2F51A

Structure of trichomonas vaginalis thioredoxin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
111
structure length
111
Chain Sequence
SDPIVHFNGTHEALLNRIKEAPGLVLVDFFATWCGPCQRLGQILPSIAEANKDVTFIKVDVDKNGNAADAYGVSSIPALFFVKKEGNEIKTLDQFVGADVSRIKADIEKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title High-resolution structure of recombinant Trichomonas vaginalis thioredoxin.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 29
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2f51A00
4OO5A 2X8HA 4AGSA 2CX3A 3OR5A 4KH7A 4LMWA 2MBSA 4XRAA 1GL8A 4IP6A 1ZL9A 3TB2A 2H0GA 3P90A 1YY7A 2LEGA 2J9HA 1SD8A 1A2JA 4YH2A 1ML6A 1Z5YE 1WIKA 3PH9A 5FWGA 4HUAA 3NZNA 5GZZB 4HOJA 1ERUA 3L9SA 3G7JA 4HU7A 3IXRA 1OC9A 2GSRA 2JZTA 5D9XA 3VPQA 2C8UA 2YZUA 2F3MA 5D73A 5JCUA 1AC1A 3MSZA 2JU5A 3ZRDA 1XVQA 1Y6EA 1F6MC 2L6CA 3FR3A 4XS6A 1QQ2A 3IV4A 4N0ZA 1S3AA 1ST9A 3KCMA 4GRFA 4KDXA 4F03A 2AHEA 4MPFA 5B6MA 3KIJA 3GRXA 4JU5A 4YAVA 5ECLB 1S3CA 4H86A 2H73A 1J0FA 3ZVJD 3FY7A 3QR6A 4IS0A 2WDUA 5D9VA 5IMFA 1OKDA 3HZ8A 3W6GA 1XIYA 2RLIA 5H5QA 5COHA 2V6KA 1U6TA 4K6XA 2ON5A 3GH9A 3ZTLA 1B9XC 2C3TA 4ZBBA 3NOFA 4WBRD 2L59A 1EP8A 2CAIA 3O3TA 2R6KA 3Q19A 5CRWA 3FZ5A 4TXOA 2H6YA 4GSTA 4KE3A 1Z7PA 4FYCA 1F2EA 5A4WA 4OCEA 1YDKA 4MH3A 4F0BA 1MDJA 2EIRA 5CP1A 3ZLPA 2DMLA 1Y25A 1G6WA 2O85A 1TXXA 1G6YA 2IFQB 2R4VA 4ZL7A 3BD2A 2H6XA 3K8NA 1GSYA 2YWOA 2ZCTA 3TJKA 1F3AA 2YPMA 5B6NA 18GSA 5EVOA 2JSZA 1GLQA 2OKAA 2V2GA 5CREA 1PQNA 3W8JA 3D4TA 4EE0A 2O87A 3ZVJA 5IOWA 3D4MA 2AB6A 1JZOA 1EOGA 5D9TA 4IVFA 1UN2A 13GSA 4I97A 3FR6A 3KH9A 1SK0A 1FB6A 2HLSA 1HNCA 1GSFA 3IDVA 3JCML 1URMA 4JEDA 1WE0A 3G7YA 4XIHA 4TW5A 4O92A 2C4JA 14GSA 3ZL5A 1TJDA 2VCXA 2O8VB 4L5OA 5G1KA 4RI6A 1HNBA 2C0EA 5LD0A 4OFMA 3UIWA 3DWVA 3TJFA 3HJOA 3H93A 1SJIA 3ZFLA 4LMVA 3I69A 2FA4A 3LYKA 3UAPA 5A4VA 2J23A 2QGVA 1EZKA 1GTIA 2FD3A 1TU7A 1U88A 1AQXA 2YANA 1JHBA 1VF3A 3L9UA 1BAYA 1M9AA 3PINA 3VWUA 1SKSB 1XW9A 2NTOA 2VCVA 3HVVA 4OCFA 2LSTA 1GSEA 4KSMA 3DRNA 2DJ1A 1NHOA 3BJ5A 2CAQA 2OE1A 2RUEA 4EKZA 4MJAA 1E6BA 1Z6MA 5HR0A 2IN3A 1NHYA 5D9WA 1SENA 2YJHA 4XHMA 3UMAA 1M7TA 5HQPA 3ERWA 1JLVA 4ZB6A 1EOHA 1OKTA 3UARA 3RPNA 7GSSA 1YKAA 4HDEA 3FZAA 1A2LA 5A4UA 2XHFA 2TIRA 3H8QA 4KB3A 2IMKA 1F37A 2K18A 1SK1A 3VLNA 4PURA 5J9BA 1OC3A 5D8IA 3EYTA 4ZBAA 6GSSA 1MTCA 2Z9SA 3UBKA 4TN8A 4HZ4A 4EF0A 3C1SA 2HE3A 1V57A 1SK2A 1GSQA 1UA5A 2HSYA 2KOKA 4OFNA 2DJ0A 2PMTA 5F07A 5J4UA 3KH7A 5H5RA 5B8BA 5HR1A 4PQIA 3ZIJA 4KDUA 3UOMA 3L78A 2VL2A 3HYPA 4NPBA 3UVHA 3FYGA 5J9CA 3HXSA 1QXHA 1H75A 5HFIA 4RUVA 3LXZA 4POBA 4GQCA 3GX8A 4NMUA 1AW9A 2GT6A 4DSSB 2LJAA 2A4VA 1ZZYA 4WR5A 3TKRA 3VK9A 2GSQA 6GSWA 1SD9A 1I9DA 3G7IA 1WWJA 3P7XA 4KCEA 5IMZA 2VD1A 2KP2A 3EU3A 1OVNA 2IMIA 3IOSA 3IAM2 3Q74A 1YF0A 4TR1A 5G5FA 2K6VA 1BX9A 3WGEA 1M99A 2WGRA 3GKNA 2GQKA 5LCZA 2GLRA 4ECCA 1X0RA 1N2AA 2LRCA 5ELAA 4MH2A 4MABA 4JBBA 2YN1A 4J56E 5DALA 4PUFC 5IOXA 1XW5A 3KMNA 2VOCA 3VI5A 2LNSA 2M72A 1AXDA 4O7HA 3D21A 2CVDA 4TR3A 4IBPA 12GSA 2GSTA 3I9V2 2DMMA 1XWCA 1X5DA 1ZMAA 1GUKA 4MZCA 1SYXA 3L0HA 2WZ9A 3HD5A 2DBCA 4QL7A 3TRPA 1B4QA 1VF4A 4GSNA 4MZBA 3SBCA 3ZREA 1FVJA 1DSBA 2H1DA 1VF2A 2PU9C 4NAXA 2A2SA 4IW9A 2KHPA 1A0FA 5CAXA 1MD4A 4KGIA 1K0OA 2TRXA 3PGTA 1T4ZA 4NWYA 4HEA2 1XXUA 3ME7A 4HJMA 5INYA 1X5CA 1TKDB 1OE7A 2H01A 2OE3A 4K7NA 3M1GA 1DE2A 2FCHA 2H72A 4YAPA 3CTGA 1XPVA 2XBIA 2C0DA 2DIZA 2B5XA 3VWVA 1SU9A 2B7JA 1FOVA 2FA8A 4BVXA 5KN0A 4L0UA 2R5GA 2FWFA 3BOAA 1FHEA 1Z3EA 2AUVA 4I5QA 1PKZA 5CRDA 1NW2A 4IN0A 2LJRA 1BG5A 3HHVA 1KEBA 3EVIA 2AJQB 4ZBDA 2GDRA 2K8VA 4GWRA 4RQRA 1PN9A 3C8EA 4IJ3A 3KTLA 4TRXA 4IKHA 2LRTA 1R5AA 3FEUA 1JZRA 4EUYA 3KGKA 2C0FA 5GAPD 1Z7RA 2GZPA 2M80A 17GSA 1K3OA 5JWRB 3GTUA 4WKWA 5AGYA 2MMOA 5ECOB 4GTUA 1AAZA 2OE0A 5IM9A 4TKYA 2L4CA 3EE2A 3ERFA 4KCAA 1YQ1A 1RQMA 2DJ3A 2YP6A 2KLXA 4IELA 2HZEA 1O8XA 2YNXA 3APSA 2FLSA 1O85A 3VURA 3E3EA 1GSSA 3WD6A 5DQSA 2X8CA 3Q18A 4BVYA 3ZYWA 4NV2A 4J2FA 3FZ9A 3KXOA 3HZ4A 4NHWA 3DYRA 1UC7A 1A24A 1GUMA 2O89A 1A8YA 3CMIA 4GF0A 4BPYA 1DBYA 1WMJA 3N5OA 4MJBA 4KUNA 4I6XA 2HZFA 2CV4A 4AJ6A 3LWAA 3F6FA 4PQ1A 1PSQA 1ILOA 2XC2A 5J5NA 2VLVA 1O7UA 2WULA 2HNLA 1A0RP 3KD0A 2NDOA 1EV4A 4IGJA 1TP9A 4WF4A 3ED3A 1XBSA 3F3QA 3FKFA 2PPTA 3TCOA 3DGQA 1PA3A 8GSSA 1UVZA 2R3XA 4V2NA 5J41A 1ZYQB 4OFTA 4G10A 3KMOA 2RM6A 5ECIB 4ID0A 1ERWA 1EEMA 5DBQA 4QQ7A 1JFUA 4FIWA 10GSA 2B7KA 5DCHA 2L4QA 3V1WA 4I2UA 4CHSA 2V1MA 3C7MA 4PNGA 3CBUA 4ECBA 4WBJA 5IPHA 5G5EA 2CX4A 1H4OA 1XOBA 3E0UA 5D96A 1X9WB 3GX0A 5E4WA 5J3RA 2VCZA 3EC3A 6GSYA 1SKRB 1GP1A 1KTEA 2HRFA 1V98A 1FG4A 2ZNMA 1YZXA 3LORA 11GSA 3WYWA 19GSA 1XWBA 2YWIA 1X9SB 1B4PA 3HY2A 2AV4A 5ECRB 2REMA 3VI7A 2LQQA 1TK0B 2E0QA 2LRNA 3F9UA 4N11A 4K7OA 4FO5A 2DJJA 3LYPA 4Q5FA 3BCIA 3VPTA 3MNGA 3GA4A 3GIXA 22GSA 4KW6A 4KSOA 5B7CA 1LJRA 1EP7A 2LUSA 2F51A 4KAEA 2G2QA 4O5RA 3ZMLA 2JZRA 3RHBA 3UL3A 4KX4A 1THOA 4XCSA 1YEPA 3QD9A 3L4NA 1G0TA 3SWLA 4JZQA 2IFQA 2ZUPA 1XFLA 5ECKB 4D73A 2HFDA 3QAVA 2TRCP 4ISDA 4YQVA 1R26A 3TJJA 1QFNA 5DDLA 3QOUA 3DXBA 5CYYA 2GZZA 2MYGA 3F63A 4K2DA 4Q5QA 1KNGA 2JADA 3LJRA 3E9JB 1M2BA 3O76A 3A5WA 2C0GA 2L5OA 1U3IA 3A2XA 1XWGA 3F3RA 3GKKA 2L6DA 5G2ZA 1AUCA 2O7KA 1AQVA 1K3YA 2DC5A 2I3YA 4ZIJA 2C3NA 2CA8A 3KP9A 3EWLA 4XTSA 3BBYA 4WXTA 2FUG2 4NHZA 1K0MA 2H1AA 3LXTA 3TUEA 1XWAA 1W89A 2H71A 3HA9A 1GTAA 4AF2A 2IWTA 3QFBC 3IPZA 3M9JA 4G19A 1TW9A 1T4YA 1LBKA 1WP0A 1WPIA 2N5AA 3FHKA 2ALBA 3CSHA 4WETA 5EPFA 3UBLA 2VLUA 2L57A 3W8SA 4BL7A 3ZIVA 1X9MB 3QMXA 5GSTA 2H70A 2VLTA 3GNJA 2CVBA 5B8AA 3H4KA 4I8BA 1JZDA 2H0HA 1U3AA 5ID2A 2CZ3A 2B5EA 4FH8A 3LG6A 2I81A 2GVPA 4IJIA 5F0GA 3FW2A 1PD21 3WT2A 1ZOFA 3RHCA 1CQGA 3FZ4A 3FR9A 4ZXGA 1K0CA 1NSWA 4ZILA 1C72A 3HVSA 3ZITA 1TDIA 3TOTA 2LJKA 2M46A 3LSZA 3P2AA 3C1RA 3HCZA 1THXA 4O32A 1PL1A 2GGTA 4TXVA 4AJ8A 2XPEA 1MD3A 2LKUA 4Z7XA 1EEJA 1U87A 3F4SA 1WRYA 4MA9A 2FWHA 1A2MA 1W4VA 4XS4B 1LU4A 1K0NA 3FRCA 4BWQA 4EDZA 1X5EA 4ILFA 2AAWA 1I5GA 4EDYA 3WT1A 2H66A 5DCGA 3APQA 2F8FA 2RIIA 4PQHA 4MDCA 4ZL8A 4LLRA 3WGDA 4F82A 4KDYA 4JRRA 4FYBA 1B9YC 1ZYEA 1TRWA 2C3QA 2GQMA 2YWNA 3QDNA 1E2YA 2WS2A 4V2LA 3KJYA 1BEDA 2VO4A 1A8LA 4TR4A 3D22A 2IPAA 5IMDA 3IA1A 4GQFA 1RW1A 2HT9A 3S9FA 2WRTA 5A5KA 4HI7A 1ACVA 3CYNA 2FY6A 3TOUA 1RK4A 3J7Yb 2B1KA 4DSSA 3H1NA 4X43A 3EURA 1XW6A 3M3MA 4PGTA 3KM6A 2H6ZA 5CRGA 2OADA 4MP4A 2VD0A 2YWMA 4OO4A 3M9KA 1FVKA 5IMVA 3GH6A 4MF6A 1ERTA 1O6JA 4ML1A 4NV5A 3GSTA 4NXIA 2MBTA 4LL4B 3RPPA 4L5LA 2A2RA 2PVQA 3U6VA 3GTUB 4MPGA 5ECMB 2OBIA 2PUKC 2QSIA 2YOIA 1AIUA 1OAZA 4HQZA 4QL9A 1HNAA 2KUCA 1V2AA 3QCPA 3RAZA 3ERGA 3EU4A 4MK3A 3A2WA 4BA7A 2HRNA 4Q5NA 3DIEA 5HFKA 3F4RA 3DKSA 2OACA 2HZEB 2PN8A 1V9WA 2C80A 2I4AA 1PX6A 4HJ2A 1A23A 2B5YA 2GTUA 1IYHA 3CTFA 1ZCPA 5ECPB 3WGXA 3G9BA 5GAND 3DVXA 4K0GA 5L71A 4DVCA 3M0FA 3R2QA 1OC9B 1PX7A 2JSYA 3J7Yk 2PGTA 3UVTA 4GSSA 4ZB8A 3I6AA 3PR8A 1XVWA 1TRSA 2PBJA 1VF1A 3HJMA 1ZGNA 4ZL9A 1XOAA 3TRXA 1K0DA 4V1Ap 4K1FA 1TRUA 4E8HA 1FW1A 1MDKA 3MAKA 2I9HA 2VIMA 5HFGA 3HVXA 3US3A 4WEYA 2V32A 2YV7A 3GKMA 1B48A 2IIYA 1HD2A 1R4WA 1VRSD 4DSRA 5KEJA 1N8JA 2EIQA 4TVEA 3TRQA 1O73A 3UEMA 2EC4A 2VL3A 2JZSA 6GSXA 4IHUA 5ENUA 4EVMA 5KN2A 4I2TA 5ELGA 3P8WA 4V2MA 4X1UA 3RBTA 2WCIA 3M8NA 3BCKA 4TXOB 3DD3A 4WR4A 2FWEA 5F06A 5AIVA 5ABRA 1SJZA 3TKQA 1O8WA 4DEJA 4K9ZA 3F6DA 2CT6A 2VCTA 1IYIA 5DAKA 3O6TA 2PWJA 3HJPA 1KBNA 5ECQB 4POMA 4XRDA 1JLWA 2E2MA 2IMDA 3CRUA 1Q4JA 1DE1A 3IK9A 2HSHA 3D6IA 5ECSA 5C00A 4K0NA 5CRHA 5AIXA 4MJCA 2C1YA 2MMNA 3A3TA 4YQUA 2ON7A 1V58A 5FT3A 4MJEA 5AN1A 1YJ6A 2LQOA 4IP1A 1BQ7A 4KA0A 2E2GA 1YKCA 3I43A 3GYKA 2KP1A 1Z9HA 4JR4A 1ABAA 3IE3A 1FAAA 5DQYA 3C71A 2YZHA 2IMFA 3CRTA 3IK7A 1M9BA 1TI3A 2GT5A 4CDOA 3GL3A 2FHEA 3TDGA 3DMLA 2XPDA 1K3LA 2MMAA 3CXGA 6GSVA 1GULA 1SYRA 1ERVA 3GHAA 2B3SA 2IJYA 2H1GA 3N9JA 3GN3A 1J08A 3IAS2 1T3BA 2B1LA 2H76A 4OWYA 5KN3A 4ML6A 3UJ1A 4D73B 3ZMKA 1PMTA 2ES7A 16GSA 4POLA 3IBHA 2IL3A 2RUFA 2BJXA 1T1VA 2WJUA 5JWOB 5DJLA 5G1LA 4G2EA 2DJ2A 1GH2A 1GSDA 2DIYA 2K9FA 1T8EB 3RDWA 2VCWA 3D5JA 3LGCA 3DEXA 6GSUA 1OYJA 4N10A 1T00A 4L0WA 2VUPA 2YV9A 3F8UA 4MF7A 2H8LA 4N0VA 4KNDA 2YJ7A 3VFIA 5DJMA 1WJKA 4ZB9A 1AQWA 1OE8A 1QK8A 2X99A 4K7IA 3QFAC 1QUWA 2QKEA 1O81A 4YQMA 1GRXA 4HS1A 2H74A 5CNWA 1SL0B 2E7PA 5HR3A 4MMMA 2LTKA 1F3BA 3GMFA 4CW9A 3LQ7A 3IHQA 1XZOA 2OA7A 2K8SA 3IR4A 3ISOA 5KN1A 2OJLA 2MZCA 3GV1A 1GNEA 5C04A 3ZZXA 2OBKA 4XS1A 3TGZA 5D93A 1MDIA 1ON4A 3TJGA 4X0XA 5G31A 1FO5A 5ID2B 1VGLA 2GS3A 2CQ9A 3L9VA 2EIOA 1HYUA 2B6MA 1WOUA 2MMZA 2YCDA 1BJXA 2DSAA 2WB9A 1TK5B 1YF1A 4L8EA 3GKXA 4GLTA 2D2ZA 20GSA 3KEBA 4EXJA 1R7HA 3F0IA 3KP8A 4IQAA 1EGRA 6GSTA 5IO2A 4HZ2A 4PX1A 1JZWA 2F9SA 1R5PA 4TOPA 1G7EA 2VL2C 5IPGA 2P0GA 5LNKe 1TI1A 4EL1A 2I1UA 3CSIA 4JE1A 1EWXA 3APOA 5EY6A 3VWXA 5ECNB 4EO3A 1PKWA 4OMVA 1QGVA 3Q6OA 3HDCA 3HKRA 2VL9A 5CO3A 4PUAA 1M2DA 3GFKA 5IQYA 1M2AA 4BWSA 4TR1B 4HU9A 4EC0A 1Z6NA 1SL1B 2HI7A 2X64A 1TK8B 4MF5A 3FK8A 2BTOT 3QPMA 1PL2A 1YEXA 2VM2A 3MWHA 1M0UA 2BMXA 1TOFA 3NIVA 4J57E 3LFLA 1HQOA 1F9MA 4MLYA 5F8BA 2VAFA 1TRVA 2FNOA 3TJBA 5DALB 2H30A 2PERA 3KTBA 4WF5A 1GLPA 1XWKA 1K0BA 1USBA 2P5QA 2P31A 5JCGA 1PRXA 2HXKA 1BYEA 4GXZA 2N5BA 3AY8A 3KZQA 1OC8A 3TKSC 1GWCA 4K8MA 4F0CA 2FWGA 2GQLA 2X8GA 2CVKA 3ZFBA 2DJKA 5E59A 5FHIA 3DVWA 2N5FA 2PVOC 2GSSA 4E8EA 1T7PB 2AYTA 1V40A 5G30A 3GSSA 4TR0A 4ECIA 1S3DA 1B8XA 2R2JA 2G0FA 1GUHA 4HQSA 2FGXA 2LS5A 5IMAA 3D0ZA 3A2VA 4FYUA 1TTZA 1SKWB 3TKSE 2GZYA 5DVBA 4MZWA 4MCUA 2WFCA 1GTUA 1K0AA 3IRAA 3EMPA 5EL8A 4ECJA 4N30A 3U5RE 4LL1B 3F4TA 3MDKA 2P5RA 3TKSA 5IO0A 3GUSA 4XS4A 1EGOA 4AJ7A 5H5SA 3ME8A 3CSJA 4PNFA 3TKPA 2NVLA 2CZ2A 3H79A 4RI7A 3EMXA 5JWQB 2IMEA 5IIZA 2R37A 2H0IA 2F8AA 1DUGA 3C73A 2HYXA 2JL4A 2LNTA 1NM3A 4PXOA 1GNWA 5GSSA 4V1Ag 1MEKA 2VCQA 1PGTA 2V41A 1TU8A 2V6OA 9GSSA 4ACSA 1G7OA 4LA1A 4P3YB 5HR2A 4POKA 4IQ1A 3GL5A 4DSQA 2XBQA 4F9ZA 4Q5RA 2LV3A 3GURA 2H1BA 5JCWA 1FB0A 2H19A 4F2IA 1CQHA 1GTBA 2NBSA 1SL2B 4G9HA 2JACA 4JR6A 2VM1A 2QC7A 3EINA 1J9BA 3QAGA 3LEFA 1XCCA 2L5LA 3QAWA 1SJ6A 5ECHB 4OD7A 5AISA 1EV9A 3IC4A 2DLXA 4GCIA 4ULXA 1Q98A 1GSUA 1QMVA 5DAKB 3VWWA 2NPBA 4RQXA 5F05A 5IMCA 2H75A 2RM5A
