4L0UA

Crystal structure of plasmodium vivax prx1a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
168
structure length
168
Chain Sequence
PTYVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDAFHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLFDDSVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKYGDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-Cys peroxiredoxin, putative
publication title Observed octameric assembly of a Plasmodium yoelii peroxiredoxin can be explained by the replacement of native "ball-and-socket" interacting residues by an affinity tag.
pubmed doi rcsb
source organism Plasmodium vivax sal-1
total genus 55
structure length 168
sequence length 168
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4l0uA00
2DC5A 3TRXA 2VD0A 4XTSA 2RLIA 1TP9A 2ON7A 3F6FA 1GL8A 3I43A 5CRGA 5IO0A 2O87A 4YAVA 3BJ5A 4KNDA 4ECIA 2C3NA 5F05A 4OCFA 1M2AA 4JBBA 1ILOA 1SKSB 4WR5A 2TRCP 1XBSA 2CVBA 4KH7A 4L0UA 22GSA 1MDKA 2A4VA 2I81A 3TKQA 4WF4A 2DJ2A 4BWQA 2FD3A 1EV9A 4XRDA 2VL2A 4KDYA 2PU9C 3Q18A 4ILFA 3TOTA 2CAQA 3TKSC 3HZ8A 1A24A 5HFGA 4JRRA 1SU9A 3G9BA 4KCAA 2JU5A 4G9HA 1SJIA 6GSTA 1Z6NA 4MMMA 1XWCA 3IRAA 2R6KA 1F37A 5DQYA 2I4AA 3IPZA 3MDKA 1TW9A 1YZXA 3I69A 5IOXA 2HZFA 2XPDA 4EUYA 1I9DA 1K0DA 2CAIA 4XHMA 6GSSA 3GA4A 3GURA 5J5NA 2JSYA 2X8CA 1WJKA 2GQLA 4TRXA 4WBJA 1XPVA 5ECRB 3F6DA 3P8WA 2LQQA 4NAXA 2VCZA 1ERWA 4L5OA 3UBLA 1ZYQB 4OO4A 2C3TA 1Z7PA 2GQMA 2JZSA 17GSA 3RPNA 3LORA 3EU3A 1MTCA 1FVJA 4EE0A 3D0ZA 3APQA 3PR8A 2V32A 4TXOB 4MF7A 1K0CA 2H01A 3QDNA 2XHFA 1UC7A 5EL8A 4NWYA 4OWYA 1B4PA 5ELGA 2E0QA 2HSHA 3VI5A 1YEPA 3GH6A 4K0GA 4F0CA 4D73B 2L57A 1GSUA 1TI3A 3GL5A 2H71A 1B9YC 3D5JA 2I9HA 3CBUA 4TXOA 4GLTA 3GTUA 2YANA 5IO2A 2H66A 2IMEA 3HVVA 1O6JA 3EYTA 3F63A 10GSA 2H8LA 3GYKA 1PSQA 3MNGA 3O3TA 1VRSD 5G1KA 1BAYA 3TKSA 3VWUA 1O8XA 4D73A 1EWXA 3QMXA 1MEKA 2RIIA 5F8BA 5KN1A 1W4VA 5G5FA 3DYRA 1GLQA 2DJJA 5IOWA 1O85A 3HHVA 1RQMA 3KGKA 5GSSA 1ST9A 1UVZA 3I9V2 2DMLA 4MLYA 3APOA 2F3MA 2WB9A 1FHEA 3C7MA 1AAZA 1HNBA 1Q98A 2IFQB 1KTEA 4XS6A 3A2WA 3UMAA 3M3MA 1PN9A 1PL1A 3FW2A 5L71A 3TJKA 5ECPB 4KGIA 2PVOC 5HR3A 5CREA 2O7KA 5ID2A 1TRVA 1GUKA 4K9ZA 4ISDA 2JZTA 1A0RP 3ISOA 3KP8A 1NHOA 5DAKB 3G7YA 2DLXA 3FEUA 3A3TA 3ZIVA 3GL3A 2PGTA 3NIVA 3CTFA 1AIUA 2DJ1A 5FT3A 2E7PA 2HLSA 1OKDA 3GH9A 4ECCA 2CQ9A 3QOUA 1R5AA 2PPTA 2F9SA 5DJLA 4KCEA 2RUEA 3I6AA 1T7PB 2IL3A 2WULA 3LSZA 5DAKA 4V1Ag 2YWMA 4V2NA 2XPEA 4YH2A 5D9WA 2FGXA 2EIQA 4WEYA 1X9WB 2C0EA 5AIVA 3CMIA 4MH3A 3UVHA 1ZMAA 1TXXA 1OE7A 4JE1A 5G30A 3KCMA 3HVSA 3DMLA 1K0BA 3DWVA 1SYRA 1GNEA 3WD6A 4MDCA 4Q5RA 1PRXA 3FR6A 5B6NA 1A0FA 3ZLPA 2FLSA 1A8LA 1DSBA 5KN3A 1U88A 4I6XA 2H1BA 3H1NA 3HZ4A 1X9SB 4LMVA 3KM6A 3HXSA 3UBKA 3IOSA 3SBCA 2VOCA 3DKSA 3ZL5A 3D22A 4OCEA 1GH2A 3TKSE 2L4QA 3ERFA 3W8JA 1M9BA 2GT6A 3CRUA 2CX3A 3GKKA 4HOJA 1HNAA 4MABA 5J41A 1AQXA 4H86A 1GSFA 4JEDA 2B1KA 2VCTA 2AAWA 5J9BA 2VAFA 1ACVA 4PXOA 4XCSA 2VUPA 1PGTA 4FYBA 1WIKA 3IAM2 2YWOA 4XS4B 1YF1A 4IP1A 5DCHA 3ZVJD 2LRCA 1JZRA 2TRXA 4K8MA 1ZL9A 4F82A 2L4CA 1JLWA 2F8FA 4EVMA 4IKHA 1X9MB 1PQNA 4MH2A 3TJBA 4YQMA 1NHYA 4ZILA 4XIHA 5AISA 4XS4A 4N30A 3UVTA 4QL9A 2FWGA 3IK9A 4EXJA 4BPYA 3F4SA 1AQVA 3QD9A 2IPAA 3F8UA 1LJRA 1TRUA 3BOAA 2VCXA 4HU7A 1GTIA 4L5LA 2LRTA 4KE3A 4V2LA 5IQYA 3ERWA 2AHEA 1B9XC 2BTOT 1TI1A 3HDCA 2L5OA 4E8EA 1KEBA 2CZ2A 3BCKA 1DE1A 3CYNA 5D8IA 4BVYA 5JCGA 5ECIB 4AGSA 2FWEA 4Z7XA 2K6VA 1T3BA 2IJYA 2YPMA 2EIRA 4AF2A 3GSTA 1Q4JA 2HFDA 5EVOA 3DIEA 1T1VA 4ZL7A 3GRXA 5ELAA 3GFKA 2J9HA 2OE1A 1G7EA 3MWHA 4ECBA 4GF0A 4HU9A 2CT6A 5E4WA 5G5EA 1JLVA 1OC9A 19GSA 4EDZA 1VGLA 2F8AA 3TKRA 1X5CA 1J9BA 3LQ7A 3J7Yb 5A5KA 4XRAA 2KLXA 3D4MA 4ZB8A 3ERGA 4TR4A 1XW6A 4K1FA 3KZQA 3ME7A 1GUHA 2GVPA 1TK0B 1U87A 4IGJA 5ABRA 1TU8A 2N5AA 4FO5A 1X5DA 2HE3A 2VL9A 4TW5A 2GGTA 3UEMA 4IVFA 5ECKB 1G6YA 3QCPA 1THOA 4RI7A 5HR0A 3U5RE 1TK8B 3VLNA 3VWVA 5DVBA 2GZPA 3KH9A 2H1GA 1SK1A 3FZAA 3ME8A 4Q5FA 3UJ1A 4ACSA 4I2UA 5CNWA 3ZVJA 2MBSA 4NMUA 4KSMA 4MJAA 3NZNA 5J9CA 4GRFA 2HYXA 5B6MA 4RQXA 4HS1A 3RHBA 1EEJA 2OADA 5FWGA 5AN1A 4HUAA 3P90A 1SENA 3TRPA 1XOAA 4RI6A 1LBKA 1H4OA 1KBNA 1YKCA 4CW9A 1U3AA 1WOUA 9GSSA 2P0GA 1RW1A 4MJBA 4RUVA 4O7HA 3DVWA 2GLRA 3WT1A 2Z9SA 5CRDA 4HQSA 2HSYA 2MMZA 1R7HA 3DEXA 2KUCA 1BG5A 1USBA 3IV4A 4ZL9A 4OO5A 4OFTA 4TVEA 1H75A 4IHUA 4G19A 2WCIA 1JZOA 1BJXA 4DEJA 2DMMA 1F6MC 16GSA 4K7OA 1O81A 5KN0A 1B8XA 5GZZB 3TOUA 2KHPA 2JL4A 4WKWA 1KNGA 2X99A 4ECJA 3VI7A 5EY6A 2B5XA 2VCVA 1PKZA 4DSQA 1PX7A 1K0OA 1A2JA 1PMTA 3IAS2 1TK5B 1Y6EA 2FWFA 1EV4A 3HCZA 4CDOA 2MMAA 5H5QA 5G2ZA 4FIWA 1YDKA 2B7JA 2LSTA 3GKXA 5HR2A 2B3SA 1OVNA 4P3YB 1A23A 4ZL8A 1YJ6A 1Z3EA 4IN0A 3HD5A 2LTKA 3RPPA 1GTAA 1I5GA 3FR9A 1OC8A 3HKRA 3FZ4A 2OKAA 3CSIA 4LL4B 2NDOA 3EINA 3GTUB 3E9JB 4JR6A 8GSSA 2H1AA 5IMCA 4IBPA 1M99A 2PERA 1GTBA 3ZMKA 2HNLA 2LUSA 4TOPA 3ZTLA 4NHZA 5B8AA 3FKFA 4MPFA 1TRSA 5FHIA 1Z9HA 1OE8A 1TRWA 1V98A 2L6DA 4AJ6A 3H4KA 1THXA 1XWBA 2GSSA 2VO4A 2LJRA 2HZEA 1T00A 5ECNB 1WP0A 1OKTA 4IQ1A 4YAPA 3W6GA 6GSXA 2L59A 1EEMA 1QFNA 1BEDA 3WGEA 1UA5A 3F9UA 11GSA 1JHBA 1M2BA 2N5BA 3GV1A 5ID2B 5KEJA 4IS0A 1SKRB 1X5EA 3MAKA 3WGXA 3WT2A 2H76A 4PQIA 1NM3A 5B7CA 1GSYA 3NOFA 3PH9A 1AC1A 5EPFA 3KTLA 2C4JA 1SK2A 2O8VB 3TCOA 4ZBDA 1QMVA 3TGZA 1ZCPA 4KAEA 2E2MA 3C1SA 2KP2A 3R2QA 4O32A 5CRHA 2R37A 2BMXA 3CRTA 1EZKA 2ALBA 3EMPA 2FA8A 2HRNA 3P7XA 2E2GA 2OBIA 2H6XA 3M1GA 2R5GA 3LG6A 4HJMA 3A5WA 2LEGA 3EC3A 1S3DA 3DVXA 5ECMB 2WZ9A 2YZUA 4EF0A 1J0FA 4GWRA 3TRQA 2QKEA 4KDXA 1M7TA 5ECQB 4IW9A 1ERUA 3KMOA 4I97A 1EOGA 4MK3A 3IC4A 4BVXA 2IMIA 2GQKA 4J57E 2XBQA 5D9XA 4GTUA 2VLUA 