SD8A 4KH7A 3FRCA 2AB6A 4F82A 3DKSA 3KH7A 4DSSA 3UOMA 4ULXA 4EKZA 2F8FA 1ZGNA 2LKUA 1M7TA 4KSOA 4H86A 2GDRA 1OE7A 1TI3A 2GZPA 3IK9A 2YNXA 2P31A 3EU4A 1HNBA 1QQ2A 4CY6A 3D21A 5DCGA 2KP2A 4GLTA 5LNKe 1NHOA 2H72A 4NAXA 4K7OA 3KTLA 1V57A 4KNDA 1GULA 5IO0A 2QA2A 4JEDA 1SENA 4MH2A 3TRQA 4ZBAA 2CAIA 3C1RA 4FH8A 5H5QA 1FW1A 2XBIA 5KN1A 3Q18A 5D73A 4PTSA 1BX9A 5DJMA 3LYPA 1SL1B 2O7KA 1ZOFA 3OR5A 4L8EA 3TB2A 2I9HA 4I97A 4CDOA 2WJUA 3CSJA 5F8BA 1FB0A 2VL9A 2H74A 2H73A 1MDIA 4KCAA 2IMEA 2LEGA 2KOKA 1FOVA 3LEFA 3KM6A 2K8SA 1SYRA 3EWLA 4IP6A 9GSSA 4DSRA 2YV9A 2F3MA 1XCCA 1GTUA 2E7PA 2IMDA 5A4UA 4EL1A 4ILFA 1O8XA 2C3QA 3M9JA 3QD9A 4K7NA 4KF9A 3TKQA 4ECCA 1X9SB 2GLRA 1R4WA 3HCZA 2V1MA 2YWIA 4HU7A 2OE0A 2ON5A 1JHBA 3M9KA 4OFNA 3PPUA 3TGZA 4J56E 3JCML 3GL3A 4ECBA 1TI1A 1EEMA 4X43A 5CP1A 1NM3A 4V2LA 3LYKA 4XS1A 2DJJA 1T00A 2B5YA 1THOA 1ZYPA 3HYPA 4F2IA 3ERFA 3RDWA 1NW2A 3DRNA 5LCZA 4LMWA 1X0RA 1XW6A 1Y6EA 2CX3A 3VPTA 2HRAA 1OKTA 5DCHA 3QFBC 1BYEA 4USSA 5JCGA 5ECLB 4NMUA 1XWAA 3FY7A 5CO3A 1TK8B 3A2VA 1I5GA 1UVZA 3F63A 2X8GA 4WBRD 1EP7A 2TRXA 1G6WA 4HS1A 5FT3A 2DKHA 2FWEA 5C04A 3GX8A 3DD3A 3DWVA 2YCDA 1QMVA 5EVOA 4LLRA 2MYGA 4MPGA 4AJ7A 5AIVA 3MAKA 1TRVA 2MMAA 3GIXA 4QL7A 2M80A 4ZBDA 2H6XA 2IMIA 1F9MA 1AQVA 4TVEA 4ZB6A 3P90A 4N11A 1XWGA 2VM2A 3SBCA 2LJKA 4KW6A 2VUPA 1T3BA 2JSZA 3LG6A 1G7EA 5J9BA 1LU4A 1KTEA 4HQZA 5IMZA 2PN8A 3QCPA 4O92A 2IMFA 2FWGA 3IK7A 1OVNA 2L6CA 1EGOA 4F0CA 2LS5A 5EL8A 2X8CA 1XVQA 1M3IA 2H1AA 1K3YA 4ZL9A 5HFIA 2AUVA 4ECJA 6GSVA 2ZCTA 1MEKA 3BBYA 3GL5A 5DAKB 1JZOA 4EUYA 3L9VA 4F9ZA 2H76A 3L9SA 3CQFA 2VM1A 2B5XA 3L9UA 2A4VA 2V6OA 3RBTA 1ERTA 1O73A 4K7IA 2CVKA 2WB9A 1ABAA 1SKRB 2JU5A 1TP9A 4TR1B 5DAKA 5J41A 4MF7A 5F0GA 1UA5A 3QR6A 4ML6A 4N30A 5D9XA 3G9BA 5DALB 3ZFBA 5B6MA 4EO3A 1K0OA 5JWOB 3PGTA 2GSQA 5HR0A 4QQ7A 2GSTA 3UMAA 1HNCA 4PX1A 3ED3A 2MMNA 4OMVA 2DKIA 4TR1A 3ZVJD 1SJ6A 5INYA 2RM6A 2I81A 5HFKA 5DALA 3EMXA 5DDLA 1M2AA 3CTFA 1PL2A 2BTOT 2AJQB 2HNLA 4KGIA 3F6DA 1YY7A 3D0ZA 3G7IA 5AN1A 4HOJA 3J7Yb 2VIMA 4Q5QA 2QKEA 3C1SA 2WFCA 4GTUA 4TXVA 1PQNA 3N5OA 4K9ZA 1GP1A 2GVPA 1EZKA 1M9BA 3R2QA 6GSWA 5J3RA 1GTBA 3GA4A 3QAVA 4MZWA 4N0VA 1YEXA 4YKGA 4MMMA 4MCUA 1JLWA 1FO5A 5AIXA 2FWFA 3CTGA 5E4WA 5GSSA 2BJXA 3BOAA 4QL9A 3CSIA 2YJHA 5BMUA 1U88A 3HJOA 1GLPA 3UVTA 2H01A 2QGVA 2NBSA 4LMVA 5G1LA 5JCUA 3TDGA 3F4TA 2RUEA 1SL2B 1K0BA 1ZYNA 2DMLA 4EC0A 1OC9B 3GKMA 4GXZA 1GSDA 1XWKA 2AYTA 3M8NA 5IO2A 3HY2A 4WF4A 1N8JA 1ERVA 1G7OA 2GGTA 1G6YA 3BJ5A 1XBSA 1BJXA 3F3RA 4KX4A 2PPTA 2XPEA 2LRTA 3IHGA 5D9WA 3QOUA 4ZIJA 1YKAA 3ZMLA 5JCWA 1OC9A 3D4MA 4TR3A 5BRTA 1DE2A 1M0UA 2R0PA 1BEDA 3Q19A 3GN3A 4TR4A 2WRTA 4FYCA 1NHYA 1A8LA 3KZQA 4EIPA 2B1LA 5DJLA 1I9DA 1V9WA 3LORA 5IMVA 2KUCA 3DIEA 3GHAA 3I9V2 3CRUA 4K5SA 1A0FA
chains in the Genus database with same CATH topology
3DEXA 1YF0A 1SJZA 1WMJA 5ENUA 5G1KA 4KDXA 1R5AA 1B4PA 1AIUA 1W4VA 4D73B 4JBBA 4MABA 3BD2A 1A2JA 2JACA 3EVIA 1PSQA 4KSMA 3A3TA 1LBKA 1T4ZA 4G0IA 2GTUA 2EIQA 4XRDA 3GV1A 3HVVA 2LV3A 4OCFA 1TDIA 3CMIA 4IN0A 3TJGA 4CHSA 5IPGA 1RK4A 4D73A 4TW5A 4EF0A 2X8HA 3DGQA 1J0FA 4MJBA 1Z3EA 1Z7PA 3F4RA 2JL4A 2H0HA 1AW9A 4ISDA 3ME8A 3ZVJA 5KN3A 2V41A 2NPBA 3IC4A 3Q74A 1PN9A 3U6VA 3TUEA 4BWSA 1DE1A 3IAM2 4DEJA 3HVSA 4BVXB 4OFTA 2H75A 1HNAA 1XPVA 2XBQA 2VCWA 2X4AA 2HRNA 1THXA 4K0NA 1JZDA 2P0GA 4MP4A 4IP1A 1RQMA 1PMTA 4XS4B 3NZNA 1WE0A 18GSA 3APSA 5IIZA 4G19A 2HZFA 1FHEA 4V2NA 3ZLPA 4MA9A 3LQ7A 1V58A 2M72A 3ME7A 3ZTLA 3AY8A 1Q4JA 1K0NA 3HA9A 2CZ2A 4HQSA 3FZAA 2HSYA 3HHVA 3O3TA 1XWCA 2CVDA 1GRXA 1GSFA 2CVBA 3KXOA 4XS4A 1GTIA 4IS0A 1B48A 3E3EA 4K2XA 2FHEA 4WR4A 3FHKA 16GSA 2QA1A 2H6YA 3TJJA 2WGRA 2YP6A 4IJ3A 2VLTA 2HSHA 2BMXA 3ZIJA 4IHUA 1GUKA 2GQMA 5D9VA 1K0AA 3ZIVA 4ACSA 1TRSA 2R37A 3A5WA 4YH2A 1AUCA 3KTBA 2IFQB 4Z2UA 3RHBA 5ELAA 3ZRDA 2ZNMA 4WR5A 4PNGA 1GSYA 1TTZA 2WCIA 3LSZA 2EIOA 3I69A 2GQKA 4NXIA 3IR4A 3DMLA 3FR9A 3QDNA 1YQ1A 4FYUA 3TRXA 1AXDA 1K0MA 4EIQA 3A2XA 3UVHA 4L5LA 2IFQA 3EINA 1WOUA 4EDYA 3KJYA 1YDKA 1TU8A 3LXTA 2OADA 2FCHA 2L5LA 1TK5B 1J9BA 1VF1A 1S3AA 2DJ3A 3EC3A 2YV7A 1GLQA 2H66A 1XOAA 2YWOA 3TKRA 3IOSA 5H5SA 3GSSA 2G0FA 4BA7A 5AGYA 4WKWA 2PVOC 1ZZYA 3S9FA 3D6IA 1Q98A 3FZ9A 2NTOA 4L5OA 4J57E 3IPZA 2KP1A 4XHMA 4IGJA 4TKYA 5GAPD 4RUVA 5HR1A 4O5UA 5CREA 2RLIA 4L0WA 2OBIA 4YQMA 3DXBA 1N2AA 4PUFC 3KP9A 3QFAC 2AHEA 2CA8A 4ECIA 2L6DA 6GSTA 2PMTA 4MF5A 1AAZA 2XHFA 1SK2A 2XC2A 5IMDA 2HI7A 4XS6A 5CAXA 4OO4A 4Z2RA 2IL3A 1IYIA 1GSQA 1O85A 3WT1A 2FLSA 5KN0A 4HZ2A 4IBPA 1W89A 4WETA 4XTSA 2A2RA 3F3QA 5ECIB 5ELGA 2FD3A 1USBA 3F6FA 5CRGA 1FOHA 3UBLA 5F07A 3CBUA 3WD6A 1F37A 1S3CA 3PINA 1XZOA 1SK1A 2OKAA 2OE3A 2HRKA 3U5RE 5FWGA 4MDCA 1A8YA 3EU3A 2PBJA 3KD0A 4CW9A 3KGKA 1OKDA 4I6XA 1OE8A 4OFMA 4PQIA 2X99A 4JR6A 4RQXA 3UEMA 3M3MA 4I8BA 1HYUA 2YOIA 2PWJA 2PVQA 3A2WA 5HR3A 1Z6MA 4BPYA 3D4TA 3UJ1A 6GSYA 1MTCA 2O8VB 2DBCA 3F8UA 4EVMA 2HE3A 3L78A 4PURA 2ZUPA 1XW5A 4HJ2A 1VGLA 1R7HA 3TJKA 2MMZA 5EY6A 1K0DA 3EMPA 1ZCPA 5G31A 4MZBA 3M0FA 4DSQA 1E6BA 4G10A 3PR8A 1O6JA 2MBSA 4TR0A 4OWYA 4ZXGA 4BVYB 5KN2A 2H30A 5H5RA 4I2TA 1TOFA 1SYXA 4V1Ag 2FWHA 1Z9HA 4TXOB 1MDKA 2CT6A 3W6GA 3Q6OA 2N5FA 3FZ5A 3P8WA 2H1DA 4LA1A 2R5GA 2VO4A 4XIHA 4BVYA 5DQYA 2FA8A 2O89A 3GURA 1PD21 2LNSA 2L4QA 3KIJA 3MIXA 1K3LA 1QXHA 1FG4A 1ST9A 4JU5A 4MH3A 2OA7A 4TXOA 1ACVA 4HJMA 2I4AA 3ZL5A 2N5AA 2D2ZA 3HXSA 3N9JA 1PL1A 1EOGA 3QMXA 1ILOA 3K8NA 3NIVA 3H8QA 1YKCA 5CRWA 2EIRA 17GSA 2H6ZA 5ID2B 2C4JA 4FIWA 4PNFA 2Z9SA 5ECQB 4TRXA 2VL3A 4JE1A 1EGRA 1V98A 3H4KA 4GQFA 3LXZA 1ON4A 5IOXA 2JZRA 1F3BA 4P3YB 2H1BA 8GSSA 2RIIA 1R26A 5D96A 2GSSA 4O5RA 5ID2A 4JZQA 1WIKA 4EDZA 2J23A 3MSZA 3MYDA 4IQAA 1A0RP 2REMA 4BWQA 4MJCA 5HQPA 3FKFA 4G0LA 3SWLA 4I5QA 3ZZXA 2H0IA 5ECMB 4ZILA 3HZ4A 4MPFA 4IQ1A 4KA0A 1SU9A 4O32A 2J9HA 3VLNA 4KDYA 2H1GA 3TOTA 22GSA 4K8MA 1Z7RA 5G30A 4GCIA 5EPFA 1UN2A 5C00A 2JSYA 2LRNA 2C8UA 2YZUA 1U3IA 2FA4A 2YZHA 5ECRB 3ERGA 3M1GA 5J9CA 1JZRA 2LTKA 1YEPA 2CV4A 1FAAA 3CRTA 4JRRA 4RQRA 2AV4A 2CZ3A 5G5FA 2WS2A 3CYNA 2PUKC 2VD0A 3GX0A 1GNEA 3GNJA 4GF0A 2X49A 3H93A 4NWYA 2LNTA 3DVXA 1KBNA 4BL7B 2YWNA 1F3AA 2GT5A 3FYGA 1WP0A 3FR6A 5JWRB 4Q5RA 1A23A 2V6KA 1QK8A 1EOHA 1TRUA 4MLYA 2C3NA 3A5IA 2DIYA 2HLSA 1JLVA 1KEBA 4FQUA 3I6AA 1EWXA 4BL7A 2F51A 2DIZA 3NOFA 5IMCA 5J4UA 5ECOB 1DSBA 3APOA 1R5PA 2A4HA 3VPQA 3HVXA 2P5RA 2PGTA 4KDUA 4DVCA 4LL4B 3WGDA 1B9XC 1UC7A 2DJ1A 2VCZA 3MNGA 3GRXA 1XWBA 1V2AA 5GZZB 4Z2TA 5CRHA 4HUAA 11GSA 1K3OA 1O8WA 1GH2A 4ID0A 3KMNA 3VWUA 5AISA 3L4NA 1AQWA 4JR4A 4L0UA 1V40A 4Z7XA 2C0FA 4FYBA 3ISOA 3GKXA 5D8IA 2IMKA 3HJMA 2YJ7A 2GQLA 3F4SA 2ES7A 1OC8A 1JZWA 3FR3A 2IPAA 1PX7A 3I43A 1T7PB 4G2EA 2YWMA 3VI7A 4YAPA 1PN0A 2C80A 2GT6A 4CY8A 3RPNA 4PGTA 4X4JA 3TKSC 5DQSA 4OD7A 3P7XA 2WZ9A 4YQVA 1X9MB 2XPDA 4BVXA 1GUMA 4ZL8A 3VI5A 1EEJA 3W8JA 1VF4A 3D22A 4V2MA 2B6MA 3QAGA 3GUSA 2TIRA 3WGXA 3FEUA 3W8SA 1Y25A 1Z5YE 5J5NA 2VLVA 1GL8A 4HDEA 4A5PA 2H70A 2PERA 4RI6A 3GKNA 2B7JA 3IRAA 3O6TA 3PH9A 5HFGA 2VL2A 4MJEA 4K5RA 4KB3A 5A4VA 4KAEA 3F9UA 1H4OA 2F9SA 3TKSA 1M2DA 2HSMA 2R4VA 3VWWA 5CNWA 2O85A 1FVKA 2ON7A 4K6XA 4J2FA 2HZEB 3E9JB 3EYTA 1OC3A 2I3YA 1PA3A 1RW1A 1F2EA 3KMOA 2E0QA 3GKKA 4POMA 