chains in the Genus database with same CATH superfamily
4OO5A 2X8HA 4AGSA 2CX3A 3OR5A 4KH7A 4LMWA 2MBSA 4XRAA 1GL8A 4IP6A 1ZL9A 3TB2A 4Z2UA 2H0GA 3P90A 1YY7A 2LEGA 2J9HA 1SD8A 1A2JA 4YH2A 1ML6A 3CQFA 1Z5YE 1WIKA 3PH9A 5FWGA 4HUAA 3NZNA 5GZZB 4HOJA 1ERUA 3L9SA 3G7JA 4HU7A 3IXRA 1OC9A 2GSRA 2JZTA 5D9XA 3VPQA 2C8UA 2YZUA 4KF9A 2F3MA 3EPTA 5D73A 5JCUA 1AC1A 3MSZA 2JU5A 3ZRDA 1XVQA 1Y6EA 1F6MC 2L6CA 3FR3A 4XS6A 1QQ2A 3IV4A 4N0ZA 1S3AA 1ST9A 3KCMA 4GRFA 4KDXA 4F03A 2AHEA 4MPFA 5B6MA 3KIJA 3GRXA 4JU5A 4YAVA 5ECLB 1S3CA 4H86A 2H73A 1J0FA 3ZVJD 3FY7A 3QR6A 4IS0A 2WDUA 5D9VA 5IMFA 5KOXA 1OKDA 3HZ8A 3W6GA 1XIYA 2RLIA 5H5QA 5COHA 2V6KA 1U6TA 4K6XA 2ON5A 3GH9A 3ZTLA 1B9XC 2C3TA 4ZBBA 3NOFA 4WBRD 2L59A 1EP8A 2CAIA 3O3TA 2R6KA 3Q19A 5CRWA 3FZ5A 4TXOA 2H6YA 4GSTA 2DKHA 4KE3A 1Z7PA 4FYCA 1F2EA 5A4WA 4OCEA 1YDKA 4MH3A 4F0BA 1MDJA 2EIRA 5CP1A 3ZLPA 2DMLA 1Y25A 1G6WA 2O85A 2X4AA 1TXXA 1G6YA 2IFQB 2R4VA 4ZL7A 3BD2A 2H6XA 3K8NA 1GSYA 2YWOA 2ZCTA 3TJKA 1F3AA 2YPMA 5B6NA 18GSA 5EVOA 2JSZA 1GLQA 2OKAA 2V2GA 5CREA 1PQNA 3W8JA 3D4TA 4EE0A 2O87A 3ZVJA 5IOWA 3D4MA 2AB6A 1JZOA 1EOGA 5D9TA 4IVFA 1UN2A 13GSA 4I97A 3FR6A 3KH9A 1SK0A 1FB6A 2HLSA 1HNCA 1GSFA 3IDVA 3JCML 1URMA 4JEDA 1WE0A 3G7YA 4XIHA 4TW5A 4O92A 2C4JA 14GSA 3ZL5A 1TJDA 2VCXA 2O8VB 4L5OA 5G1KA 4RI6A 1HNBA 2C0EA 5LD0A 4OFMA 3UIWA 3DWVA 3TJFA 3HJOA 3H93A 1SJIA 4BL7B 3ZFLA 4LMVA 3I69A 2FA4A 3LYKA 3UAPA 5A4VA 2J23A 2QGVA 1EZKA 1GTIA 2FD3A 1TU7A 1U88A 1AQXA 2YANA 1JHBA 1VF3A 3L9UA 1BAYA 1M9AA 3PINA 3VWUA 1SKSB 1XW9A 2NTOA 2VCVA 3HVVA 4OCFA 2LSTA 1GSEA 4KSMA 3DRNA 2DJ1A 1NHOA 3BJ5A 2CAQA 2OE1A 2RUEA 4EKZA 4MJAA 1E6BA 1Z6MA 5HR0A 2IN3A 1NHYA 5D9WA 1SENA 2YJHA 1FOHA 4XHMA 3UMAA 1M7TA 3FMWA 5HQPA 3ERWA 1JLVA 4ZB6A 1EOHA 1OKTA 3UARA 3RPNA 7GSSA 1YKAA 4HDEA 3FZAA 1A2LA 5A4UA 2XHFA 2TIRA 3H8QA 4KB3A 2IMKA 1F37A 2K18A 1SK1A 3VLNA 4PURA 5J9BA 1OC3A 5D8IA 3EYTA 4ZBAA 6GSSA 1MTCA 2Z9SA 3UBKA 4CY8A 4TN8A 4HZ4A 4EF0A 3C1SA 2HE3A 1V57A 1SK2A 1GSQA 1UA5A 2HSYA 2KOKA 4OFNA 2DJ0A 2PMTA 5F07A 5J4UA 3KH7A 5H5RA 5B8BA 5HR1A 4PQIA 3ZIJA 4KDUA 3UOMA 3L78A 2VL2A 3HYPA 4NPBA 3UVHA 3FYGA 5J9CA 3HXSA 1QXHA 1H75A 5HFIA 4RUVA 3LXZA 4POBA 4GQCA 3GX8A 4NMUA 1AW9A 2GT6A 4DSSB 2LJAA 2A4VA 1ZZYA 4WR5A 3TKRA 3VK9A 2GSQA 6GSWA 1SD9A 1I9DA 3G7IA 1WWJA 3P7XA 4KCEA 5IMZA 2VD1A 2KP2A 3EU3A 1OVNA 2HSMA 2IMIA 3IOSA 3IAM2 3Q74A 1YF0A 4TR1A 5G5FA 2K6VA 1BX9A 3WGEA 1M99A 2WGRA 3GKNA 4K5RA 2GQKA 5LCZA 2GLRA 4ECCA 1X0RA 1N2AA 2LRCA 5ELAA 4PTSA 4MH2A 4MABA 4JBBA 2YN1A 4J56E 5DALA 4PUFC 4G0IA 5IOXA 1XW5A 3KMNA 2VOCA 3VI5A 2LNSA 3A5IA 2M72A 1AXDA 4O7HA 3D21A 2CVDA 4TR3A 4IBPA 12GSA 2GSTA 3I9V2 2DMMA 1XWCA 1X5DA 1ZMAA 1GUKA 4MZCA 1SYXA 3L0HA 2WZ9A 3HD5A 2DBCA 4QL7A 3TRPA 1B4QA 1VF4A 4GSNA 4MZBA 3SBCA 3ZREA 1FVJA 1DSBA 2H1DA 1VF2A 2PU9C 4NAXA 2A2SA 4IW9A 2KHPA 1A0FA 5CAXA 1MD4A 4KGIA 1K0OA 2TRXA 3PGTA 1T4ZA 4NWYA 4HEA2 1XXUA 3ME7A 4HJMA 5INYA 1X5CA 1TKDB 1OE7A 2H01A 2QA1A 2OE3A 4K7NA 3M1GA 1DE2A 2FCHA 2H72A 4YAPA 3CTGA 1XPVA 2XBIA 2C0DA 2DIZA 2B5XA 3VWVA 1SU9A 2B7JA 1FOVA 2FA8A 4BVXA 5KN0A 4L0UA 2R5GA 2FWFA 3BOAA 1FHEA 1Z3EA 2AUVA 4I5QA 1PKZA 5CRDA 1NW2A 4IN0A 2LJRA 1BG5A 3HHVA 1KEBA 3EVIA 2AJQB 4ZBDA 2GDRA 2K8VA 4GWRA 4RQRA 1PN9A 3C8EA 4IJ3A 3KTLA 4TRXA 4IKHA 2LRTA 1R5AA 3FEUA 1JZRA 4EUYA 3KGKA 2C0FA 5GAPD 1Z7RA 2GZPA 2M80A 17GSA 1K3OA 5JWRB 3GTUA 4WKWA 5AGYA 2MMOA 5ECOB 4GTUA 1AAZA 2OE0A 5IM9A 4TKYA 2L4CA 3EE2A 3ERFA 4KCAA 1YQ1A 4YKFA 1RQMA 2DJ3A 2YP6A 2KLXA 4IELA 2HZEA 1O8XA 2YNXA 3APSA 2FLSA 1O85A 3VURA 3E3EA 1GSSA 3WD6A 5DQSA 2X8CA 3Q18A 4BVYA 4Z2TA 3ZYWA 4NV2A 4J2FA 3FZ9A 3KXOA 3HZ4A 4NHWA 3DYRA 1UC7A 1A24A 1GUMA 2O89A 1A8YA 3CMIA 4GF0A 4BPYA 2HRKA 1DBYA 1WMJA 3N5OA 4MJBA 4KUNA 2R0CA 4I6XA 2HZFA 2CV4A 4AJ6A 3LWAA 3F6FA 4PQ1A 4G0KA 1PSQA 1ILOA 2XC2A 5J5NA 2VLVA 1O7UA 2WULA 2HNLA 1A0RP 3KD0A 4MNNA 2NDOA 1EV4A 4IGJA 1TP9A 4WF4A 3ED3A 1XBSA 3F3QA 3FKFA 2PPTA 3TCOA 4G0LA 3DGQA 1PA3A 8GSSA 1UVZA 2R3XA 4V2NA 5J41A 1ZYQB 4OFTA 4G10A 3KMOA 2RM6A 5ECIB 4ID0A 1ERWA 4USSA 1EEMA 5DBQA 4QQ7A 1JFUA 4FIWA 10GSA 2B7KA 2L4QA 5DCHA 3V1WA 4I2UA 4CHSA 2V1MA 3C7MA 4PNGA 3CBUA 4ECBA 4WBJA 5IPHA 5G5EA 2CX4A 1H4OA 1XOBA 3E0UA 5D96A 1X9WB 3GX0A 5E4WA 5J3RA 2VCZA 3EC3A 6GSYA 1SKRB 1GP1A 1KTEA 2HRFA 1V98A 1FG4A 2ZNMA 1YZXA 3LORA 11GSA 3WYWA 19GSA 1XWBA 2YWIA 1X9SB 1B4PA 3HY2A 2AV4A 5ECRB 2REMA 3VI7A 2LQQA 1TK0B 2E0QA 2LRNA 3F9UA 4N11A 4K7OA 4FO5A 2DJJA 3LYPA 4Q5FA 3BCIA 3VPTA 1PN0A 3GA4A 3MNGA 3GIXA 22GSA 4KW6A 4KSOA 5B7CA 1LJRA 1EP7A 2LUSA 2F51A 4KAEA 2G2QA 4O5RA 3ZMLA 2JZRA 3RHBA 3UL3A 4KX4A 1THOA 4XCSA 1YEPA 3QD9A 3L4NA 1G0TA 3SWLA 4JZQA 2IFQA 2ZUPA 1XFLA 5ECKB 4D73A 2HFDA 1ZYNA 3QAVA 2TRCP 4ISDA 4YQVA 1R26A 3TJJA 1QFNA 5DDLA 3QOUA 3DXBA 5CYYA 2GZZA 2MYGA 3F63A 4K2DA 4Q5QA 1KNGA 2JADA 1M3JA 3IC8A 3LJRA 3E9JB 1M2BA 3O76A 3A5WA 2C0GA 2L5OA 2HRAA 1U3IA 3A2XA 1XWGA 3F3RA 3GKKA 2L6DA 5G2ZA 1AUCA 2O7KA 1AQVA 1K3YA 2DC5A 2I3YA 4ZIJA 2C3NA 2CA8A 3KP9A 3EWLA 4XTSA 3BBYA 4WXTA 2FUG2 4NHZA 1K0MA 2H1AA 3LXTA 3TUEA 1XWAA 1W89A 2H71A 3HA9A 1GTAA 4AF2A 2IWTA 3QFBC 4FQUA 3IPZA 3M9JA 4G19A 1TW9A 1T4YA 1LBKA 1WP0A 1WPIA 2N5AA 3FHKA 4YKGA 2ALBA 3CSHA 4WETA 5EPFA 2QA2A 3UBLA 2VLUA 2L57A 3W8SA 4BL7A 3ZIVA 1X9MB 3QMXA 5GSTA 2H70A 2VLTA 3GNJA 2CVBA 5B8AA 3H4KA 4I8BA 1JZDA 2H0HA 1U3AA 5ID2A 2X49A 2CZ3A 2B5EA 4FH8A 3LG6A 2I81A 2GVPA 4IJIA 5F0GA 3FW2A 1PD21 3WT2A 1ZOFA 3RHCA 1CQGA 3FZ4A 2DKIA 3FR9A 4ZXGA 1K0CA 1NSWA 4ZILA 1C72A 3HVSA 3ZITA 1TDIA 3TOTA 2LJKA 2M46A 3LSZA 3P2AA 3C1RA 3HCZA 1THXA 4O32A 1PL1A 2GGTA 4TXVA 4AJ8A 2XPEA 1MD3A 2LKUA 4Z7XA 1EEJA 1U87A 3F4SA 1WRYA 4MA9A 2FWHA 1A2MA 1W4VA 4XS4B 1LU4A 1K0NA 3FRCA 4BWQA 4EDZA 1X5EA 4ILFA 2AAWA 1I5GA 4EDYA 3WT1A 2H66A 5DCGA 3APQA 4K2XA 2F8FA 2RIIA 4PQHA 4MDCA 4ZL8A 4LLRA 3WGDA 4K5SA 4F82A 4KDYA 4JRRA 4FYBA 1B9YC 1ZYEA 1TRWA 2C3QA 2GQMA 2YWNA 3QDNA 1E2YA 2WS2A 4V2LA 3KJYA 1BEDA 2VO4A 1A8LA 4TR4A 3D22A 2IPAA 5IMDA 3IA1A 4GQFA 1RW1A 2HT9A 3S9FA 4ICYA 2WRTA 5A5KA 4HI7A 1ACVA 3CYNA 2FY6A 3TOUA 1RK4A 3J7Yb 2B1KA 4DSSA 3H1NA 4X43A 3EURA 1XW6A 3M3MA 4PGTA 3PPUA 3KM6A 2H6ZA 5CRGA 2OADA 4MP4A 2VD0A 2YWMA 4OO4A 3M9KA 1FVKA 5IMVA 3GH6A 1XG8A 4MF6A 1ERTA 1O6JA 4ML1A 4NV5A 3GSTA 4NXIA 2MBTA 4LL4B 3RPPA 4L5LA 2A2RA 2PVQA 3U6VA 3GTUB 4MPGA 5ECMB 2OBIA 2PUKC 2QSIA 2YOIA 1AIUA 1S3RA 1OAZA 4HQZA 4QL9A 1HNAA 2KUCA 1V2AA 1ZYPA 3QCPA 3RAZA 3ERGA 3EU4A 4MK3A 3A2WA 4BA7A 2HRNA 4Q5NA 3DIEA 5HFKA 5BRTA 3F4RA 4BIKA 3DKSA 2OACA 2HZEB 2PN8A 1V9WA 2C80A 2I4AA 1PX6A 4HJ2A 1A23A 2B5YA 2GTUA 1IYHA 3CTFA 1ZCPA 5ECPB 3WGXA 3G9BA 5GAND 3DVXA 4K0GA 5L71A 4DVCA 3M0FA 3R2QA 1OC9B 1PX7A 2JSYA 3J7Yk 2PGTA 3UVTA 4GSSA 4ZB8A 3I6AA 3PR8A 1XVWA 1TRSA 2PBJA 1VF1A 3HJMA 1ZGNA 4ZL9A 1XOAA 4O5UA 3TRXA 1K0DA 4V1Ap 4K1FA 1TRUA 4E8HA 1FW1A 1MDKA 3MAKA 2I9HA 2VIMA 5HFGA 3HVXA 3US3A 4WEYA 2V32A 2YV7A 3GKMA 1B48A 2IIYA 1HD2A 1R4WA 1VRSD 4DSRA 5KEJA 1N8JA 2EIQA 4TVEA 3TRQA 1O73A 3UEMA 2EC4A 2VL3A 2JZSA 6GSXA 4IHUA 5ENUA 4EVMA 5KN2A 4I2TA 5ELGA 3P8WA 4V2MA 4X1UA 3RBTA 2WCIA 3M8NA 3BCKA 4TXOB 3DD3A 4WR4A 4Z2RA 2FWEA 5F06A 5AIVA 5ABRA 1SJZA 3TKQA 1O8WA 4DEJA 4K9ZA 3F6DA 2CT6A 2VCTA 1IYIA 5DAKA 3O6TA 2PWJA 3HJPA 1KBNA 5ECQB 4POMA 4XRDA 1JLWA 2E2MA 2IMDA 3CRUA 1Q4JA 1DE1A 3IK9A 2HSHA 3D6IA 5ECSA 5C00A 4K0NA 5CRHA 5AIXA 4MJCA 2C1YA 2MMNA 3A3TA 4YQUA 2ON7A 1V58A 5FT3A 4MJEA 5AN1A 1YJ6A 2LQOA 4IP1A 1BQ7A 4KA0A 2UZ8A 2E2GA 1YKCA 3I43A 3GYKA 2KP1A 1Z9HA 4JR4A 1ABAA 3IE3A 1FAAA 5DQYA 3C71A 2YZHA 2IMFA 3CRTA 3IK7A 1M9BA 1TI3A 2GT5A 4CDOA 3GL3A 2FHEA 3TDGA 3DMLA 2XPDA 1K3LA 2MMAA 3CXGA 6GSVA 1GULA 1SYRA 1ERVA 3GHAA 2B3SA 2IJYA 2H1GA 3N9JA 3GN3A 1J08A 3IAS2 1T3BA 2B1LA 2H76A 4OWYA 5KN3A 4ML6A 3UJ1A 4HSCX 4D73B 3ZMKA 3MYDA 1PMTA 2ES7A 16GSA 4EIQA 4POLA 3IBHA 2IL3A 2RUFA 2BJXA 1T1VA 2WJUA 5JWOB 5DJLA 5G1LA 4G2EA 2DJ2A 3HVNA 1GH2A 1GSDA 2DIYA 2K9FA 1T8EB 3RDWA 2VCWA 3D5JA 3LGCA 3DEXA 6GSUA 1OYJA 4N10A 1T00A 4L0WA 2VUPA 2YV9A 3F8UA 4MF7A 2H8LA 4N0VA 4KNDA 2YJ7A 3MIXA 3VFIA 5DJMA 1WJKA 2A4HA 4ZB9A 1AQWA 1OE8A 1QK8A 2X99A 4K7IA 3QFAC 1QUWA 2QKEA 1O81A 4YQMA 1GRXA 4HS1A 2H74A 5CNWA 1SL0B 2E7PA 5HR3A 4MMMA 2LTKA 1F3BA 3GMFA 4CW9A 3LQ7A 3IHQA 1XZOA 2OA7A 2K8SA 3IR4A 3ISOA 5KN1A 2OJLA 2MZCA 3GV1A 1GNEA 5C04A 3ZZXA 2OBKA 5BMUA 4XS1A 3TGZA 5D93A 1MDIA 1ON4A 3TJGA 4X0XA 5G31A 1FO5A 5ID2B 1VGLA 2GS3A 2CQ9A 3L9VA 2EIOA 1HYUA 2B6MA 1WOUA 2MMZA 2YCDA 1BJXA 2DSAA 2WB9A 1TK5B 1YF1A 1M3IA 4L8EA 3GKXA 4GLTA 1PFOA 2D2ZA 20GSA 3KEBA 4EXJA 1R7HA 3F0IA 3KP8A 4IQAA 1EGRA 6GSTA 5IO2A 4HZ2A 4PX1A 1JZWA 2F9SA 1R5PA 4TOPA 1G7EA 2VL2C 5IPGA 2P0GA 5LNKe 1TI1A 4EL1A 2I1UA 