2FY6A 2N5FA 2JACA 1SJZA 2OJLA 20GSA 1SL2B 5D93A 4TR3A 1UN2A 4GQCA 2L6CA 3IDVA 1SL1B 4LL1B 1GSQA 2WDUA 1ML6A 1SJ6A 1HQOA 4I8BA 1TKDB 1O7UA 1F2EA 1K0AA 2GZYA 4JU5A 3ED3A 4KDUA 5DJMA 3BCIA 4PUAA 2IWTA 1VF3A 4BA7A 5D73A 2C0FA 1GRXA 3IA1A 1YF0A 2H73A 5DALA 4KB3A 3IHQA 2ON5A 4KUNA 1JZWA 3VPTA 1YKAA 3HA9A 1XZOA 1NSWA 5GAPD 4DVCA 2IMKA 1SD8A 2B6MA 4ML1A 1FVKA 2K9FA 3APSA 2H0GA 3QR6A 2WS2A 5E59A 5CRWA 5IMZA 1IYIA 2K8VA 4AJ7A 2VCQA 4AJ8A 4N11A 2H0HA 2DIYA 2H6ZA 3ZFBA 3SWLA 5JWRB 5ENUA 2RUFA 14GSA 3Q6OA 5LD0A 1T8EB 1B4QA 2B1LA 2JADA 5AGYA 1TOFA 3VPQA 3ZZXA 4QQ7A 4ULXA 2PVQA 1ABAA 3KH7A 4NV2A 3J7Yk 4BWSA 3M9KA 3UAPA 4HEA2 4TR1B 4WBRD 3FHKA 4L8EA 2HRFA 3GX0A 3CSHA 3OR5A 5IMDA 3LYPA 2FUG2 1ZOFA 1R26A 3WYWA 2I3YA 1PKWA 3A2VA 1OC9B 4ZB9A 2H70A 13GSA 5JCWA 1XWGA 3FZ9A 3C73A 3L9VA 5D9TA 2CZ3A 4NV5A 4PQ1A 4J2FA 1V9WA 2QSIA 5F0GA 2OBKA 2WRTA 5ECHB 3DXBA 4TR1A 5GAND 1N8JA 2JSZA 1TTZA 2HT9A 1VF1A 4K0NA 4HZ2A 2LQOA 1RK4A 1XCCA 4NPBA 1O8WA 2V41A 3IR4A 2FCHA 3DRNA 3KMNA 3KIJA 4PNGA 2V1MA 3U6VA 3L0HA 1WE0A 5INYA 1N2AA 1U3IA 5JWOB 3BD2A 2VL2C 3HY2A 3N5OA 1GSEA 1FAAA 3QAWA 2GTUA 4G10A 1J08A 1ON4A 4DSRA 2GDRA 4IJ3A 2DIZA 2O89A 1EGRA 2CX4A 3L4NA 12GSA 3L9SA 4HJ2A 3C1RA 2V6OA 4OMVA 5GSTA 3QFBC 1IYHA 3EU4A 3FZ5A 3O76A 2V6KA 2C0GA 2EC4A 2YJ7A 3KP9A 2H1DA 1G6WA 4RQRA 2DJ0A 2YV7A 4O92A 2REMA 4MF6A 3HYPA 2VLTA 3D21A 5CAXA 1TJDA 4F03A 5ECSA 3H79A 4X1UA 3FY7A 2LKUA 3GKNA 1QXHA 4KA0A 3G7IA 1NW2A 4WF5A 2CA8A 3M9JA 2PBJA 5ECLB 3D4TA 2H30A 3FRCA 1JZDA 3E3EA 3GMFA 3EVIA 1M2DA 2DJKA 4POLA 1OC3A 2VM2A 1XIYA 2H74A 5D96A 4V1Ap 2B5YA 1ERVA 5G31A 2HI7A 2C8UA 3LGCA 1JFUA 4NHWA 2H6YA 2TIRA 2NVLA 2PN8A 3ZREA 1HD2A 1GTUA 1QK8A 4YQVA 2B7KA 4GCIA 3V1WA 2GSRA 4IQAA 1XWKA 6GSVA 1E6BA 1TDIA 2C3QA 3IK7A 3FYGA 2OACA 3IXRA 1FB6A 1PX6A 1YEXA 2QGVA 1PA3A 2WGRA 1XVWA 4FYCA 4K7IA 4PNFA 1B48A 1K3YA 5IMVA 2IN3A 4ID0A 4X0XA 1XXUA 2PWJA 1AXDA 1K0NA 5IMFA 3VK9A 5CP1A 4PX1A 2A2SA 4POMA 3TKPA 4KW6A 2ZCTA 4LLRA 2DBCA 2A2RA 2D2ZA 2HZEB 2I1UA 3N9JA 5LNKe 2P5QA 2P31A 3VWWA 4BL7A 2FA4A 1PL2A 5D9VA 2VCWA 4L0WA 2KP1A 2YWNA 1SD9A 5J4UA 2K18A 1SKWB 3LFLA 3IE3A 2ZUPA 3C8EA 3DD3A 4E8HA 4JR4A 1V58A 5IPHA 2CV4A 5DQSA 3RAZA 1M9AA 3KEBA 3M0FA 1HNCA 4J56E 1R5PA 2X64A 3CSJA 3PGTA 1EGOA 3GX8A 1V57A 2OE0A 2H75A 5IMAA 2YOIA 2JZRA 3F4RA 4ZB6A 4N10A 2PMTA 4MZBA 1QUWA 1XVQA 2C80A 3GUSA 3VWXA 2GSTA 4GQFA 1FOVA 6GSWA 1AQWA 1E2YA 3TJJA 1DBYA 2IIYA 2K8SA 4N0ZA 2NTOA 2LV3A 5DCGA 3JCML 3GHAA 5A4UA 2MMOA 1SL0B 1QQ2A 3WGDA 2DJ3A 3G7JA 3ZRDA 1M0UA 2GZZA 4POBA 2CVKA 4GXZA 2AB6A 6GSYA 3EE2A 1A2LA 4GSNA 5IIZA 4TKYA 4TXVA 4MF5A 1SK0A 1XW5A 3LXTA 6GSUA 3TB2A 3H8QA 2FNOA 3UARA 3RBTA 4WXTA 1WRYA 5HR1A 2AJQB 5B8BA 4GSSA 5G1LA 2IFQA 2YV9A 1YY7A 1F3AA 2LS5A 4Q5QA 1TU7A 3Q74A 3TJFA 4I2TA 1AW9A 1URMA 3A2XA 1PD21 1Z6MA 3KTBA 1Z5YE 2X8HA 3QPMA 3AY8A 4JZQA 4TR0A 2AUVA 5DBQA 2MMNA 1FG4A 3P2AA 5F07A 5F06A 4MA9A 2KOKA 3C71A 3LYKA 3E0UA 4G2EA 4CHSA 4MZWA 4KX4A 4HI7A 7GSSA 3GIXA 5DALB 2HXKA 1BX9A 4EDYA 3ZYWA 1GP1A 2YJHA 3DGQA 3KD0A 4O5RA 2YNXA 1GUMA 2MZCA 3RHCA 5CO3A 3TUEA 1V2AA 4HZ4A 3UOMA 1GLPA 1EP7A 5A4VA 4LA1A 2YN1A 1GNWA 2LRNA 3S9FA 2VLVA 5IPGA 2IMDA 4MJEA 4Q5NA 2MYGA 4OD7A 2ZNMA 2XC2A 3VURA 4ZBBA 1FW1A 2WFCA 4ZBAA 2R3XA 4EL1A 1QGVA 4FH8A 4ZXGA 5C04A 2H0IA 1MDJA 5C00A 2LNSA 4QL7A 2FHEA 3FR3A 4ZIJA 3GKMA 3LWAA 3HVXA 3Q19A 1WMJA 2M46A 5J3RA 1LU4A 1DE2A 2ES7A 1F9MA 3O6TA 4MJCA 1U6TA 4XS1A 1AUCA 2LJKA 2H72A 1K3LA 2IMFA 1XOBA 4K6XA 3GNJA 4N0VA 4POKA 2EIOA 1ZZYA 1T4YA 1X0RA 3KXOA 2R2JA 2GS3A 2AV4A 2BJXA 2VL3A 1G0TA 1SYXA 2P5RA 3L9UA 3IBHA 5HQPA 1R4WA 1WPIA 2X8GA 3CXGA 2DSAA 4GSTA 1ZGNA 4PURA 4MPGA 1S3AA 18GSA 1VF4A 1OYJA 4OFNA 4X43A 1A8YA 3H93A 5KN2A 4HDEA 3D6IA 4PQHA 2RM6A 3K8NA 3MSZA 4F0BA 1BYEA 5AIXA 2L5LA 4YQUA 3GSSA 2YZHA 1EOHA 1CQHA 1EP8A 3ZMLA 2G0FA 5JCUA 4EC0A 1ZYEA 2VIMA 1FB0A 4DSSB 3TDGA 1MD3A 3LEFA 4TN8A 4EKZA 3ZIJA 4HQZA 3VFIA 2MBTA 2OE3A 1Y25A 1MD4A 3FK8A 5HFKA 2M80A 1GSDA 4IP6A 5JWQB 4WETA 1VF2A 1GULA 4PGTA 5H5RA 4FYUA 4IELA 3TJGA 1HYUA 2YP6A 1V40A 4ML6A 2V2GA 4WR4A 1WWJA 4F9ZA 1GSSA 1YQ1A 2QC7A 3GN3A 2YCDA 4DSSA 4PUFC 5ECOB 2CVDA 1XFLA 3HJPA 5LCZA 2NBSA 1MDIA 3KJYA 3EURA 4MCUA 3QAVA 2PUKC 3HJMA 1XW9A 1C72A 3EMXA 4I5QA 2C1YA 4NXIA 2WJUA 2M72A 4KSOA 3UIWA 5IM9A 1GWCA 1W89A 4IJIA 3ZFLA 2NPBA 2O85A 4LMWA 4K7NA 3ZITA 2C0DA 2VD1A 5DDLA 1T4ZA 2OA7A 2VM1A 3F3QA 2LNTA 2J23A 1DUGA 3QAGA 4EO3A 2GSQA 1FO5A 3US3A 2FWHA 5COHA 4MP4A 1F3BA 4MZCA 1CQGA 2G2QA 2RM5A 1Z7RA 4OFMA 4K2DA 1K3OA 2LJAA 1A2MA 3EWLA 3CTGA 2AYTA 2XBIA 3PINA 3UL3A 5A4WA 3F0IA 5HFIA 1OAZA 3RDWA 2R4VA 4V2MA 2F51A 3M8NA 3LXZA 3L78A 2B5EA 1G7OA 5CYYA 3W8SA 1K0MA 3QFAC 3HJOA 2GT5A 5H5SA 3F3RA 3LJRA 1O73A 1XWAA 1ERTA 1BQ7A 1S3CA 3F4TA 2YWIA 4F2IA 3BBYA 2H19A
chains in the Genus database with same CATH superfamily