4EE0A 1XIYA 14GSA 1PKWA 1XOBA 4AJ6A 2HZEA 2VAFA 1XVWA 2YN1A 1U87A 1VF2A 4WBJA 3TJBA 2R0CA 3H1NA 2A2SA 2EC4A 3G7YA 3ZYWA 4MJAA 4GWRA 1URMA 3GMFA 2B3SA 3D5JA 3J7Yk 4HZ4A 4KE3A 3F0IA 4AGSA 2DJ2A 5CYYA 3CXGA 2LRCA 1GTAA 3G7JA 1NSWA 2GSRA 1OYJA 3MDKA 2WDUA 2MZCA 4MZCA 2VOCA 4PXOA 2IJYA 2IWTA 4MNNA 1QFNA 2G2QA 5DBQA 3ZMKA 4TOPA 1DBYA 2K9FA 4HU9A 3C8EA 3HD5A 3TKSE 1XW9A 5B8BA 3BCKA 1MDJA 1A2MA 2JZTA 4MK3A 2YANA 1H75A 3FZ4A 2DLXA 3V1WA 5IPHA 1AC1A 4POKA 5F06A 2DMMA 4POBA 2R0GA 2L5OA 3VWXA 1ERWA 2V2GA 2RM5A 3APQA 2R3XA 4NPBA 2B5EA 4GSSA 1G0TA 5IMAA 2YPMA 5KOXA 1EV4A 2VLUA 1WPIA 4ML1A 3ZREA 2LSTA 1X5EA 1LJRA 3US3A 3LJRA 3RPPA 2C3TA 5B8AA 3H79A 2R6KA 4I2UA 1MD4A 2R2JA 1SD9A 2GZYA 3ERWA 4GSTA 3HKRA 3IBHA 5ECNB 2VCTA 2C0GA 2DJKA 2HYXA 1B8XA 2NDOA 6GSUA 4K2DA 3WYWA 3KEBA 3IA1A 3VURA 1MD3A 3P2AA 2HRFA 1GSSA 1K0CA 1GSUA 2M46A 4YQUA 1IYHA 2VD1A 5IM9A 12GSA 1BAYA 5FHIA 3VFIA 1CQHA 4NHZA 3LFLA 2LUSA 4PQHA 4EXJA 5IOWA 1GWCA 1S3DA 1EP8A 1YF1A 3HDCA 4IW9A 1T8EB 1M2BA 3L0HA 1SKWB 2KHPA 2O87A 1TXXA 1TRWA 4F0BA 3TRPA 5ECKB 1SL0B 1O7UA 2L4CA 2MMOA 2LQQA 2E2GA 2H71A 5IQYA 1SKSB 5KEJA 5JWQB 5ECSA 5G2ZA 5GSTA 1FVJA 1BQ7A 3GFKA 2QC7A 2RUFA 3WGEA 3CSHA 4NHWA 2NVLA 1HQOA 1J08A 1E2YA 1WJKA 1B9YC 2IIYA 4MF6A 2N5BA 4RI7A 4IKHA 1GSEA 20GSA 3LW9A 4IELA 2GS3A 4YKFA 5DVBA 3HZ8A 4OCEA 4PQ1A 3IHQA 3R3EA 3VK9A 1PKZA 2VCVA 2OJLA 2LJAA 4ZL7A 13GSA 2PU9C 3RHCA 5L71A 2FGXA 5G5EA 2V32A 2L57A 4KUNA 1ZYEA 2B1KA 2QSIA 3GSTA 4O5QA 3EE2A 4GQCA 3KCMA 4WF5A 2C0DA 4HEA2 4AJ8A 1YJ6A 1ZMAA 5ABRA 1QGVA 3QAWA 3QPMA 3C73A 1JFUA 1QUWA 3KP8A 3LGCA 4X0XA 3IC8A 1DUGA 1WRYA 1PGTA 2TRCP 4NV2A 6GSSA 1A24A 3IXRA 1XXUA 1WWJA 3IE3A 2VCXA 1X9WB 3ZITA 2CQ9A 4E8HA 2FY6A 3C7MA 2K6VA 4GRFA 1CQGA 4POLA 4OO5A 2E2MA 3FW2A 3UARA 4ZBBA 2MBTA 1Z6NA 3MWHA 4NV5A 2CX4A 2DJ0A 3DVWA 2HFDA 3GH6A 2H19A 3IAS2 3LWAA 5IMFA 1PX6A 3IDVA 4HI7A 1VRSD 1FB6A 2ALBA 2LQOA 1TK0B 4K0GA 1PRXA 2CAQA 5D9TA 5B7CA 1TKDB 3C71A 4X1UA 2X64A 3GYKA 2AAWA 3GTUB 1T4YA 4Q5FA 1VF3A 1HD2A 2C1YA 4FO5A 3BCIA 2L59A 1B4QA 1U3AA 2OBKA 2F8AA 4N10A 2H8LA 4ICYA 1X5DA 3GTUA 5E59A 1GNWA 3TOUA 4N0ZA 1C72A 5LD0A 3UBKA 1AQXA 4TN8A 3IV4A 3WT2A 4LL1B 4PUAA 4IVFA 1ML6A 5ECPB 2OE1A 1ERUA 2DC5A 2B7KA 5D93A 4O7HA 1O81A 5A4WA 4V1Ap 4WEYA 2FUG2 2WULA 5GAND 3DYRA 2GZZA 5HR2A 2K8VA 4G0KA 3ZFLA 1ZYQB 1SJIA 5B6NA 5COHA 1BG5A 7GSSA 2LJRA 1T1VA 3HJPA 1YZXA 1M9AA 3O76A 6GSXA 4WXTA 5CRDA 2OACA 1X5CA 2IN3A 1A2LA 2K18A 4XCSA 2HT9A 1M99A 4XRAA 3FMWA 2DSAA 5F05A 1OAZA 5A5KA 2FNOA 2KLXA 4ZB8A 2UZ8A 4K1FA 3UAPA 3UIWA 4YAVA 4G9HA 3TCOA 4E8EA 1F6MC 2A2PA 3TJFA 1XFLA 2VCQA 2I1UA 2C0EA 1ZL9A 2VL2C 3GH9A 1TW9A 4AF2A 1SK0A 5ECHB 4KCEA 3VWVA 3TKPA 3EPTA 2JZSA 3EURA 3UL3A 1KNGA 5KOWA 1TJDA 1U6TA 2HXKA 3FK8A 19GSA 4ZB9A 4F03A 2P5QA 4DSSB 2H0GA 2JADA 4Q5NA 1EV9A 10GSA 3E0UA 1TU7A 3KH9A 4GSNA 4IJIA 1GUHA 3RAZA 1SD8A 4KH7A 3FRCA 2AB6A 4F82A 3DKSA 3KH7A 4DSSA 3UOMA 4ULXA 4EKZA 2F8FA 1ZGNA 2LKUA 1M7TA 4KSOA 4H86A 2GDRA 1OE7A 1TI3A 2GZPA 3IK9A 2YNXA 2P31A 3EU4A 1HNBA 1QQ2A 4CY6A 3D21A 5DCGA 2KP2A 4GLTA 5LNKe 1NHOA 2H72A 4NAXA 4K7OA 3KTLA 1V57A 4KNDA 1GULA 5IO0A 2QA2A 4JEDA 1SENA 4MH2A 3TRQA 4ZBAA 2CAIA 3C1RA 4FH8A 5H5QA 1FW1A 2XBIA 5KN1A 3Q18A 5D73A 4PTSA 1BX9A 5DJMA 3LYPA 1SL1B 2O7KA 1ZOFA 3OR5A 4L8EA 3TB2A 2I9HA 4I97A 4CDOA 2WJUA 3CSJA 5F8BA 1FB0A 2VL9A 2H74A 2H73A 1MDIA 4KCAA 2IMEA 2LEGA 2KOKA 1FOVA 3LEFA 3KM6A 2K8SA 1SYRA 3EWLA 4IP6A 9GSSA 4DSRA 2YV9A 2F3MA 1XCCA 1GTUA 2E7PA 2IMDA 5A4UA 4EL1A 4ILFA 1O8XA 2C3QA 3M9JA 3QD9A 4K7NA 4KF9A 3TKQA 4ECCA 1X9SB 2GLRA 1R4WA 3HCZA 2V1MA 2YWIA 4HU7A 2OE0A 2ON5A 1JHBA 3M9KA 4OFNA 3PPUA 3TGZA 4J56E 3JCML 3GL3A 4ECBA 1TI1A 1EEMA 4X43A 5CP1A 1NM3A 4V2LA 3LYKA 4XS1A 2DJJA 1T00A 2B5YA 1THOA 1ZYPA 3HYPA 4F2IA 3ERFA 3RDWA 1NW2A 3DRNA 5LCZA 4LMWA 1X0RA 1XW6A 1Y6EA 2CX3A 3VPTA 2HRAA 1OKTA 5DCHA 3QFBC 1BYEA 4USSA 5JCGA 5ECLB 4NMUA 1XWAA 3FY7A 5CO3A 1TK8B 3A2VA 1I5GA 1UVZA 3F63A 2X8GA 4WBRD 1EP7A 2TRXA 1G6WA 4HS1A 5FT3A 2DKHA 2FWEA 5C04A 3GX8A 3DD3A 3DWVA 2YCDA 1QMVA 5EVOA 4LLRA 2MYGA 4MPGA 4AJ7A 5AIVA 3MAKA 1TRVA 2MMAA 3GIXA 4QL7A 2M80A 4ZBDA 2H6XA 2IMIA 1F9MA 1AQVA 4TVEA 4ZB6A 3P90A 4N11A 1XWGA 2VM2A 3SBCA 2LJKA 4KW6A 2VUPA 1T3BA 2JSZA 3LG6A 1G7EA 5J9BA 1LU4A 1KTEA 4HQZA 5IMZA 2PN8A 3QCPA 4O92A 2IMFA 2FWGA 3IK7A 1OVNA 2L6CA 1EGOA 4F0CA 2LS5A 5EL8A 2X8CA 1XVQA 2H1AA 1K3YA 4ZL9A 5HFIA 2AUVA 4ECJA 6GSVA 2ZCTA 1MEKA 3BBYA 3GL5A 5DAKB 1JZOA 4EUYA 3L9VA 4F9ZA 2H76A 3L9SA 2VM1A 2B5XA 3L9UA 2A4VA 2V6OA 3RBTA 1ERTA 1O73A 4K7IA 2CVKA 2WB9A 1ABAA 1SKRB 2JU5A 1TP9A 4TR1B 5DAKA 5J41A 4MF7A 5F0GA 1UA5A 3QR6A 4ML6A 4N30A 5D9XA 3G9BA 5DALB 3ZFBA 5B6MA 4EO3A 1K0OA 5JWOB 3PGTA 2GSQA 5HR0A 4QQ7A 2GSTA 3UMAA 1HNCA 4PX1A 3ED3A 2MMNA 4OMVA 2DKIA 4TR1A 3ZVJD 1SJ6A 5INYA 2RM6A 2I81A 5HFKA 5DALA 3EMXA 5DDLA 1M2AA 3CTFA 1PL2A 2BTOT 2AJQB 2HNLA 4KGIA 3F6DA 1YY7A 3D0ZA 3G7IA 5AN1A 4HOJA 3J7Yb 2VIMA 4Q5QA 2QKEA 3C1SA 2WFCA 4GTUA 4TXVA 1PQNA 3N5OA 4K9ZA 1GP1A 2GVPA 1EZKA 1M9BA 3R2QA 6GSWA 5J3RA 1GTBA 3GA4A 3QAVA 4MZWA 4N0VA 1YEXA 4YKGA 4MMMA 4MCUA 1JLWA 1FO5A 5AIXA 2FWFA 3CTGA 5E4WA 5GSSA 2BJXA 3BOAA 4QL9A 3CSIA 2YJHA 5BMUA 1U88A 3HJOA 1GLPA 3UVTA 2H01A 2QGVA 2NBSA 4LMVA 5G1LA 5JCUA 3TDGA 3F4TA 2RUEA 1SL2B 1K0BA 1ZYNA 2DMLA 4EC0A 1OC9B 3GKMA 4GXZA 1GSDA 1XWKA 2AYTA 3M8NA 5IO2A 3HY2A 4WF4A 1N8JA 1ERVA 1G7OA 2GGTA 1G6YA 3BJ5A 1XBSA 1BJXA 3F3RA 4KX4A 2PPTA 2XPEA 2LRTA 3IHGA 5D9WA 3QOUA 4ZIJA 1YKAA 3ZMLA 5JCWA 1OC9A 3D4MA 4TR3A 5BRTA 1DE2A 1M0UA 2R0PA 1BEDA 3Q19A 3GN3A 4TR4A 2WRTA 4FYCA 1NHYA 1A8LA 3KZQA 4EIPA 2B1LA 5DJLA 1I9DA 1V9WA 3LORA 5IMVA 2KUCA 3DIEA 3GHAA 3I9V2 3CRUA 4K5SA 1A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEX A;  1YF0 A;  1SJZ A;  1WMJ A;  5ENU A;  5G1K A;  4KDX A;  1R5A A;  1B4P A;  1AIU A;  1W4V A;  4D73 B;  4JBB A;  4MAB A;  3BD2 A;  1A2J A;  2JAC A;  3EVI A;  1PSQ A;  4KSM A;  3A3T A;  1LBK A;  1T4Z A;  2GTU A;  2EIQ A;  4XRD A;  3GV1 A;  3HVV A;  2LV3 A;  4OCF A;  1TDI A;  3CMI A;  4IN0 A;  3TJG A;  4CHS A;  5IPG A;  1RK4 A;  4D73 A;  4TW5 A;  4EF0 A;  2X8H A;  3DGQ A;  1J0F A;  4MJB A;  1Z3E A;  1Z7P A;  3F4R A;  2JL4 A;  2H0H A;  1AW9 A;  4ISD A;  3ME8 A;  3ZVJ A;  5KN3 A;  2V41 A;  2NPB A;  3IC4 A;  3Q74 A;  1PN9 A;  3U6V A;  3TUE A;  4BWS A;  1DE1 A;  3IAM 2;  4DEJ A;  3HVS A;  4OFT A;  2H75 A;  1HNA A;  1XPV A;  2XBQ A;  2VCW A;  2HRN A;  1THX A;  4K0N A;  1JZD A;  2P0G A;  4MP4 A;  4IP1 A;  1RQM A;  1PMT A;  4XS4 B;  3NZN A;  1WE0 A;  18GS A;  3APS A;  5IIZ A;  4G19 A;  2HZF A;  1FHE A;  4V2N A;  3ZLP A;  4MA9 A;  3LQ7 A;  1V58 A;  2M72 A;  3ME7 A;  3ZTL A;  3AY8 A;  1Q4J A;  1K0N A;  3HA9 A;  2CZ2 A;  4HQS A;  3FZA A;  2HSY A;  3HHV A;  3O3T A;  1XWC A;  2CVD A;  1GRX A;  1GSF A;  2CVB A;  3KXO A;  4XS4 A;  1GTI A;  4IS0 A;  1B48 A;  3E3E A;  2FHE A;  4WR4 A;  3FHK A;  16GS A;  2H6Y A;  3TJJ A;  2WGR A;  2YP6 A;  4IJ3 A;  2VLT A;  2HSH A;  2BMX A;  3ZIJ A;  4IHU A;  1GUK A;  2GQM A;  5D9V A;  1K0A A;  3ZIV A;  4ACS A;  1TRS A;  2R37 A;  3A5W A;  4YH2 A;  1AUC A;  3KTB A;  2IFQ B;  3RHB A;  5ELA A;  3ZRD A;  2ZNM A;  4WR5 A;  4PNG A;  1GSY A;  1TTZ A;  2WCI A;  3LSZ A;  