3CSIA 4JE1A 1EWXA 3APOA 5EY6A 2R0PA 3VWXA 3LW9A 5ECNB 4EO3A 1PKWA 4OMVA 1QGVA 3Q6OA 3HDCA 3HKRA 2VL9A 5CO3A 4PUAA 1M2DA 3GFKA 5IQYA 1M2AA 4BWSA 4TR1B 4HU9A 4EC0A 1Z6NA 1SL1B 2HI7A 2X64A 1TK8B 4MF5A 3FK8A 2BTOT 3QPMA 1PL2A 1YEXA 2VM2A 3MWHA 1M0UA 2BMXA 1TOFA 3NIVA 4J57E 3LFLA 5KOWA 1HQOA 1F9MA 4MLYA 5F8BA 2VAFA 1TRVA 2FNOA 3TJBA 5DALB 2H30A 2PERA 3KTBA 4WF5A 4A5PA 1GLPA 1XWKA 1K0BA 4EIPA 1USBA 2P5QA 2P31A 4X4JA 5JCGA 1PRXA 2HXKA 1BYEA 4GXZA 2N5BA 3AY8A 3KZQA 1OC8A 3TKSC 1GWCA 4K8MA 4F0CA 2FWGA 2GQLA 2X8GA 2CVKA 3ZFBA 2DJKA 5E59A 5FHIA 3DVWA 2N5FA 2PVOC 2GSSA 3R3EA 4E8EA 1T7PB 2AYTA 1V40A 5G30A 3GSSA 4TR0A 4ECIA 1S3DA 1B8XA 2R2JA 2G0FA 1GUHA 4HQSA 2FGXA 2LS5A 5IMAA 3D0ZA 3A2VA 4FYUA 1TTZA 4BVXB 1SKWB 3TKSE 2GZYA 5DVBA 4MZWA 4MCUA 2WFCA 3IHGA 1GTUA 1K0AA 3IRAA 3EMPA 5EL8A 4ECJA 4N30A 3U5RE 4LL1B 3F4TA 3MDKA 2P5RA 3TKSA 5IO0A 3GUSA 4XS4A 1EGOA 4AJ7A 5H5SA 3ME8A 2A2PA 3CSJA 4PNFA 3TKPA 2NVLA 2CZ2A 3H79A 4RI7A 3EMXA 5JWQB 2IMEA 5IIZA 2R37A 2H0IA 2F8AA 1DUGA 3C73A 2HYXA 2JL4A 2LNTA 1NM3A 4PXOA 1GNWA 5GSSA 4V1Ag 1MEKA 2VCQA 1PGTA 2V41A 1TU8A 2V6OA 9GSSA 4ACSA 1G7OA 4LA1A 4P3YB 5HR2A 4POKA 2R0GA 4IQ1A 3GL5A 4DSQA 2XBQA 4F9ZA 4Q5RA 2LV3A 3GURA 2H1BA 4BVYB 5JCWA 1FB0A 2H19A 4F2IA 1CQHA 1GTBA 2NBSA 1SL2B 4G9HA 2JACA 4JR6A 2VM1A 2QC7A 3EINA 1J9BA 3QAGA 4CY6A 3LEFA 1XCCA 2L5LA 3QAWA 1SJ6A 5ECHB 4OD7A 5AISA 4O5QA 1EV9A 3IC4A 2DLXA 4GCIA 4ULXA 1Q98A 1GSUA 1QMVA 5DAKB 3VWWA 2NPBA 4RQXA 5F05A 5IMCA 2H75A 2RM5A
chains in the Genus database with same CATH topology
4OO5A 2X8HA 4AGSA 2CX3A 3OR5A 4KH7A 4LMWA 2MBSA 4XRAA 1GL8A 4IP6A 1ZL9A 3TB2A 4Z2UA 2H0GA 3P90A 1YY7A 2LEGA 2J9HA 1SD8A 1A2JA 4YH2A 1ML6A 1Z5YE 1WIKA 3PH9A 5FWGA 4HUAA 3NZNA 5GZZB 4HOJA 1ERUA 3L9SA 3G7JA 4HU7A 3IXRA 1OC9A 2GSRA 2JZTA 5D9XA 3VPQA 2C8UA 2YZUA 4KF9A 2F3MA 3EPTA 5D73A 5JCUA 1AC1A 3MSZA 2JU5A 3ZRDA 1XVQA 1Y6EA 1F6MC 2L6CA 3FR3A 4XS6A 1QQ2A 3IV4A 4N0ZA 1S3AA 1ST9A 3KCMA 4GRFA 4KDXA 4F03A 2AHEA 4MPFA 5B6MA 3KIJA 3GRXA 4JU5A 4YAVA 5ECLB 1S3CA 4H86A 2H73A 1J0FA 3ZVJD 3FY7A 3QR6A 4IS0A 2WDUA 5D9VA 5IMFA 5KOXA 1OKDA 3HZ8A 3W6GA 1XIYA 2RLIA 5H5QA 5COHA 2V6KA 1U6TA 4K6XA 2ON5A 3GH9A 3ZTLA 1B9XC 2C3TA 4ZBBA 3NOFA 4WBRD 2L59A 1EP8A 2CAIA 3O3TA 2R6KA 3Q19A 5CRWA 3FZ5A 4TXOA 2H6YA 4GSTA 2DKHA 4KE3A 1Z7PA 4FYCA 1F2EA 5A4WA 4OCEA 1YDKA 4MH3A 4F0BA 1MDJA 2EIRA 5CP1A 3ZLPA 2DMLA 1Y25A 1G6WA 2O85A 2X4AA 1TXXA 1G6YA 2IFQB 2R4VA 4ZL7A 3BD2A 2H6XA 3K8NA 1GSYA 2YWOA 2ZCTA 3TJKA 1F3AA 2YPMA 5B6NA 18GSA 5EVOA 2JSZA 1GLQA 2OKAA 2V2GA 5CREA 1PQNA 3W8JA 3D4TA 4EE0A 2O87A 3ZVJA 5IOWA 3D4MA 2AB6A 1JZOA 1EOGA 5D9TA 4IVFA 1UN2A 13GSA 4I97A 3FR6A 3KH9A 1SK0A 1FB6A 2HLSA 1HNCA 1GSFA 3IDVA 3JCML 1URMA 4JEDA 1WE0A 3G7YA 4XIHA 4TW5A 4O92A 2C4JA 14GSA 3ZL5A 1TJDA 2VCXA 2O8VB 4L5OA 5G1KA 4RI6A 1HNBA 2C0EA 5LD0A 4OFMA 3UIWA 3DWVA 3TJFA 3HJOA 3H93A 1SJIA 4BL7B 3ZFLA 4LMVA 3I69A 2FA4A 3LYKA 3UAPA 5A4VA 2J23A 2QGVA 1EZKA 1GTIA 2FD3A 1TU7A 1U88A 1AQXA 2YANA 1JHBA 1VF3A 3L9UA 1BAYA 1M9AA 3PINA 3VWUA 1SKSB 1XW9A 2NTOA 2VCVA 3HVVA 4OCFA 2LSTA 1GSEA 4KSMA 3DRNA 2DJ1A 1NHOA 3BJ5A 2CAQA 2OE1A 2RUEA 4EKZA 4MJAA 1E6BA 1Z6MA 5HR0A 2IN3A 1NHYA 5D9WA 1SENA 2YJHA 1FOHA 4XHMA 3UMAA 1M7TA 3FMWA 5HQPA 3ERWA 1JLVA 4ZB6A 1EOHA 1OKTA 3UARA 3RPNA 7GSSA 1YKAA 4HDEA 3FZAA 1A2LA 5A4UA 2XHFA 2TIRA 3H8QA 4KB3A 2IMKA 1F37A 2K18A 1SK1A 3VLNA 4PURA 5J9BA 1OC3A 5D8IA 3EYTA 4ZBAA 6GSSA 1MTCA 2Z9SA 3UBKA 4CY8A 4TN8A 4HZ4A 4EF0A 3C1SA 2HE3A 1V57A 1SK2A 1GSQA 1UA5A 2HSYA 2KOKA 4OFNA 2DJ0A 2PMTA 5F07A 5J4UA 3KH7A 5H5RA 5B8BA 5HR1A 4PQIA 3ZIJA 4KDUA 3UOMA 3L78A 2VL2A 3HYPA 4NPBA 3UVHA 3FYGA 5J9CA 3HXSA 1QXHA 1H75A 5HFIA 4RUVA 3LXZA 4POBA 4GQCA 3GX8A 4NMUA 1AW9A 2GT6A 4DSSB 2LJAA 2A4VA 1ZZYA 4WR5A 3TKRA 3VK9A 2GSQA 6GSWA 1SD9A 1I9DA 3G7IA 1WWJA 3P7XA 4KCEA 5IMZA 2VD1A 2KP2A 3EU3A 1OVNA 2HSMA 2IMIA 3IOSA 3IAM2 3Q74A 1YF0A 4TR1A 5G5FA 2K6VA 1BX9A 3WGEA 1M99A 2WGRA 3GKNA 4K5RA 2GQKA 5LCZA 2GLRA 4ECCA 1X0RA 1N2AA 2LRCA 5ELAA 4PTSA 4MH2A 4MABA 4JBBA 2YN1A 4J56E 5DALA 4PUFC 4G0IA 5IOXA 1XW5A 3KMNA 2VOCA 3VI5A 2LNSA 3A5IA 2M72A 1AXDA 4O7HA 3D21A 2CVDA 4TR3A 4IBPA 12GSA 2GSTA 3I9V2 2DMMA 1XWCA 1X5DA 1ZMAA 1GUKA 4MZCA 1SYXA 3L0HA 2WZ9A 3HD5A 2DBCA 4QL7A 3TRPA 1B4QA 1VF4A 4GSNA 4MZBA 3SBCA 3ZREA 1FVJA 1DSBA 2H1DA 1VF2A 2PU9C 4NAXA 2A2SA 4IW9A 2KHPA 1A0FA 5CAXA 1MD4A 4KGIA 1K0OA 2TRXA 3PGTA 1T4ZA 4NWYA 4HEA2 1XXUA 3ME7A 4HJMA 5INYA 1X5CA 1TKDB 1OE7A 2H01A 2QA1A 2OE3A 4K7NA 3M1GA 1DE2A 2FCHA 2H72A 4YAPA 3CTGA 1XPVA 2XBIA 2C0DA 2DIZA 2B5XA 3VWVA 1SU9A 2B7JA 1FOVA 2FA8A 4BVXA 5KN0A 4L0UA 2R5GA 2FWFA 3BOAA 1FHEA 1Z3EA 2AUVA 4I5QA 1PKZA 5CRDA 1NW2A 4IN0A 2LJRA 1BG5A 3HHVA 1KEBA 3EVIA 2AJQB 4ZBDA 2GDRA 2K8VA 4GWRA 4RQRA 1PN9A 3C8EA 4IJ3A 3KTLA 4TRXA 4IKHA 2LRTA 1R5AA 3FEUA 1JZRA 4EUYA 3KGKA 2C0FA 5GAPD 1Z7RA 2GZPA 2M80A 17GSA 1K3OA 5JWRB 3GTUA 4WKWA 5AGYA 2MMOA 5ECOB 4GTUA 1AAZA 2OE0A 5IM9A 4TKYA 2L4CA 3EE2A 3ERFA 4KCAA 1YQ1A 4YKFA 1RQMA 2DJ3A 2YP6A 2KLXA 4IELA 2HZEA 1O8XA 2YNXA 3APSA 2FLSA 1O85A 3VURA 3E3EA 1GSSA 3WD6A 5DQSA 2X8CA 3Q18A 4BVYA 4Z2TA 3ZYWA 4NV2A 4J2FA 3FZ9A 3KXOA 3HZ4A 4NHWA 3DYRA 1UC7A 1A24A 1GUMA 2O89A 1A8YA 3CMIA 4GF0A 4BPYA 2HRKA 1DBYA 1WMJA 3N5OA 4MJBA 4KUNA 2R0CA 4I6XA 2HZFA 2CV4A 4AJ6A 3LWAA 3F6FA 4PQ1A 4G0KA 1PSQA 1ILOA 2XC2A 5J5NA 2VLVA 1O7UA 2WULA 2HNLA 1A0RP 3KD0A 4MNNA 2NDOA 1EV4A 4IGJA 1TP9A 4WF4A 3ED3A 1XBSA 3F3QA 3FKFA 2PPTA 3TCOA 4G0LA 3DGQA 1PA3A 8GSSA 1UVZA 2R3XA 4V2NA 5J41A 1ZYQB 4OFTA 4G10A 3KMOA 2RM6A 5ECIB 4ID0A 1ERWA 4USSA 1EEMA 5DBQA 4QQ7A 1JFUA 4FIWA 10GSA 2B7KA 2L4QA 5DCHA 3V1WA 4I2UA 4CHSA 2V1MA 3C7MA 4PNGA 3CBUA 4ECBA 4WBJA 5IPHA 5G5EA 2CX4A 1H4OA 1XOBA 3E0UA 5D96A 1X9WB 3GX0A 5E4WA 5J3RA 2VCZA 3EC3A 6GSYA 1SKRB 1GP1A 1KTEA 2HRFA 1V98A 1FG4A 2ZNMA 1YZXA 3LORA 11GSA 3WYWA 19GSA 1XWBA 2YWIA 1X9SB 1B4PA 3HY2A 2AV4A 5ECRB 2REMA 3VI7A 2LQQA 1TK0B 2E0QA 2LRNA 3F9UA 4N11A 4K7OA 4FO5A 2DJJA 3LYPA 4Q5FA 3BCIA 3VPTA 1PN0A 3GA4A 3MNGA 3GIXA 22GSA 4KW6A 4KSOA 5B7CA 1LJRA 1EP7A 2LUSA 2F51A 4KAEA 2G2QA 4O5RA 3ZMLA 2JZRA 3RHBA 3UL3A 4KX4A 1THOA 4XCSA 1YEPA 3QD9A 3L4NA 1G0TA 3SWLA 4JZQA 2IFQA 2ZUPA 1XFLA 5ECKB 4D73A 2HFDA 1ZYNA 3QAVA 2TRCP 4ISDA 4YQVA 1R26A 3TJJA 1QFNA 5DDLA 3QOUA 3DXBA 5CYYA 2GZZA 2MYGA 3F63A 4K2DA 4Q5QA 1KNGA 2JADA 3IC8A 3LJRA 3E9JB 1M2BA 3O76A 3A5WA 2C0GA 2L5OA 2HRAA 1U3IA 3A2XA 1XWGA 3F3RA 3GKKA 2L6DA 5G2ZA 1AUCA 2O7KA 1AQVA 1K3YA 2DC5A 2I3YA 4ZIJA 2C3NA 2CA8A 3KP9A 3EWLA 4XTSA 3BBYA 4WXTA 2FUG2 4NHZA 1K0MA 2H1AA 3LXTA 3TUEA 1XWAA 1W89A 2H71A 3HA9A 1GTAA 4AF2A 2IWTA 3QFBC 4FQUA 3IPZA 3M9JA 4G19A 1TW9A 1T4YA 1LBKA 1WP0A 1WPIA 2N5AA 3FHKA 4YKGA 2ALBA 3CSHA 4WETA 5EPFA 2QA2A 3UBLA 2VLUA 2L57A 3W8SA 4BL7A 3ZIVA 1X9MB 3QMXA 5GSTA 2H70A 2VLTA 3GNJA 2CVBA 5B8AA 3H4KA 4I8BA 1JZDA 2H0HA 1U3AA 5ID2A 2X49A 2CZ3A 2B5EA 4FH8A 3LG6A 2I81A 2GVPA 4IJIA 5F0GA 3FW2A 1PD21 3WT2A 1ZOFA 3RHCA 1CQGA 3FZ4A 2DKIA 3FR9A 4ZXGA 1K0CA 1NSWA 4ZILA 1C72A 3HVSA 3ZITA 1TDIA 3TOTA 2LJKA 2M46A 3LSZA 3P2AA 3C1RA 3HCZA 1THXA 4O32A 1PL1A 2GGTA 4TXVA 4AJ8A 2XPEA 1MD3A 2LKUA 4Z7XA 1EEJA 1U87A 3F4SA 1WRYA 4MA9A 2FWHA 1A2MA 1W4VA 4XS4B 1LU4A 1K0NA 3FRCA 4BWQA 4EDZA 1X5EA 4ILFA 2AAWA 1I5GA 4EDYA 3WT1A 2H66A 5DCGA 3APQA 4K2XA 2F8FA 2RIIA 4PQHA 4MDCA 4ZL8A 4LLRA 3WGDA 4K5SA 4F82A 4KDYA 4JRRA 4FYBA 1B9YC 1ZYEA 1TRWA 2C3QA 2GQMA 2YWNA 3QDNA 1E2YA 2WS2A 4V2LA 3KJYA 1BEDA 2VO4A 1A8LA 4TR4A 3D22A 2IPAA 5IMDA 3IA1A 4GQFA 1RW1A 2HT9A 3S9FA 4ICYA 2WRTA 5A5KA 4HI7A 1ACVA 3CYNA 2FY6A 3TOUA 1RK4A 3J7Yb 2B1KA 4DSSA 3H1NA 4X43A 3EURA 1XW6A 3M3MA 4PGTA 3PPUA 3KM6A 2H6ZA 5CRGA 2OADA 4MP4A 2VD0A 2YWMA 4OO4A 3M9KA 1FVKA 5IMVA 3GH6A 4MF6A 1ERTA 1O6JA 4ML1A 4NV5A 3GSTA 4NXIA 2MBTA 4LL4B 3RPPA 4L5LA 2A2RA 2PVQA 3U6VA 3GTUB 4MPGA 5ECMB 2OBIA 2PUKC 2QSIA 2YOIA 1AIUA 1OAZA 4HQZA 4QL9A 1HNAA 2KUCA 1V2AA 1ZYPA 3QCPA 3RAZA 3ERGA 3EU4A 4MK3A 3A2WA 4BA7A 2HRNA 4Q5NA 3DIEA 5HFKA 5BRTA 3F4RA 3DKSA 2OACA 2HZEB 2PN8A 1V9WA 2C80A 2I4AA 1PX6A 4HJ2A 1A23A 2B5YA 2GTUA 1IYHA 3CTFA 1ZCPA 5ECPB 3WGXA 3G9BA 5GAND 3DVXA 4K0GA 5L71A 4DVCA 3M0FA 3R2QA 1OC9B 1PX7A 2JSYA 3J7Yk 2PGTA 3UVTA 4GSSA 4ZB8A 3I6AA 3PR8A 1XVWA 1TRSA 2PBJA 1VF1A 3HJMA 1ZGNA 4ZL9A 1XOAA 4O5UA 3TRXA 1K0DA 4V1Ap 4K1FA 1TRUA 4E8HA 1FW1A 1MDKA 3MAKA 2I9HA 2VIMA 5HFGA 3HVXA 3US3A 4WEYA 2V32A 2YV7A 3GKMA 1B48A 2IIYA 1HD2A 1R4WA 1VRSD 4DSRA 5KEJA 1N8JA 2EIQA 4TVEA 3TRQA 1O73A 3UEMA 2EC4A 2VL3A 2JZSA 6GSXA 4IHUA 5ENUA 4EVMA 5KN2A 4I2TA 5ELGA 3P8WA 4V2MA 4X1UA 3RBTA 2WCIA 3M8NA 3BCKA 4TXOB 3DD3A 4WR4A 4Z2RA 2FWEA 5F06A 5AIVA 5ABRA 1SJZA 3TKQA 1O8WA 4DEJA 4K9ZA 3F6DA 2CT6A 2VCTA 1IYIA 5DAKA 3O6TA 2PWJA 3HJPA 1KBNA 5ECQB 4POMA 4XRDA 1JLWA 2E2MA 2IMDA 3CRUA 1Q4JA 1DE1A 3IK9A 2HSHA 3D6IA 5ECSA 5C00A 4K0NA 5CRHA 5AIXA 4MJCA 2C1YA 2MMNA 3A3TA 4YQUA 2ON7A 1V58A 5FT3A 4MJEA 5AN1A 1YJ6A 2LQOA 4IP1A 1BQ7A 4KA0A 2UZ8A 2E2GA 1YKCA 3I43A 3GYKA 2KP1A 1Z9HA 4JR4A 1ABAA 3IE3A 1FAAA 5DQYA 3C71A 2YZHA 2IMFA 3CRTA 3IK7A 1M9BA 1TI3A 2GT5A 4CDOA 3GL3A 2FHEA 3TDGA 3DMLA 2XPDA 1K3LA 2MMAA 3CXGA 6GSVA 1GULA 1SYRA 1ERVA 3GHAA 2B3SA 2IJYA 2H1GA 3N9JA 3GN3A 1J08A 3IAS2 1T3BA 2B1LA 2H76A 4OWYA 5KN3A 4ML6A 3UJ1A 4D73B 3ZMKA 3MYDA 1PMTA 2ES7A 16GSA 4EIQA 4POLA 3IBHA 2IL3A 2RUFA 2BJXA 1T1VA 2WJUA 5JWOB 5DJLA 5G1LA 4G2EA 2DJ2A 1GH2A 1GSDA 2DIYA 2K9FA 1T8EB 3RDWA 2VCWA 3D5JA 3LGCA 3DEXA 6GSUA 1OYJA 4N10A 1T00A 