2DC5A 3TRXA 2VD0A 4XTSA 2RLIA 1TP9A 2ON7A 3F6FA 1GL8A 3I43A 5CRGA 5IO0A 2O87A 4YAVA 3BJ5A 4KNDA 4ECIA 2C3NA 4PTSA 5F05A 4OCFA 1M2AA 4JBBA 1ILOA 1SKSB 4WR5A 2TRCP 1XBSA 2CVBA 4KH7A 4L0UA 22GSA 1MDKA 2A4VA 2DKHA 2I81A 2QA1A 3TKQA 4WF4A 2DJ2A 4BWQA 2FD3A 1EV9A 4XRDA 2VL2A 4KDYA 2PU9C 3Q18A 4ILFA 3TOTA 2CAQA 3TKSC 3HZ8A 1A24A 5HFGA 4JRRA 1SU9A 3G9BA 4KCAA 2JU5A 4G9HA 1SJIA 6GSTA 1Z6NA 4MMMA 1XWCA 3IRAA 2R6KA 1F37A 4ICYA 5DQYA 2I4AA 3IPZA 3MDKA 1TW9A 1YZXA 3I69A 5IOXA 2HZFA 2XPDA 4EUYA 1I9DA 1K0DA 4YKFA 2CAIA 4XHMA 6GSSA 3GA4A 3GURA 5J5NA 2JSYA 2X8CA 4G0IA 1WJKA 2GQLA 4TRXA 4WBJA 1XPVA 5ECRB 3F6DA 3P8WA 4KF9A 2LQQA 4NAXA 2VCZA 1ERWA 4L5OA 3UBLA 1ZYQB 4OO4A 2C3TA 1Z7PA 2GQMA 2JZSA 17GSA 3RPNA 3LORA 3EU3A 1MTCA 1FVJA 4EE0A 3D0ZA 1ZYNA 3APQA 3PR8A 2V32A 4TXOB 4MF7A 1K0CA 2H01A 3QDNA 2XHFA 1UC7A 5EL8A 4NWYA 4OWYA 1B4PA 1PFOA 5ELGA 2E0QA 2HSHA 3VI5A 1YEPA 3GH6A 4K0GA 4F0CA 3LW9A 4D73B 2L57A 4FQUA 1GSUA 1TI3A 3GL5A 2H71A 1B9YC 3R3EA 3D5JA 2I9HA 3CBUA 4TXOA 4GLTA 3GTUA 2YANA 5IO2A 2H66A 2IMEA 3HVVA 1O6JA 3EYTA 3F63A 10GSA 2H8LA 3GYKA 1PSQA 3MNGA 3O3TA 1VRSD 5G1KA 1BAYA 3TKSA 3VWUA 1O8XA 4D73A 1EWXA 3QMXA 1MEKA 2RIIA 5F8BA 5KN1A 1W4VA 5G5FA 3DYRA 1GLQA 2DJJA 5IOWA 1O85A 3HHVA 1RQMA 3KGKA 5GSSA 1ST9A 1UVZA 3I9V2 2DMLA 4MLYA 3APOA 2F3MA 2WB9A 2UZ8A 1FHEA 3C7MA 1AAZA 1HNBA 1Q98A 2IFQB 1KTEA 4XS6A 3A2WA 3UMAA 3M3MA 1PN9A 1PL1A 3FW2A 5L71A 3TJKA 5ECPB 4KGIA 2PVOC 5HR3A 2HRKA 4X4JA 5CREA 2O7KA 5ID2A 1TRVA 1GUKA 4K9ZA 4ISDA 2JZTA 1A0RP 3ISOA 3KP8A 1NHOA 5DAKB 3G7YA 2DLXA 3FEUA 3A3TA 3ZIVA 3GL3A 2PGTA 3NIVA 3CTFA 1AIUA 2DJ1A 5FT3A 2E7PA 2HLSA 1OKDA 3GH9A 4ECCA 2CQ9A 3QOUA 1R5AA 2PPTA 2F9SA 5DJLA 4KCEA 2RUEA 3I6AA 1T7PB 2IL3A 2WULA 3LSZA 5DAKA 4V1Ag 2YWMA 4V2NA 2XPEA 4YH2A 5D9WA 2FGXA 2EIQA 4WEYA 1X9WB 2C0EA 5AIVA 3CMIA 4MH3A 3UVHA 1ZMAA 1TXXA 1OE7A 4JE1A 5G30A 3KCMA 3HVSA 3DMLA 1K0BA 3DWVA 1SYRA 1GNEA 3WD6A 4MDCA 4Q5RA 1PRXA 3FR6A 5B6NA 1A0FA 3ZLPA 2FLSA 1A8LA 1DSBA 5KN3A 1U88A 4I6XA 2H1BA 3H1NA 3HZ4A 1X9SB 4LMVA 3KM6A 3HXSA 3UBKA 3IOSA 3SBCA 2VOCA 3DKSA 3ZL5A 3D22A 4OCEA 1GH2A 3TKSE 2L4QA 3ERFA 3W8JA 1M9BA 2GT6A 3CRUA 2CX3A 3GKKA 4HOJA 1HNAA 4MABA 5J41A 1AQXA 4H86A 1GSFA 4JEDA 2B1KA 2VCTA 5KOWA 2AAWA 5J9BA 2VAFA 1ACVA 4PXOA 4XCSA 2VUPA 1PGTA 4FYBA 1WIKA 3IAM2 2YWOA 4XS4B 1YF1A 4IP1A 5DCHA 3ZVJD 2LRCA 1JZRA 2A2PA 2TRXA 4K8MA 1ZL9A 4F82A 2L4CA 1JLWA 2F8FA 4EVMA 4IKHA 1X9MB 1PQNA 4MH2A 3TJBA 4YQMA 1NHYA 4ZILA 4XIHA 5AISA 4XS4A 4N30A 3UVTA 4QL9A 2FWGA 3IK9A 4EXJA 4BPYA 3F4SA 1AQVA 3QD9A 2IPAA 3F8UA 1LJRA 1TRUA 3BOAA 2VCXA 4HU7A 1GTIA 4L5LA 4K5RA 2LRTA 4KE3A 4V2LA 5IQYA 3ERWA 2AHEA 1B9XC 2BTOT 1TI1A 3HDCA 2L5OA 4E8EA 1KEBA 2CZ2A 3BCKA 1DE1A 3CYNA 5D8IA 1FOHA 4BVYA 5JCGA 5ECIB 4AGSA 2FWEA 4Z7XA 2K6VA 1T3BA 2IJYA 2YPMA 2EIRA 4AF2A 3GSTA 4Z2RA 1Q4JA 2HFDA 5EVOA 3DIEA 1T1VA 4ZL7A 3GRXA 5ELAA 3GFKA 2J9HA 2OE1A 1G7EA 3MWHA 4ECBA 4GF0A 4HU9A 2CT6A 5E4WA 5G5EA 1JLVA 1OC9A 19GSA 4EDZA 1VGLA 2F8AA 3TKRA 3CQFA 1X5CA 1J9BA 3LQ7A 3J7Yb 5A5KA 4XRAA 2KLXA 3D4MA 1PN0A 4ZB8A 3ERGA 4TR4A 1XW6A 4K1FA 3KZQA 3ME7A 1GUHA 2GVPA 1TK0B 1U87A 4IGJA 5ABRA 1TU8A 2N5AA 4FO5A 1X5DA 2HE3A 2VL9A 4TW5A 2GGTA 3UEMA 2R0PA 4IVFA 5ECKB 1G6YA 3QCPA 1THOA 4RI7A 5HR0A 3U5RE 1TK8B 3VLNA 3VWVA 5DVBA 2GZPA 3KH9A 2H1GA 1SK1A 3FZAA 3ME8A 4Q5FA 3UJ1A 4ACSA 4I2UA 5CNWA 3ZVJA 2MBSA 4NMUA 4KSMA 4MJAA 3NZNA 5J9CA 4GRFA 3FMWA 2HYXA 5B6MA 4RQXA 4HS1A 3RHBA 1EEJA 2OADA 5FWGA 5AN1A 4HUAA 3P90A 1SENA 3TRPA 1XOAA 4RI6A 1LBKA 1H4OA 1KBNA 1YKCA 4CW9A 1U3AA 1WOUA 4EIQA 9GSSA 2P0GA 1RW1A 4MJBA 4RUVA 4O7HA 3DVWA 2GLRA 3WT1A 2Z9SA 5CRDA 4HQSA 2HSYA 2MMZA 1R7HA 3DEXA 2KUCA 1BG5A 1USBA 3IV4A 4ZL9A 4OO5A 4OFTA 4TVEA 1H75A 4IHUA 4G19A 2WCIA 1JZOA 1BJXA 4DEJA 2DMMA 1F6MC 16GSA 4K7OA 1O81A 5KN0A 1B8XA 5GZZB 3TOUA 2KHPA 2JL4A 4WKWA 1KNGA 2X99A 4ECJA 3VI7A 5EY6A 2B5XA 2VCVA 1PKZA 4DSQA 1PX7A 1K0OA 1A2JA 1PMTA 3IAS2 1TK5B 1Y6EA 2FWFA 1EV4A 3HCZA 4CDOA 2MMAA 5H5QA 5G2ZA 4FIWA 1YDKA 2B7JA 2LSTA 3GKXA 5HR2A 4Z2TA 2HSMA 2B3SA 1OVNA 4P3YB 1A23A 4ZL8A 1YJ6A 1Z3EA 4IN0A 3HD5A 2LTKA 3RPPA 1GTAA 1I5GA 3FR9A 1OC8A 3HKRA 3FZ4A 2OKAA 3CSIA 4LL4B 2NDOA 3EINA 3GTUB 3E9JB 4JR6A 8GSSA 2H1AA 5IMCA 4IBPA 1M99A 2PERA 1GTBA 3ZMKA 2HNLA 2LUSA 4TOPA 3ZTLA 4NHZA 5B8AA 3FKFA 4MPFA 1TRSA 5FHIA 1Z9HA 1OE8A 3EPTA 1TRWA 1V98A 2L6DA 4AJ6A 3H4KA 1THXA 1XWBA 2GSSA 2VO4A 2LJRA 2HZEA 1T00A 5ECNB 4K2XA 1WP0A 1OKTA 4IQ1A 4YAPA 3W6GA 4BIKA 6GSXA 2L59A 1EEMA 1QFNA 1BEDA 3WGEA 1UA5A 3F9UA 11GSA 1JHBA 1M2BA 2N5BA 3GV1A 5ID2B 5KEJA 4IS0A 1SKRB 1X5EA 3MAKA 3WGXA 3WT2A 4USSA 2H76A 4PQIA 1NM3A 5B7CA 1GSYA 3NOFA 3PH9A 1AC1A 5EPFA 3KTLA 2C4JA 1SK2A 2O8VB 3TCOA 4ZBDA 1QMVA 3TGZA 3HVNA 1ZCPA 4KAEA 2E2MA 3C1SA 2KP2A 3R2QA 4O32A 5CRHA 2R37A 2BMXA 3CRTA 1EZKA 2ALBA 3EMPA 2FA8A 2HRNA 3P7XA 2E2GA 2OBIA 2H6XA 3M1GA 2R5GA 3LG6A 4HJMA 3A5WA 2LEGA 3EC3A 1S3DA 3DVXA 5ECMB 2WZ9A 2YZUA 4EF0A 1J0FA 4GWRA 3TRQA 2QKEA 4KDXA 1M7TA 5ECQB 4IW9A 5BRTA 1ERUA 3KMOA 3IC8A 4I97A 1EOGA 4MK3A 3IC4A 4BVXA 2IMIA 2GQKA 4J57E 2XBQA 5D9XA 4GTUA 2VLUA 2FY6A 2N5FA 2JACA 1SJZA 2OJLA 20GSA 1SL2B 5D93A 4TR3A 1UN2A 4GQCA 2L6CA 3IDVA 1SL1B 4LL1B 1GSQA 2WDUA 1ML6A 1SJ6A 1HQOA 4I8BA 1TKDB 1O7UA 1F2EA 1K0AA 2GZYA 4JU5A 3ED3A 4KDUA 5DJMA 2R0GA 3BCIA 4PUAA 4Z2UA 2IWTA 1VF3A 4BA7A 5D73A 2C0FA 1GRXA 3IA1A 1YF0A 2H73A 5DALA 4KB3A 3IHQA 2ON5A 4KUNA 1JZWA 3VPTA 1YKAA 3HA9A 1XZOA 1NSWA 5GAPD 4DVCA 4O5QA 2IMKA 1SD8A 2B6MA 4ML1A 1FVKA 2K9FA 3APSA 2H0GA 3QR6A 2WS2A 5E59A 5CRWA 5IMZA 1IYIA 2K8VA 4AJ7A 2VCQA 4AJ8A 4N11A 2H0HA 2DIYA 2H6ZA 3ZFBA 3SWLA 5JWRB 5ENUA 2RUFA 14GSA 3Q6OA 5LD0A 3A5IA 1T8EB 1B4QA 4BVYB 2B1LA 2JADA 5AGYA 1TOFA 3VPQA 3ZZXA 4QQ7A 4ULXA 2PVQA 1ABAA 3KH7A 4NV2A 3J7Yk 4BWSA 3M9KA 3UAPA 4HEA2 4TR1B 4WBRD 3FHKA 4L8EA 2HRFA 3GX0A 3CSHA 3OR5A 5IMDA 3LYPA 2FUG2 1ZOFA 1R26A 3WYWA 4O5UA 2I3YA 1PKWA 3A2VA 1OC9B 4ZB9A 2H70A 13GSA 5JCWA 1XWGA 3FZ9A 4K5SA 3C73A 3L9VA 5D9TA 2CZ3A 4NV5A 4PQ1A 4J2FA 1V9WA 2QSIA 5F0GA 2OBKA 2WRTA 5ECHB 3DXBA 4TR1A 5GAND 1N8JA 2JSZA 1TTZA 2HT9A 1VF1A 4K0NA 4HZ2A 2LQOA 1RK4A 1XCCA 4NPBA 1O8WA 2V41A 3IR4A 2FCHA 3DRNA 3KMNA 3KIJA 4PNGA 2V1MA 3U6VA 4EIPA 3L0HA 4MNNA 1WE0A 5INYA 1N2AA 1U3IA 5JWOB 3BD2A 2VL2C 3HY2A 3N5OA 1GSEA 1FAAA 3QAWA 2GTUA 4G10A 1J08A 1ON4A 4DSRA 2GDRA 4IJ3A 5BMUA 2DIZA 2O89A 1EGRA 2CX4A 3L4NA 3IHGA 12GSA 3L9SA 4HJ2A 3C1RA 2V6OA 4OMVA 5GSTA 3QFBC 1IYHA 3EU4A 1XG8A 3FZ5A 3O76A 2V6KA 2C0GA 2EC4A 4CY8A 2YJ7A 3KP9A 2H1DA 2R0CA 1G6WA 4RQRA 2DJ0A 