2EIO A;  3I69 A;  2GQK A;  4NXI A;  3IR4 A;  3DML A;  3FR9 A;  3QDN A;  1YQ1 A;  4FYU A;  3TRX A;  1AXD A;  1K0M A;  3A2X A;  3UVH A;  4L5L A;  2IFQ A;  3EIN A;  1WOU A;  4EDY A;  3KJY A;  1YDK A;  1TU8 A;  3LXT A;  2OAD A;  2FCH A;  2L5L A;  1TK5 B;  1J9B A;  1VF1 A;  1S3A A;  2DJ3 A;  3EC3 A;  2YV7 A;  1GLQ A;  2H66 A;  1XOA A;  2YWO A;  3TKR A;  3IOS A;  5H5S A;  3GSS A;  2G0F A;  4BA7 A;  5AGY A;  4WKW A;  2PVO C;  1ZZY A;  3S9F A;  3D6I A;  1Q98 A;  3FZ9 A;  2NTO A;  4L5O A;  4J57 E;  3IPZ A;  2KP1 A;  4XHM A;  4IGJ A;  4TKY A;  5GAP D;  4RUV A;  5HR1 A;  5CRE A;  2RLI A;  4L0W A;  2OBI A;  4YQM A;  3DXB A;  1N2A A;  4PUF C;  3KP9 A;  3QFA C;  2AHE A;  2CA8 A;  4ECI A;  2L6D A;  6GST A;  2PMT A;  4MF5 A;  1AAZ A;  2XHF A;  1SK2 A;  2XC2 A;  5IMD A;  2HI7 A;  4XS6 A;  5CAX A;  4OO4 A;  2IL3 A;  1IYI A;  1GSQ A;  1O85 A;  3WT1 A;  2FLS A;  5KN0 A;  4HZ2 A;  4IBP A;  1W89 A;  4WET A;  4XTS A;  2A2R A;  3F3Q A;  5ECI B;  5ELG A;  2FD3 A;  1USB A;  3F6F A;  5CRG A;  3UBL A;  5F07 A;  3CBU A;  3WD6 A;  1F37 A;  1S3C A;  3PIN A;  1XZO A;  1SK1 A;  2OKA A;  2OE3 A;  3U5R E;  5FWG A;  4MDC A;  1A8Y A;  3EU3 A;  2PBJ A;  3KD0 A;  4CW9 A;  3KGK A;  1OKD A;  4I6X A;  1OE8 A;  4OFM A;  4PQI A;  2X99 A;  4JR6 A;  4RQX A;  3UEM A;  3M3M A;  4I8B A;  1HYU A;  2YOI A;  2PWJ A;  2PVQ A;  3A2W A;  5HR3 A;  1Z6M A;  4BPY A;  3D4T A;  3UJ1 A;  6GSY A;  1MTC A;  2O8V B;  2DBC A;  3F8U A;  4EVM A;  2HE3 A;  3L78 A;  4PUR A;  2ZUP A;  1XW5 A;  4HJ2 A;  1VGL A;  1R7H A;  3TJK A;  2MMZ A;  5EY6 A;  1K0D A;  3EMP A;  1ZCP A;  5G31 A;  4MZB A;  3M0F A;  4DSQ A;  1E6B A;  4G10 A;  3PR8 A;  1O6J A;  2MBS A;  4TR0 A;  4OWY A;  4ZXG A;  5KN2 A;  2H30 A;  5H5R A;  4I2T A;  1TOF A;  1SYX A;  4V1A g;  2FWH A;  1Z9H A;  4TXO B;  1MDK A;  2CT6 A;  3W6G A;  3Q6O A;  2N5F A;  3FZ5 A;  3P8W A;  2H1D A;  4LA1 A;  2R5G A;  2VO4 A;  4XIH A;  4BVY A;  5DQY A;  2FA8 A;  2O89 A;  3GUR A;  1PD2 1;  2LNS A;  2L4Q A;  3KIJ A;  1K3L A;  1QXH A;  1FG4 A;  1ST9 A;  4JU5 A;  4MH3 A;  2OA7 A;  4TXO A;  1ACV A;  4HJM A;  2I4A A;  3ZL5 A;  2N5A A;  2D2Z A;  3HXS A;  3N9J A;  1PL1 A;  1EOG A;  3QMX A;  1ILO A;  3K8N A;  3NIV A;  3H8Q A;  1YKC A;  5CRW A;  2EIR A;  17GS A;  2H6Z A;  5ID2 B;  2C4J A;  4FIW A;  4PNF A;  2Z9S A;  5ECQ B;  4TRX A;  2VL3 A;  4JE1 A;  1EGR A;  1V98 A;  3H4K A;  4GQF A;  3LXZ A;  1ON4 A;  5IOX A;  2JZR A;  1F3B A;  4P3Y B;  2H1B A;  8GSS A;  2RII A;  1R26 A;  5D96 A;  2GSS A;  4O5R A;  5ID2 A;  4JZQ A;  1WIK A;  4EDZ A;  2J23 A;  3MSZ A;  4IQA A;  1A0R P;  2REM A;  4BWQ A;  4MJC A;  5HQP A;  3FKF A;  3SWL A;  4I5Q A;  3ZZX A;  2H0I A;  5ECM B;  4ZIL A;  3HZ4 A;  4MPF A;  4IQ1 A;  4KA0 A;  1SU9 A;  4O32 A;  2J9H A;  3VLN A;  4KDY A;  2H1G A;  3TOT A;  22GS A;  4K8M A;  1Z7R A;  5G30 A;  4GCI A;  5EPF A;  1UN2 A;  5C00 A;  2JSY A;  2LRN A;  2C8U A;  2YZU A;  1U3I A;  2FA4 A;  2YZH A;  5ECR B;  3ERG A;  3M1G A;  5J9C A;  1JZR A;  2LTK A;  1YEP A;  2CV4 A;  1FAA A;  3CRT A;  4JRR A;  4RQR A;  2AV4 A;  2CZ3 A;  5G5F A;  2WS2 A;  3CYN A;  2PUK C;  2VD0 A;  3GX0 A;  1GNE A;  3GNJ A;  4GF0 A;  3H93 A;  4NWY A;  2LNT A;  3DVX A;  1KBN A;  2YWN A;  1F3A A;  2GT5 A;  3FYG A;  1WP0 A;  3FR6 A;  5JWR B;  4Q5R A;  1A23 A;  2V6K A;  1QK8 A;  1EOH A;  1TRU A;  4MLY A;  2C3N A;  2DIY A;  2HLS A;  1JLV A;  1KEB A;  3I6A A;  1EWX A;  4BL7 A;  2F51 A;  2DIZ A;  3NOF A;  5IMC A;  5J4U A;  5ECO B;  1DSB A;  3APO A;  1R5P A;  3VPQ A;  3HVX A;  2P5R A;  2PGT A;  4KDU A;  4DVC A;  4LL4 B;  3WGD A;  1B9X C;  1UC7 A;  2DJ1 A;  2VCZ A;  3MNG A;  3GRX A;  1XWB A;  1V2A A;  5GZZ B;  5CRH A;  4HUA A;  11GS A;  1K3O A;  1O8W A;  1GH2 A;  4ID0 A;  3KMN A;  3VWU A;  5AIS A;  3L4N A;  1AQW A;  4JR4 A;  4L0U A;  1V40 A;  4Z7X A;  2C0F A;  4FYB A;  3ISO A;  3GKX A;  5D8I A;  2IMK A;  3HJM A;  2YJ7 A;  2GQL A;  3F4S A;  2ES7 A;  1OC8 A;  1JZW A;  3FR3 A;  2IPA A;  1PX7 A;  3I43 A;  1T7P B;  4G2E A;  2YWM A;  3VI7 A;  4YAP A;  2C80 A;  2GT6 A;  3RPN A;  4PGT A;  3TKS C;  5DQS A;  4OD7 A;  3P7X A;  2WZ9 A;  4YQV A;  1X9M B;  2XPD A;  4BVX A;  1GUM A;  4ZL8 A;  3VI5 A;  1EEJ A;  3W8J A;  1VF4 A;  3D22 A;  4V2M A;  2B6M A;  3QAG A;  3GUS A;  2TIR A;  3WGX A;  3FEU A;  3W8S A;  1Y25 A;  1Z5Y E;  5J5N A;  2VLV A;  1GL8 A;  4HDE A;  2H70 A;  2PER A;  4RI6 A;  3GKN A;  2B7J A;  3IRA A;  3O6T A;  3PH9 A;  5HFG A;  2VL2 A;  4MJE A;  4KB3 A;  5A4V A;  4KAE A;  3F9U A;  1H4O A;  2F9S A;  3TKS A;  1M2D A;  2R4V A;  3VWW A;  5CNW A;  2O85 A;  1FVK A;  2ON7 A;  4K6X A;  4J2F A;  2HZE B;  3E9J B;  3EYT A;  1OC3 A;  2I3Y A;  1PA3 A;  1RW1 A;  1F2E A;  3KMO A;  2E0Q A;  3GKK A;  4POM A;  4EE0 A;  1XIY A;  14GS A;  1PKW A;  1XOB A;  4AJ6 A;  2HZE A;  2VAF A;  1XVW A;  2YN1 A;  1U87 A;  1VF2 A;  4WBJ A;  3TJB A;  3H1N A;  2A2S A;  2EC4 A;  3G7Y A;  3ZYW A;  4MJA A;  4GWR A;  1URM A;  3GMF A;  2B3S A;  3D5J A;  3J7Y k;  4HZ4 A;  4KE3 A;  3F0I A;  4AGS A;  2DJ2 A;  5CYY A;  3CXG A;  2LRC A;  1GTA A;  3G7J A;  1NSW A;  2GSR A;  1OYJ A;  3MDK A;  2WDU A;  2MZC A;  4MZC A;  2VOC A;  4PXO A;  2IJY A;  2IWT A;  1QFN A;  2G2Q A;  5DBQ A;  3ZMK A;  4TOP A;  1DBY A;  2K9F A;  4HU9 A;  3C8E A;  3HD5 A;  3TKS E;  1XW9 A;  5B8B A;  3BCK A;  1MDJ A;  1A2M A;  2JZT A;  4MK3 A;  2YAN A;  1H75 A;  3FZ4 A;  2DLX A;  3V1W A;  5IPH A;  1AC1 A;  4POK A;  5F06 A;  2DMM A;  4POB A;  2L5O A;  3VWX A;  1ERW A;  2V2G A;  2RM5 A;  3APQ A;  2R3X A;  4NPB A;  2B5E A;  4GSS A;  1G0T A;  5IMA A;  2YPM A;  1EV4 A;  2VLU A;  1WPI A;  4ML1 A;  3ZRE A;  2LST A;  1X5E A;  1LJR A;  3US3 A;  3LJR A;  3RPP A;  2C3T A;  5B8A A;  3H79 A;  2R6K A;  4I2U A;  1MD4 A;  2R2J A;  1SD9 A;  2GZY A;  3ERW A;  4GST A;  3HKR A;  3IBH A;  5ECN B;  2VCT A;  2C0G A;  2DJK A;  2HYX A;  1B8X A;  2NDO A;  6GSU A;  4K2D A;  3WYW A;  3KEB A;  3IA1 A;  3VUR A;  1MD3 A;  3P2A A;  2HRF A;  1GSS A;  1K0C A;  1GSU A;  2M46 A;  4YQU A;  1IYH A;  2VD1 A;  5IM9 A;  12GS A;  1BAY A;  5FHI A;  3VFI A;  1CQH A;  4NHZ A;  3LFL A;  2LUS A;  4PQH A;  4EXJ A;  5IOW A;  1GWC A;  1S3D A;  1EP8 A;  1YF1 A;  3HDC A;  4IW9 A;  1T8E B;  1M2B A;  3L0H A;  1SKW B;  2KHP A;  2O87 A;  1TXX A;  1TRW A;  4F0B A;  3TRP A;  5ECK B;  1SL0 B;  1O7U A;  2L4C A;  2MMO A;  2LQQ A;  2E2G A;  2H71 A;  5IQY A;  1SKS B;  5KEJ A;  5JWQ B;  5ECS A;  5G2Z A;  5GST A;  1FVJ A;  1BQ7 A;  3GFK A;  2QC7 A;  2RUF A;  3WGE A;  3CSH A;  4NHW A;  2NVL A;  1HQO A;  1J08 A;  1E2Y A;  1WJK A;  1B9Y C;  2IIY A;  4MF6 A;  2N5B A;  4RI7 A;  4IKH A;  1GSE A;  20GS A;  4IEL A;  5DVB A;  2GS3 A;  3HZ8 A;  4OCE A;  4PQ1 A;  3IHQ A;  3VK9 A;  1PKZ A;  2VCV A;  2OJL A;  2LJA A;  4ZL7 A;  13GS A;  2PU9 C;  3RHC A;  5L71 A;  2FGX A;  5G5E A;  2V32 A;  2L57 A;  4KUN A;  1ZYE A;  2B1K A;  2QSI A;  3GST A;  3EE2 A;  4GQC A;  3KCM A;  4WF5 A;  2C0D A;  4HEA 2;  4AJ8 A;  1YJ6 A;  1ZMA A;  5ABR A;  1QGV A;  3QAW A;  3QPM A;  3C73 A;  1JFU A;  1QUW A;  3KP8 A;  3LGC A;  4X0X A;  1DUG A;  1WRY A;  1PGT A;  2TRC P;  4NV2 A;  6GSS A;  1A24 A;  3IXR A;  1XXU