4L0WA 2VUPA 2YV9A 3F8UA 4MF7A 2H8LA 4N0VA 4KNDA 2YJ7A 3MIXA 3VFIA 5DJMA 1WJKA 2A4HA 4ZB9A 1AQWA 1OE8A 1QK8A 2X99A 4K7IA 3QFAC 1QUWA 2QKEA 1O81A 4YQMA 1GRXA 4HS1A 2H74A 5CNWA 1SL0B 2E7PA 5HR3A 4MMMA 2LTKA 1F3BA 3GMFA 4CW9A 3LQ7A 3IHQA 1XZOA 2OA7A 2K8SA 3IR4A 3ISOA 5KN1A 2OJLA 2MZCA 3GV1A 1GNEA 5C04A 3ZZXA 2OBKA 5BMUA 4XS1A 3TGZA 5D93A 1MDIA 1ON4A 3TJGA 4X0XA 5G31A 1FO5A 5ID2B 1VGLA 2GS3A 2CQ9A 3L9VA 2EIOA 1HYUA 2B6MA 1WOUA 2MMZA 2YCDA 1BJXA 2DSAA 2WB9A 1TK5B 1YF1A 4L8EA 3GKXA 4GLTA 2D2ZA 20GSA 3KEBA 4EXJA 1R7HA 3F0IA 3KP8A 4IQAA 1EGRA 6GSTA 5IO2A 4HZ2A 4PX1A 1JZWA 2F9SA 1R5PA 4TOPA 1G7EA 2VL2C 5IPGA 2P0GA 5LNKe 1TI1A 4EL1A 2I1UA 3CSIA 4JE1A 1EWXA 3APOA 5EY6A 2R0PA 3VWXA 3LW9A 5ECNB 4EO3A 1PKWA 4OMVA 1QGVA 3Q6OA 3HDCA 3HKRA 2VL9A 5CO3A 4PUAA 1M2DA 3GFKA 5IQYA 1M2AA 4BWSA 4TR1B 4HU9A 4EC0A 1Z6NA 1SL1B 2HI7A 2X64A 1TK8B 4MF5A 3FK8A 2BTOT 3QPMA 1PL2A 1YEXA 2VM2A 3MWHA 1M0UA 2BMXA 1TOFA 3NIVA 4J57E 3LFLA 5KOWA 1HQOA 1F9MA 4MLYA 5F8BA 2VAFA 1TRVA 2FNOA 3TJBA 5DALB 2H30A 2PERA 3KTBA 4WF5A 4A5PA 1GLPA 1XWKA 1K0BA 4EIPA 1USBA 2P5QA 2P31A 4X4JA 5JCGA 1PRXA 2HXKA 1BYEA 4GXZA 2N5BA 3AY8A 3KZQA 1OC8A 3TKSC 1GWCA 4K8MA 4F0CA 2FWGA 2GQLA 2X8GA 2CVKA 3ZFBA 2DJKA 5E59A 5FHIA 3DVWA 2N5FA 2PVOC 2GSSA 3R3EA 4E8EA 1T7PB 2AYTA 1V40A 5G30A 3GSSA 4TR0A 4ECIA 1S3DA 1B8XA 2R2JA 2G0FA 1GUHA 4HQSA 2FGXA 2LS5A 5IMAA 3D0ZA 3A2VA 4FYUA 1TTZA 4BVXB 1SKWB 3TKSE 2GZYA 5DVBA 4MZWA 4MCUA 2WFCA 3IHGA 1GTUA 1K0AA 3IRAA 3EMPA 5EL8A 4ECJA 4N30A 3U5RE 4LL1B 3F4TA 3MDKA 2P5RA 3TKSA 5IO0A 3GUSA 4XS4A 1EGOA 4AJ7A 5H5SA 3ME8A 2A2PA 3CSJA 4PNFA 3TKPA 2NVLA 2CZ2A 3H79A 4RI7A 3EMXA 5JWQB 2IMEA 5IIZA 2R37A 2H0IA 2F8AA 1DUGA 3C73A 2HYXA 2JL4A 2LNTA 1NM3A 4PXOA 1GNWA 5GSSA 4V1Ag 1MEKA 2VCQA 1PGTA 2V41A 1TU8A 2V6OA 9GSSA 4ACSA 1G7OA 4LA1A 4P3YB 5HR2A 4POKA 2R0GA 4IQ1A 3GL5A 4DSQA 2XBQA 4F9ZA 4Q5RA 2LV3A 3GURA 2H1BA 4BVYB 5JCWA 1FB0A 2H19A 4F2IA 1CQHA 1GTBA 2NBSA 1SL2B 4G9HA 2JACA 4JR6A 2VM1A 2QC7A 3EINA 1J9BA 3QAGA 4CY6A 3LEFA 1XCCA 2L5LA 3QAWA 1SJ6A 5ECHB 4OD7A 5AISA 4O5QA 1EV9A 3IC4A 2DLXA 4GCIA 4ULXA 1Q98A 1GSUA 1QMVA 5DAKB 3VWWA 2NPBA 4RQXA 5F05A 5IMCA 2H75A 2RM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO5 A;  2X8H A;  4AGS A;  2CX3 A;  3OR5 A;  4KH7 A;  4LMW A;  2MBS A;  4XRA A;  1GL8 A;  4IP6 A;  1ZL9 A;  3TB2 A;  2H0G A;  3P90 A;  1YY7 A;  2LEG A;  2J9H A;  1SD8 A;  1A2J A;  4YH2 A;  1ML6 A;  1Z5Y E;  1WIK A;  3PH9 A;  5FWG A;  4HUA A;  3NZN A;  5GZZ B;  4HOJ A;  1ERU A;  3L9S A;  3G7J A;  4HU7 A;  3IXR A;  1OC9 A;  2GSR A;  2JZT A;  5D9X A;  3VPQ A;  2C8U A;  2YZU A;  2F3M A;  5D73 A;  5JCU A;  1AC1 A;  3MSZ A;  2JU5 A;  3ZRD A;  1XVQ A;  1Y6E A;  1F6M C;  2L6C A;  3FR3 A;  4XS6 A;  1QQ2 A;  3IV4 A;  4N0Z A;  1S3A A;  1ST9 A;  3KCM A;  4GRF A;  4KDX A;  4F03 A;  2AHE A;  4MPF A;  5B6M A;  3KIJ A;  3GRX A;  4JU5 A;  4YAV A;  5ECL B;  1S3C A;  4H86 A;  2H73 A;  1J0F A;  3ZVJ D;  3FY7 A;  3QR6 A;  4IS0 A;  2WDU A;  5D9V A;  5IMF A;  1OKD A;  3HZ8 A;  3W6G A;  1XIY A;  2RLI A;  5H5Q A;  5COH A;  2V6K A;  1U6T A;  4K6X A;  2ON5 A;  3GH9 A;  3ZTL A;  1B9X C;  2C3T A;  4ZBB A;  3NOF A;  4WBR D;  2L59 A;  1EP8 A;  2CAI A;  3O3T A;  2R6K A;  3Q19 A;  5CRW A;  3FZ5 A;  4TXO A;  2H6Y A;  4GST A;  4KE3 A;  1Z7P A;  4FYC A;  1F2E A;  5A4W A;  4OCE A;  1YDK A;  4MH3 A;  4F0B A;  1MDJ A;  2EIR A;  5CP1 A;  3ZLP A;  2DML A;  1Y25 A;  1G6W A;  2O85 A;  1TXX A;  1G6Y A;  2IFQ B;  2R4V A;  4ZL7 A;  3BD2 A;  2H6X A;  3K8N A;  1GSY A;  2YWO A;  2ZCT A;  3TJK A;  1F3A A;  2YPM A;  5B6N A;  18GS A;  5EVO A;  2JSZ A;  1GLQ A;  2OKA A;  2V2G A;  5CRE A;  1PQN A;  3W8J A;  3D4T A;  4EE0 A;  2O87 A;  3ZVJ A;  5IOW A;  3D4M A;  2AB6 A;  1JZO A;  1EOG A;  5D9T A;  4IVF A;  1UN2 A;  13GS A;  4I97 A;  3FR6 A;  3KH9 A;  1SK0 A;  1FB6 A;  2HLS A;  1HNC A;  1GSF A;  3IDV A;  3JCM L;  1URM A;  4JED A;  1WE0 A;  3G7Y A;  4XIH A;  4TW5 A;  4O92 A;  2C4J A;  14GS A;  3ZL5 A;  1TJD A;  2VCX A;  2O8V B;  4L5O A;  5G1K A;  4RI6 A;  1HNB A;  2C0E A;  5LD0 A;  4OFM A;  3UIW A;  3DWV A;  3TJF A;  3HJO A;  3H93 A;  1SJI A;  3ZFL A;  4LMV A;  3I69 A;  2FA4 A;  3LYK A;  3UAP A;  5A4V A;  2J23 A;  2QGV A;  1EZK A;  1GTI A;  2FD3 A;  1TU7 A;  1U88 A;  1AQX A;  2YAN A;  1JHB A;  1VF3 A;  3L9U A;  1BAY A;  1M9A A;  3PIN A;  3VWU A;  1SKS B;  1XW9 A;  2NTO A;  2VCV A;  3HVV A;  4OCF A;  2LST A;  1GSE A;  4KSM A;  3DRN A;  2DJ1 A;  1NHO A;  3BJ5 A;  2CAQ A;  2OE1 A;  2RUE A;  4EKZ A;  4MJA A;  1E6B A;  1Z6M A;  5HR0 A;  2IN3 A;  1NHY A;  5D9W A;  1SEN A;  2YJH A;  4XHM A;  3UMA A;  1M7T A;  5HQP A;  3ERW A;  1JLV A;  4ZB6 A;  1EOH A;  1OKT A;  3UAR A;  3RPN A;  7GSS A;  1YKA A;  4HDE A;  3FZA A;  1A2L A;  5A4U A;  2XHF A;  2TIR A;  3H8Q A;  4KB3 A;  2IMK A;  1F37 A;  2K18 A;  1SK1 A;  3VLN A;  4PUR A;  5J9B A;  1OC3 A;  5D8I A;  3EYT A;  4ZBA A;  6GSS A;  1MTC A;  2Z9S A;  3UBK A;  4TN8 A;  4HZ4 A;  4EF0 A;  3C1S A;  2HE3 A;  1V57 A;  1SK2 A;  1GSQ A;  1UA5 A;  2HSY A;  2KOK A;  4OFN A;  2DJ0 A;  2PMT A;  5F07 A;  5J4U A;  3KH7 A;  5H5R A;  5B8B A;  5HR1 A;  4PQI A;  3ZIJ A;  4KDU A;  3UOM A;  3L78 A;  2VL2 A;  3HYP A;  4NPB A;  3UVH A;  3FYG A;  5J9C A;  3HXS A;  1QXH A;  1H75 A;  5HFI A;  4RUV A;  3LXZ A;  4POB A;  4GQC A;  3GX8 A;  4NMU A;  1AW9 A;  2GT6 A;  4DSS B;  2LJA A;  2A4V A;  1ZZY A;  4WR5 A;  3TKR A;  3VK9 A;  2GSQ A;  6GSW A;  1SD9 A;  1I9D A;  3G7I A;  1WWJ A;  3P7X A;  4KCE A;  5IMZ A;  2VD1 A;  2KP2 A;  3EU3 A;  1OVN A;  2IMI A;  3IOS A;  3IAM 2;  3Q74 A;  1YF0 A;  4TR1 A;  5G5F A;  2K6V A;  1BX9 A;  3WGE A;  1M99 A;  2WGR A;  3GKN A;  2GQK A;  5LCZ A;  2GLR A;  4ECC A;  1X0R A;  1N2A A;  2LRC A;  5ELA A;  4MH2 A;  4MAB A;  4JBB A;  2YN1 A;  4J56 E;  5DAL A;  4PUF C;  5IOX A;  1XW5 A;  3KMN A;  2VOC A;  3VI5 A;  2LNS A;  2M72 A;  1AXD A;  4O7H A;  3D21 A;  2CVD A;  4TR3 A;  4IBP A;  12GS A;  2GST A;  3I9V 2;  2DMM A;  1XWC A;  1X5D A;  1ZMA A;  1GUK A;  4MZC A;  1SYX A;  3L0H A;  2WZ9 A;  3HD5 A;  2DBC A;  4QL7 A;  3TRP A;  1B4Q A;  1VF4 A;  4GSN A;  4MZB A;  3SBC A;  3ZRE A;  1FVJ A;  1DSB A;  2H1D A;  1VF2 A;  2PU9 C;  4NAX A;  2A2S A;  4IW9 A;  2KHP A;  1A0F A;  5CAX A;  1MD4 A;  4KGI A;  1K0O A;  2TRX A;  3PGT A;  1T4Z A;  4NWY A;  4HEA 2;  1XXU A;  3ME7 A;  4HJM A;  5INY A;  1X5C A;  1TKD B;  1OE7 A;  2H01 A;  2OE3 A;  4K7N A;  3M1G A;  1DE2 A;  2FCH A;  2H72 A;  4YAP A;  3CTG A;  1XPV A;  2XBI A;  2C0D A;  2DIZ A;  2B5X A;  3VWV A;  1SU9 A;  2B7J A;  1FOV A;  2FA8 A;  4BVX A;  5KN0 A;  4L0U A;  2R5G A;  2FWF A;  3BOA A;  1FHE A;  1Z3E A;  2AUV A;  4I5Q A;  1PKZ A;  5CRD A;  1NW2 A;  4IN0 A;  2LJR A;  1BG5 A;  3HHV A;  1KEB A;  3EVI A;  2AJQ B;  4ZBD A;  2GDR A;  2K8V A;  4GWR A;  4RQR A;  1PN9 A;  3C8E A;  4IJ3 A;  3KTL A;  4TRX A;  4IKH A;  2LRT A;  1R5A A;  3FEU A;  1JZR A;  4EUY A;  3KGK A;  2C0F A;  5GAP D;  1Z7R A;  2GZP A;  2M80 A;  17GS A;  1K3O A;  5JWR B;  3GTU A;  4WKW A;  5AGY A;  2MMO A;  5ECO B;  4GTU A;  1AAZ A;  2OE0 A;  5IM9 A;  4TKY A;  2L4C A;  3EE2 A;  3ERF A;  4KCA A;  1YQ1 A;  1RQM A;  2DJ3 A;  2YP6 A;  2KLX A;  4IEL A;  2HZE A;  1O8X A;  2YNX A;  3APS A;  2FLS A;  1O85 A;  3VUR A;  3E3E A;  1GSS A;  3WD6 A;  5DQS A;  2X8C A;  3Q18 A;  4BVY A;  3ZYW A;  4NV2 A;  4J2F A;  3FZ9 A;  3KXO A;  3HZ4 A;  4NHW A;  3DYR A;  1UC7 A;  1A24 A;  1GUM A;  2O89 A;  1A8Y A;  3CMI A;  4GF0 A;  4BPY A;  1DBY A;  1WMJ A;  3N5O A;  4MJB A;  4KUN A;  4I6X A;  2HZF A;  2CV4 A;  4AJ6 A;  3LWA A;  3F6F A;  4PQ1 A;  1PSQ A;  1ILO A;  2XC2 A;  5J5N A;  2VLV A;  1O7U A;  2WUL A;  2HNL A;  1A0R P;  3KD0 A;  2NDO A;  1EV4 A;  4IGJ A;  1TP9 A;  4WF4 A;  3ED3 A;  1XBS A;  3F3Q A;  3FKF A;  2PPT A;  3TCO A;  3DGQ A;  1PA3 A;  8GSS A;  1UVZ A;  2R3X A;  4V2N A;  5J41 A;  1ZYQ B;  4OFT A;  4G10 A;  3KMO A;  2RM6 A;  5ECI B;  4ID0 A;  1ERW A;  1EEM A;  5DBQ A;  4QQ7 A;  1JFU A;  4FIW A;  10GS A;  2B7K A;  5DCH A;  2L4Q A;  3V1W A;  4I2U A;  4CHS A;  2V1M A;  3C7M A;  4PNG A;  3CBU A;  4ECB A;  4WBJ A;  5IPH A;  5G5E A;  2CX4 A;  1H4O A;  1XOB A;  3E0U A;  5D96 A;  1X9W B;  3GX0 A;  5E4W A;  5J3R A;  2VCZ A;  3EC3 A;  6GSY A;  1SKR B;  1GP1 A;  1KTE A;  2HRF A;  1V98 A;  1FG4 A;  2ZNM A;  1YZX A;  3LOR A;  11GS A;  3WYW A;  19GS A;  1XWB A;  2YWI A;  1X9S B;  1B4P A;  3HY2 A;  2AV4 A;  5ECR B;  2REM A;  3VI7 A;  2LQQ A;  1TK0 B;  2E0Q A;  2LRN A;  3F9U A;  4N11 A;  4K7O A;  4FO5 A;  2DJJ A;  3LYP A;  4Q5F A;  3BCI A;  3VPT A;  3MNG A;  3GA4 A;  3GIX A;  22GS A;  4KW6 A;  4KSO A;  5B7C A;  1LJR A;  1EP7 A;  2LUS A;  2F51 A;  4KAE A;  2G2Q A;  4O5R A;  3ZML A;  2JZR A;  3RHB A;  3UL3 A;  4KX4 A;  1THO A;  4XCS A;  1YEP A;  3QD9 A;  3L4N A;  1G0T A;  3SWL A;  4JZQ A;  2IFQ A;  2ZUP A;  1XFL A;  5ECK B;  4D73 A;  2HFD A;  3QAV A;  2TRC P;  4ISD A;  4YQV A;  1R26 A;  3TJJ A;  1QFN A;  5DDL A;  3QOU A;  3DXB A;  5CYY A;  2GZZ A;  2MYG A;  3F63 A;  4K2D A;  4Q5Q A;  1KNG A;  2JAD A;  3LJR A;  3E9J B;  1M2B A;  3O76 A;  3A5W A;  2C0G A;  2L5O A;  1U3I A;  3A2X A;  1XWG A;  3F3R A;  3GKK A;  2L6D A;  5G2Z A;  1AUC A;  2O7K A;  1AQV A;  1K3Y A;  2DC5 A;  2I3Y A;  4ZIJ A;  2C3N A;  2CA8 A;  3KP9 A;  3EWL A;  4XTS A;  3BBY A;  4WXT A;  2FUG 2;  4NHZ A;  1K0M A;  2H1A A;  3LXT A;  3TUE A;  1XWA A;  1W89 A;  2H71 A;  3HA9 A;  1GTA A;  4AF2 A;  2IWT A;  3QFB C;  3IPZ A;  3M9J A;  4G19 A;  1TW9 A;  1T4Y A;  1LBK A;  1WP0 A;  1WPI A;  2N5A A;  3FHK A;  2ALB A;  3CSH A;  4WET A;  5EPF A;  3UBL A;  2VLU A;  2L57 A;  3W8S A;  4BL7 A;  3ZIV A;  1X9M B;  3QMX A;  5GST A;  2H70 A;  2VLT A;  3GNJ A;  2CVB A;  5B8A A;  3H4K A;  4I8B A;  1JZD A;  2H0H A;  1U3A A;  5ID2 A;  2CZ3 A;  2B5E A;  4FH8 A;  3LG6 A;  2I81 A;  2GVP A;  4IJI A;  5F0G A;  3FW2 A;  1PD2 1;  3WT2 A;  1ZOF A;  3RHC A;  1CQG A;  3FZ4 A;  3FR9 A;  4ZXG A;  1K0C A;  1NSW A;  4ZIL A;  1C72 A;  3HVS A;  3ZIT A;  1TDI A;  3TOT A;  2LJK A;  2M46 A;  3LSZ A;  3P2A A;  3C1R A;  3HCZ A;  1THX A;  4O32 A;  1PL1 A;  2GGT A;  4TXV A;  4AJ8 A;  2XPE A;  1MD3 A;  2LKU A;  4Z7X A;  1EEJ A;  1U87 A;  3F4S A;  1WRY A;  4MA9 A;  2FWH A;  1A2M A;  1W4V A;  4XS4 B;  1LU4 A;  1K0N A;  3FRC A;  4BWQ A;  4EDZ A;  1X5E A;  4ILF A;  2AAW A;  1I5G A;  4EDY A;  3WT1 A;  2H66 A;  5DCG A;  3APQ A;  2F8F A;  2RII A;  4PQH A;  4MDC A;  4ZL8 A;  4LLR A;  3WGD A;  4F82 A;  4KDY A;  4JRR A;  4FYB A;  1B9Y C;  1ZYE A;  1TRW A;  2C3Q A;  2GQM A;  2YWN A;  3QDN A;  1E2Y A;  2WS2 A;  4V2L A;  3KJY A;  1BED A;  2VO4 A;  1A8L A;  4TR4 A;  3D22 A;  2IPA A;  5IMD A;  3IA1 A;  4GQF A;  1RW1 A;  2HT9 A;  3S9F A;  2WRT A;  5A5K A;  4HI7 A;  1ACV A;  3CYN A;  2FY6 A;  3TOU A;  1RK4 A;  3J7Y b;  2B1K A;  4DSS A;  3H1N A;  4X43 A;  3EUR A;  1XW6 A;  3M3M A;  4PGT A;  3KM6 A;  2H6Z A;  5CRG A;  2OAD A;  4MP4 A;  2VD0 A;  2YWM A;  4OO4 A;  3M9K A;  1FVK A;  5IMV A;  3GH6 A;  4MF6 A;  1ERT A;  1O6J A;  4ML1 A;  4NV5 A;  3GST A;  4NXI A;  2MBT A;  4LL4 B;  3RPP A;  4L5L A;  2A2R A;  2PVQ A;  3U6V A;  3GTU B;  4MPG A;  5ECM B;  2OBI A;  2PUK C;  2QSI A;  2YOI A;  1AIU A;  1OAZ A;  4HQZ A;  4QL9 A;  1HNA A;  2KUC A;  1V2A A;  3QCP A;  3RAZ A;  3ERG A;  3EU4 A;  4MK3 A;  3A2W A;  4BA7 A;  2HRN A;  4Q5N A;  3DIE A;  5HFK A;  3F4R A;  3DKS A;  2OAC A;  2HZE B;  2PN8 A;  1V9W A;  2C80 A;  2I4A A;  1PX6 A;  4HJ2 A;  1A23 A;  2B5Y A;  2GTU A;  1IYH A;  3CTF A;  1ZCP A;  5ECP B;  3WGX A;  3G9B A;  5GAN D;  3DVX A;  4K0G A;  5L71 A;  4DVC A;  3M0F A;  3R2Q A;  1OC9 B;  1PX7 A;  2JSY A;  3J7Y k;  2PGT A;  3UVT A;  4GSS A;  4ZB8 A;  3I6A A;  3PR8 A;  1XVW A;  1TRS A;  2PBJ A;  1VF1 A;  3HJM A;  1ZGN A;  4ZL9 A;  1XOA A;  3TRX A;  1K0D A;  4V1A p;  4K1F A;  1TRU A;  4E8H A;  1FW1 A;  1MDK A;  3MAK A;  2I9H A;  2VIM A;  5HFG A;  3HVX A;  3US3 A;  4WEY A;  2V32 A;  2YV7 A;  3GKM A;  1B48 A;  2IIY A;  1HD2 A;  1R4W A;  1VRS D;  4DSR A;  5KEJ A;  1N8J A;  2EIQ A;  4TVE A;  3TRQ A;  1O73 A;  3UEM A;  2EC4 A;  2VL3 A;  2JZS A;  6GSX A;  4IHU A;  5ENU A;  4EVM A;  5KN2 A;  4I2T A;  5ELG A;  3P8W A;  4V2M A;  4X1U A;  3RBT A;  2WCI A;  3M8N A;  3BCK A;  4TXO B;  3DD3 A;  4WR4 A;  2FWE A;  5F06 A;  5AIV A;  5ABR A;  1SJZ A;  3TKQ A;  1O8W A;  4DEJ A;  4K9Z A;  3F6D A;  2CT6 A;  2VCT A;  1IYI A;  5DAK A;  3O6T A;  2PWJ A;  3HJP A;  1KBN A;  5ECQ B;  4POM A;  4XRD A;  1JLW A;  2E2M A;  2IMD A;  3CRU A;  1Q4J A;  1DE1 A;  3IK9 A;  2HSH A;  3D6I A;  5ECS A;  5C00 A;  4K0N A;  5CRH A;  5AIX A;  4MJC A;  2C1Y A;  2MMN A;  3A3T A;  4YQU A;  2ON7 A;  1V58 A;  5FT3 A;  4MJE A;  5AN1 A;  1YJ6 A;  2LQO A;  4IP1 A;  1BQ7 A;  4KA0 A;  2E2G A;  1YKC A;  3I43 A;  3GYK A;  2KP1 A;  1Z9H A;  4JR4 A;  1ABA A;  3IE3 A;  1FAA A;  5DQY A;  3C71 A;  2YZH A;  2IMF A;  3CRT A;  3IK7 A;  1M9B A;  1TI3 A;  2GT5 A;  4CDO A;  3GL3 A;  2FHE A;  3TDG A;  3DML A;  2XPD A;  1K3L A;  2MMA A;  3CXG A;  6GSV A;  1GUL A;  1SYR A;  1ERV A;  3GHA A;  2B3S A;  2IJY A;  2H1G A;  3N9J A;  3GN3 A;  1J08 A;  3IAS 2;  1T3B A;  2B1L A;  2H76 A;  4OWY A;  5KN3 A;  4ML6 A;  3UJ1 A;  4D73 B;  3ZMK A;  1PMT A;  2ES7 A;  16GS A;  4POL A;  3IBH A;  2IL3 A;  2RUF A;  2BJX A;  1T1V A;  2WJU A;  5JWO B;  5DJL A;  5G1L A;  4G2E A;  2DJ2 A;  1GH2 A;  1GSD A;  2DIY A;  2K9F A;  1T8E B;  3RDW A;  2VCW A;  3D5J A;  3LGC A;  3DEX A;  6GSU A;  1OYJ A;  4N10 A;  1T00 A;  4L0W A;  2VUP A;  2YV9 A;  3F8U A;  4MF7 A;  2H8L A;  4N0V A;  4KND A;  2YJ7 A;  3VFI A;  5DJM A;  1WJK A;  4ZB9 A;  1AQW A;  1OE8 A;  1QK8 A;  2X99 A;  4K7I A;  3QFA C;  1QUW A;  2QKE A;  1O81 A;  4YQM A;  1GRX A;  4HS1 A;  2H74 A;  5CNW A;  1SL0 B;  2E7P A;  5HR3 A;  4MMM A;  2LTK A;  1F3B A;  3GMF A;  4CW9 A;  3LQ7 A;  3IHQ A;  1XZO A;  2OA7 A;  2K8S A;  3IR4 A;  3ISO A;  5KN1 A;  2OJL A;  2MZC A;  3GV1 A;  1GNE A;  5C04 A;  3ZZX A;  2OBK A;  4XS1 A;  3TGZ A;  5D93 A;  1MDI A;  1ON4 A;  3TJG A;  4X0X A;  5G31 A;  1FO5 A;  5ID2 B;  1VGL A;  2GS3 A;  2CQ9 A;  3L9V A;  2EIO A;  1HYU A;  2B6M A;  1WOU A;  2MMZ A;  2YCD A;  1BJX A;  2DSA A;  2WB9 A;  1TK5 B;  1YF1 A;  4L8E A;  3GKX A;  4GLT A;  2D2Z A;  20GS A;  3KEB A;  4EXJ A;  1R7H A;  3F0I A;  3KP8 A;  4IQA A;  1EGR A;  6GST A;  5IO2 A;  4HZ2 A;  4PX1 A;  1JZW A;  2F9S A;  1R5P A;  4TOP A;  1G7E A;  2VL2 C;  5IPG A;  2P0G A;  5LNK e;  1TI1 A;  4EL1 A;  2I1U A;  3CSI A;  4JE1 A;  1EWX A;  3APO A;  5EY6 A;  3VWX A;  5ECN B;  4EO3 A;  1PKW A;  4OMV A;  1QGV A;  3Q6O A;  3HDC A;  3HKR A;  2VL9 A;  5CO3 A;  4PUA A;  1M2D A;  3GFK A;  5IQY A;  1M2A A;  4BWS A;  4TR1 B;  4HU9 A;  4EC0 A;  1Z6N A;  1SL1 B;  2HI7 A;  2X64 A;  1TK8 B;  4MF5 A;  3FK8 A;  2BTO T;  3QPM A;  1PL2 A;  1YEX A;  2VM2 A;  3MWH A;  1M0U A;  2BMX A;  1TOF A;  3NIV A;  4J57 E;  3LFL A;  1HQO A;  1F9M A;  4MLY A;  5F8B A;  2VAF A;  1TRV A;  2FNO A;  3TJB A;  5DAL B;  2H30 A;  2PER A;  3KTB A;  4WF5 A;  1GLP A;  1XWK A;  1K0B A;  1USB A;  2P5Q A;  2P31 A;  5JCG A;  1PRX A;  2HXK A;  1BYE A;  4GXZ A;  2N5B A;  3AY8 A;  3KZQ A;  1OC8 A;  3TKS C;  1GWC A;  4K8M A;  4F0C A;  2FWG A;  2GQL A;  2X8G A;  2CVK A;  3ZFB A;  2DJK A;  5E59 A;  5FHI A;  3DVW A;  2N5F A;  2PVO C;  2GSS A;  4E8E A;  1T7P B;  2AYT A;  1V40 A;  5G30 A;  3GSS A;  4TR0 A;  4ECI A;  1S3D A;  1B8X A;  2R2J A;  2G0F A;  1GUH A;  4HQS A;  2FGX A;  2LS5 A;  5IMA A;  3D0Z A;  3A2V A;  4FYU A;  1TTZ A;  1SKW B;  3TKS E;  2GZY A;  5DVB A;  4MZW A;  4MCU A;  2WFC A;  1GTU A;  1K0A A;  3IRA A;  3EMP A;  5EL8 A;  4ECJ A;  4N30 A;  3U5R E;  4LL1 B;  3F4T A;  3MDK A;  2P5R A;  3TKS A;  5IO0 A;  3GUS A;  4XS4 A;  1EGO A;  4AJ7 A;  5H5S A;  3ME8 A;  3CSJ A;  4PNF A;  3TKP A;  2NVL A;  2CZ2 A;  3H79 A;  4RI7 A;  3EMX A;  5JWQ B;  2IME A;  5IIZ A;  2R37 A;  2H0I A;  2F8A A;  1DUG A;  3C73 A;  2HYX A;  2JL4 A;  2LNT A;  1NM3 A;  4PXO A;  1GNW A;  5GSS A;  4V1A g;  1MEK A;  2VCQ A;  1PGT A;  2V41 A;  1TU8 A;  2V6O A;  9GSS A;  4ACS A;  1G7O A;  4LA1 A;  4P3Y B;  5HR2 A;  4POK A;  4IQ1 A;  3GL5 A;  4DSQ A;  2XBQ A;  4F9Z A;  4Q5R A;  2LV3 A;  3GUR A;  2H1B A;  5JCW A;  1FB0 A;  2H19 A;  4F2I A;  1CQH A;  1GTB A;  2NBS A;  1SL2 B;  4G9H A;  2JAC A;  4JR6 A;  2VM1 A;  2QC7 A;  3EIN A;  1J9B A;  3QAG A;  3LEF A;  1XCC A;  2L5L A;  3QAW A;  1SJ6 A;  5ECH B;  4OD7 A;  5AIS A;  1EV9 A;  3IC4 A;  2DLX A;  4GCI A;  4ULX A;  1Q98 A;  1GSU A;  1QMV A;  5DAK B;  3VWW A;  2NPB A;  4RQX A;  5F05 A;  5IMC A;  2H75 A;  2RM5 A; 
#chains in the Genus database with same CATH topology
 4OO5 A;  2X8H A;  4AGS A;  2CX3 A;  3OR5 A;  4KH7 A;  4LMW A;  2MBS A;  4XRA A;  1GL8 A;  4IP6 A;  1ZL9 A;  3TB2 A;  4Z2U A;  2H0G A;  3P90 A;  1YY7 A;  2LEG A;  2J9H A;  1SD8 A;  1A2J A;  4YH2 A;  1ML6 A;  3CQF A;  1Z5Y E;  1WIK A;  3PH9 A;  5FWG A;  4HUA A;  3NZN A;  5GZZ B;  4HOJ A;  1ERU A;  3L9S A;  3G7J A;  4HU7 A;  3IXR A;  1OC9 A;  2GSR A;  2JZT A;  5D9X A;  3VPQ A;  2C8U A;  2YZU A;  4KF9 A;  2F3M A;  3EPT A;  5D73 A;  5JCU A;  1AC1 A;  3MSZ A;  2JU5 A;  3ZRD A;  1XVQ A;  1Y6E A;  1F6M C;  2L6C A;  3FR3 A;  4XS6 A;  1QQ2 A;  3IV4 A;  4N0Z A;  1S3A A;  1ST9 A;  3KCM A;  4GRF A;  4KDX A;  4F03 A;  2AHE A;  4MPF A;  5B6M A;  3KIJ A;  3GRX A;  4JU5 A;  4YAV A;  5ECL B;  1S3C A;  4H86 A;  2H73 A;  1J0F A;  3ZVJ D;  3FY7 A;  3QR6 A;  4IS0 A;  2WDU A;  5D9V A;  5IMF A;  5KOX A;  1OKD A;  3HZ8 A;  3W6G A;  1XIY A;  2RLI A;  5H5Q A;  5COH A;  2V6K A;  1U6T A;  4K6X A;  2ON5 A;  3GH9 A;  3ZTL A;  1B9X C;  2C3T A;  4ZBB A;  3NOF A;  4WBR D;  2L59 A;  1EP8 A;  2CAI A;  3O3T A;  2R6K A;  3Q19 A;  5CRW A;  3FZ5 A;  4TXO A;  2H6Y A;  4GST A;  2DKH A;  4KE3 A;  1Z7P A;  4FYC A;  1F2E A;  5A4W A;  4OCE A;  1YDK A;  4MH3 A;  4F0B A;  1MDJ A;  2EIR A;  5CP1 A;  3ZLP A;  2DML A;  1Y25 A;  1G6W A;  2O85 A;  2X4A A;  1TXX A;  1G6Y A;  2IFQ B;  2R4V A;  4ZL7 A;  3BD2 A;  2H6X A;  3K8N A;  1GSY A;  2YWO A;  2ZCT A;  3TJK A;  1F3A A;  2YPM A;  5B6N A;  18GS A;  5EVO A;  2JSZ A;  1GLQ A;  2OKA A;  2V2G A;  5CRE A;  1PQN A;  3W8J A;  3D4T A;  4EE0 A;  2O87 A;  3ZVJ A;  5IOW A;  3D4M A;  2AB6 A;  1JZO A;  1EOG A;  5D9T A;  4IVF A;  1UN2 A;  13GS A;  4I97 A;  3FR6 A;  3KH9 A;  1SK0 A;  1FB6 A;  2HLS A;  1HNC A;  1GSF A;  3IDV A;  3JCM L;  1URM A;  4JED A;  1WE0 A;  3G7Y A;  4XIH A;  4TW5 A;  4O92 A;  2C4J A;  14GS A;  3ZL5 A;  1TJD A;  2VCX A;  2O8V B;  4L5O A;  5G1K A;  4RI6 A;  1HNB A;  2C0E A;  5LD0 A;  4OFM A;  3UIW A;  3DWV A;  3TJF A;  3HJO A;  3H93 A;  1SJI A;  4BL7 B;  3ZFL A;  4LMV A;  3I69 A;  2FA4 A;  3LYK A;  