2YV7A 4O92A 2REMA 4MF6A 3HYPA 1S3RA 2VLTA 3D21A 5CAXA 1TJDA 4F03A 5ECSA 3H79A 4X1UA 3FY7A 2LKUA 3GKNA 1QXHA 4KA0A 3G7IA 1NW2A 4WF5A 2CA8A 3M9JA 2PBJA 5ECLB 3D4TA 2H30A 3FRCA 1JZDA 3E3EA 3GMFA 3EVIA 1M3IA 1M2DA 2DJKA 4POLA 1OC3A 2VM2A 1XIYA 2H74A 5D96A 4V1Ap 2B5YA 4CY6A 2HRAA 1ERVA 5G31A 2HI7A 2C8UA 3LGCA 1JFUA 4NHWA 2H6YA 2TIRA 2X4AA 2NVLA 2PN8A 3ZREA 1HD2A 1GTUA 1QK8A 4YQVA 2B7KA 4GCIA 3V1WA 3PPUA 2GSRA 4IQAA 1XWKA 6GSVA 1E6BA 1TDIA 2C3QA 3IK7A 3FYGA 2OACA 3IXRA 1FB6A 4BL7B 1PX6A 1YEXA 2QGVA 1PA3A 2WGRA 1XVWA 4FYCA 4K7IA 4PNFA 1B48A 1K3YA 5IMVA 2IN3A 4ID0A 4X0XA 1XXUA 2PWJA 1AXDA 1K0NA 5IMFA 3VK9A 5CP1A 4PX1A 2A2SA 4POMA 3TKPA 4KW6A 2ZCTA 4LLRA 2DBCA 2A2RA 2D2ZA 2HZEB 2I1UA 3N9JA 5LNKe 2P5QA 2P31A 3VWWA 4BL7A 2FA4A 1PL2A 5D9VA 2VCWA 4L0WA 2KP1A 4A5PA 2YWNA 1SD9A 5J4UA 2K18A 1SKWB 3LFLA 5KOXA 3IE3A 2ZUPA 3C8EA 3DD3A 4E8HA 4HSCX 4JR4A 1V58A 5IPHA 2CV4A 5DQSA 3RAZA 1M9AA 3KEBA 3M0FA 1HNCA 4J56E 1R5PA 2X64A 3CSJA 3PGTA 1EGOA 3GX8A 1V57A 2OE0A 2H75A 5IMAA 2YOIA 2JZRA 3F4RA 4ZB6A 4N10A 2PMTA 4MZBA 1QUWA 1XVQA 2C80A 3GUSA 3VWXA 2GSTA 4GQFA 1M3JA 1FOVA 6GSWA 2DKIA 1AQWA 1E2YA 3TJJA 1DBYA 2IIYA 2K8SA 4N0ZA 2NTOA 2LV3A 5DCGA 3JCML 3GHAA 5A4UA 2MMOA 1SL0B 1QQ2A 3WGDA 2DJ3A 3G7JA 3ZRDA 1M0UA 2GZZA 4POBA 2CVKA 4GXZA 2AB6A 6GSYA 3EE2A 1A2LA 4GSNA 5IIZA 4TKYA 4TXVA 4MF5A 1SK0A 1XW5A 3LXTA 6GSUA 3TB2A 3H8QA 2FNOA 3UARA 3RBTA 2A4HA 4BVXB 4WXTA 1WRYA 5HR1A 2AJQB 5B8BA 4GSSA 5G1LA 2IFQA 2YV9A 1YY7A 1F3AA 3MYDA 2LS5A 4Q5QA 1TU7A 3Q74A 3TJFA 4I2TA 1AW9A 1URMA 3A2XA 1PD21 1Z6MA 3KTBA 1Z5YE 2X8HA 3QPMA 3AY8A 4JZQA 4TR0A 2AUVA 5DBQA 2MMNA 1FG4A 3P2AA 5F07A 5F06A 4MA9A 2KOKA 3C71A 3LYKA 3E0UA 4G2EA 4CHSA 4MZWA 4KX4A 4HI7A 7GSSA 3GIXA 5DALB 2HXKA 1BX9A 4EDYA 3ZYWA 1GP1A 2YJHA 3DGQA 3KD0A 4O5RA 1ZYPA 2YNXA 1GUMA 2MZCA 4G0LA 3RHCA 5CO3A 3TUEA 1V2AA 4HZ4A 3UOMA 1GLPA 1EP7A 5A4VA 4LA1A 2YN1A 1GNWA 2LRNA 3S9FA 2VLVA 5IPGA 2IMDA 4MJEA 4Q5NA 2MYGA 4OD7A 2ZNMA 2XC2A 3VURA 4ZBBA 1FW1A 2WFCA 4ZBAA 2R3XA 4YKGA 4EL1A 1QGVA 4FH8A 4ZXGA 5C04A 2H0IA 1MDJA 5C00A 2LNSA 4QL7A 2FHEA 3FR3A 4ZIJA 3GKMA 3LWAA 3HVXA 3Q19A 1WMJA 2M46A 5J3RA 1LU4A 1DE2A 2ES7A 1F9MA 3O6TA 4MJCA 1U6TA 4XS1A 1AUCA 2LJKA 2H72A 1K3LA 2IMFA 1XOBA 4K6XA 3GNJA 4N0VA 4POKA 2EIOA 1ZZYA 1T4YA 1X0RA 3KXOA 2R2JA 2GS3A 2AV4A 2BJXA 2VL3A 1G0TA 1SYXA 2P5RA 3L9UA 3IBHA 5HQPA 1R4WA 1WPIA 2X8GA 3CXGA 2DSAA 4GSTA 1ZGNA 4PURA 4MPGA 1S3AA 18GSA 1VF4A 1OYJA 4OFNA 4X43A 1A8YA 3H93A 5KN2A 4HDEA 3D6IA 4PQHA 2RM6A 3K8NA 3MSZA 4F0BA 1BYEA 5AIXA 2L5LA 4YQUA 3GSSA 2YZHA 1EOHA 1CQHA 1EP8A 3ZMLA 2G0FA 5JCUA 4EC0A 1ZYEA 2VIMA 1FB0A 4DSSB 3TDGA 1MD3A 3LEFA 4TN8A 4EKZA 3ZIJA 4HQZA 3VFIA 2MBTA 2OE3A 1Y25A 1MD4A 3FK8A 5HFKA 2M80A 1GSDA 4IP6A 5JWQB 4WETA 1VF2A 1GULA 4PGTA 5H5RA 4FYUA 4IELA 3TJGA 1HYUA 2YP6A 1V40A 4ML6A 2V2GA 4WR4A 1WWJA 4F9ZA 1GSSA 1YQ1A 2QC7A 3GN3A 2YCDA 4DSSA 4PUFC 5ECOB 2CVDA 1XFLA 3HJPA 5LCZA 2NBSA 4G0KA 1MDIA 3KJYA 3EURA 4MCUA 3QAVA 2PUKC 3HJMA 1XW9A 1C72A 2X49A 3EMXA 4I5QA 2C1YA 4NXIA 2WJUA 2M72A 4KSOA 3UIWA 5IM9A 1GWCA 1W89A 4IJIA 3ZFLA 2NPBA 2O85A 4LMWA 4K7NA 3ZITA 2C0DA 2VD1A 5DDLA 1T4ZA 2OA7A 2QA2A 2VM1A 3F3QA 2LNTA 3MIXA 2J23A 1DUGA 3QAGA 4EO3A 2GSQA 1FO5A 3US3A 2FWHA 5COHA 4MP4A 1F3BA 4MZCA 1CQGA 2G2QA 2RM5A 1Z7RA 4OFMA 4K2DA 1K3OA 2LJAA 1A2MA 3EWLA 3CTGA 2AYTA 2XBIA 3PINA 3UL3A 5A4WA 3F0IA 5HFIA 1OAZA 3RDWA 2R4VA 4V2MA 2F51A 3M8NA 3LXZA 3L78A 2B5EA 1G7OA 5CYYA 3W8SA 1K0MA 3QFAC 3HJOA 2GT5A 5H5SA 3F3RA 3LJRA 1O73A 1XWAA 1ERTA 1BQ7A 1S3CA 3F4TA 2YWIA 4F2IA 3BBYA 2H19A
chains in the Genus database with same CATH topology
2DC5A 3TRXA 2VD0A 4XTSA 2RLIA 1TP9A 2ON7A 3F6FA 1GL8A 3I43A 5CRGA 5IO0A 2O87A 4YAVA 3BJ5A 4KNDA 4ECIA 2C3NA 4PTSA 5F05A 4OCFA 1M2AA 4JBBA 1ILOA 1SKSB 4WR5A 2TRCP 1XBSA 2CVBA 4KH7A 4L0UA 22GSA 1MDKA 2A4VA 2DKHA 2I81A 2QA1A 3TKQA 4WF4A 2DJ2A 4BWQA 2FD3A 1EV9A 4XRDA 2VL2A 4KDYA 2PU9C 3Q18A 4ILFA 3TOTA 2CAQA 3TKSC 3HZ8A 1A24A 5HFGA 4JRRA 1SU9A 3G9BA 4KCAA 2JU5A 4G9HA 1SJIA 6GSTA 1Z6NA 4MMMA 1XWCA 3IRAA 2R6KA 1F37A 4ICYA 5DQYA 2I4AA 3IPZA 3MDKA 1TW9A 1YZXA 3I69A 5IOXA 2HZFA 2XPDA 4EUYA 1I9DA 1K0DA 4YKFA 2CAIA 4XHMA 6GSSA 3GA4A 3GURA 5J5NA 2JSYA 2X8CA 4G0IA 1WJKA 2GQLA 4TRXA 4WBJA 1XPVA 5ECRB 3F6DA 3P8WA 4KF9A 2LQQA 4NAXA 2VCZA 1ERWA 4L5OA 3UBLA 1ZYQB 4OO4A 2C3TA 1Z7PA 2GQMA 2JZSA 17GSA 3RPNA 3LORA 3EU3A 1MTCA 1FVJA 4EE0A 3D0ZA 1ZYNA 3APQA 3PR8A 2V32A 4TXOB 4MF7A 1K0CA 2H01A 3QDNA 2XHFA 1UC7A 5EL8A 4NWYA 4OWYA 1B4PA 5ELGA 2E0QA 2HSHA 3VI5A 1YEPA 3GH6A 4K0GA 4F0CA 3LW9A 4D73B 2L57A 4FQUA 1GSUA 1TI3A 3GL5A 2H71A 1B9YC 3R3EA 3D5JA 2I9HA 3CBUA 4TXOA 4GLTA 3GTUA 2YANA 5IO2A 2H66A 2IMEA 3HVVA 1O6JA 3EYTA 3F63A 10GSA 2H8LA 3GYKA 1PSQA 3MNGA 3O3TA 1VRSD 5G1KA 1BAYA 3TKSA 3VWUA 1O8XA 4D73A 1EWXA 3QMXA 1MEKA 2RIIA 5F8BA 5KN1A 1W4VA 5G5FA 3DYRA 1GLQA 2DJJA 5IOWA 1O85A 3HHVA 1RQMA 3KGKA 5GSSA 1ST9A 1UVZA 3I9V2 2DMLA 4MLYA 3APOA 2F3MA 2WB9A 2UZ8A 1FHEA 3C7MA 1AAZA 1HNBA 1Q98A 2IFQB 1KTEA 4XS6A 3A2WA 3UMAA 3M3MA 1PN9A 1PL1A 3FW2A 5L71A 3TJKA 5ECPB 4KGIA 2PVOC 5HR3A 2HRKA 4X4JA 5CREA 2O7KA 5ID2A 1TRVA 1GUKA 4K9ZA 4ISDA 2JZTA 1A0RP 3ISOA 3KP8A 1NHOA 5DAKB 3G7YA 2DLXA 3FEUA 3A3TA 3ZIVA 3GL3A 2PGTA 3NIVA 3CTFA 1AIUA 2DJ1A 5FT3A 2E7PA 2HLSA 1OKDA 3GH9A 4ECCA 2CQ9A 3QOUA 1R5AA 2PPTA 2F9SA 5DJLA 4KCEA 2RUEA 3I6AA 1T7PB 2IL3A 2WULA 3LSZA 5DAKA 4V1Ag 2YWMA 4V2NA 2XPEA 4YH2A 5D9WA 2FGXA 2EIQA 4WEYA 1X9WB 2C0EA 5AIVA 3CMIA 4MH3A 3UVHA 1ZMAA 1TXXA 1OE7A 4JE1A 5G30A 3KCMA 3HVSA 3DMLA 1K0BA 3DWVA 1SYRA 1GNEA 3WD6A 4MDCA 4Q5RA 1PRXA 3FR6A 5B6NA 1A0FA 3ZLPA 2FLSA 1A8LA 1DSBA 5KN3A 1U88A 4I6XA 2H1BA 3H1NA 3HZ4A 1X9SB 4LMVA 