A;  1WWJ A;  3IE3 A;  2VCX A;  1X9W B;  3ZIT A;  2CQ9 A;  4E8H A;  2FY6 A;  3C7M A;  2K6V A;  4GRF A;  1CQG A;  4POL A;  4OO5 A;  2E2M A;  3FW2 A;  3UAR A;  4ZBB A;  2MBT A;  1Z6N A;  3MWH A;  4NV5 A;  2CX4 A;  2DJ0 A;  3DVW A;  2HFD A;  3GH6 A;  2H19 A;  3IAS 2;  3LWA A;  5IMF A;  1PX6 A;  3IDV A;  4HI7 A;  1VRS D;  1FB6 A;  2ALB A;  2LQO A;  1TK0 B;  4K0G A;  1PRX A;  2CAQ A;  5D9T A;  5B7C A;  1TKD B;  3C71 A;  4X1U A;  2X64 A;  3GYK A;  2AAW A;  3GTU B;  1T4Y A;  4Q5F A;  1VF3 A;  1HD2 A;  2C1Y A;  4FO5 A;  3BCI A;  2L59 A;  1B4Q A;  1U3A A;  2OBK A;  2F8A A;  4N10 A;  2H8L A;  1X5D A;  3GTU A;  5E59 A;  1GNW A;  3TOU A;  4N0Z A;  1C72 A;  5LD0 A;  3UBK A;  1AQX A;  4TN8 A;  3IV4 A;  3WT2 A;  4LL1 B;  4PUA A;  4IVF A;  1ML6 A;  5ECP B;  2OE1 A;  1ERU A;  2DC5 A;  2B7K A;  5D93 A;  4O7H A;  1O81 A;  5A4W A;  4V1A p;  4WEY A;  2FUG 2;  2WUL A;  5GAN D;  3DYR A;  2GZZ A;  5HR2 A;  2K8V A;  3ZFL A;  1ZYQ B;  1SJI A;  5B6N A;  5COH A;  1BG5 A;  7GSS A;  2LJR A;  1T1V A;  3HJP A;  1YZX A;  1M9A A;  3O76 A;  6GSX A;  4WXT A;  5CRD A;  2OAC A;  1X5C A;  2IN3 A;  1A2L A;  2K18 A;  4XCS A;  2HT9 A;  1M99 A;  4XRA A;  2DSA A;  5F05 A;  1OAZ A;  5A5K A;  2FNO A;  2KLX A;  4ZB8 A;  4K1F A;  3UAP A;  3UIW A;  4YAV A;  4G9H A;  3TCO A;  4E8E A;  1F6M C;  3TJF A;  1XFL A;  2VCQ A;  2I1U A;  2C0E A;  1ZL9 A;  2VL2 C;  3GH9 A;  1TW9 A;  4AF2 A;  1SK0 A;  5ECH B;  4KCE A;  3VWV A;  3TKP A;  2JZS A;  3EUR A;  3UL3 A;  1KNG A;  1TJD A;  1U6T A;  2HXK A;  3FK8 A;  19GS A;  4ZB9 A;  4F03 A;  2P5Q A;  4DSS B;  2H0G A;  2JAD A;  4Q5N A;  1EV9 A;  10GS A;  3E0U A;  1TU7 A;  3KH9 A;  4GSN A;  4IJI A;  1GUH A;  3RAZ A;  1SD8 A;  4KH7 A;  3FRC A;  2AB6 A;  4F82 A;  3DKS A;  3KH7 A;  4DSS A;  3UOM A;  4ULX A;  4EKZ A;  2F8F A;  1ZGN A;  2LKU A;  1M7T A;  4KSO A;  4H86 A;  2GDR A;  1OE7 A;  1TI3 A;  2GZP A;  3IK9 A;  2YNX A;  2P31 A;  3EU4 A;  1HNB A;  1QQ2 A;  3D21 A;  5DCG A;  2KP2 A;  4GLT A;  5LNK e;  1NHO A;  2H72 A;  4NAX A;  4K7O A;  3KTL A;  1V57 A;  4KND A;  1GUL A;  5IO0 A;  4JED A;  1SEN A;  4MH2 A;  3TRQ A;  4ZBA A;  2CAI A;  3C1R A;  4FH8 A;  5H5Q A;  1FW1 A;  2XBI A;  5KN1 A;  3Q18 A;  5D73 A;  1BX9 A;  5DJM A;  3LYP A;  1SL1 B;  2O7K A;  1ZOF A;  3OR5 A;  4L8E A;  3TB2 A;  2I9H A;  4I97 A;  4CDO A;  2WJU A;  3CSJ A;  5F8B A;  1FB0 A;  2VL9 A;  2H74 A;  2H73 A;  1MDI A;  4KCA A;  2IME A;  2LEG A;  2KOK A;  1FOV A;  3LEF A;  3KM6 A;  2K8S A;  1SYR A;  3EWL A;  4IP6 A;  9GSS A;  4DSR A;  2YV9 A;  2F3M A;  1XCC A;  1GTU A;  2E7P A;  2IMD A;  5A4U A;  4EL1 A;  4ILF A;  1O8X A;  2C3Q A;  3M9J A;  3QD9 A;  4K7N A;  3TKQ A;  4ECC A;  1X9S B;  2GLR A;  1R4W A;  3HCZ A;  2V1M A;  2YWI A;  4HU7 A;  2OE0 A;  2ON5 A;  1JHB A;  3M9K A;  4OFN A;  3TGZ A;  4J56 E;  3JCM L;  3GL3 A;  4ECB A;  1TI1 A;  1EEM A;  4X43 A;  5CP1 A;  1NM3 A;  4V2L A;  3LYK A;  4XS1 A;  2DJJ A;  1T00 A;  2B5Y A;  1THO A;  3HYP A;  4F2I A;  3ERF A;  3RDW A;  1NW2 A;  3DRN A;  5LCZ A;  4LMW A;  1X0R A;  1XW6 A;  1Y6E A;  2CX3 A;  3VPT A;  1OKT A;  5DCH A;  3QFB C;  1BYE A;  5JCG A;  5ECL B;  4NMU A;  1XWA A;  3FY7 A;  5CO3 A;  1TK8 B;  3A2V A;  1I5G A;  1UVZ A;  3F63 A;  2X8G A;  4WBR D;  1EP7 A;  2TRX A;  1G6W A;  4HS1 A;  5FT3 A;  2FWE A;  5C04 A;  3GX8 A;  3DD3 A;  3DWV A;  2YCD A;  1QMV A;  5EVO A;  4LLR A;  2MYG A;  4MPG A;  4AJ7 A;  5AIV A;  3MAK A;  1TRV A;  2MMA A;  3GIX A;  4QL7 A;  2M80 A;  4ZBD A;  2H6X A;  2IMI A;  1F9M A;  1AQV A;  4TVE A;  4ZB6 A;  3P90 A;  4N11 A;  1XWG A;  2VM2 A;  3SBC A;  2LJK A;  4KW6 A;  2VUP A;  1T3B A;  2JSZ A;  3LG6 A;  1G7E A;  5J9B A;  1LU4 A;  1KTE A;  4HQZ A;  5IMZ A;  2PN8 A;  3QCP A;  4O92 A;  2IMF A;  2FWG A;  3IK7 A;  1OVN A;  2L6C A;  1EGO A;  4F0C A;  2LS5 A;  5EL8 A;  2X8C A;  1XVQ A;  2H1A A;  1K3Y A;  4ZL9 A;  5HFI A;  2AUV A;  4ECJ A;  6GSV A;  2ZCT A;  1MEK A;  3BBY A;  3GL5 A;  5DAK B;  1JZO A;  4EUY A;  3L9V A;  4F9Z A;  2H76 A;  3L9S A;  2VM1 A;  2B5X A;  3L9U A;  2A4V A;  2V6O A;  3RBT A;  1ERT A;  1O73 A;  4K7I A;  2CVK A;  2WB9 A;  1ABA A;  1SKR B;  2JU5 A;  1TP9 A;  4TR1 B;  5DAK A;  5J41 A;  4MF7 A;  5F0G A;  1UA5 A;  3QR6 A;  4ML6 A;  4N30 A;  5D9X A;  3G9B A;  5DAL B;  3ZFB A;  5B6M A;  4EO3 A;  1K0O A;  5JWO B;  3PGT A;  2GSQ A;  5HR0 A;  4QQ7 A;  2GST A;  3UMA A;  1HNC A;  4PX1 A;  3ED3 A;  2MMN A;  4OMV A;  4TR1 A;  3ZVJ D;  1SJ6 A;  5INY A;  2RM6 A;  2I81 A;  5HFK A;  5DAL A;  3EMX A;  5DDL A;  1M2A A;  3CTF A;  1PL2 A;  2BTO T;  2AJQ B;  2HNL A;  4KGI A;  3F6D A;  1YY7 A;  3D0Z A;  3G7I A;  5AN1 A;  4HOJ A;  3J7Y b;  2VIM A;  4Q5Q A;  2QKE A;  3C1S A;  2WFC A;  4GTU A;  4TXV A;  1PQN A;  3N5O A;  4K9Z A;  1GP1 A;  2GVP A;  1EZK A;  1M9B A;  3R2Q A;  6GSW A;  5J3R A;  1GTB A;  3GA4 A;  3QAV A;  4MZW A;  4N0V A;  1YEX A;  4MMM A;  4MCU A;  1JLW A;  1FO5 A;  5AIX A;  2FWF A;  3CTG A;  5E4W A;  5GSS A;  2BJX A;  3BOA A;  4QL9 A;  3CSI A;  2YJH A;  1U88 A;  3HJO A;  1GLP A;  3UVT A;  2H01 A;  2QGV A;  2NBS A;  4LMV A;  5G1L A;  5JCU A;  3TDG A;  3F4T A;  2RUE A;  1SL2 B;  1K0B A;  2DML A;  4EC0 A;  1OC9 B;  3GKM A;  4GXZ A;  1GSD A;  1XWK A;  2AYT A;  3M8N A;  5IO2 A;  3HY2 A;  4WF4 A;  1N8J A;  1ERV A;  1G7O A;  2GGT A;  1G6Y A;  3BJ5 A;  1XBS A;  1BJX A;  3F3R A;  4KX4 A;  2PPT A;  2XPE A;  2LRT A;  5D9W A;  3QOU A;  4ZIJ A;  1YKA A;  3ZML A;  5JCW A;  1OC9 A;  3D4M A;  4TR3 A;  1DE2 A;  1M0U A;  1BED A;  3Q19 A;  3GN3 A;  4TR4 A;  2WRT A;  4FYC A;  1NHY A;  1A8L A;  3KZQ A;  2B1L A;  5DJL A;  1I9D A;  1V9W A;  3LOR A;  5IMV A;  2KUC A;  3DIE A;  3GHA A;  3I9V 2;  3CRU A;  1A0F A; 
#chains in the Genus database with same CATH topology
 3DEX A;  1YF0 A;  1SJZ A;  1WMJ A;  5ENU A;  5G1K A;  4KDX A;  1R5A A;  1B4P A;  1AIU A;  1W4V A;  4D73 B;  4JBB A;  4MAB A;  3BD2 A;  1A2J A;  2JAC A;  3EVI A;  1PSQ A;  4KSM A;  3A3T A;  1LBK A;  1T4Z A;  4G0I A;  2GTU A;  2EIQ A;  4XRD A;  3GV1 A;  3HVV A;  2LV3 A;  4OCF A;  1TDI A;  3CMI A;  4IN0 A;  3TJG A;  4CHS A;  5IPG A;  1RK4 A;  4D73 A;  4TW5 A;  4EF0 A;  2X8H A;  3DGQ A;  1J0F A;  4MJB A;  1Z3E A;  1Z7P A;  3F4R A;  2JL4 A;  2H0H A;  1AW9 A;  4ISD A;  3ME8 A;  3ZVJ A;  5KN3 A;  2V41 A;  2NPB A;  3IC4 A;  3Q74 A;  1PN9 A;  3U6V A;  3TUE A;  4BWS A;  1DE1 A;  3IAM 2;  4DEJ A;  3HVS A;  4BVX B;  4OFT A;  2H75 A;  1HNA A;  1XPV A;  2XBQ A;  2VCW A;  2X4A A;  2HRN A;  1THX A;  4K0N A;  1JZD A;  2P0G A;  4MP4 A;  4IP1 A;  1RQM A;  1PMT A;  4XS4 B;  3NZN A;  1WE0 A;  18GS A;  3APS A;  5IIZ A;  4G19 A;  2HZF A;  1FHE A;  4V2N A;  3ZLP A;  4MA9 A;  3LQ7 A;  1V58 A;  2M72 A;  3ME7 A;  3ZTL A;  3AY8 A;  1Q4J A;  1K0N A;  3HA9 A;  2CZ2 A;  4HQS A;  3FZA A;  2HSY A;  3HHV A;  3O3T A;  1XWC A;  2CVD A;  1GRX A;  1GSF A;  2CVB A;  3KXO A;  4XS4 A;  1GTI A;  4IS0 A;  1B48 A;  3E3E A;  4K2X A;  2FHE A;  3HVN A;  4WR4 A;  3FHK A;  16GS A;  2QA1 A;  2H6Y A;  3TJJ A;  2WGR A;  2YP6 A;  4IJ3 A;  2VLT A;  2HSH A;  2BMX A;  3ZIJ A;  4IHU A;  1GUK A;  2GQM A;  5D9V A;  1K0A A;  3ZIV A;  4ACS A;  1TRS A;  2R37 A;  3A5W A;  4YH2 A;  1AUC A;  3KTB A;  2IFQ B;  4Z2U A;  3RHB A;  5ELA A;  3ZRD A;  2ZNM A;  4WR5 A;  4PNG A;  1GSY A;  1TTZ A;  2WCI A;  3LSZ A;  2EIO A;  3I69 A;  2GQK A;  4NXI A;  3IR4 A;  3DML A;  3FR9 A;  3QDN A;  1YQ1 A;  4FYU A;  3TRX A;  1AXD A;  1K0M A;  4EIQ A;  3A2X A;  3UVH A;  4L5L A;  2IFQ A;  3EIN A;  1WOU A;  4EDY A;  3KJY A;  1YDK A;  1TU8 A;  3LXT A;  2OAD A;  2FCH A;  2L5L A;  1TK5 B;  1J9B A;  1VF1 A;  1S3A A;  2DJ3 A;  3EC3 A;  2YV7 A;  1GLQ A;  2H66 A;  1XOA A;  2YWO A;  3TKR A;  3IOS A;  5H5S A;  3GSS A;  2G0F A;  4BA7 A;  5AGY A;  4WKW A;  2PVO C;  1ZZY A;  3S9F A;  3D6I A;  1Q98 A;  3FZ9 A;  2NTO A;  4L5O A;  4J57 E;  3IPZ A;  2KP1 A;  4XHM A;  4IGJ A;  4TKY A;  5GAP D;  4RUV A;  5HR1 A;  4O5U A;  5CRE A;  2RLI A;  4L0W A;  2OBI A;  4YQM A;  3DXB A;  1N2A A;  4PUF C;  3KP9 A;  3QFA C;  2AHE A;  2CA8 A;  4ECI A;  2L6D A;  6GST A;  2PMT A;  4MF5 A;  1AAZ A;  2XHF A;  1SK2 A;  2XC2 A;  5IMD A;  2HI7 A;  4XS6 A;  5CAX A;  4OO4 A;  4Z2R A;  2IL3 A;  1IYI A;  1GSQ A;  1O85 A;  3WT1 A;  2FLS A;  5KN0 A;  4HZ2 A;  4IBP A;  1W89 A;  4WET A;  4XTS A;  2A2R A;  3F3Q A;  5ECI B;  5ELG A;  2FD3 A;  1USB A;  3F6F A;  5CRG A;  1FOH A;  3UBL A;  5F07 A;  3CBU A;  3WD6 A;  1F37 A;  1S3C A;  3PIN A;  1XZO A;  1SK1 A;  2OKA A;  2OE3 A;  2HRK A;  3U5R E;  5FWG A;  4MDC A;  1A8Y A;  3EU3 A;  2PBJ A;  3KD0 A;  4CW9 A;  3KGK A;  1OKD A;  4I6X A;  1OE8 A;  4OFM A;  4PQI A;  1S3R A;  2X99 A;  4JR6 A;  4RQX A;  3UEM A;  3M3M A;  4I8B A;  1HYU A;  2YOI A;  2PWJ A;  2PVQ A;  3A2W A;  5HR3 A;  1Z6M A;  4BPY A;  3D4T A;  3UJ1 A;  6GSY A;  1MTC A;  2O8V B;  2DBC A;  3F8U A;  4EVM A;  2HE3 A;  3L78 A;  4PUR A;  2ZUP A;  1XW5 A;  4HJ2 A;  1VGL A;  1R7H A;  3TJK A;  2MMZ A;  5EY6 A;  1K0D A;  3EMP A;  1ZCP A;  5G31 A;  4MZB A;  3M0F A;  4DSQ A;  1E6B A;  4G10 A;  3PR8 A;  1O6J A;  2MBS A;  4TR0 A;  4OWY A;  4ZXG A;  4BVY B;  5KN2 A;  2H30 A;  5H5R A;  4I2T A;  1TOF A;  1SYX A;  4V1A g;  2FWH A;  1Z9H A;  4TXO B;  1MDK A;  2CT6 A;  3W6G A;  3Q6O A;  2N5F A;  3FZ5 A;  3P8W A;  2H1D A;  4LA1 A;  2R5G A;  2VO4 A;  4XIH A;  4BVY A;  5DQY A;  2FA8 A;  2O89 A;  3GUR A;  1PD2 1;  2LNS A;  2L4Q A;  3KIJ A;  3MIX A;  1K3L A;  1QXH A;  1FG4 A;  1ST9 A;  4JU5 A;  4MH3 A;  2OA7 A;  4TXO A;  1ACV A;  4HJM A;  2I4A A;  3ZL5 A;  2N5A A;  2D2Z A;  3HXS A;  3N9J A;  1PL1 A;  1EOG A;  3QMX A;  1ILO A;  3K8N A;  3NIV A;  3H8Q A;  1YKC A;  5CRW A;  2EIR A;  17GS A;  2H6Z A;  5ID2 B;  2C4J A;  4FIW A;  4PNF A;  2Z9S A;  5ECQ B;  4HSC X;  4TRX A;  2VL3 A;  4JE1 A;  1EGR A;  1V98 A;  3H4K A;  4GQF A;  3LXZ A;  1ON4 A;  5IOX A;  2JZR A;  1F3B A;  4P3Y B;  2H1B A;  8GSS A;  2RII A;  1R26 A;  5D96 A;  2GSS A;  4O5R A;  5ID2 A;  4JZQ A;  1WIK A;  4EDZ A;  2J23 A;  3MSZ A;  3MYD A;  4IQA A;  1A0R P;  2REM A;  4BWQ A;  4MJC A;  5HQP A;  3FKF A;  4G0L A;  3SWL A;  4I5Q A;  3ZZX A;  2H0I A;  5ECM B;  4ZIL A;  3HZ4 A;  4MPF A;  4IQ1 A;  4KA0 A;  1SU9 A;  4O32 A;  2J9H A;  3VLN A;  4KDY A;  2H1G A;  3TOT A;  22GS A;  4K8M A;  1Z7R A;  5G30 A;  4GCI A;  5EPF A;  1UN2 A;  5C00 A;  2JSY A;  2LRN A;  2C8U A;  2YZU A;  1U3I A;  2FA4 A;  2YZH A;  5ECR B;  4BIK A;  3ERG A;  3M1G A;  5J9C A;  1JZR A;  2LTK A;  1YEP A;  2CV4 A;  1FAA A;  3CRT A;  4JRR A;  4RQR A;  2AV4 A;  2CZ3 A;  5G5F A;  2WS2 A;  3CYN A;  2PUK C;  2VD0 A;  3GX0 A;  1GNE A;  3GNJ A;  4GF0 A;  2X49 A;  3H93 A;  4NWY A;  2LNT A;  3DVX A;  1KBN A;  4BL7 B;  2YWN A;  1F3A A;  2GT5 A;  3FYG A;  1WP0 A;  3FR6 A;  5JWR B;  4Q5R A;  1A23 A;  2V6K A;  1QK8 A;  1EOH A;  1TRU A;  4MLY A;  2C3N A;  3A5I A;  2DIY A;  2HLS A;  1JLV A;  1KEB A;  4FQU A;  3I6A A;  1EWX A;  4BL7 A;  2F51 A;  2DIZ A;  3NOF A;  5IMC A;  5J4U A;  5ECO B;  1DSB A;  3APO A;  1R5P A;  2A4H A;  3VPQ A;  3HVX A;  2P5R A;  2PGT A;  4KDU A;  4DVC A;  4LL4 B;  3WGD A;  1B9X C;  1UC7 A;  2DJ1 A;  2VCZ A;  3MNG A;  3GRX A;  1XWB A;  1V2A A;  5GZZ B;  4Z2T A;  5CRH A;  4HUA A;  11GS A;  1K3O A;  1O8W A;  1GH2 A;  4ID0 A;  3KMN A;  3VWU A;  5AIS A;  3L4N A;  1AQW A;  4JR4 A;  4L0U A;  1V40 A;  4Z7X A;  2C0F A;  4FYB A;  3ISO A;  3GKX A;  5D8I A;  2IMK A;  3HJM A;  2YJ7 A;  2GQL A;  3F4S A;  2ES7 A;  1OC8 A;  1JZW A;  3FR3 A;  2IPA A;  1PX7 A;  3I43 A;  1T7P B;  4G2E A;  2YWM A;  3VI7 A;  4YAP A;  1PN0 A;  2C80 A;  2GT6 A;  4CY8 A;  3RPN A;  4PGT A;  4X4J A;  3TKS C;  5DQS A;  4OD7 A;  3P7X A;  2WZ9 A;  4YQV A;  1X9M B;  2XPD A;  4BVX A;  1GUM A;  4ZL8 A;  3VI5 A;  1EEJ A;  3W8J A;  1VF4 A;  3D22 A;  4V2M A;  2B6M A;  3QAG A;  3GUS A;  2TIR A;  3WGX A;  3FEU A;  3W8S A;  1Y25 A;  1Z5Y E;  5J5N A;  2VLV A;  1GL8 A;  4HDE A;  4A5P A;  2H70 A;  2PER A;  4RI6 A;  3GKN A;  2B7J A;  3IRA A;  3O6T A;  3PH9 A;  5HFG A;  2VL2 A;  4MJE A;  4K5R A;  4KB3 A;  5A4V A;  4KAE A;  3F9U A;  1H4O A;  2F9S A;  3TKS A;  1M2D A;  2HSM A;  2R4V A;  3VWW A;  5CNW A;  2O85 A;  1FVK A;  2ON7 A;  4K6X A;  4J2F A;  2HZE B;  3E9J B;  3EYT A;  1OC3 A;  2I3Y A;  1PA3 A;  1RW1 A;  1F2E A;  3KMO A;  2E0Q A;  3GKK A;  4POM A;  4EE0 A;  1XIY A;  14GS A;  1PKW A;  1XOB A;  4AJ6 A;  2HZE A;  2VAF A;  1XVW A;  2YN1 A;  1U87 A;  1VF2 A;  4WBJ A;  3TJB A;  2R0C A;  3H1N A;  2A2S A;  2EC4 A;  3G7Y A;  3ZYW A;  4MJA A;  4GWR A;  1URM A;  3GMF A;  2B3S A;  3D5J A;  3J7Y k;  1PFO A;  4HZ4 A;  4KE3 A;  3F0I A;  4AGS A;  2DJ2 A;  5CYY A;  3CXG A;  2LRC A;  1GTA A;  3G7J A;  1NSW A;  2GSR A;  1OYJ A;  3MDK A;  2WDU A;  2MZC A;  4MZC A;  2VOC A;  4PXO A;  2IJY A;  2IWT A;  4MNN A;  1QFN A;  2G2Q A;  5DBQ A;  3ZMK A;  4TOP A;  1DBY A;  2K9F A;  4HU9 A;  3C8E A;  3HD5 A;  3TKS E;  1XW9 A;  5B8B A;  3BCK A;  1MDJ A;  1A2M A;  2JZT A;  4MK3 A;  2YAN A;  1H75 A;  3FZ4 A;  2DLX A;  3V1W A;  5IPH A;  1AC1 A;  4POK A;  5F06 A;  2DMM A;  4POB A;  2R0G A;  2L5O A;  3VWX A;  1ERW A;  2V2G A;  2RM5 A;  3APQ A;  2R3X A;  4NPB A;  2B5E A;  4GSS A;  1G0T A;  5IMA A;  2YPM A;  5KOX A;  1EV4 A;  2VLU A;  1WPI A;  4ML1 A;  3ZRE A;  2LST A;  1X5E A;  1LJR A;  3US3 A;  3LJR A;  3RPP A;  2C3T A;  5B8A A;  3H79 A;  2R6K A;  4I2U A;  1MD4 A;  2R2J A;  1SD9 A;  2GZY A;  3ERW A;  4GST A;  3HKR A;  3IBH A;  5ECN B;  2VCT A;  2C0G A;  2DJK A;  2HYX A;  1B8X A;  2NDO A;  6GSU A;  4K2D A;  3WYW A;  3KEB A;  3IA1 A;  3VUR A;  1MD3 A;  3P2A A;  2HRF A;  1GSS A;  1K0C A;  1GSU A;  2M46 A;  4YQU A;  1IYH A;  2VD1 A;  5IM9 A;  12GS A;  1BAY A;  5FHI A;  3VFI A;  1CQH A;  4NHZ A;  3LFL A;  2LUS A;  4PQH A;  4EXJ A;  5IOW A;  1GWC A;  1S3D A;  1EP8 A;  1YF1 A;  3HDC A;  4IW9 A;  1T8E B;  1M2B A;  3L0H A;  1SKW B;  2KHP A;  2O87 A;  1TXX A;  1TRW A;  4F0B A;  3TRP A;  5ECK B;  1SL0 B;  1O7U A;  2L4C A;  2MMO A;  2LQQ A;  2E2G A;  2H71 A;  5IQY A;  1SKS B;  5KEJ A;  5JWQ B;  5ECS A;  5G2Z A;  5GST A;  1FVJ A;  1BQ7 A;  3GFK A;  2QC7 A;  2RUF A;  3WGE A;  3CSH A;  4NHW A;  2NVL A;  1HQO A;  1J08 A;  1E2Y A;  1WJK A;  1B9Y C;  2IIY A;  4MF6 A;  2N5B A;  4RI7 A;  4IKH A;  1GSE A;  20GS A;  3LW9 A;  4IEL A;  2GS3 A;  4YKF A;  5DVB A;  3HZ8 A;  4OCE A;  4PQ1 A;  3IHQ A;  