3UAP A;  5A4V A;  2J23 A;  2QGV A;  1EZK A;  1GTI A;  2FD3 A;  1TU7 A;  1U88 A;  1AQX A;  2YAN A;  1JHB A;  1VF3 A;  3L9U A;  1BAY A;  1M9A A;  3PIN A;  3VWU A;  1SKS B;  1XW9 A;  2NTO A;  2VCV A;  3HVV A;  4OCF A;  2LST A;  1GSE A;  4KSM A;  3DRN A;  2DJ1 A;  1NHO A;  3BJ5 A;  2CAQ A;  2OE1 A;  2RUE A;  4EKZ A;  4MJA A;  1E6B A;  1Z6M A;  5HR0 A;  2IN3 A;  1NHY A;  5D9W A;  1SEN A;  2YJH A;  1FOH A;  4XHM A;  3UMA A;  1M7T A;  3FMW A;  5HQP A;  3ERW A;  1JLV A;  4ZB6 A;  1EOH A;  1OKT A;  3UAR A;  3RPN A;  7GSS A;  1YKA A;  4HDE A;  3FZA A;  1A2L A;  5A4U A;  2XHF A;  2TIR A;  3H8Q A;  4KB3 A;  2IMK A;  1F37 A;  2K18 A;  1SK1 A;  3VLN A;  4PUR A;  5J9B A;  1OC3 A;  5D8I A;  3EYT A;  4ZBA A;  6GSS A;  1MTC A;  2Z9S A;  3UBK A;  4CY8 A;  4TN8 A;  4HZ4 A;  4EF0 A;  3C1S A;  2HE3 A;  1V57 A;  1SK2 A;  1GSQ A;  1UA5 A;  2HSY A;  2KOK A;  4OFN A;  2DJ0 A;  2PMT A;  5F07 A;  5J4U A;  3KH7 A;  5H5R A;  5B8B A;  5HR1 A;  4PQI A;  3ZIJ A;  4KDU A;  3UOM A;  3L78 A;  2VL2 A;  3HYP A;  4NPB A;  3UVH A;  3FYG A;  5J9C A;  3HXS A;  1QXH A;  1H75 A;  5HFI A;  4RUV A;  3LXZ A;  4POB A;  4GQC A;  3GX8 A;  4NMU A;  1AW9 A;  2GT6 A;  4DSS B;  2LJA A;  2A4V A;  1ZZY A;  4WR5 A;  3TKR A;  3VK9 A;  2GSQ A;  6GSW A;  1SD9 A;  1I9D A;  3G7I A;  1WWJ A;  3P7X A;  4KCE A;  5IMZ A;  2VD1 A;  2KP2 A;  3EU3 A;  1OVN A;  2HSM A;  2IMI A;  3IOS A;  3IAM 2;  3Q74 A;  1YF0 A;  4TR1 A;  5G5F A;  2K6V A;  1BX9 A;  3WGE A;  1M99 A;  2WGR A;  3GKN A;  4K5R A;  2GQK A;  5LCZ A;  2GLR A;  4ECC A;  1X0R A;  1N2A A;  2LRC A;  5ELA A;  4PTS A;  4MH2 A;  4MAB A;  4JBB A;  2YN1 A;  4J56 E;  5DAL A;  4PUF C;  4G0I A;  5IOX A;  1XW5 A;  3KMN A;  2VOC A;  3VI5 A;  2LNS A;  3A5I A;  2M72 A;  1AXD A;  4O7H A;  3D21 A;  2CVD A;  4TR3 A;  4IBP A;  12GS A;  2GST A;  3I9V 2;  2DMM A;  1XWC A;  1X5D A;  1ZMA A;  1GUK A;  4MZC A;  1SYX A;  3L0H A;  2WZ9 A;  3HD5 A;  2DBC A;  4QL7 A;  3TRP A;  1B4Q A;  1VF4 A;  4GSN A;  4MZB A;  3SBC A;  3ZRE A;  1FVJ A;  1DSB A;  2H1D A;  1VF2 A;  2PU9 C;  4NAX A;  2A2S A;  4IW9 A;  2KHP A;  1A0F A;  5CAX A;  1MD4 A;  4KGI A;  1K0O A;  2TRX A;  3PGT A;  1T4Z A;  4NWY A;  4HEA 2;  1XXU A;  3ME7 A;  4HJM A;  5INY A;  1X5C A;  1TKD B;  1OE7 A;  2H01 A;  2QA1 A;  2OE3 A;  4K7N A;  3M1G A;  1DE2 A;  2FCH A;  2H72 A;  4YAP A;  3CTG A;  1XPV A;  2XBI A;  2C0D A;  2DIZ A;  2B5X A;  3VWV A;  1SU9 A;  2B7J A;  1FOV A;  2FA8 A;  4BVX A;  5KN0 A;  4L0U A;  2R5G A;  2FWF A;  3BOA A;  1FHE A;  1Z3E A;  2AUV A;  4I5Q A;  1PKZ A;  5CRD A;  1NW2 A;  4IN0 A;  2LJR A;  1BG5 A;  3HHV A;  1KEB A;  3EVI A;  2AJQ B;  4ZBD A;  2GDR A;  2K8V A;  4GWR A;  4RQR A;  1PN9 A;  3C8E A;  4IJ3 A;  3KTL A;  4TRX A;  4IKH A;  2LRT A;  1R5A A;  3FEU A;  1JZR A;  4EUY A;  3KGK A;  2C0F A;  5GAP D;  1Z7R A;  2GZP A;  2M80 A;  17GS A;  1K3O A;  5JWR B;  3GTU A;  4WKW A;  5AGY A;  2MMO A;  5ECO B;  4GTU A;  1AAZ A;  2OE0 A;  5IM9 A;  4TKY A;  2L4C A;  3EE2 A;  3ERF A;  4KCA A;  1YQ1 A;  4YKF A;  1RQM A;  2DJ3 A;  2YP6 A;  2KLX A;  4IEL A;  2HZE A;  1O8X A;  2YNX A;  3APS A;  2FLS A;  1O85 A;  3VUR A;  3E3E A;  1GSS A;  3WD6 A;  5DQS A;  2X8C A;  3Q18 A;  4BVY A;  4Z2T A;  3ZYW A;  4NV2 A;  4J2F A;  3FZ9 A;  3KXO A;  3HZ4 A;  4NHW A;  3DYR A;  1UC7 A;  1A24 A;  1GUM A;  2O89 A;  1A8Y A;  3CMI A;  4GF0 A;  4BPY A;  2HRK A;  1DBY A;  1WMJ A;  3N5O A;  4MJB A;  4KUN A;  2R0C A;  4I6X A;  2HZF A;  2CV4 A;  4AJ6 A;  3LWA A;  3F6F A;  4PQ1 A;  4G0K A;  1PSQ A;  1ILO A;  2XC2 A;  5J5N A;  2VLV A;  1O7U A;  2WUL A;  2HNL A;  1A0R P;  3KD0 A;  4MNN A;  2NDO A;  1EV4 A;  4IGJ A;  1TP9 A;  4WF4 A;  3ED3 A;  1XBS A;  3F3Q A;  3FKF A;  2PPT A;  3TCO A;  4G0L A;  3DGQ A;  1PA3 A;  8GSS A;  1UVZ A;  2R3X A;  4V2N A;  5J41 A;  1ZYQ B;  4OFT A;  4G10 A;  3KMO A;  2RM6 A;  5ECI B;  4ID0 A;  1ERW A;  4USS A;  1EEM A;  5DBQ A;  4QQ7 A;  1JFU A;  4FIW A;  10GS A;  2B7K A;  2L4Q A;  5DCH A;  3V1W A;  4I2U A;  4CHS A;  2V1M A;  3C7M A;  4PNG A;  3CBU A;  4ECB A;  4WBJ A;  5IPH A;  5G5E A;  2CX4 A;  1H4O A;  1XOB A;  3E0U A;  5D96 A;  1X9W B;  3GX0 A;  5E4W A;  5J3R A;  2VCZ A;  3EC3 A;  6GSY A;  1SKR B;  1GP1 A;  1KTE A;  2HRF A;  1V98 A;  1FG4 A;  2ZNM A;  1YZX A;  3LOR A;  11GS A;  3WYW A;  19GS A;  1XWB A;  2YWI A;  1X9S B;  1B4P A;  3HY2 A;  2AV4 A;  5ECR B;  2REM A;  3VI7 A;  2LQQ A;  1TK0 B;  2E0Q A;  2LRN A;  3F9U A;  4N11 A;  4K7O A;  4FO5 A;  2DJJ A;  3LYP A;  4Q5F A;  3BCI A;  3VPT A;  1PN0 A;  3GA4 A;  3MNG A;  3GIX A;  22GS A;  4KW6 A;  4KSO A;  5B7C A;  1LJR A;  1EP7 A;  2LUS A;  2F51 A;  4KAE A;  2G2Q A;  4O5R A;  3ZML A;  2JZR A;  3RHB A;  3UL3 A;  4KX4 A;  1THO A;  4XCS A;  1YEP A;  3QD9 A;  3L4N A;  1G0T A;  3SWL A;  4JZQ A;  2IFQ A;  2ZUP A;  1XFL A;  5ECK B;  4D73 A;  2HFD A;  1ZYN A;  3QAV A;  2TRC P;  4ISD A;  4YQV A;  1R26 A;  3TJJ A;  1QFN A;  5DDL A;  3QOU A;  3DXB A;  5CYY A;  2GZZ A;  2MYG A;  3F63 A;  4K2D A;  4Q5Q A;  1KNG A;  2JAD A;  1M3J A;  3IC8 A;  3LJR A;  3E9J B;  1M2B A;  3O76 A;  3A5W A;  2C0G A;  2L5O A;  2HRA A;  1U3I A;  3A2X A;  1XWG A;  3F3R A;  3GKK A;  2L6D A;  5G2Z A;  1AUC A;  2O7K A;  1AQV A;  1K3Y A;  2DC5 A;  2I3Y A;  4ZIJ A;  2C3N A;  2CA8 A;  3KP9 A;  3EWL A;  4XTS A;  3BBY A;  4WXT A;  2FUG 2;  4NHZ A;  1K0M A;  2H1A A;  3LXT A;  3TUE A;  1XWA A;  1W89 A;  2H71 A;  3HA9 A;  1GTA A;  4AF2 A;  2IWT A;  3QFB C;  4FQU A;  3IPZ A;  3M9J A;  4G19 A;  1TW9 A;  1T4Y A;  1LBK A;  1WP0 A;  1WPI A;  2N5A A;  3FHK A;  4YKG A;  2ALB A;  3CSH A;  4WET A;  5EPF A;  2QA2 A;  3UBL A;  2VLU A;  2L57 A;  3W8S A;  4BL7 A;  3ZIV A;  1X9M B;  3QMX A;  5GST A;  2H70 A;  2VLT A;  3GNJ A;  2CVB A;  5B8A A;  3H4K A;  4I8B A;  1JZD A;  2H0H A;  1U3A A;  5ID2 A;  2X49 A;  2CZ3 A;  2B5E A;  4FH8 A;  3LG6 A;  2I81 A;  2GVP A;  4IJI A;  5F0G A;  3FW2 A;  1PD2 1;  3WT2 A;  1ZOF A;  3RHC A;  1CQG A;  3FZ4 A;  2DKI A;  3FR9 A;  4ZXG A;  1K0C A;  1NSW A;  4ZIL A;  1C72 A;  3HVS A;  3ZIT A;  1TDI A;  3TOT A;  2LJK A;  2M46 A;  3LSZ A;  3P2A A;  3C1R A;  3HCZ A;  1THX A;  4O32 A;  1PL1 A;  2GGT A;  4TXV A;  4AJ8 A;  2XPE A;  1MD3 A;  2LKU A;  4Z7X A;  1EEJ A;  1U87 A;  3F4S A;  1WRY A;  4MA9 A;  2FWH A;  1A2M A;  1W4V A;  4XS4 B;  1LU4 A;  1K0N A;  3FRC A;  4BWQ A;  4EDZ A;  1X5E A;  4ILF A;  2AAW A;  1I5G A;  4EDY A;  3WT1 A;  2H66 A;  5DCG A;  3APQ A;  4K2X A;  2F8F A;  2RII A;  4PQH A;  4MDC A;  4ZL8 A;  4LLR A;  3WGD A;  4K5S A;  4F82 A;  4KDY A;  4JRR A;  4FYB A;  1B9Y C;  1ZYE A;  1TRW A;  2C3Q A;  2GQM A;  2YWN A;  3QDN A;  1E2Y A;  2WS2 A;  4V2L A;  3KJY A;  1BED A;  2VO4 A;  1A8L A;  4TR4 A;  3D22 A;  2IPA A;  5IMD A;  3IA1 A;  4GQF A;  1RW1 A;  2HT9 A;  3S9F A;  4ICY A;  2WRT A;  5A5K A;  4HI7 A;  1ACV A;  3CYN A;  2FY6 A;  3TOU A;  1RK4 A;  3J7Y b;  2B1K A;  4DSS A;  3H1N A;  4X43 A;  3EUR A;  1XW6 A;  3M3M A;  4PGT A;  3PPU A;  3KM6 A;  2H6Z A;  5CRG A;  2OAD A;  4MP4 A;  2VD0 A;  2YWM A;  4OO4 A;  3M9K A;  1FVK A;  5IMV A;  3GH6 A;  1XG8 A;  4MF6 A;  1ERT A;  1O6J A;  4ML1 A;  4NV5 A;  3GST A;  4NXI A;  2MBT A;  4LL4 B;  3RPP A;  4L5L A;  2A2R A;  2PVQ A;  3U6V A;  3GTU B;  4MPG A;  5ECM B;  2OBI A;  2PUK C;  2QSI A;  2YOI A;  1AIU A;  1S3R A;  1OAZ A;  4HQZ A;  4QL9 A;  1HNA A;  2KUC A;  1V2A A;  1ZYP A;  3QCP A;  3RAZ A;  3ERG A;  3EU4 A;  4MK3 A;  3A2W A;  4BA7 A;  2HRN A;  4Q5N A;  3DIE A;  5HFK A;  5BRT A;  3F4R A;  4BIK A;  3DKS A;  2OAC A;  2HZE B;  2PN8 A;  1V9W A;  2C80 A;  2I4A A;  1PX6 A;  4HJ2 A;  1A23 A;  2B5Y A;  2GTU A;  1IYH A;  3CTF A;  1ZCP A;  5ECP B;  3WGX A;  3G9B A;  5GAN D;  3DVX A;  4K0G A;  5L71 A;  4DVC A;  3M0F A;  3R2Q A;  1OC9 B;  1PX7 A;  2JSY A;  3J7Y k;  2PGT A;  3UVT A;  4GSS A;  4ZB8 A;  3I6A A;  3PR8 A;  1XVW A;  1TRS A;  2PBJ A;  1VF1 A;  3HJM A;  1ZGN A;  4ZL9 A;  1XOA A;  4O5U A;  3TRX A;  1K0D A;  4V1A p;  4K1F A;  1TRU A;  4E8H A;  1FW1 A;  1MDK A;  3MAK A;  2I9H A;  2VIM A;  5HFG A;  3HVX A;  3US3 A;  4WEY A;  2V32 A;  2YV7 A;  3GKM A;  1B48 A;  2IIY A;  1HD2 A;  1R4W A;  1VRS D;  4DSR A;  5KEJ A;  1N8J A;  2EIQ A;  4TVE A;  3TRQ A;  1O73 A;  3UEM A;  2EC4 A;  2VL3 A;  2JZS A;  6GSX A;  4IHU A;  5ENU A;  4EVM A;  5KN2 A;  4I2T A;  5ELG A;  3P8W A;  4V2M A;  4X1U A;  3RBT A;  2WCI A;  3M8N A;  3BCK A;  4TXO B;  3DD3 A;  4WR4 A;  4Z2R A;  2FWE A;  5F06 A;  5AIV A;  5ABR A;  1SJZ A;  3TKQ A;  1O8W A;  4DEJ A;  4K9Z A;  3F6D A;  2CT6 A;  2VCT A;  1IYI A;  5DAK A;  3O6T A;  2PWJ A;  3HJP A;  1KBN A;  5ECQ B;  4POM A;  4XRD A;  1JLW A;  2E2M A;  2IMD A;  3CRU A;  1Q4J A;  1DE1 A;  3IK9 A;  2HSH A;  3D6I A;  5ECS A;  5C00 A;  4K0N A;  5CRH A;  5AIX A;  4MJC A;  2C1Y A;  2MMN A;  3A3T A;  4YQU A;  2ON7 A;  1V58 A;  5FT3 A;  4MJE A;  5AN1 A;  1YJ6 A;  2LQO A;  4IP1 A;  1BQ7 A;  4KA0 A;  2UZ8 A;  2E2G A;  1YKC A;  3I43 A;  3GYK A;  2KP1 A;  1Z9H A;  4JR4 A;  1ABA A;  3IE3 A;  1FAA A;  5DQY A;  3C71 A;  2YZH A;  2IMF A;  3CRT A;  3IK7 A;  1M9B A;  1TI3 A;  2GT5 A;  4CDO A;  3GL3 A;  2FHE A;  3TDG A;  3DML A;  2XPD A;  1K3L A;  2MMA A;  3CXG A;  6GSV A;  1GUL A;  1SYR A;  1ERV A;  3GHA A;  2B3S A;  2IJY A;  2H1G A;  3N9J A;  3GN3 A;  1J08 A;  3IAS 2;  1T3B A;  2B1L A;  2H76 A;  4OWY A;  