3KM6A 3HXSA 3UBKA 3IOSA 3SBCA 2VOCA 3DKSA 3ZL5A 3D22A 4OCEA 1GH2A 3TKSE 2L4QA 3ERFA 3W8JA 1M9BA 2GT6A 3CRUA 2CX3A 3GKKA 4HOJA 1HNAA 4MABA 5J41A 1AQXA 4H86A 1GSFA 4JEDA 2B1KA 2VCTA 5KOWA 2AAWA 5J9BA 2VAFA 1ACVA 4PXOA 4XCSA 2VUPA 1PGTA 4FYBA 1WIKA 3IAM2 2YWOA 4XS4B 1YF1A 4IP1A 5DCHA 3ZVJD 2LRCA 1JZRA 2A2PA 2TRXA 4K8MA 1ZL9A 4F82A 2L4CA 1JLWA 2F8FA 4EVMA 4IKHA 1X9MB 1PQNA 4MH2A 3TJBA 4YQMA 1NHYA 4ZILA 4XIHA 5AISA 4XS4A 4N30A 3UVTA 4QL9A 2FWGA 3IK9A 4EXJA 4BPYA 3F4SA 1AQVA 3QD9A 2IPAA 3F8UA 1LJRA 1TRUA 3BOAA 2VCXA 4HU7A 1GTIA 4L5LA 4K5RA 2LRTA 4KE3A 4V2LA 5IQYA 3ERWA 2AHEA 1B9XC 2BTOT 1TI1A 3HDCA 2L5OA 4E8EA 1KEBA 2CZ2A 3BCKA 1DE1A 3CYNA 5D8IA 1FOHA 4BVYA 5JCGA 5ECIB 4AGSA 2FWEA 4Z7XA 2K6VA 1T3BA 2IJYA 2YPMA 2EIRA 4AF2A 3GSTA 4Z2RA 1Q4JA 2HFDA 5EVOA 3DIEA 1T1VA 4ZL7A 3GRXA 5ELAA 3GFKA 2J9HA 2OE1A 1G7EA 3MWHA 4ECBA 4GF0A 4HU9A 2CT6A 5E4WA 5G5EA 1JLVA 1OC9A 19GSA 4EDZA 1VGLA 2F8AA 3TKRA 1X5CA 1J9BA 3LQ7A 3J7Yb 5A5KA 4XRAA 2KLXA 3D4MA 1PN0A 4ZB8A 3ERGA 4TR4A 1XW6A 4K1FA 3KZQA 3ME7A 1GUHA 2GVPA 1TK0B 1U87A 4IGJA 5ABRA 1TU8A 2N5AA 4FO5A 1X5DA 2HE3A 2VL9A 4TW5A 2GGTA 3UEMA 2R0PA 4IVFA 5ECKB 1G6YA 3QCPA 1THOA 4RI7A 5HR0A 3U5RE 1TK8B 3VLNA 3VWVA 5DVBA 2GZPA 3KH9A 2H1GA 1SK1A 3FZAA 3ME8A 4Q5FA 3UJ1A 4ACSA 4I2UA 5CNWA 3ZVJA 2MBSA 4NMUA 4KSMA 4MJAA 3NZNA 5J9CA 4GRFA 3FMWA 2HYXA 5B6MA 4RQXA 4HS1A 3RHBA 1EEJA 2OADA 5FWGA 5AN1A 4HUAA 3P90A 1SENA 3TRPA 1XOAA 4RI6A 1LBKA 1H4OA 1KBNA 1YKCA 4CW9A 1U3AA 1WOUA 4EIQA 9GSSA 2P0GA 1RW1A 4MJBA 4RUVA 4O7HA 3DVWA 2GLRA 3WT1A 2Z9SA 5CRDA 4HQSA 2HSYA 2MMZA 1R7HA 3DEXA 2KUCA 1BG5A 1USBA 3IV4A 4ZL9A 4OO5A 4OFTA 4TVEA 1H75A 4IHUA 4G19A 2WCIA 1JZOA 1BJXA 4DEJA 2DMMA 1F6MC 16GSA 4K7OA 1O81A 5KN0A 1B8XA 5GZZB 3TOUA 2KHPA 2JL4A 4WKWA 1KNGA 2X99A 4ECJA 3VI7A 5EY6A 2B5XA 2VCVA 1PKZA 4DSQA 1PX7A 1K0OA 1A2JA 1PMTA 3IAS2 1TK5B 1Y6EA 2FWFA 1EV4A 3HCZA 4CDOA 2MMAA 5H5QA 5G2ZA 4FIWA 1YDKA 2B7JA 2LSTA 3GKXA 5HR2A 4Z2TA 2HSMA 2B3SA 1OVNA 4P3YB 1A23A 4ZL8A 1YJ6A 1Z3EA 4IN0A 3HD5A 2LTKA 3RPPA 1GTAA 1I5GA 3FR9A 1OC8A 3HKRA 3FZ4A 2OKAA 3CSIA 4LL4B 2NDOA 3EINA 3GTUB 3E9JB 4JR6A 8GSSA 2H1AA 5IMCA 4IBPA 1M99A 2PERA 1GTBA 3ZMKA 2HNLA 2LUSA 4TOPA 3ZTLA 4NHZA 5B8AA 3FKFA 4MPFA 1TRSA 5FHIA 1Z9HA 1OE8A 3EPTA 1TRWA 1V98A 2L6DA 4AJ6A 3H4KA 1THXA 1XWBA 2GSSA 2VO4A 2LJRA 2HZEA 1T00A 5ECNB 4K2XA 1WP0A 1OKTA 4IQ1A 4YAPA 3W6GA 6GSXA 2L59A 1EEMA 1QFNA 1BEDA 3WGEA 1UA5A 3F9UA 11GSA 1JHBA 1M2BA 2N5BA 3GV1A 5ID2B 5KEJA 4IS0A 1SKRB 1X5EA 3MAKA 3WGXA 3WT2A 4USSA 2H76A 4PQIA 1NM3A 5B7CA 1GSYA 3NOFA 3PH9A 1AC1A 5EPFA 3KTLA 2C4JA 1SK2A 2O8VB 3TCOA 4ZBDA 1QMVA 3TGZA 1ZCPA 4KAEA 2E2MA 3C1SA 2KP2A 3R2QA 4O32A 5CRHA 2R37A 2BMXA 3CRTA 1EZKA 2ALBA 3EMPA 2FA8A 2HRNA 3P7XA 2E2GA 2OBIA 2H6XA 3M1GA 2R5GA 3LG6A 4HJMA 3A5WA 2LEGA 3EC3A 1S3DA 3DVXA 5ECMB 2WZ9A 2YZUA 4EF0A 1J0FA 4GWRA 3TRQA 2QKEA 4KDXA 1M7TA 5ECQB 4IW9A 5BRTA 1ERUA 3KMOA 3IC8A 4I97A 1EOGA 4MK3A 3IC4A 4BVXA 2IMIA 2GQKA 4J57E 2XBQA 5D9XA 4GTUA 2VLUA 2FY6A 2N5FA 2JACA 1SJZA 2OJLA 20GSA 1SL2B 5D93A 4TR3A 1UN2A 4GQCA 2L6CA 3IDVA 1SL1B 4LL1B 1GSQA 2WDUA 1ML6A 1SJ6A 1HQOA 4I8BA 1TKDB 1O7UA 1F2EA 1K0AA 2GZYA 4JU5A 3ED3A 4KDUA 5DJMA 2R0GA 3BCIA 4PUAA 4Z2UA 2IWTA 1VF3A 4BA7A 5D73A 2C0FA 1GRXA 3IA1A 1YF0A 2H73A 5DALA 4KB3A 3IHQA 2ON5A 4KUNA 1JZWA 3VPTA 1YKAA 3HA9A 1XZOA 1NSWA 5GAPD 4DVCA 4O5QA 2IMKA 1SD8A 2B6MA 4ML1A 1FVKA 2K9FA 3APSA 2H0GA 3QR6A 2WS2A 5E59A 5CRWA 5IMZA 1IYIA 2K8VA 4AJ7A 2VCQA 4AJ8A 4N11A 2H0HA 2DIYA 2H6ZA 3ZFBA 3SWLA 5JWRB 5ENUA 2RUFA 14GSA 3Q6OA 5LD0A 3A5IA 1T8EB 1B4QA 4BVYB 2B1LA 2JADA 5AGYA 1TOFA 3VPQA 3ZZXA 4QQ7A 4ULXA 2PVQA 1ABAA 3KH7A 4NV2A 3J7Yk 4BWSA 3M9KA 3UAPA 4HEA2 4TR1B 4WBRD 3FHKA 4L8EA 2HRFA 3GX0A 3CSHA 3OR5A 5IMDA 3LYPA 2FUG2 1ZOFA 1R26A 3WYWA 4O5UA 2I3YA 1PKWA 3A2VA 1OC9B 4ZB9A 2H70A 13GSA 5JCWA 1XWGA 3FZ9A 4K5SA 3C73A 3L9VA 5D9TA 2CZ3A 4NV5A 4PQ1A 4J2FA 1V9WA 2QSIA 5F0GA 2OBKA 2WRTA 5ECHB 3DXBA 4TR1A 5GAND 1N8JA 2JSZA 1TTZA 2HT9A 1VF1A 4K0NA 4HZ2A 2LQOA 1RK4A 1XCCA 4NPBA 1O8WA 2V41A 3IR4A 2FCHA 3DRNA 3KMNA 3KIJA 4PNGA 2V1MA 3U6VA 4EIPA 3L0HA 4MNNA 1WE0A 5INYA 1N2AA 1U3IA 5JWOB 3BD2A 2VL2C 3HY2A 3N5OA 1GSEA 1FAAA 3QAWA 2GTUA 4G10A 1J08A 1ON4A 4DSRA 2GDRA 4IJ3A 5BMUA 2DIZA 2O89A 1EGRA 2CX4A 3L4NA 3IHGA 12GSA 3L9SA 4HJ2A 3C1RA 2V6OA 4OMVA 5GSTA 3QFBC 1IYHA 3EU4A 3FZ5A 3O76A 2V6KA 2C0GA 2EC4A 4CY8A 2YJ7A 3KP9A 2H1DA 2R0CA 1G6WA 4RQRA 2DJ0A 2YV7A 4O92A 2REMA 4MF6A 3HYPA 2VLTA 3D21A 5CAXA 1TJDA 4F03A 5ECSA 3H79A 4X1UA 3FY7A 2LKUA 3GKNA 1QXHA 4KA0A 3G7IA 1NW2A 4WF5A 2CA8A 3M9JA 2PBJA 5ECLB 3D4TA 2H30A 3FRCA 1JZDA 3E3EA 3GMFA 3EVIA 1M2DA 2DJKA 4POLA 1OC3A 2VM2A 1XIYA 2H74A 5D96A 4V1Ap 2B5YA 4CY6A 2HRAA 1ERVA 5G31A 2HI7A 2C8UA 3LGCA 1JFUA 4NHWA 2H6YA 2TIRA 2X4AA 2NVLA 2PN8A 3ZREA 1HD2A 1GTUA 1QK8A 4YQVA 2B7KA 4GCIA 3V1WA 3PPUA 2GSRA 4IQAA 1XWKA 6GSVA 1E6BA 1TDIA 2C3QA 3IK7A 3FYGA 2OACA 3IXRA 1FB6A 4BL7B 1PX6A 1YEXA 2QGVA 1PA3A 2WGRA 1XVWA 4FYCA 4K7IA 4PNFA 1B48A 1K3YA 5IMVA 2IN3A 4ID0A 4X0XA 1XXUA 2PWJA 1AXDA 1K0NA 5IMFA 3VK9A 5CP1A 4PX1A 2A2SA 4POMA 3TKPA 4KW6A 2ZCTA 4LLRA 2DBCA 2A2RA 2D2ZA 2HZEB 2I1UA 3N9JA 5LNKe 2P5QA 2P31A 3VWWA 4BL7A 2FA4A 1PL2A 5D9VA 2VCWA 4L0WA 2KP1A 4A5PA 2YWNA 1SD9A 5J4UA 2K18A 1SKWB 3LFLA 5KOXA 3IE3A 2ZUPA 3C8EA 3DD3A 4E8HA 4JR4A 1V58A 5IPHA 2CV4A 5DQSA 3RAZA 1M9AA 3KEBA 3M0FA 1HNCA 4J56E 1R5PA 2X64A 3CSJA 3PGTA 1EGOA 3GX8A 1V57A 2OE0A 2H75A 5IMAA 2YOIA 2JZRA 3F4RA 4ZB6A 4N10A 2PMTA 4MZBA 1QUWA 1XVQA 2C80A 3GUSA 3VWXA 2GSTA 4GQFA 1FOVA 6GSWA 2DKIA 1AQWA 1E2YA 3TJJA 1DBYA 2IIYA 2K8SA 4N0ZA 2NTOA 2LV3A 5DCGA 3JCML 3GHAA 5A4UA 2MMOA 1SL0B 1QQ2A 3WGDA 2DJ3A 