3R3E A;  3VK9 A;  1PKZ A;  2VCV A;  2OJL A;  2LJA A;  4ZL7 A;  13GS A;  2PU9 C;  3RHC A;  5L71 A;  2FGX A;  5G5E A;  2V32 A;  2L57 A;  4KUN A;  1ZYE A;  2B1K A;  2QSI A;  3GST A;  4O5Q A;  3EE2 A;  4GQC A;  3KCM A;  4WF5 A;  2C0D A;  4HEA 2;  4AJ8 A;  1YJ6 A;  1ZMA A;  5ABR A;  1QGV A;  3QAW A;  3QPM A;  3C73 A;  1JFU A;  1QUW A;  3KP8 A;  3LGC A;  4X0X A;  3IC8 A;  1DUG A;  1WRY A;  1PGT A;  2TRC P;  4NV2 A;  6GSS A;  1A24 A;  3IXR A;  1XXU A;  1WWJ A;  3IE3 A;  2VCX A;  1X9W B;  3ZIT A;  2CQ9 A;  4E8H A;  2FY6 A;  3C7M A;  2K6V A;  4GRF A;  1CQG A;  4POL A;  4OO5 A;  2E2M A;  3FW2 A;  3UAR A;  4ZBB A;  2MBT A;  1Z6N A;  3MWH A;  4NV5 A;  2CX4 A;  2DJ0 A;  3DVW A;  2HFD A;  3GH6 A;  2H19 A;  3IAS 2;  3LWA A;  5IMF A;  1PX6 A;  3IDV A;  4HI7 A;  1VRS D;  1FB6 A;  2ALB A;  2LQO A;  1TK0 B;  4K0G A;  1PRX A;  2CAQ A;  5D9T A;  5B7C A;  1TKD B;  3C71 A;  4X1U A;  2X64 A;  3GYK A;  2AAW A;  3GTU B;  1T4Y A;  4Q5F A;  1VF3 A;  1HD2 A;  2C1Y A;  4FO5 A;  3BCI A;  2L59 A;  1B4Q A;  1U3A A;  2OBK A;  2F8A A;  4N10 A;  2H8L A;  4ICY A;  1X5D A;  3GTU A;  5E59 A;  1GNW A;  3TOU A;  4N0Z A;  1C72 A;  5LD0 A;  3UBK A;  1AQX A;  4TN8 A;  3IV4 A;  3WT2 A;  4LL1 B;  4PUA A;  4IVF A;  1ML6 A;  5ECP B;  2OE1 A;  1ERU A;  2DC5 A;  2B7K A;  5D93 A;  4O7H A;  1O81 A;  5A4W A;  4V1A p;  4WEY A;  2FUG 2;  2WUL A;  5GAN D;  3DYR A;  2GZZ A;  5HR2 A;  2K8V A;  4G0K A;  3ZFL A;  1ZYQ B;  1SJI A;  5B6N A;  5COH A;  1M3J A;  1BG5 A;  7GSS A;  2LJR A;  1T1V A;  3HJP A;  1YZX A;  1M9A A;  3O76 A;  6GSX A;  4WXT A;  5CRD A;  2OAC A;  1X5C A;  2IN3 A;  1XG8 A;  1A2L A;  2K18 A;  4XCS A;  2HT9 A;  1M99 A;  4XRA A;  3FMW A;  2DSA A;  5F05 A;  1OAZ A;  5A5K A;  2FNO A;  2KLX A;  4ZB8 A;  2UZ8 A;  4K1F A;  3UAP A;  3UIW A;  4YAV A;  4G9H A;  3TCO A;  4E8E A;  1F6M C;  2A2P A;  3TJF A;  1XFL A;  2VCQ A;  2I1U A;  2C0E A;  1ZL9 A;  2VL2 C;  3GH9 A;  1TW9 A;  4AF2 A;  1SK0 A;  5ECH B;  4KCE A;  3VWV A;  3TKP A;  3EPT A;  2JZS A;  3EUR A;  3UL3 A;  1KNG A;  5KOW A;  1TJD A;  1U6T A;  2HXK A;  3FK8 A;  19GS A;  4ZB9 A;  4F03 A;  2P5Q A;  4DSS B;  2H0G A;  2JAD A;  4Q5N A;  1EV9 A;  10GS A;  3E0U A;  1TU7 A;  3KH9 A;  4GSN A;  4IJI A;  1GUH A;  3RAZ A;  1SD8 A;  4KH7 A;  3FRC A;  2AB6 A;  4F82 A;  3DKS A;  3KH7 A;  4DSS A;  3UOM A;  4ULX A;  4EKZ A;  2F8F A;  1ZGN A;  2LKU A;  1M7T A;  4KSO A;  4H86 A;  2GDR A;  1OE7 A;  1TI3 A;  2GZP A;  3IK9 A;  2YNX A;  2P31 A;  3EU4 A;  1HNB A;  1QQ2 A;  4CY6 A;  3D21 A;  5DCG A;  2KP2 A;  4GLT A;  5LNK e;  1NHO A;  2H72 A;  4NAX A;  4K7O A;  3KTL A;  1V57 A;  4KND A;  1GUL A;  5IO0 A;  2QA2 A;  4JED A;  1SEN A;  4MH2 A;  3TRQ A;  4ZBA A;  2CAI A;  3C1R A;  4FH8 A;  5H5Q A;  1FW1 A;  2XBI A;  5KN1 A;  3Q18 A;  5D73 A;  4PTS A;  1BX9 A;  5DJM A;  3LYP A;  1SL1 B;  2O7K A;  1ZOF A;  3OR5 A;  4L8E A;  3TB2 A;  2I9H A;  4I97 A;  4CDO A;  2WJU A;  3CSJ A;  5F8B A;  1FB0 A;  2VL9 A;  2H74 A;  2H73 A;  1MDI A;  4KCA A;  2IME A;  2LEG A;  2KOK A;  1FOV A;  3LEF A;  3KM6 A;  2K8S A;  1SYR A;  3EWL A;  4IP6 A;  9GSS A;  4DSR A;  2YV9 A;  2F3M A;  1XCC A;  1GTU A;  2E7P A;  2IMD A;  5A4U A;  4EL1 A;  4ILF A;  1O8X A;  2C3Q A;  3M9J A;  3QD9 A;  4K7N A;  4KF9 A;  3TKQ A;  4ECC A;  1X9S B;  2GLR A;  1R4W A;  3HCZ A;  2V1M A;  2YWI A;  4HU7 A;  2OE0 A;  2ON5 A;  1JHB A;  3M9K A;  4OFN A;  3PPU A;  3TGZ A;  4J56 E;  3JCM L;  3GL3 A;  4ECB A;  1TI1 A;  1EEM A;  4X43 A;  5CP1 A;  1NM3 A;  4V2L A;  3LYK A;  4XS1 A;  2DJJ A;  1T00 A;  2B5Y A;  1THO A;  1ZYP A;  3HYP A;  4F2I A;  3ERF A;  3RDW A;  1NW2 A;  3DRN A;  5LCZ A;  4LMW A;  1X0R A;  1XW6 A;  1Y6E A;  2CX3 A;  3VPT A;  2HRA A;  1OKT A;  5DCH A;  3QFB C;  1BYE A;  4USS A;  5JCG A;  5ECL B;  4NMU A;  1XWA A;  3FY7 A;  5CO3 A;  1TK8 B;  3A2V A;  1I5G A;  1UVZ A;  3F63 A;  2X8G A;  4WBR D;  1EP7 A;  2TRX A;  1G6W A;  4HS1 A;  5FT3 A;  2DKH A;  2FWE A;  5C04 A;  3GX8 A;  3DD3 A;  3DWV A;  2YCD A;  1QMV A;  5EVO A;  4LLR A;  2MYG A;  4MPG A;  4AJ7 A;  5AIV A;  3MAK A;  1TRV A;  2MMA A;  3GIX A;  4QL7 A;  2M80 A;  4ZBD A;  2H6X A;  2IMI A;  1F9M A;  1AQV A;  4TVE A;  4ZB6 A;  3P90 A;  4N11 A;  1XWG A;  2VM2 A;  3SBC A;  2LJK A;  4KW6 A;  2VUP A;  1T3B A;  2JSZ A;  3LG6 A;  1G7E A;  5J9B A;  1LU4 A;  1KTE A;  4HQZ A;  5IMZ A;  2PN8 A;  3QCP A;  4O92 A;  2IMF A;  2FWG A;  3IK7 A;  1OVN A;  2L6C A;  1EGO A;  4F0C A;  2LS5 A;  5EL8 A;  2X8C A;  1XVQ A;  1M3I A;  2H1A A;  1K3Y A;  4ZL9 A;  5HFI A;  2AUV A;  4ECJ A;  6GSV A;  2ZCT A;  1MEK A;  3BBY A;  3GL5 A;  5DAK B;  1JZO A;  4EUY A;  3L9V A;  4F9Z A;  2H76 A;  3L9S A;  3CQF A;  2VM1 A;  2B5X A;  3L9U A;  2A4V A;  2V6O A;  3RBT A;  1ERT A;  1O73 A;  4K7I A;  2CVK A;  2WB9 A;  1ABA A;  1SKR B;  2JU5 A;  1TP9 A;  4TR1 B;  5DAK A;  5J41 A;  4MF7 A;  5F0G A;  1UA5 A;  3QR6 A;  4ML6 A;  4N30 A;  5D9X A;  3G9B A;  5DAL B;  3ZFB A;  5B6M A;  4EO3 A;  1K0O A;  5JWO B;  3PGT A;  2GSQ A;  5HR0 A;  4QQ7 A;  2GST A;  3UMA A;  1HNC A;  4PX1 A;  3ED3 A;  2MMN A;  4OMV A;  2DKI A;  4TR1 A;  3ZVJ D;  1SJ6 A;  5INY A;  2RM6 A;  2I81 A;  5HFK A;  5DAL A;  3EMX A;  5DDL A;  1M2A A;  3CTF A;  1PL2 A;  2BTO T;  2AJQ B;  2HNL A;  4KGI A;  3F6D A;  1YY7 A;  3D0Z A;  3G7I A;  5AN1 A;  4HOJ A;  3J7Y b;  2VIM A;  4Q5Q A;  2QKE A;  3C1S A;  2WFC A;  4GTU A;  4TXV A;  1PQN A;  3N5O A;  4K9Z A;  1GP1 A;  2GVP A;  1EZK A;  1M9B A;  3R2Q A;  6GSW A;  5J3R A;  1GTB A;  3GA4 A;  3QAV A;  4MZW A;  4N0V A;  1YEX A;  4YKG A;  4MMM A;  4MCU A;  1JLW A;  1FO5 A;  5AIX A;  2FWF A;  3CTG A;  5E4W A;  5GSS A;  2BJX A;  3BOA A;  4QL9 A;  3CSI A;  2YJH A;  5BMU A;  1U88 A;  3HJO A;  1GLP A;  3UVT A;  2H01 A;  2QGV A;  2NBS A;  4LMV A;  5G1L A;  5JCU A;  3TDG A;  3F4T A;  2RUE A;  1SL2 B;  1K0B A;  1ZYN A;  2DML A;  4EC0 A;  1OC9 B;  3GKM A;  4GXZ A;  1GSD A;  1XWK A;  2AYT A;  3M8N A;  5IO2 A;  3HY2 A;  4WF4 A;  1N8J A;  1ERV A;  1G7O A;  2GGT A;  1G6Y A;  3BJ5 A;  1XBS A;  1BJX A;  3F3R A;  4KX4 A;  2PPT A;  2XPE A;  2LRT A;  3IHG A;  5D9W A;  3QOU A;  4ZIJ A;  1YKA A;  3ZML A;  5JCW A;  1OC9 A;  3D4M A;  4TR3 A;  5BRT A;  1DE2 A;  1M0U A;  2R0P A;  1BED A;  3Q19 A;  3GN3 A;  4TR4 A;  2WRT A;  4FYC A;  1NHY A;  1A8L A;  3KZQ A;  4EIP A;  2B1L A;  5DJL A;  1I9D A;  1V9W A;  3LOR A;  5IMV A;  2KUC A;  3DIE A;  3GHA A;  3I9V 2;  3CRU A;  4K5S A;  1A0F A; 
#chains in the Genus database with same CATH homology