5KN3 A;  4ML6 A;  3UJ1 A;  4HSC X;  4D73 B;  3ZMK A;  3MYD A;  1PMT A;  2ES7 A;  16GS A;  4EIQ A;  4POL A;  3IBH A;  2IL3 A;  2RUF A;  2BJX A;  1T1V A;  2WJU A;  5JWO B;  5DJL A;  5G1L A;  4G2E A;  2DJ2 A;  3HVN A;  1GH2 A;  1GSD A;  2DIY A;  2K9F A;  1T8E B;  3RDW A;  2VCW A;  3D5J A;  3LGC A;  3DEX A;  6GSU A;  1OYJ A;  4N10 A;  1T00 A;  4L0W A;  2VUP A;  2YV9 A;  3F8U A;  4MF7 A;  2H8L A;  4N0V A;  4KND A;  2YJ7 A;  3MIX A;  3VFI A;  5DJM A;  1WJK A;  2A4H A;  4ZB9 A;  1AQW A;  1OE8 A;  1QK8 A;  2X99 A;  4K7I A;  3QFA C;  1QUW A;  2QKE A;  1O81 A;  4YQM A;  1GRX A;  4HS1 A;  2H74 A;  5CNW A;  1SL0 B;  2E7P A;  5HR3 A;  4MMM A;  2LTK A;  1F3B A;  3GMF A;  4CW9 A;  3LQ7 A;  3IHQ A;  1XZO A;  2OA7 A;  2K8S A;  3IR4 A;  3ISO A;  5KN1 A;  2OJL A;  2MZC A;  3GV1 A;  1GNE A;  5C04 A;  3ZZX A;  2OBK A;  5BMU A;  4XS1 A;  3TGZ A;  5D93 A;  1MDI A;  1ON4 A;  3TJG A;  4X0X A;  5G31 A;  1FO5 A;  5ID2 B;  1VGL A;  2GS3 A;  2CQ9 A;  3L9V A;  2EIO A;  1HYU A;  2B6M A;  1WOU A;  2MMZ A;  2YCD A;  1BJX A;  2DSA A;  2WB9 A;  1TK5 B;  1YF1 A;  1M3I A;  4L8E A;  3GKX A;  4GLT A;  1PFO A;  2D2Z A;  20GS A;  3KEB A;  4EXJ A;  1R7H A;  3F0I A;  3KP8 A;  4IQA A;  1EGR A;  6GST A;  5IO2 A;  4HZ2 A;  4PX1 A;  1JZW A;  2F9S A;  1R5P A;  4TOP A;  1G7E A;  2VL2 C;  5IPG A;  2P0G A;  5LNK e;  1TI1 A;  4EL1 A;  2I1U A;  3CSI A;  4JE1 A;  1EWX A;  3APO A;  5EY6 A;  2R0P A;  3VWX A;  3LW9 A;  5ECN B;  4EO3 A;  1PKW A;  4OMV A;  1QGV A;  3Q6O A;  3HDC A;  3HKR A;  2VL9 A;  5CO3 A;  4PUA A;  1M2D A;  3GFK A;  5IQY A;  1M2A A;  4BWS A;  4TR1 B;  4HU9 A;  4EC0 A;  1Z6N A;  1SL1 B;  2HI7 A;  2X64 A;  1TK8 B;  4MF5 A;  3FK8 A;  2BTO T;  3QPM A;  1PL2 A;  1YEX A;  2VM2 A;  3MWH A;  1M0U A;  2BMX A;  1TOF A;  3NIV A;  4J57 E;  3LFL A;  5KOW A;  1HQO A;  1F9M A;  4MLY A;  5F8B A;  2VAF A;  1TRV A;  2FNO A;  3TJB A;  5DAL B;  2H30 A;  2PER A;  3KTB A;  4WF5 A;  4A5P A;  1GLP A;  1XWK A;  1K0B A;  4EIP A;  1USB A;  2P5Q A;  2P31 A;  4X4J A;  5JCG A;  1PRX A;  2HXK A;  1BYE A;  4GXZ A;  2N5B A;  3AY8 A;  3KZQ A;  1OC8 A;  3TKS C;  1GWC A;  4K8M A;  4F0C A;  2FWG A;  2GQL A;  2X8G A;  2CVK A;  3ZFB A;  2DJK A;  5E59 A;  5FHI A;  3DVW A;  2N5F A;  2PVO C;  2GSS A;  3R3E A;  4E8E A;  1T7P B;  2AYT A;  1V40 A;  5G30 A;  3GSS A;  4TR0 A;  4ECI A;  1S3D A;  1B8X A;  2R2J A;  2G0F A;  1GUH A;  4HQS A;  2FGX A;  2LS5 A;  5IMA A;  3D0Z A;  3A2V A;  4FYU A;  1TTZ A;  4BVX B;  1SKW B;  3TKS E;  2GZY A;  5DVB A;  4MZW A;  4MCU A;  2WFC A;  3IHG A;  1GTU A;  1K0A A;  3IRA A;  3EMP A;  5EL8 A;  4ECJ A;  4N30 A;  3U5R E;  4LL1 B;  3F4T A;  3MDK A;  2P5R A;  3TKS A;  5IO0 A;  3GUS A;  4XS4 A;  1EGO A;  4AJ7 A;  5H5S A;  3ME8 A;  2A2P A;  3CSJ A;  4PNF A;  3TKP A;  2NVL A;  2CZ2 A;  3H79 A;  4RI7 A;  3EMX A;  5JWQ B;  2IME A;  5IIZ A;  2R37 A;  2H0I A;  2F8A A;  1DUG A;  3C73 A;  2HYX A;  2JL4 A;  2LNT A;  1NM3 A;  4PXO A;  1GNW A;  5GSS A;  4V1A g;  1MEK A;  2VCQ A;  1PGT A;  2V41 A;  1TU8 A;  2V6O A;  9GSS A;  4ACS A;  1G7O A;  4LA1 A;  4P3Y B;  5HR2 A;  4POK A;  2R0G A;  4IQ1 A;  3GL5 A;  4DSQ A;  2XBQ A;  4F9Z A;  4Q5R A;  2LV3 A;  3GUR A;  2H1B A;  4BVY B;  5JCW A;  1FB0 A;  2H19 A;  4F2I A;  1CQH A;  1GTB A;  2NBS A;  1SL2 B;  4G9H A;  2JAC A;  4JR6 A;  2VM1 A;  2QC7 A;  3EIN A;  1J9B A;  3QAG A;  4CY6 A;  3LEF A;  1XCC A;  2L5L A;  3QAW A;  1SJ6 A;  5ECH B;  4OD7 A;  5AIS A;  4O5Q A;  1EV9 A;  3IC4 A;  2DLX A;  4GCI A;  4ULX A;  1Q98 A;  1GSU A;  1QMV A;  5DAK B;  3VWW A;  2NPB A;  4RQX A;  5F05 A;  5IMC A;  2H75 A;  2RM5 A; 
#chains in the Genus database with same CATH homology
 4OO5 A;  2X8H A;  4AGS A;  2CX3 A;  3OR5 A;  4KH7 A;  4LMW A;  2MBS A;  4XRA A;  1GL8 A;  4IP6 A;  1ZL9 A;  3TB2 A;  4Z2U A;  2H0G A;  3P90 A;  1YY7 A;  2LEG A;  2J9H A;  1SD8 A;  1A2J A;  4YH2 A;  1ML6 A;  1Z5Y E;  1WIK A;  3PH9 A;  5FWG A;  4HUA A;  3NZN A;  5GZZ B;  4HOJ A;  1ERU A;  3L9S A;  3G7J A;  4HU7 A;  3IXR A;  1OC9 A;  2GSR A;  2JZT A;  5D9X A;  3VPQ A;  2C8U A;  2YZU A;  4KF9 A;  2F3M A;  3EPT A;  5D73 A;  5JCU A;  1AC1 A;  3MSZ A;  2JU5 A;  3ZRD A;  1XVQ A;  1Y6E A;  1F6M C;  2L6C A;  3FR3 A;  4XS6 A;  1QQ2 A;  3IV4 A;  4N0Z A;  1S3A A;  1ST9 A;  3KCM A;  4GRF A;  4KDX A;  4F03 A;  2AHE A;  4MPF A;  5B6M A;  3KIJ A;  3GRX A;  4JU5 A;  4YAV A;  5ECL B;  1S3C A;  4H86 A;  2H73 A;  1J0F A;  3ZVJ D;  3FY7 A;  3QR6 A;  4IS0 A;  2WDU A;  5D9V A;  5IMF A;  5KOX A;  1OKD A;  3HZ8 A;  3W6G A;  1XIY A;  2RLI A;  5H5Q A;  5COH A;  2V6K A;  1U6T A;  4K6X A;  2ON5 A;  3GH9 A;  3ZTL A;  1B9X C;  2C3T A;  4ZBB A;  3NOF A;  4WBR D;  2L59 A;  1EP8 A;  2CAI A;  3O3T A;  2R6K A;  3Q19 A;  5CRW A;  3FZ5 A;  4TXO A;  2H6Y A;  4GST A;  2DKH A;  4KE3 A;  1Z7P A;  4FYC A;  1F2E A;  5A4W A;  4OCE A;  1YDK A;  4MH3 A;  4F0B A;  1MDJ A;  2EIR A;  5CP1 A;  3ZLP A;  2DML A;  1Y25 A;  1G6W A;  2O85 A;  2X4A A;  1TXX A;  1G6Y A;  2IFQ B;  2R4V A;  4ZL7 A;  3BD2 A;  2H6X A;  3K8N A;  1GSY A;  2YWO A;  2ZCT A;  3TJK A;  1F3A A;  2YPM A;  5B6N A;  18GS A;  5EVO A;  2JSZ A;  1GLQ A;  2OKA A;  2V2G A;  5CRE A;  1PQN A;  3W8J A;  3D4T A;  4EE0 A;  2O87 A;  3ZVJ A;  5IOW A;  3D4M A;  2AB6 A;  1JZO A;  1EOG A;  5D9T A;  4IVF A;  1UN2 A;  13GS A;  4I97 A;  3FR6 A;  3KH9 A;  1SK0 A;  1FB6 A;  2HLS A;  1HNC A;  1GSF A;  3IDV A;  3JCM L;  1URM A;  4JED A;  1WE0 A;  3G7Y A;  4XIH A;  4TW5 A;  4O92 A;  2C4J A;  14GS A;  3ZL5 A;  1TJD A;  2VCX A;  2O8V B;  4L5O A;  5G1K A;  4RI6 A;  1HNB A;  2C0E A;  5LD0 A;  4OFM A;  3UIW A;  3DWV A;  3TJF A;  3HJO A;  3H93 A;  1SJI A;  4BL7 B;  3ZFL A;  4LMV A;  3I69 A;  2FA4 A;  3LYK A;  3UAP A;  5A4V A;  2J23 A;  2QGV A;  1EZK A;  1GTI A;  2FD3 A;  1TU7 A;  1U88 A;  1AQX A;  2YAN A;  1JHB A;  1VF3 A;  3L9U A;  1BAY A;  1M9A A;  3PIN A;  3VWU A;  1SKS B;  1XW9 A;  2NTO A;  2VCV A;  3HVV A;  4OCF A;  2LST A;  1GSE A;  4KSM A;  3DRN A;  2DJ1 A;  1NHO A;  3BJ5 A;  2CAQ A;  2OE1 A;  2RUE A;  4EKZ A;  4MJA A;  1E6B A;  1Z6M A;  5HR0 A;  2IN3 A;  1NHY A;  5D9W A;  1SEN A;  2YJH A;  1FOH A;  4XHM A;  3UMA A;  1M7T A;  3FMW A;  5HQP A;  3ERW A;  1JLV A;  4ZB6 A;  1EOH A;  1OKT A;  3UAR A;  3RPN A;  7GSS A;  1YKA A;  4HDE A;  3FZA A;  1A2L A;  5A4U A;  2XHF A;  2TIR A;  3H8Q A;  4KB3 A;  2IMK A;  1F37 A;  2K18 A;  1SK1 A;  3VLN A;  4PUR A;  5J9B A;  1OC3 A;  5D8I A;  3EYT A;  4ZBA A;  6GSS A;  1MTC A;  2Z9S A;  3UBK A;  4CY8 A;  4TN8 A;  4HZ4 A;  4EF0 A;  3C1S A;  2HE3 A;  1V57 A;  1SK2 A;  1GSQ A;  1UA5 A;  2HSY A;  2KOK A;  4OFN A;  2DJ0 A;  2PMT A;  5F07 A;  5J4U A;  3KH7 A;  5H5R A;  5B8B A;  5HR1 A;  4PQI A;  3ZIJ A;  4KDU A;  3UOM A;  3L78 A;  2VL2 A;  3HYP A;  4NPB A;  3UVH A;  3FYG A;  5J9C A;  3HXS A;  1QXH A;  1H75 A;  5HFI A;  4RUV A;  3LXZ A;  4POB A;  4GQC A;  3GX8 A;  4NMU A;  1AW9 A;  2GT6 A;  4DSS B;  2LJA A;  2A4V A;  1ZZY A;  4WR5 A;  3TKR A;  3VK9 A;  2GSQ A;  6GSW A;  1SD9 A;  1I9D A;  3G7I A;  1WWJ A;  3P7X A;  4KCE A;  5IMZ A;  2VD1 A;  2KP2 A;  3EU3 A;  1OVN A;  2HSM A;  2IMI A;  3IOS A;  3IAM 2;  3Q74 A;  1YF0 A;  4TR1 A;  5G5F A;  2K6V A;  1BX9 A;  3WGE A;  1M99 A;  2WGR A;  3GKN A;  4K5R A;  2GQK A;  5LCZ A;  2GLR A;  4ECC A;  1X0R A;  1N2A A;  2LRC A;  5ELA A;  4PTS A;  4MH2 A;  4MAB A;  4JBB A;  2YN1 A;  4J56 E;  5DAL A;  4PUF C;  4G0I A;  5IOX A;  1XW5 A;  3KMN A;  2VOC A;  3VI5 A;  2LNS A;  3A5I A;  2M72 A;  1AXD A;  4O7H A;  3D21 A;  2CVD A;  4TR3 A;  4IBP A;  12GS A;  2GST A;  3I9V 2;  2DMM A;  1XWC A;  1X5D A;  1ZMA A;  1GUK A;  4MZC A;  1SYX A;  3L0H A;  2WZ9 A;  3HD5 A;  2DBC A;  4QL7 A;  3TRP A;  1B4Q A;  1VF4 A;  4GSN A;  4MZB A;  3SBC A;  3ZRE A;  1FVJ A;  1DSB A;  2H1D A;  1VF2 A;  2PU9 C;  4NAX A;  2A2S A;  4IW9 A;  2KHP A;  1A0F A;  5CAX A;  1MD4 A;  4KGI A;  1K0O A;  2TRX A;  3PGT A;  1T4Z A;  4NWY A;  4HEA 2;  1XXU A;  3ME7 A;  4HJM A;  5INY A;  1X5C A;  1TKD B;  1OE7 A;  2H01 A;  2QA1 A;  2OE3 A;  4K7N A;  3M1G A;  1DE2 A;  2FCH A;  2H72 A;  4YAP A;  3CTG A;  1XPV A;  2XBI A;  2C0D A;  2DIZ A;  2B5X A;  3VWV A;  1SU9 A;  2B7J A;  1FOV A;  2FA8 A;  4BVX A;  5KN0 A;  4L0U A;  2R5G A;  2FWF A;  3BOA A;  1FHE A;  1Z3E A;  2AUV A;  4I5Q A;  1PKZ A;  5CRD A;  1NW2 A;  4IN0 A;  2LJR A;  1BG5 A;  3HHV A;  1KEB A;  3EVI A;  2AJQ B;  4ZBD A;  2GDR A;  2K8V A;  4GWR A;  4RQR A;  1PN9 A;  3C8E A;  4IJ3 A;  3KTL A;  4TRX A;  4IKH A;  2LRT A;  1R5A A;  3FEU A;  1JZR A;  4EUY A;  3KGK A;  2C0F A;  5GAP D;  1Z7R A;  2GZP A;  2M80 A;  17GS A;  1K3O A;  5JWR B;  3GTU A;  4WKW A;  5AGY A;  2MMO A;  5ECO B;  4GTU A;  1AAZ A;  2OE0 A;  5IM9 A;  4TKY A;  2L4C A;  3EE2 A;  3ERF A;  4KCA A;  1YQ1 A;  4YKF A;  1RQM A;  2DJ3 A;  2YP6 A;  2KLX A;  4IEL A;  2HZE A;  1O8X A;  2YNX A;  3APS A;  2FLS A;  1O85 A;  3VUR A;  3E3E A;  1GSS A;  3WD6 A;  5DQS A;  2X8C A;  3Q18 A;  4BVY A;  4Z2T A;  3ZYW A;  4NV2 A;  4J2F A;  3FZ9 A;  3KXO A;  3HZ4 A;  4NHW A;  3DYR A;  1UC7 A;  1A24 A;  1GUM A;  2O89 A;  1A8Y A;  3CMI A;  4GF0 A;  4BPY A;  2HRK A;  1DBY A;  1WMJ A;  3N5O A;  4MJB A;  4KUN A;  2R0C A;  4I6X A;  2HZF A;  2CV4 A;  4AJ6 A;  3LWA A;  3F6F A;  4PQ1 A;  4G0K A;  1PSQ A;  1ILO A;  2XC2 A;  5J5N A;  2VLV A;  1O7U A;  2WUL A;  2HNL