3G7JA 3ZRDA 1M0UA 2GZZA 4POBA 2CVKA 4GXZA 2AB6A 6GSYA 3EE2A 1A2LA 4GSNA 5IIZA 4TKYA 4TXVA 4MF5A 1SK0A 1XW5A 3LXTA 6GSUA 3TB2A 3H8QA 2FNOA 3UARA 3RBTA 2A4HA 4BVXB 4WXTA 1WRYA 5HR1A 2AJQB 5B8BA 4GSSA 5G1LA 2IFQA 2YV9A 1YY7A 1F3AA 3MYDA 2LS5A 4Q5QA 1TU7A 3Q74A 3TJFA 4I2TA 1AW9A 1URMA 3A2XA 1PD21 1Z6MA 3KTBA 1Z5YE 2X8HA 3QPMA 3AY8A 4JZQA 4TR0A 2AUVA 5DBQA 2MMNA 1FG4A 3P2AA 5F07A 5F06A 4MA9A 2KOKA 3C71A 3LYKA 3E0UA 4G2EA 4CHSA 4MZWA 4KX4A 4HI7A 7GSSA 3GIXA 5DALB 2HXKA 1BX9A 4EDYA 3ZYWA 1GP1A 2YJHA 3DGQA 3KD0A 4O5RA 1ZYPA 2YNXA 1GUMA 2MZCA 4G0LA 3RHCA 5CO3A 3TUEA 1V2AA 4HZ4A 3UOMA 1GLPA 1EP7A 5A4VA 4LA1A 2YN1A 1GNWA 2LRNA 3S9FA 2VLVA 5IPGA 2IMDA 4MJEA 4Q5NA 2MYGA 4OD7A 2ZNMA 2XC2A 3VURA 4ZBBA 1FW1A 2WFCA 4ZBAA 2R3XA 4YKGA 4EL1A 1QGVA 4FH8A 4ZXGA 5C04A 2H0IA 1MDJA 5C00A 2LNSA 4QL7A 2FHEA 3FR3A 4ZIJA 3GKMA 3LWAA 3HVXA 3Q19A 1WMJA 2M46A 5J3RA 1LU4A 1DE2A 2ES7A 1F9MA 3O6TA 4MJCA 1U6TA 4XS1A 1AUCA 2LJKA 2H72A 1K3LA 2IMFA 1XOBA 4K6XA 3GNJA 4N0VA 4POKA 2EIOA 1ZZYA 1T4YA 1X0RA 3KXOA 2R2JA 2GS3A 2AV4A 2BJXA 2VL3A 1G0TA 1SYXA 2P5RA 3L9UA 3IBHA 5HQPA 1R4WA 1WPIA 2X8GA 3CXGA 2DSAA 4GSTA 1ZGNA 4PURA 4MPGA 1S3AA 18GSA 1VF4A 1OYJA 4OFNA 4X43A 1A8YA 3H93A 5KN2A 4HDEA 3D6IA 4PQHA 2RM6A 3K8NA 3MSZA 4F0BA 1BYEA 5AIXA 2L5LA 4YQUA 3GSSA 2YZHA 1EOHA 1CQHA 1EP8A 3ZMLA 2G0FA 5JCUA 4EC0A 1ZYEA 2VIMA 1FB0A 4DSSB 3TDGA 1MD3A 3LEFA 4TN8A 4EKZA 3ZIJA 4HQZA 3VFIA 2MBTA 2OE3A 1Y25A 1MD4A 3FK8A 5HFKA 2M80A 1GSDA 4IP6A 5JWQB 4WETA 1VF2A 1GULA 4PGTA 5H5RA 4FYUA 4IELA 3TJGA 1HYUA 2YP6A 1V40A 4ML6A 2V2GA 4WR4A 1WWJA 4F9ZA 1GSSA 1YQ1A 2QC7A 3GN3A 2YCDA 4DSSA 4PUFC 5ECOB 2CVDA 1XFLA 3HJPA 5LCZA 2NBSA 4G0KA 1MDIA 3KJYA 3EURA 4MCUA 3QAVA 2PUKC 3HJMA 1XW9A 1C72A 2X49A 3EMXA 4I5QA 2C1YA 4NXIA 2WJUA 2M72A 4KSOA 3UIWA 5IM9A 1GWCA 1W89A 4IJIA 3ZFLA 2NPBA 2O85A 4LMWA 4K7NA 3ZITA 2C0DA 2VD1A 5DDLA 1T4ZA 2OA7A 2QA2A 2VM1A 3F3QA 2LNTA 3MIXA 2J23A 1DUGA 3QAGA 4EO3A 2GSQA 1FO5A 3US3A 2FWHA 5COHA 4MP4A 1F3BA 4MZCA 1CQGA 2G2QA 2RM5A 1Z7RA 4OFMA 4K2DA 1K3OA 2LJAA 1A2MA 3EWLA 3CTGA 2AYTA 2XBIA 3PINA 3UL3A 5A4WA 3F0IA 5HFIA 1OAZA 3RDWA 2R4VA 4V2MA 2F51A 3M8NA 3LXZA 3L78A 2B5EA 1G7OA 5CYYA 3W8SA 1K0MA 3QFAC 3HJOA 2GT5A 5H5SA 3F3RA 3LJRA 1O73A 1XWAA 1ERTA 1BQ7A 1S3CA 3F4TA 2YWIA 4F2IA 3BBYA 2H19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DC5 A;  3TRX A;  2VD0 A;  4XTS A;  2RLI A;  1TP9 A;  2ON7 A;  3F6F A;  1GL8 A;  3I43 A;  5CRG A;  5IO0 A;  2O87 A;  4YAV A;  3BJ5 A;  4KND A;  4ECI A;  2C3N A;  5F05 A;  4OCF A;  1M2A A;  4JBB A;  1ILO A;  1SKS B;  4WR5 A;  2TRC P;  1XBS A;  2CVB A;  4KH7 A;  4L0U A;  22GS A;  1MDK A;  2A4V A;  2I81 A;  3TKQ A;  4WF4 A;  2DJ2 A;  4BWQ A;  2FD3 A;  1EV9 A;  4XRD A;  2VL2 A;  4KDY A;  2PU9 C;  3Q18 A;  4ILF A;  3TOT A;  2CAQ A;  3TKS C;  3HZ8 A;  1A24 A;  5HFG A;  4JRR A;  1SU9 A;  3G9B A;  4KCA A;  2JU5 A;  4G9H A;  1SJI A;  6GST A;  1Z6N A;  4MMM A;  1XWC A;  3IRA A;  2R6K A;  1F37 A;  5DQY A;  2I4A A;  3IPZ A;  3MDK A;  1TW9 A;  1YZX A;  3I69 A;  5IOX A;  2HZF A;  2XPD A;  4EUY A;  1I9D A;  1K0D A;  2CAI A;  4XHM A;  6GSS A;  3GA4 A;  3GUR A;  5J5N A;  2JSY A;  2X8C A;  1WJK A;  2GQL A;  4TRX A;  4WBJ A;  1XPV A;  5ECR B;  3F6D A;  3P8W A;  2LQQ A;  4NAX A;  2VCZ A;  1ERW A;  4L5O A;  3UBL A;  1ZYQ B;  4OO4 A;  2C3T A;  1Z7P A;  2GQM A;  2JZS A;  17GS A;  3RPN A;  3LOR A;  3EU3 A;  1MTC A;  1FVJ A;  4EE0 A;  3D0Z A;  3APQ A;  3PR8 A;  2V32 A;  4TXO B;  4MF7 A;  1K0C A;  2H01 A;  3QDN A;  2XHF A;  1UC7 A;  5EL8 A;  4NWY A;  4OWY A;  1B4P A;  5ELG A;  2E0Q A;  2HSH A;  3VI5 A;  1YEP A;  3GH6 A;  4K0G A;  4F0C A;  4D73 B;  2L57 A;  1GSU A;  1TI3 A;  3GL5 A;  2H71 A;  1B9Y C;  3D5J A;  2I9H A;  3CBU A;  4TXO A;  4GLT A;  3GTU A;  2YAN A;  5IO2 A;  2H66 A;  2IME A;  3HVV A;  1O6J A;  3EYT A;  3F63 A;  10GS A;  2H8L A;  3GYK A;  1PSQ A;  3MNG A;  3O3T A;  1VRS D;  5G1K A;  1BAY A;  3TKS A;  3VWU A;  1O8X A;  4D73 A;  1EWX A;  3QMX A;  1MEK A;  2RII A;  5F8B A;  5KN1 A;  1W4V A;  5G5F A;  3DYR A;  1GLQ A;  2DJJ A;  5IOW A;  1O85 A;  3HHV A;  1RQM A;  3KGK A;  5GSS A;  1ST9 A;  1UVZ A;  3I9V 2;  2DML A;  4MLY A;  3APO A;  2F3M A;  2WB9 A;  1FHE A;  3C7M A;  1AAZ A;  1HNB A;  1Q98 A;  2IFQ B;  1KTE A;  4XS6 A;  3A2W A;  3UMA A;  3M3M A;  1PN9 A;  1PL1 A;  3FW2 A;  5L71 A;  3TJK A;  5ECP B;  4KGI A;  2PVO C;  5HR3 A;  5CRE A;  2O7K A;  5ID2 A;  1TRV A;  1GUK A;  4K9Z A;  4ISD A;  2JZT A;  1A0R P;  3ISO A;  3KP8 A;  1NHO A;  5DAK B;  3G7Y A;  2DLX A;  3FEU A;  3A3T A;  3ZIV A;  3GL3 A;  2PGT A;  3NIV A;  3CTF A;  1AIU A;  2DJ1 A;  5FT3 A;  2E7P A;  2HLS A;  1OKD A;  3GH9 A;  4ECC A;  2CQ9 A;  3QOU A;  1R5A A;  2PPT A;  2F9S A;  5DJL A;  4KCE A;  2RUE A;  3I6A A;  1T7P B;  2IL3 A;  2WUL A;  3LSZ A;  5DAK A;  4V1A g;  2YWM A;  4V2N A;  2XPE A;  4YH2 A;  5D9W A;  2FGX A;  2EIQ A;  4WEY A;  1X9W B;  2C0E A;  5AIV A;  3CMI A;  4MH3 A;  3UVH A;  1ZMA A;  1TXX A;  1OE7 A;  4JE1 A;  5G30 A;  3KCM A;  3HVS A;  3DML A;  1K0B A;  3DWV A;  1SYR A;  1GNE A;  3WD6 A;  4MDC A;  4Q5R A;  1PRX A;  3FR6 A;  5B6N A;  1A0F A;  3ZLP A;  2FLS A;  1A8L A;  1DSB A;  5KN3 A;  1U88 A;  4I6X A;  2H1B A;  3H1N A;  3HZ4 A;  1X9S B;  4LMV A;  3KM6 A;  3HXS A;  3UBK A;  3IOS A;  3SBC A;  2VOC A;  3DKS A;  3ZL5 A;  3D22 A;  4OCE A;  1GH2 A;  3TKS E;  2L4Q A;  3ERF A;  3W8J A;  1M9B A;  2GT6 A;  3CRU A;  2CX3 A;  3GKK A;  4HOJ A;  1HNA A;  4MAB A;  5J41 A;  1AQX A;  4H86 A;  1GSF A;  4JED A;  2B1K A;  2VCT A;  2AAW A;  5J9B A;  2VAF A;  1ACV A;  4PXO A;  4XCS A;  2VUP A;  1PGT A;  4FYB A;  