 3DEX A;  1YF0 A;  1SJZ A;  1WMJ A;  5ENU A;  5G1K A;  4KDX A;  1R5A A;  1B4P A;  1AIU A;  1W4V A;  4D73 B;  4JBB A;  4MAB A;  3BD2 A;  1A2J A;  2JAC A;  3EVI A;  1PSQ A;  4KSM A;  3A3T A;  1LBK A;  1T4Z A;  4G0I A;  2GTU A;  2EIQ A;  4XRD A;  3GV1 A;  3HVV A;  2LV3 A;  4OCF A;  1TDI A;  3CMI A;  4IN0 A;  3TJG A;  4CHS A;  5IPG A;  1RK4 A;  4D73 A;  4TW5 A;  4EF0 A;  2X8H A;  3DGQ A;  1J0F A;  4MJB A;  1Z3E A;  1Z7P A;  3F4R A;  2JL4 A;  2H0H A;  1AW9 A;  4ISD A;  3ME8 A;  3ZVJ A;  5KN3 A;  2V41 A;  2NPB A;  3IC4 A;  3Q74 A;  1PN9 A;  3U6V A;  3TUE A;  4BWS A;  1DE1 A;  3IAM 2;  4DEJ A;  3HVS A;  4BVX B;  4OFT A;  2H75 A;  1HNA A;  1XPV A;  2XBQ A;  2VCW A;  2X4A A;  2HRN A;  1THX A;  4K0N A;  1JZD A;  2P0G A;  4MP4 A;  4IP1 A;  1RQM A;  1PMT A;  4XS4 B;  3NZN A;  1WE0 A;  18GS A;  3APS A;  5IIZ A;  4G19 A;  2HZF A;  1FHE A;  4V2N A;  3ZLP A;  4MA9 A;  3LQ7 A;  1V58 A;  2M72 A;  3ME7 A;  3ZTL A;  3AY8 A;  1Q4J A;  1K0N A;  3HA9 A;  2CZ2 A;  4HQS A;  3FZA A;  2HSY A;  3HHV A;  3O3T A;  1XWC A;  2CVD A;  1GRX A;  1GSF A;  2CVB A;  3KXO A;  4XS4 A;  1GTI A;  4IS0 A;  1B48 A;  3E3E A;  4K2X A;  2FHE A;  4WR4 A;  3FHK A;  16GS A;  2QA1 A;  2H6Y A;  3TJJ A;  2WGR A;  2YP6 A;  4IJ3 A;  2VLT A;  2HSH A;  2BMX A;  3ZIJ A;  4IHU A;  1GUK A;  2GQM A;  5D9V A;  1K0A A;  3ZIV A;  4ACS A;  1TRS A;  2R37 A;  3A5W A;  4YH2 A;  1AUC A;  3KTB A;  2IFQ B;  4Z2U A;  3RHB A;  5ELA A;  3ZRD A;  2ZNM A;  4WR5 A;  4PNG A;  1GSY A;  1TTZ A;  2WCI A;  3LSZ A;  2EIO A;  3I69 A;  2GQK A;  4NXI A;  3IR4 A;  3DML A;  3FR9 A;  3QDN A;  1YQ1 A;  4FYU A;  3TRX A;  1AXD A;  1K0M A;  4EIQ A;  3A2X A;  3UVH A;  4L5L A;  2IFQ A;  3EIN A;  1WOU A;  4EDY A;  3KJY A;  1YDK A;  1TU8 A;  3LXT A;  2OAD A;  2FCH A;  2L5L A;  1TK5 B;  1J9B A;  1VF1 A;  1S3A A;  2DJ3 A;  3EC3 A;  2YV7 A;  1GLQ A;  2H66 A;  1XOA A;  2YWO A;  3TKR A;  3IOS A;  5H5S A;  3GSS A;  2G0F A;  4BA7 A;  5AGY A;  4WKW A;  2PVO C;  1ZZY A;  3S9F A;  3D6I A;  1Q98 A;  3FZ9 A;  2NTO A;  4L5O A;  4J57 E;  3IPZ A;  2KP1 A;  4XHM A;  4IGJ A;  4TKY A;  5GAP D;  4RUV A;  5HR1 A;  4O5U A;  5CRE A;  2RLI A;  4L0W A;  2OBI A;  4YQM A;  3DXB A;  1N2A A;  4PUF C;  3KP9 A;  3QFA C;  2AHE A;  2CA8 A;  4ECI A;  2L6D A;  6GST A;  2PMT A;  4MF5 A;  1AAZ A;  2XHF A;  1SK2 A;  2XC2 A;  5IMD A;  2HI7 A;  4XS6 A;  5CAX A;  4OO4 A;  4Z2R A;  2IL3 A;  1IYI A;  1GSQ A;  1O85 A;  3WT1 A;  2FLS A;  5KN0 A;  4HZ2 A;  4IBP A;  1W89 A;  4WET A;  4XTS A;  2A2R A;  3F3Q A;  5ECI B;  5ELG A;  2FD3 A;  1USB A;  3F6F A;  5CRG A;  1FOH A;  3UBL A;  5F07 A;  3CBU A;  3WD6 A;  1F37 A;  1S3C A;  3PIN A;  1XZO A;  1SK1 A;  2OKA A;  2OE3 A;  2HRK A;  3U5R E;  5FWG A;  4MDC A;  1A8Y A;  3EU3 A;  2PBJ A;  3KD0 A;  4CW9 A;  3KGK A;  1OKD A;  4I6X A;  1OE8 A;  4OFM A;  4PQI A;  2X99 A;  4JR6 A;  4RQX A;  3UEM A;  3M3M A;  4I8B A;  1HYU A;  2YOI A;  2PWJ A;  2PVQ A;  3A2W A;  5HR3 A;  1Z6M A;  4BPY A;  3D4T A;  3UJ1 A;  6GSY A;  1MTC A;  2O8V B;  2DBC A;  3F8U A;  4EVM A;  2HE3 A;  3L78 A;  4PUR A;  2ZUP A;  1XW5 A;  4HJ2 A;  1VGL A;  1R7H A;  3TJK A;  2MMZ A;  5EY6 A;  1K0D A;  3EMP A;  1ZCP A;  5G31 A;  4MZB A;  3M0F A;  4DSQ A;  1E6B A;  4G10 A;  3PR8 A;  1O6J A;  2MBS A;  4TR0 A;  4OWY A;  4ZXG A;  4BVY B;  5KN2 A;  2H30 A;  5H5R A;  4I2T A;  1TOF A;  1SYX A;  4V1A g;  2FWH A;  1Z9H A;  4TXO B;  1MDK A;  2CT6 A;  3W6G A;  3Q6O A;  2N5F A;  3FZ5 A;  3P8W A;  2H1D A;  4LA1 A;  2R5G A;  2VO4 A;  4XIH A;  4BVY A;  5DQY A;  2FA8 A;  2O89 A;  3GUR A;  1PD2 1;  2LNS A;  2L4Q A;  3KIJ A;  3MIX A;  1K3L A;  1QXH A;  1FG4 A;  1ST9 A;  4JU5 A;  4MH3 A;  2OA7 A;  4TXO A;  1ACV A;  4HJM A;  2I4A A;  3ZL5 A;  2N5A A;  2D2Z A;  3HXS A;  3N9J A;  1PL1 A;  1EOG A;  3QMX A;  1ILO A;  3K8N A;  3NIV A;  3H8Q A;  1YKC A;  5CRW A;  2EIR A;  17GS A;  2H6Z A;  5ID2 B;  2C4J A;  4FIW A;  4PNF A;  2Z9S A;  5ECQ B;  4TRX A;  2VL3 A;  4JE1 A;  1EGR A;  1V98 A;  3H4K A;  4GQF A;  3LXZ A;  1ON4 A;  5IOX A;  2JZR A;  1F3B A;  4P3Y B;  2H1B A;  8GSS A;  2RII A;  1R26 A;  5D96 A;  2GSS A;  4O5R A;  5ID2 A;  4JZQ A;  1WIK A;  4EDZ A;  2J23 A;  3MSZ A;  3MYD A;  4IQA A;  1A0R P;  2REM A;  4BWQ A;  4MJC A;  5HQP A;  3FKF A;  4G0L A;  3SWL A;  4I5Q A;  3ZZX A;  2H0I A;  5ECM B;  4ZIL A;  3HZ4 A;  4MPF A;  4IQ1 A;  4KA0 A;  1SU9 A;  4O32 A;  2J9H A;  3VLN A;  4KDY A;  2H1G A;  3TOT A;  22GS A;  4K8M A;  1Z7R A;  5G30 A;  4GCI A;  5EPF A;  1UN2 A;  5C00 A;  2JSY A;  2LRN A;  2C8U A;  2YZU A;  1U3I A;  2FA4 A;  2YZH A;  5ECR B;  3ERG A;  3M1G A;  5J9C A;  1JZR A;  2LTK A;  1YEP A;  2CV4 A;  1FAA A;  3CRT A;  4JRR A;  4RQR A;  2AV4 A;  2CZ3 A;  5G5F A;  2WS2 A;  3CYN A;  2PUK C;  2VD0 A;  3GX0 A;  1GNE A;  3GNJ A;  4GF0 A;  2X49 A;  3H93 A;  4NWY A;  2LNT A;  3DVX A;  1KBN A;  4BL7 B;  2YWN A;  1F3A A;  2GT5 A;  3FYG A;  1WP0 A;  3FR6 A;  5JWR B;  4Q5R A;  1A23 A;  2V6K A;  1QK8 A;  1EOH A;  1TRU A;  4MLY A;  2C3N A;  3A5I A;  2DIY A;  2HLS A;  1JLV A;  1KEB A;  4FQU A;  3I6A A;  1EWX A;  4BL7 A;  2F51 A;  2DIZ A;  3NOF A;  5IMC A;  5J4U A;  5ECO B;  1DSB A;  3APO A;  1R5P A;  2A4H A;  3VPQ A;  3HVX A;  2P5R A;  2PGT A;  4KDU A;  4DVC A;  4LL4 B;  3WGD A;  1B9X C;  1UC7 A;  2DJ1 A;  2VCZ A;  3MNG A;  3GRX A;  1XWB A;  1V2A A;  5GZZ B;  4Z2T A;  5CRH A;  4HUA A;  11GS A;  1K3O A;  1O8W A;  1GH2 A;  4ID0 A;  3KMN A;  3VWU A;  5AIS A;  3L4N A;  1AQW A;  4JR4 A;  4L0U A;  1V40 A;  4Z7X A;  2C0F A;  4FYB A;  3ISO A;  3GKX A;  5D8I A;  2IMK A;  3HJM A;  2YJ7 A;  2GQL A;  3F4S A;  2ES7 A;  1OC8 A;  1JZW A;  3FR3 A;  2IPA A;  1PX7 A;  3I43 A;  1T7P B;  4G2E A;  2YWM A;  3VI7 A;  4YAP A;  1PN0 A;  2C80 A;  2GT6 A;  4CY8 A;  3RPN A;  4PGT A;  4X4J A;  3TKS C;  5DQS A;  4OD7 A;  3P7X A;  2WZ9 A;  4YQV A;  1X9M B;  2XPD A;  4BVX A;  1GUM A;  4ZL8 A;  3VI5 A;  1EEJ A;  3W8J A;  1VF4 A;  3D22 A;  4V2M A;  2B6M A;  3QAG A;  3GUS A;  2TIR A;  3WGX A;  3FEU A;  3W8S A;  1Y25 A;  1Z5Y E;  5J5N A;  2VLV A;  1GL8 A;  4HDE A;  4A5P A;  2H70 A;  2PER A;  4RI6 A;  3GKN A;  2B7J A;  3IRA A;  3O6T A;  3PH9 A;  5HFG A;  2VL2 A;  4MJE A;  4K5R A;  4KB3 A;  5A4V A;  4KAE A;  3F9U A;  1H4O A;  2F9S A;  3TKS A;  1M2D A;  2HSM A;  2R4V A;  3VWW A;  5CNW A;  2O85 A;  1FVK A;  2ON7 A;  4K6X A;  4J2F A;  2HZE B;  3E9J B;  3EYT A;  1OC3 A;  2I3Y A;  1PA3 A;  1RW1 A;  1F2E A;  3KMO A;  2E0Q A;  3GKK A;  4POM A;  4EE0 A;  1XIY A;  14GS A;  1PKW A;  1XOB A;  4AJ6 A;  2HZE A;  2VAF A;  1XVW A;  2YN1 A;  1U87 A;  1VF2 A;  4WBJ A;  3TJB A;  2R0C A;  3H1N A;  2A2S A;  2EC4 A;  3G7Y A;  3ZYW A;  4MJA A;  4GWR A;  1URM A;  3GMF A;  2B3S A;  3D5J A;  3J7Y k;  4HZ4 A;  4KE3 A;  3F0I A;  4AGS A;  2DJ2 A;  5CYY A;  3CXG A;  2LRC A;  1GTA A;  3G7J A;  1NSW A;  2GSR A;  1OYJ A;  3MDK A;  2WDU A;  2MZC A;  4MZC A;  2VOC A;  4PXO A;  2IJY A;  2IWT A;  4MNN A;  1QFN A;  2G2Q A;  5DBQ A;  3ZMK A;  4TOP A;  1DBY A;  2K9F A;  4HU9 A;  3C8E A;  3HD5 A;  3TKS E;  1XW9 A;  5B8B A;  3BCK A;  1MDJ A;  1A2M A;  2JZT A;  4MK3 A;  2YAN A;  1H75 A;  3FZ4 A;  2DLX A;  3V1W A;  5IPH A;  1AC1 A;  4POK A;  5F06 A;  2DMM A;  4POB A;  2R0G A;  2L5O A;  3VWX A;  1ERW A;  2V2G A;  2RM5 A;  3APQ A;  2R3X A;  4NPB A;  2B5E A;  4GSS A;  1G0T A;  5IMA A;  2YPM A;  5KOX A;  1EV4 A;  2VLU A;  1WPI A;  4ML1 A;  3ZRE A;  2LST A;  1X5E A;  1LJR A;  3US3 A;  3LJR A;  3RPP A;  2C3T A;  5B8A A;  3H79 A;  2R6K A;  4I2U A;  1MD4 A;  2R2J A;  1SD9 A;  2GZY A;  3ERW A;  4GST A;  3HKR A;  3IBH A;  5ECN B;  2VCT A;  2C0G A;  2DJK A;  2HYX A;  1B8X A;  2NDO A;  6GSU A;  4K2D A;  3WYW A;  3KEB A;  3IA1 A;  3VUR A;  1MD3 A;  3P2A A;  2HRF A;  1GSS A;  1K0C A;  1GSU A;  2M46 A;  4YQU A;  1IYH A;  2VD1 