A;  1A0R P;  3KD0 A;  4MNN A;  2NDO A;  1EV4 A;  4IGJ A;  1TP9 A;  4WF4 A;  3ED3 A;  1XBS A;  3F3Q A;  3FKF A;  2PPT A;  3TCO A;  4G0L A;  3DGQ A;  1PA3 A;  8GSS A;  1UVZ A;  2R3X A;  4V2N A;  5J41 A;  1ZYQ B;  4OFT A;  4G10 A;  3KMO A;  2RM6 A;  5ECI B;  4ID0 A;  1ERW A;  4USS A;  1EEM A;  5DBQ A;  4QQ7 A;  1JFU A;  4FIW A;  10GS A;  2B7K A;  2L4Q A;  5DCH A;  3V1W A;  4I2U A;  4CHS A;  2V1M A;  3C7M A;  4PNG A;  3CBU A;  4ECB A;  4WBJ A;  5IPH A;  5G5E A;  2CX4 A;  1H4O A;  1XOB A;  3E0U A;  5D96 A;  1X9W B;  3GX0 A;  5E4W A;  5J3R A;  2VCZ A;  3EC3 A;  6GSY A;  1SKR B;  1GP1 A;  1KTE A;  2HRF A;  1V98 A;  1FG4 A;  2ZNM A;  1YZX A;  3LOR A;  11GS A;  3WYW A;  19GS A;  1XWB A;  2YWI A;  1X9S B;  1B4P A;  3HY2 A;  2AV4 A;  5ECR B;  2REM A;  3VI7 A;  2LQQ A;  1TK0 B;  2E0Q A;  2LRN A;  3F9U A;  4N11 A;  4K7O A;  4FO5 A;  2DJJ A;  3LYP A;  4Q5F A;  3BCI A;  3VPT A;  1PN0 A;  3GA4 A;  3MNG A;  3GIX A;  22GS A;  4KW6 A;  4KSO A;  5B7C A;  1LJR A;  1EP7 A;  2LUS A;  2F51 A;  4KAE A;  2G2Q A;  4O5R A;  3ZML A;  2JZR A;  3RHB A;  3UL3 A;  4KX4 A;  1THO A;  4XCS A;  1YEP A;  3QD9 A;  3L4N A;  1G0T A;  3SWL A;  4JZQ A;  2IFQ A;  2ZUP A;  1XFL A;  5ECK B;  4D73 A;  2HFD A;  1ZYN A;  3QAV A;  2TRC P;  4ISD A;  4YQV A;  1R26 A;  3TJJ A;  1QFN A;  5DDL A;  3QOU A;  3DXB A;  5CYY A;  2GZZ A;  2MYG A;  3F63 A;  4K2D A;  4Q5Q A;  1KNG A;  2JAD A;  3IC8 A;  3LJR A;  3E9J B;  1M2B A;  3O76 A;  3A5W A;  2C0G A;  2L5O A;  2HRA A;  1U3I A;  3A2X A;  1XWG A;  3F3R A;  3GKK A;  2L6D A;  5G2Z A;  1AUC A;  2O7K A;  1AQV A;  1K3Y A;  2DC5 A;  2I3Y A;  4ZIJ A;  2C3N A;  2CA8 A;  3KP9 A;  3EWL A;  4XTS A;  3BBY A;  4WXT A;  2FUG 2;  4NHZ A;  1K0M A;  2H1A A;  3LXT A;  3TUE A;  1XWA A;  1W89 A;  2H71 A;  3HA9 A;  1GTA A;  4AF2 A;  2IWT A;  3QFB C;  4FQU A;  3IPZ A;  3M9J A;  4G19 A;  1TW9 A;  1T4Y A;  1LBK A;  1WP0 A;  1WPI A;  2N5A A;  3FHK A;  4YKG A;  2ALB A;  3CSH A;  4WET A;  5EPF A;  2QA2 A;  3UBL A;  2VLU A;  2L57 A;  3W8S A;  4BL7 A;  3ZIV A;  1X9M B;  3QMX A;  5GST A;  2H70 A;  2VLT A;  3GNJ A;  2CVB A;  5B8A A;  3H4K A;  4I8B A;  1JZD A;  2H0H A;  1U3A A;  5ID2 A;  2X49 A;  2CZ3 A;  2B5E A;  4FH8 A;  3LG6 A;  2I81 A;  2GVP A;  4IJI A;  5F0G A;  3FW2 A;  1PD2 1;  3WT2 A;  1ZOF A;  3RHC A;  1CQG A;  3FZ4 A;  2DKI A;  3FR9 A;  4ZXG A;  1K0C A;  1NSW A;  4ZIL A;  1C72 A;  3HVS A;  3ZIT A;  1TDI A;  3TOT A;  2LJK A;  2M46 A;  3LSZ A;  3P2A A;  3C1R A;  3HCZ A;  1THX A;  4O32 A;  1PL1 A;  2GGT A;  4TXV A;  4AJ8 A;  2XPE A;  1MD3 A;  2LKU A;  4Z7X A;  1EEJ A;  1U87 A;  3F4S A;  1WRY A;  4MA9 A;  2FWH A;  1A2M A;  1W4V A;  4XS4 B;  1LU4 A;  1K0N A;  3FRC A;  4BWQ A;  4EDZ A;  1X5E A;  4ILF A;  2AAW A;  1I5G A;  4EDY A;  3WT1 A;  2H66 A;  5DCG A;  3APQ A;  4K2X A;  2F8F A;  2RII A;  4PQH A;  4MDC A;  4ZL8 A;  4LLR A;  3WGD A;  4K5S A;  4F82 A;  4KDY A;  4JRR A;  4FYB A;  1B9Y C;  1ZYE A;  1TRW A;  2C3Q A;  2GQM A;  2YWN A;  3QDN A;  1E2Y A;  2WS2 A;  4V2L A;  3KJY A;  1BED A;  2VO4 A;  1A8L A;  4TR4 A;  3D22 A;  2IPA A;  5IMD A;  3IA1 A;  4GQF A;  1RW1 A;  2HT9 A;  3S9F A;  4ICY A;  2WRT A;  5A5K A;  4HI7 A;  1ACV A;  3CYN A;  2FY6 A;  3TOU A;  1RK4 A;  3J7Y b;  2B1K A;  4DSS A;  3H1N A;  4X43 A;  3EUR A;  1XW6 A;  3M3M A;  4PGT A;  3PPU A;  3KM6 A;  2H6Z A;  5CRG A;  2OAD A;  4MP4 A;  2VD0 A;  2YWM A;  4OO4 A;  3M9K A;  1FVK A;  5IMV A;  3GH6 A;  4MF6 A;  1ERT A;  1O6J A;  4ML1 A;  4NV5 A;  3GST A;  4NXI A;  2MBT A;  4LL4 B;  3RPP A;  4L5L A;  2A2R A;  2PVQ A;  3U6V A;  3GTU B;  4MPG A;  5ECM B;  2OBI A;  2PUK C;  2QSI A;  2YOI A;  1AIU A;  1OAZ A;  4HQZ A;  4QL9 A;  1HNA A;  2KUC A;  1V2A A;  1ZYP A;  3QCP A;  3RAZ A;  3ERG A;  3EU4 A;  4MK3 A;  3A2W A;  4BA7 A;  2HRN A;  4Q5N A;  3DIE A;  5HFK A;  5BRT A;  3F4R A;  3DKS A;  2OAC A;  2HZE B;  2PN8 A;  1V9W A;  2C80 A;  2I4A A;  1PX6 A;  4HJ2 A;  1A23 A;  2B5Y A;  2GTU A;  1IYH A;  3CTF A;  1ZCP A;  5ECP B;  3WGX A;  3G9B A;  5GAN D;  3DVX A;  4K0G A;  5L71 A;  4DVC A;  3M0F A;  3R2Q A;  1OC9 B;  1PX7 A;  2JSY A;  3J7Y k;  2PGT A;  3UVT A;  4GSS A;  4ZB8 A;  3I6A A;  3PR8 A;  1XVW A;  1TRS A;  2PBJ A;  1VF1 A;  3HJM A;  1ZGN A;  4ZL9 A;  1XOA A;  4O5U A;  3TRX A;  1K0D A;  4V1A p;  4K1F A;  1TRU A;  4E8H A;  1FW1 A;  1MDK A;  3MAK A;  2I9H A;  2VIM A;  5HFG A;  3HVX A;  3US3 A;  4WEY A;  2V32 A;  2YV7 A;  3GKM A;  1B48 A;  2IIY A;  1HD2 A;  1R4W A;  1VRS D;  4DSR A;  5KEJ A;  1N8J A;  2EIQ A;  4TVE A;  3TRQ A;  1O73 A;  3UEM A;  2EC4 A;  2VL3 A;  2JZS A;  6GSX A;  4IHU A;  5ENU A;  4EVM A;  5KN2 A;  4I2T A;  5ELG A;  3P8W A;  4V2M A;  4X1U A;  3RBT A;  2WCI A;  3M8N A;  3BCK A;  4TXO B;  3DD3 A;  4WR4 A;  4Z2R A;  2FWE A;  5F06 A;  5AIV A;  5ABR A;  1SJZ A;  3TKQ A;  1O8W A;  4DEJ A;  4K9Z A;  3F6D A;  2CT6 A;  2VCT A;  1IYI A;  5DAK A;  3O6T A;  2PWJ A;  3HJP A;  1KBN A;  5ECQ B;  4POM A;  4XRD A;  1JLW A;  2E2M A;  2IMD A;  3CRU A;  1Q4J A;  1DE1 A;  3IK9 A;  2HSH A;  3D6I A;  5ECS A;  5C00 A;  4K0N A;  5CRH A;  5AIX A;  4MJC A;  2C1Y A;  2MMN A;  3A3T A;  4YQU A;  2ON7 A;  1V58 A;  5FT3 A;  4MJE A;  5AN1 A;  1YJ6 A;  2LQO A;  4IP1 A;  1BQ7 A;  4KA0 A;  2UZ8 A;  2E2G A;  1YKC A;  3I43 A;  3GYK A;  2KP1 A;  1Z9H A;  4JR4 A;  1ABA A;  3IE3 A;  1FAA A;  5DQY A;  3C71 A;  2YZH A;  2IMF A;  3CRT A;  3IK7 A;  1M9B A;  1TI3 A;  2GT5 A;  4CDO A;  3GL3 A;  2FHE A;  3TDG A;  3DML A;  2XPD A;  1K3L A;  2MMA A;  3CXG A;  6GSV A;  1GUL A;  1SYR A;  1ERV A;  3GHA A;  2B3S A;  2IJY A;  2H1G A;  3N9J A;  3GN3 A;  1J08 A;  3IAS 2;  1T3B A;  2B1L A;  2H76 A;  4OWY A;  5KN3 A;  4ML6 A;  3UJ1 A;  4D73 B;  3ZMK A;  3MYD A;  1PMT A;  2ES7 A;  16GS A;  4EIQ A;  4POL A;  3IBH A;  2IL3 A;  2RUF A;  2BJX A;  1T1V A;  2WJU A;  5JWO B;  5DJL A;  5G1L A;  4G2E A;  2DJ2 A;  1GH2 A;  1GSD A;  2DIY A;  2K9F A;  1T8E B;  3RDW A;  2VCW A;  3D5J A;  3LGC A;  3DEX A;  6GSU A;  1OYJ A;  4N10 A;  1T00 A;  4L0W A;  2VUP A;  2YV9 A;  3F8U A;  4MF7 A;  2H8L A;  4N0V A;  4KND A;  2YJ7 A;  3MIX A;  3VFI A;  5DJM A;  1WJK A;  2A4H A;  4ZB9 A;  1AQW A;  1OE8 A;  1QK8 A;  2X99 A;  4K7I A;  3QFA C;  1QUW A;  2QKE A;  1O81 A;  4YQM A;  1GRX A;  4HS1 A;  2H74 A;  5CNW A;  1SL0 B;  2E7P A;  5HR3 A;  4MMM A;  2LTK A;  1F3B A;  3GMF A;  4CW9 A;  3LQ7 A;  3IHQ A;  1XZO A;  2OA7 A;  2K8S A;  3IR4 A;  3ISO A;  5KN1 A;  2OJL A;  2MZC A;  3GV1 A;  1GNE A;  5C04 A;  3ZZX A;  2OBK A;  5BMU A;  4XS1 A;  3TGZ A;  5D93 A;  1MDI A;  1ON4 A;  3TJG A;  4X0X A;  5G31 A;  1FO5 A;  5ID2 B;  1VGL A;  2GS3 A;  2CQ9 A;  3L9V A;  2EIO A;  1HYU A;  2B6M A;  1WOU A;  2MMZ A;  2YCD A;  1BJX A;  2DSA A;  2WB9 A;  1TK5 B;  1YF1 A;  4L8E A;  3GKX A;  4GLT A;  2D2Z A;  20GS A;  3KEB A;  4EXJ A;  1R7H A;  3F0I A;  3KP8 A;  4IQA A;  1EGR A;  6GST A;  5IO2 A;  4HZ2 A;  4PX1 A;  1JZW A;  2F9S A;  1R5P A;  4TOP A;  1G7E A;  2VL2 C;  5IPG A;  2P0G A;  5LNK e;  1TI1 A;  4EL1 A;  2I1U A;  3CSI A;  4JE1 A;  1EWX A;  3APO A;  5EY6 A;  2R0P A;  3VWX A;  3LW9 A;  5ECN B;  4EO3 A;  1PKW A;  4OMV A;  1QGV A;  3Q6O A;  3HDC A;  3HKR A;  2VL9 A;  5CO3 A;  4PUA A;  1M2D A;  3GFK A;  5IQY A;  1M2A A;  4BWS A;  4TR1 B;  4HU9 A;  4EC0 A;  1Z6N A;  1SL1 B;  2HI7 A;  2X64 A;  1TK8 B;  4MF5 A;  3FK8 A;  2BTO T;  3QPM A;  1PL2 A;  1YEX A;  2VM2 A;  3MWH A;  1M0U A;  2BMX A;  1TOF A;  3NIV A;  4J57 E;  3LFL A;  5KOW A;  1HQO A;  1F9M A;  4MLY A;  5F8B A;  2VAF A;  1TRV A;  2FNO A;  3TJB A;  5DAL B;  2H30 A;  2PER A;  3KTB A;  4WF5 A;  4A5P A;  1GLP A;  1XWK A;  1K0B A;  4EIP A;  1USB A;  2P5Q A;  2P31 A;  4X4J A;  5JCG A;  1PRX A;  2HXK A;  1BYE A;  4GXZ A;  2N5B A;  3AY8 A;  3KZQ A;  1OC8 A;  3TKS C;  1GWC A;  4K8M A;  4F0C A;  2FWG A;  2GQL A;  2X8G A;  2CVK A;  3ZFB A;  2DJK A;  5E59 A;  5FHI A;  3DVW A;  2N5F A;  2PVO C;  2GSS A;  3R3E A;  4E8E A;  1T7P B;  2AYT A;  1V40 A;  5G30 A;  3GSS A;  4TR0 A;  4ECI A;  1S3D A;  1B8X A;  2R2J A;  2G0F A;  1GUH A;  4HQS A;  2FGX A;  2LS5 A;  5IMA A;  3D0Z A;  3A2V A;  4FYU A;  1TTZ A;  4BVX B;  1SKW B;  3TKS E;  2GZY A;  5DVB A;  4MZW A;  4MCU A;  2WFC A;  3IHG A;  1GTU A;  1K0A A;  3IRA A;  3EMP A;  5EL8 A;  4ECJ A;  4N30 A;  3U5R E;  4LL1 B;  3F4T A;  3MDK A;  2P5R A;  3TKS A;  5IO0 A;  3GUS A;  4XS4 A;  1EGO A;  4AJ7 A;  5H5S A;  3ME8 A;  2A2P A;  3CSJ A;  4PNF A;  3TKP A;  2NVL A;  2CZ2 A;  3H79 A;  4RI7 A;  3EMX A;  5JWQ B;  2IME A;  5IIZ A;  2R37 A;  2H0I A;  2F8A A;  1DUG A;  3C73 A;  2HYX A;  2JL4 A;  2LNT A;  1NM3 A;  4PXO A;  1GNW A;  5GSS A;  4V1A g;  1MEK A;  2VCQ A;  1PGT A;  2V41 A;  1TU8 A;  2V6O A;  9GSS A;  4ACS A;  1G7O A;  4LA1 A;  4P3Y B;  5HR2 A;  4POK A;  2R0G A;  4IQ1 A;  3GL5 A;  4DSQ A;  2XBQ A;  4F9Z A;  4Q5R A;  2LV3 A;  3GUR A;  2H1B A;  4BVY B;  5JCW A;  1FB0 A;  2H19 A;  4F2I A;  1CQH A;  1GTB A;  2NBS A;  1SL2 B;  4G9H A;  2JAC A;  4JR6 A;  2VM1 A;  2QC7 A;  3EIN A;  1J9B A;  3QAG A;  4CY6 A;  3LEF A;  1XCC A;  2L5L A;  3QAW A;  1SJ6 A;  5ECH B;  4OD7 A;  5AIS A;  4O5Q A;  1EV9 A;  3IC4 A;  2DLX A;  4GCI A;  4ULX A;  1Q98 A;  1GSU A;  1QMV A;  5DAK B;  3VWW A;  2NPB A;  4RQX A;  5F05 A;  5IMC A;  2H75 A;  2RM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...