1WIK A;  3IAM 2;  2YWO A;  4XS4 B;  1YF1 A;  4IP1 A;  5DCH A;  3ZVJ D;  2LRC A;  1JZR A;  2TRX A;  4K8M A;  1ZL9 A;  4F82 A;  2L4C A;  1JLW A;  2F8F A;  4EVM A;  4IKH A;  1X9M B;  1PQN A;  4MH2 A;  3TJB A;  4YQM A;  1NHY A;  4ZIL A;  4XIH A;  5AIS A;  4XS4 A;  4N30 A;  3UVT A;  4QL9 A;  2FWG A;  3IK9 A;  4EXJ A;  4BPY A;  3F4S A;  1AQV A;  3QD9 A;  2IPA A;  3F8U A;  1LJR A;  1TRU A;  3BOA A;  2VCX A;  4HU7 A;  1GTI A;  4L5L A;  2LRT A;  4KE3 A;  4V2L A;  5IQY A;  3ERW A;  2AHE A;  1B9X C;  2BTO T;  1TI1 A;  3HDC A;  2L5O A;  4E8E A;  1KEB A;  2CZ2 A;  3BCK A;  1DE1 A;  3CYN A;  5D8I A;  4BVY A;  5JCG A;  5ECI B;  4AGS A;  2FWE A;  4Z7X A;  2K6V A;  1T3B A;  2IJY A;  2YPM A;  2EIR A;  4AF2 A;  3GST A;  1Q4J A;  2HFD A;  5EVO A;  3DIE A;  1T1V A;  4ZL7 A;  3GRX A;  5ELA A;  3GFK A;  2J9H A;  2OE1 A;  1G7E A;  3MWH A;  4ECB A;  4GF0 A;  4HU9 A;  2CT6 A;  5E4W A;  5G5E A;  1JLV A;  1OC9 A;  19GS A;  4EDZ A;  1VGL A;  2F8A A;  3TKR A;  1X5C A;  1J9B A;  3LQ7 A;  3J7Y b;  5A5K A;  4XRA A;  2KLX A;  3D4M A;  4ZB8 A;  3ERG A;  4TR4 A;  1XW6 A;  4K1F A;  3KZQ A;  3ME7 A;  1GUH A;  2GVP A;  1TK0 B;  1U87 A;  4IGJ A;  5ABR A;  1TU8 A;  2N5A A;  4FO5 A;  1X5D A;  2HE3 A;  2VL9 A;  4TW5 A;  2GGT A;  3UEM A;  4IVF A;  5ECK B;  1G6Y A;  3QCP A;  1THO A;  4RI7 A;  5HR0 A;  3U5R E;  1TK8 B;  3VLN A;  3VWV A;  5DVB A;  2GZP A;  3KH9 A;  2H1G A;  1SK1 A;  3FZA A;  3ME8 A;  4Q5F A;  3UJ1 A;  4ACS A;  4I2U A;  5CNW A;  3ZVJ A;  2MBS A;  4NMU A;  4KSM A;  4MJA A;  3NZN A;  5J9C A;  4GRF A;  2HYX A;  5B6M A;  4RQX A;  4HS1 A;  3RHB A;  1EEJ A;  2OAD A;  5FWG A;  5AN1 A;  4HUA A;  3P90 A;  1SEN A;  3TRP A;  1XOA A;  4RI6 A;  1LBK A;  1H4O A;  1KBN A;  1YKC A;  4CW9 A;  1U3A A;  1WOU A;  9GSS A;  2P0G A;  1RW1 A;  4MJB A;  4RUV A;  4O7H A;  3DVW A;  2GLR A;  3WT1 A;  2Z9S A;  5CRD A;  4HQS A;  2HSY A;  2MMZ A;  1R7H A;  3DEX A;  2KUC A;  1BG5 A;  1USB A;  3IV4 A;  4ZL9 A;  4OO5 A;  4OFT A;  4TVE A;  1H75 A;  4IHU A;  4G19 A;  2WCI A;  1JZO A;  1BJX A;  4DEJ A;  2DMM A;  1F6M C;  16GS A;  4K7O A;  1O81 A;  5KN0 A;  1B8X A;  5GZZ B;  3TOU A;  2KHP A;  2JL4 A;  4WKW A;  1KNG A;  2X99 A;  4ECJ A;  3VI7 A;  5EY6 A;  2B5X A;  2VCV A;  1PKZ A;  4DSQ A;  1PX7 A;  1K0O A;  1A2J A;  1PMT A;  3IAS 2;  1TK5 B;  1Y6E A;  2FWF A;  1EV4 A;  3HCZ A;  4CDO A;  2MMA A;  5H5Q A;  5G2Z A;  4FIW A;  1YDK A;  2B7J A;  2LST A;  3GKX A;  5HR2 A;  2B3S A;  1OVN A;  4P3Y B;  1A23 A;  4ZL8 A;  1YJ6 A;  1Z3E A;  4IN0 A;  3HD5 A;  2LTK A;  3RPP A;  1GTA A;  1I5G A;  3FR9 A;  1OC8 A;  3HKR A;  3FZ4 A;  2OKA A;  3CSI A;  4LL4 B;  2NDO A;  3EIN A;  3GTU B;  3E9J B;  4JR6 A;  8GSS A;  2H1A A;  5IMC A;  4IBP A;  1M99 A;  2PER A;  1GTB A;  3ZMK A;  2HNL A;  2LUS A;  4TOP A;  3ZTL A;  4NHZ A;  5B8A A;  3FKF A;  4MPF A;  1TRS A;  5FHI A;  1Z9H A;  1OE8 A;  1TRW A;  1V98 A;  2L6D A;  4AJ6 A;  3H4K A;  1THX A;  1XWB A;  2GSS A;  2VO4 A;  2LJR A;  2HZE A;  1T00 A;  5ECN B;  1WP0 A;  1OKT A;  4IQ1 A;  4YAP A;  3W6G A;  6GSX A;  2L59 A;  1EEM A;  1QFN A;  1BED A;  3WGE A;  1UA5 A;  3F9U A;  11GS A;  1JHB A;  1M2B A;  2N5B A;  3GV1 A;  5ID2 B;  5KEJ A;  4IS0 A;  1SKR B;  1X5E A;  3MAK A;  3WGX A;  3WT2 A;  2H76 A;  4PQI A;  1NM3 A;  5B7C A;  1GSY A;  3NOF A;  3PH9 A;  1AC1 A;  5EPF A;  3KTL A;  2C4J A;  1SK2 A;  2O8V B;  3TCO A;  4ZBD A;  1QMV A;  3TGZ A;  1ZCP A;  4KAE A;  2E2M A;  3C1S A;  2KP2 A;  3R2Q A;  4O32 A;  5CRH A;  2R37 A;  2BMX A;  3CRT A;  1EZK A;  2ALB A;  3EMP A;  2FA8 A;  2HRN A;  3P7X A;  2E2G A;  2OBI A;  2H6X A;  3M1G A;  2R5G A;  3LG6 A;  4HJM A;  3A5W A;  2LEG A;  3EC3 A;  1S3D A;  3DVX A;  5ECM B;  2WZ9 A;  2YZU A;  4EF0 A;  1J0F A;  4GWR A;  3TRQ A;  2QKE A;  4KDX A;  1M7T A;  5ECQ B;  4IW9 A;  1ERU A;  3KMO A;  4I97 A;  1EOG A;  4MK3 A;  3IC4 A;  4BVX A;  2IMI A;  2GQK A;  4J57 E;  2XBQ A;  5D9X A;  4GTU A;  2VLU A;  2FY6 A;  2N5F A;  2JAC A;  1SJZ A;  2OJL A;  20GS A;  1SL2 B;  5D93 A;  4TR3 A;  1UN2 A;  4GQC A;  2L6C A;  3IDV A;  1SL1 B;  4LL1 B;  1GSQ A;  2WDU A;  1ML6 A;  1SJ6 A;  1HQO A;  4I8B A;  1TKD B;  1O7U A;  1F2E A;  1K0A A;  2GZY A;  4JU5 A;  3ED3 A;  4KDU A;  5DJM A;  3BCI A;  4PUA A;  2IWT A;  1VF3 A;  4BA7 A;  5D73 A;  2C0F A;  1GRX A;  3IA1 A;  1YF0 A;  2H73 A;  5DAL A;  4KB3 A;  3IHQ A;  2ON5 A;  4KUN A;  1JZW A;  3VPT A;  1YKA A;  3HA9 A;  1XZO A;  1NSW A;  5GAP D;  4DVC A;  2IMK A;  1SD8 A;  2B6M A;  4ML1 A;  1FVK A;  2K9F A;  3APS A;  2H0G A;  3QR6 A;  2WS2 A;  5E59 A;  5CRW A;  5IMZ A;  1IYI A;  2K8V A;  4AJ7 A;  2VCQ A;  4AJ8 A;  4N11 A;  2H0H A;  2DIY A;  2H6Z A;  3ZFB A;  3SWL A;  5JWR B;  5ENU A;  2RUF A;  14GS A;  3Q6O A;  5LD0 A;  1T8E B;  1B4Q A;  2B1L A;  2JAD A;  5AGY A;  1TOF A;  3VPQ A;  3ZZX A;  4QQ7 A;  4ULX A;  2PVQ A;  1ABA A;  3KH7 A;  4NV2 A;  3J7Y k;  4BWS A;  3M9K A;  3UAP A;  4HEA 2;  4TR1 B;  4WBR D;  3FHK A;  4L8E A;  2HRF A;  3GX0 A;  3CSH A;  3OR5 A;  5IMD A;  3LYP A;  2FUG 2;  1ZOF A;  1R26 A;  3WYW A;  2I3Y A;  1PKW A;  3A2V A;  1OC9 B;  4ZB9 A;  2H70 A;  13GS A;  5JCW A;  1XWG A;  3FZ9 A;  3C73 A;  3L9V A;  5D9T A;  2CZ3 A;  4NV5 A;  4PQ1 A;  4J2F A;  1V9W A;  2QSI A;  5F0G A;  2OBK A;  2WRT A;  5ECH B;  3DXB A;  4TR1 A;  5GAN D;  1N8J A;  2JSZ A;  1TTZ A;  2HT9 A;  1VF1 A;  4K0N A;  4HZ2 A;  2LQO A;  1RK4 A;  1XCC A;  4NPB A;  1O8W A;  2V41 A;  3IR4 A;  2FCH A;  3DRN A;  3KMN A;  3KIJ A;  4PNG A;  2V1M A;  3U6V A;  3L0H A;  1WE0 A;  5INY A;  1N2A A;  1U3I A;  5JWO B;  3BD2 A;  2VL2 C;  3HY2 A;  3N5O A;  1GSE A;  1FAA A;  