A;  5IM9 A;  12GS A;  1BAY A;  5FHI A;  3VFI A;  1CQH A;  4NHZ A;  3LFL A;  2LUS A;  4PQH A;  4EXJ A;  5IOW A;  1GWC A;  1S3D A;  1EP8 A;  1YF1 A;  3HDC A;  4IW9 A;  1T8E B;  1M2B A;  3L0H A;  1SKW B;  2KHP A;  2O87 A;  1TXX A;  1TRW A;  4F0B A;  3TRP A;  5ECK B;  1SL0 B;  1O7U A;  2L4C A;  2MMO A;  2LQQ A;  2E2G A;  2H71 A;  5IQY A;  1SKS B;  5KEJ A;  5JWQ B;  5ECS A;  5G2Z A;  5GST A;  1FVJ A;  1BQ7 A;  3GFK A;  2QC7 A;  2RUF A;  3WGE A;  3CSH A;  4NHW A;  2NVL A;  1HQO A;  1J08 A;  1E2Y A;  1WJK A;  1B9Y C;  2IIY A;  4MF6 A;  2N5B A;  4RI7 A;  4IKH A;  1GSE A;  20GS A;  3LW9 A;  4IEL A;  2GS3 A;  4YKF A;  5DVB A;  3HZ8 A;  4OCE A;  4PQ1 A;  3IHQ A;  3R3E A;  3VK9 A;  1PKZ A;  2VCV A;  2OJL A;  2LJA A;  4ZL7 A;  13GS A;  2PU9 C;  3RHC A;  5L71 A;  2FGX A;  5G5E A;  2V32 A;  2L57 A;  4KUN A;  1ZYE A;  2B1K A;  2QSI A;  3GST A;  4O5Q A;  3EE2 A;  4GQC A;  3KCM A;  4WF5 A;  2C0D A;  4HEA 2;  4AJ8 A;  1YJ6 A;  1ZMA A;  5ABR A;  1QGV A;  3QAW A;  3QPM A;  3C73 A;  1JFU A;  1QUW A;  3KP8 A;  3LGC A;  4X0X A;  3IC8 A;  1DUG A;  1WRY A;  1PGT A;  2TRC P;  4NV2 A;  6GSS A;  1A24 A;  3IXR A;  1XXU A;  1WWJ A;  3IE3 A;  2VCX A;  1X9W B;  3ZIT A;  2CQ9 A;  4E8H A;  2FY6 A;  3C7M A;  2K6V A;  4GRF A;  1CQG A;  4POL A;  4OO5 A;  2E2M A;  3FW2 A;  3UAR A;  4ZBB A;  2MBT A;  1Z6N A;  3MWH A;  4NV5 A;  2CX4 A;  2DJ0 A;  3DVW A;  2HFD A;  3GH6 A;  2H19 A;  3IAS 2;  3LWA A;  5IMF A;  1PX6 A;  3IDV A;  4HI7 A;  1VRS D;  1FB6 A;  2ALB A;  2LQO A;  1TK0 B;  4K0G A;  1PRX A;  2CAQ A;  5D9T A;  5B7C A;  1TKD B;  3C71 A;  4X1U A;  2X64 A;  3GYK A;  2AAW A;  3GTU B;  1T4Y A;  4Q5F A;  1VF3 A;  1HD2 A;  2C1Y A;  4FO5 A;  3BCI A;  2L59 A;  1B4Q A;  1U3A A;  2OBK A;  2F8A A;  4N10 A;  2H8L A;  4ICY A;  1X5D A;  3GTU A;  5E59 A;  1GNW A;  3TOU A;  4N0Z A;  1C72 A;  5LD0 A;  3UBK A;  1AQX A;  4TN8 A;  3IV4 A;  3WT2 A;  4LL1 B;  4PUA A;  4IVF A;  1ML6 A;  5ECP B;  2OE1 A;  1ERU A;  2DC5 A;  2B7K A;  5D93 A;  4O7H A;  1O81 A;  5A4W A;  4V1A p;  4WEY A;  2FUG 2;  2WUL A;  5GAN D;  3DYR A;  2GZZ A;  5HR2 A;  2K8V A;  4G0K A;  3ZFL A;  1ZYQ B;  1SJI A;  5B6N A;  5COH A;  1BG5 A;  7GSS A;  2LJR A;  1T1V A;  3HJP A;  1YZX A;  1M9A A;  3O76 A;  6GSX A;  4WXT A;  5CRD A;  2OAC A;  1X5C A;  2IN3 A;  1A2L A;  2K18 A;  4XCS A;  2HT9 A;  1M99 A;  4XRA A;  3FMW A;  2DSA A;  5F05 A;  1OAZ A;  5A5K A;  2FNO A;  2KLX A;  4ZB8 A;  2UZ8 A;  4K1F A;  3UAP A;  3UIW A;  4YAV A;  4G9H A;  3TCO A;  4E8E A;  1F6M C;  2A2P A;  3TJF A;  1XFL A;  2VCQ A;  2I1U A;  2C0E A;  1ZL9 A;  2VL2 C;  3GH9 A;  1TW9 A;  4AF2 A;  1SK0 A;  5ECH B;  4KCE A;  3VWV A;  3TKP A;  3EPT A;  2JZS A;  3EUR A;  3UL3 A;  1KNG A;  5KOW A;  1TJD A;  1U6T A;  2HXK A;  3FK8 A;  19GS A;  4ZB9 A;  4F03 A;  2P5Q A;  4DSS B;  2H0G A;  2JAD A;  4Q5N A;  1EV9 A;  10GS A;  3E0U A;  1TU7 A;  3KH9 A;  4GSN A;  4IJI A;  1GUH A;  3RAZ A;  1SD8 A;  4KH7 A;  3FRC A;  2AB6 A;  4F82 A;  3DKS A;  3KH7 A;  4DSS A;  3UOM A;  4ULX A;  4EKZ A;  2F8F A;  1ZGN A;  2LKU A;  1M7T A;  4KSO A;  4H86 A;  2GDR A;  1OE7 A;  1TI3 A;  2GZP A;  3IK9 A;  2YNX A;  2P31 A;  3EU4 A;  1HNB A;  1QQ2 A;  4CY6 A;  3D21 A;  5DCG A;  2KP2 A;  4GLT A;  5LNK e;  1NHO A;  2H72 A;  4NAX A;  4K7O A;  3KTL A;  1V57 A;  4KND A;  1GUL A;  5IO0 A;  2QA2 A;  4JED A;  1SEN A;  4MH2 A;  3TRQ A;  4ZBA A;  2CAI A;  3C1R A;  4FH8 A;  5H5Q A;  1FW1 A;  2XBI A;  5KN1 A;  3Q18 A;  5D73 A;  4PTS A;  1BX9 A;  5DJM A;  3LYP A;  1SL1 B;  2O7K A;  1ZOF A;  3OR5 A;  4L8E A;  3TB2 A;  2I9H A;  4I97 A;  4CDO A;  2WJU A;  3CSJ A;  5F8B A;  1FB0 A;  2VL9 A;  2H74 A;  2H73 A;  1MDI A;  4KCA A;  2IME A;  2LEG A;  2KOK A;  1FOV A;  3LEF A;  3KM6 A;  2K8S A;  1SYR A;  3EWL A;  4IP6 A;  9GSS A;  4DSR A;  2YV9 A;  2F3M A;  1XCC A;  1GTU A;  2E7P A;  2IMD A;  5A4U A;  4EL1 A;  4ILF A;  1O8X A;  2C3Q A;  3M9J A;  3QD9 A;  4K7N A;  4KF9 A;  3TKQ A;  4ECC A;  1X9S B;  2GLR A;  1R4W A;  3HCZ A;  2V1M A;  2YWI A;  4HU7 A;  2OE0 A;  2ON5 A;  1JHB A;  3M9K A;  4OFN A;  3PPU A;  3TGZ A;  4J56 E;  3JCM L;  3GL3 A;  4ECB A;  1TI1 A;  1EEM A;  4X43 A;  5CP1 A;  1NM3 A;  4V2L A;  3LYK A;  4XS1 A;  2DJJ A;  1T00 A;  2B5Y A;  1THO A;  1ZYP A;  3HYP A;  4F2I A;  3ERF A;  3RDW A;  1NW2 A;  3DRN A;  5LCZ A;  4LMW A;  1X0R A;  1XW6 A;  1Y6E A;  2CX3 A;  3VPT A;  2HRA A;  1OKT A;  5DCH A;  3QFB C;  1BYE A;  4USS A;  5JCG A;  5ECL B;  4NMU A;  1XWA A;  3FY7 A;  5CO3 A;  1TK8 B;  3A2V A;  1I5G A;  1UVZ A;  3F63 A;  2X8G A;  4WBR D;  1EP7 A;  2TRX A;  1G6W A;  4HS1 A;  5FT3 A;  2DKH A;  2FWE A;  5C04 A;  3GX8 A;  3DD3 A;  3DWV A;  2YCD A;  1QMV A;  5EVO A;  4LLR A;  2MYG A;  4MPG A;  4AJ7 A;  5AIV A;  3MAK A;  1TRV A;  2MMA A;  3GIX A;  4QL7 A;  2M80 A;  4ZBD A;  2H6X A;  2IMI A;  1F9M A;  1AQV A;  4TVE A;  4ZB6 A;  3P90 A;  4N11 A;  1XWG A;  2VM2 A;  3SBC A;  2LJK A;  4KW6 A;  2VUP A;  1T3B A;  2JSZ A;  3LG6 A;  1G7E A;  5J9B A;  1LU4 A;  1KTE A;  4HQZ A;  5IMZ A;  2PN8 A;  3QCP A;  4O92 A;  2IMF A;  2FWG A;  3IK7 A;  1OVN A;  2L6C A;  1EGO A;  4F0C A;  2LS5 A;  5EL8 A;  2X8C A;  1XVQ A;  2H1A A;  1K3Y A;  4ZL9 A;  5HFI A;  2AUV A;  4ECJ A;  6GSV A;  2ZCT A;  1MEK A;  3BBY A;  3GL5 A;  5DAK B;  1JZO A;  4EUY A;  3L9V A;  4F9Z A;  2H76 A;  3L9S A;  2VM1 A;  2B5X A;  3L9U A;  2A4V A;  2V6O A;  3RBT A;  1ERT A;  1O73 A;  4K7I A;  2CVK A;  2WB9 A;  1ABA A;  1SKR B;  2JU5 A;  1TP9 A;  4TR1 B;  5DAK A;  5J41 A;  4MF7 A;  5F0G A;  1UA5 A;  3QR6 A;  4ML6 A;  4N30 A;  5D9X A;  3G9B A;  5DAL B;  3ZFB A;  5B6M A;  4EO3 A;  1K0O A;  5JWO B;  3PGT A;  2GSQ A;  5HR0 A;  4QQ7 A;  2GST A;  3UMA A;  1HNC A;  4PX1 A;  3ED3 A;  2MMN A;  4OMV A;  2DKI A;  4TR1 A;  3ZVJ D;  1SJ6 A;  5INY A;  2RM6 A;  2I81 A;  5HFK A;  5DAL A;  3EMX A;  5DDL A;  1M2A A;  3CTF A;  1PL2 A;  2BTO T;  2AJQ B;  2HNL A;  4KGI A;  3F6D A;  1YY7 A;  3D0Z A;  3G7I A;  5AN1 A;  4HOJ A;  3J7Y b;  2VIM A;  4Q5Q A;  2QKE A;  3C1S A;  2WFC A;  4GTU A;  4TXV A;  1PQN A;  3N5O A;  4K9Z A;  1GP1 A;  2GVP A;  1EZK A;  1M9B A;  3R2Q A;  6GSW A;  5J3R A;  1GTB A;  3GA4 A;  3QAV A;  4MZW A;  4N0V A;  1YEX A;  4YKG A;  4MMM A;  4MCU A;  1JLW A;  1FO5 A;  5AIX A;  2FWF A;  3CTG A;  5E4W A;  5GSS A;  2BJX A;  3BOA A;  4QL9 A;  3CSI A;  2YJH A;  5BMU A;  1U88 A;  3HJO A;  1GLP A;  3UVT A;  2H01 A;  2QGV A;  2NBS A;  4LMV A;  5G1L A;  5JCU A;  3TDG A;  3F4T A;  2RUE A;  1SL2 B;  1K0B A;  1ZYN A;  2DML A;  4EC0 A;  1OC9 B;  3GKM A;  4GXZ A;  1GSD A;  1XWK A;  2AYT A;  3M8N A;  5IO2 A;  3HY2 A;  4WF4 A;  1N8J A;  1ERV A;  1G7O A;  2GGT A;  1G6Y A;  3BJ5 A;  1XBS A;  1BJX A;  3F3R A;  4KX4 A;  2PPT A;  2XPE A;  2LRT A;  3IHG A;  5D9W A;  3QOU A;  4ZIJ A;  1YKA A;  3ZML A;  5JCW A;  1OC9 A;  3D4M A;  4TR3 A;  5BRT A;  1DE2 A;  1M0U A;  2R0P A;  1BED A;  3Q19 A;  3GN3 A;  4TR4 A;  2WRT A;  4FYC A;  1NHY A;  1A8L A;  3KZQ A;  4EIP A;  2B1L A;  5DJL A;  1I9D A;  1V9W A;  3LOR A;  5IMV A;  2KUC A;  3DIE A;  3GHA A;  3I9V 2;  3CRU A;  4K5S A;  1A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...