3QAW A;  2GTU A;  4G10 A;  1J08 A;  1ON4 A;  4DSR A;  2GDR A;  4IJ3 A;  2DIZ A;  2O89 A;  1EGR A;  2CX4 A;  3L4N A;  12GS A;  3L9S A;  4HJ2 A;  3C1R A;  2V6O A;  4OMV A;  5GST A;  3QFB C;  1IYH A;  3EU4 A;  3FZ5 A;  3O76 A;  2V6K A;  2C0G A;  2EC4 A;  2YJ7 A;  3KP9 A;  2H1D A;  1G6W A;  4RQR A;  2DJ0 A;  2YV7 A;  4O92 A;  2REM A;  4MF6 A;  3HYP A;  2VLT A;  3D21 A;  5CAX A;  1TJD A;  4F03 A;  5ECS A;  3H79 A;  4X1U A;  3FY7 A;  2LKU A;  3GKN A;  1QXH A;  4KA0 A;  3G7I A;  1NW2 A;  4WF5 A;  2CA8 A;  3M9J A;  2PBJ A;  5ECL B;  3D4T A;  2H30 A;  3FRC A;  1JZD A;  3E3E A;  3GMF A;  3EVI A;  1M2D A;  2DJK A;  4POL A;  1OC3 A;  2VM2 A;  1XIY A;  2H74 A;  5D96 A;  4V1A p;  2B5Y A;  1ERV A;  5G31 A;  2HI7 A;  2C8U A;  3LGC A;  1JFU A;  4NHW A;  2H6Y A;  2TIR A;  2NVL A;  2PN8 A;  3ZRE A;  1HD2 A;  1GTU A;  1QK8 A;  4YQV A;  2B7K A;  4GCI A;  3V1W A;  2GSR A;  4IQA A;  1XWK A;  6GSV A;  1E6B A;  1TDI A;  2C3Q A;  3IK7 A;  3FYG A;  2OAC A;  3IXR A;  1FB6 A;  1PX6 A;  1YEX A;  2QGV A;  1PA3 A;  2WGR A;  1XVW A;  4FYC A;  4K7I A;  4PNF A;  1B48 A;  1K3Y A;  5IMV A;  2IN3 A;  4ID0 A;  4X0X A;  1XXU A;  2PWJ A;  1AXD A;  1K0N A;  5IMF A;  3VK9 A;  5CP1 A;  4PX1 A;  2A2S A;  4POM A;  3TKP A;  4KW6 A;  2ZCT A;  4LLR A;  2DBC A;  2A2R A;  2D2Z A;  2HZE B;  2I1U A;  3N9J A;  5LNK e;  2P5Q A;  2P31 A;  3VWW A;  4BL7 A;  2FA4 A;  1PL2 A;  5D9V A;  2VCW A;  4L0W A;  2KP1 A;  2YWN A;  1SD9 A;  5J4U A;  2K18 A;  1SKW B;  3LFL A;  3IE3 A;  2ZUP A;  3C8E A;  3DD3 A;  4E8H A;  4JR4 A;  1V58 A;  5IPH A;  2CV4 A;  5DQS A;  3RAZ A;  1M9A A;  3KEB A;  3M0F A;  1HNC A;  4J56 E;  1R5P A;  2X64 A;  3CSJ A;  3PGT A;  1EGO A;  3GX8 A;  1V57 A;  2OE0 A;  2H75 A;  5IMA A;  2YOI A;  2JZR A;  3F4R A;  4ZB6 A;  4N10 A;  2PMT A;  4MZB A;  1QUW A;  1XVQ A;  2C80 A;  3GUS A;  3VWX A;  2GST A;  4GQF A;  1FOV A;  6GSW A;  1AQW A;  1E2Y A;  3TJJ A;  1DBY A;  2IIY A;  2K8S A;  4N0Z A;  2NTO A;  2LV3 A;  5DCG A;  3JCM L;  3GHA A;  5A4U A;  2MMO A;  1SL0 B;  1QQ2 A;  3WGD A;  2DJ3 A;  3G7J A;  3ZRD A;  1M0U A;  2GZZ A;  4POB A;  2CVK A;  4GXZ A;  2AB6 A;  6GSY A;  3EE2 A;  1A2L A;  4GSN A;  5IIZ A;  4TKY A;  4TXV A;  4MF5 A;  1SK0 A;  1XW5 A;  3LXT A;  6GSU A;  3TB2 A;  3H8Q A;  2FNO A;  3UAR A;  3RBT A;  4WXT A;  1WRY A;  5HR1 A;  2AJQ B;  5B8B A;  4GSS A;  5G1L A;  2IFQ A;  2YV9 A;  1YY7 A;  1F3A A;  2LS5 A;  4Q5Q A;  1TU7 A;  3Q74 A;  3TJF A;  4I2T A;  1AW9 A;  1URM A;  3A2X A;  1PD2 1;  1Z6M A;  3KTB A;  1Z5Y E;  2X8H A;  3QPM A;  3AY8 A;  4JZQ A;  4TR0 A;  2AUV A;  5DBQ A;  2MMN A;  1FG4 A;  3P2A A;  5F07 A;  5F06 A;  4MA9 A;  2KOK A;  3C71 A;  3LYK A;  3E0U A;  4G2E A;  4CHS A;  4MZW A;  4KX4 A;  4HI7 A;  7GSS A;  3GIX A;  5DAL B;  2HXK A;  1BX9 A;  4EDY A;  3ZYW A;  1GP1 A;  2YJH A;  3DGQ A;  3KD0 A;  4O5R A;  2YNX A;  1GUM A;  2MZC A;  3RHC A;  5CO3 A;  3TUE A;  1V2A A;  4HZ4 A;  3UOM A;  1GLP A;  1EP7 A;  5A4V A;  4LA1 A;  2YN1 A;  1GNW A;  2LRN A;  3S9F A;  2VLV A;  5IPG A;  2IMD A;  4MJE A;  4Q5N A;  2MYG A;  4OD7 A;  2ZNM A;  2XC2 A;  3VUR A;  4ZBB A;  1FW1 A;  2WFC A;  4ZBA A;  2R3X A;  4EL1 A;  1QGV A;  4FH8 A;  4ZXG A;  5C04 A;  2H0I A;  1MDJ A;  5C00 A;  2LNS A;  4QL7 A;  2FHE A;  3FR3 A;  4ZIJ A;  3GKM A;  3LWA A;  3HVX A;  3Q19 A;  1WMJ A;  2M46 A;  5J3R A;  1LU4 A;  1DE2 A;  2ES7 A;  1F9M A;  3O6T A;  4MJC A;  1U6T A;  4XS1 A;  1AUC A;  2LJK A;  2H72 A;  1K3L A;  2IMF A;  1XOB A;  4K6X A;  3GNJ A;  4N0V A;  4POK A;  2EIO A;  1ZZY A;  1T4Y A;  1X0R A;  3KXO A;  2R2J A;  2GS3 A;  2AV4 A;  2BJX A;  2VL3 A;  1G0T A;  1SYX A;  2P5R A;  3L9U A;  3IBH A;  5HQP A;  1R4W A;  1WPI A;  2X8G A;  3CXG A;  2DSA A;  4GST A;  1ZGN A;  4PUR A;  4MPG A;  1S3A A;  18GS A;  1VF4 A;  1OYJ A;  4OFN A;  4X43 A;  1A8Y A;  3H93 A;  5KN2 A;  4HDE A;  3D6I A;  4PQH A;  2RM6 A;  3K8N A;  3MSZ A;  4F0B A;  1BYE A;  5AIX A;  2L5L A;  4YQU A;  3GSS A;  2YZH A;  1EOH A;  1CQH A;  1EP8 A;  3ZML A;  2G0F A;  5JCU A;  4EC0 A;  1ZYE A;  2VIM A;  1FB0 A;  4DSS B;  3TDG A;  1MD3 A;  3LEF A;  4TN8 A;  4EKZ A;  3ZIJ A;  4HQZ A;  3VFI A;  2MBT A;  2OE3 A;  1Y25 A;  1MD4 A;  3FK8 A;  5HFK A;  2M80 A;  1GSD A;  4IP6 A;  5JWQ B;  4WET A;  1VF2 A;  1GUL A;  4PGT A;  5H5R A;  4FYU A;  4IEL A;  3TJG A;  1HYU A;  2YP6 A;  1V40 A;  4ML6 A;  2V2G A;  4WR4 A;  1WWJ A;  4F9Z A;  1GSS A;  1YQ1 A;  2QC7 A;  3GN3 A;  2YCD A;  4DSS A;  4PUF C;  5ECO B;  2CVD A;  1XFL A;  3HJP A;  5LCZ A;  2NBS A;  1MDI A;  3KJY A;  3EUR A;  4MCU A;  3QAV A;  2PUK C;  3HJM A;  1XW9 A;  1C72 A;  3EMX A;  4I5Q A;  2C1Y A;  4NXI A;  2WJU A;  2M72 A;  4KSO A;  3UIW A;  5IM9 A;  1GWC A;  1W89 A;  4IJI A;  3ZFL A;  2NPB A;  2O85 A;  4LMW A;  4K7N A;  3ZIT A;  2C0D A;  2VD1 A;  5DDL A;  1T4Z A;  2OA7 A;  2VM1 A;  3F3Q A;  2LNT A;  2J23 A;  1DUG A;  3QAG A;  4EO3 A;  2GSQ A;  1FO5 A;  3US3 A;  2FWH A;  5COH A;  4MP4 A;  1F3B A;  4MZC A;  1CQG A;  2G2Q A;  2RM5 A;  1Z7R A;  4OFM A;  4K2D A;  1K3O A;  2LJA A;  1A2M A;  3EWL A;  3CTG A;  2AYT A;  2XBI A;  3PIN A;  3UL3 A;  5A4W A;  3F0I A;  5HFI A;  1OAZ A;  3RDW A;  2R4V A;  4V2M A;  2F51 A;  3M8N A;  3LXZ A;  3L78 A;  2B5E A;  1G7O A;  5CYY A;  3W8S A;  1K0M A;  3QFA C;  3HJO A;  2GT5 A;  5H5S A;  3F3R A;  3LJR A;  1O73 A;  1XWA A;  1ERT A;  1BQ7 A;  1S3C A;  3F4T A;  2YWI A;  4F2I A;  3BBY A;  2H19 A; 
#chains in the Genus database with same CATH topology
 2DC5 A;  3TRX A;  2VD0 A;  4XTS A;  2RLI A;  1TP9 A;  2ON7 A;  3F6F A;  1GL8 A;  3I43 A;  5CRG A;  5IO0 A;  2O87 A;  4YAV A;  3BJ5 A;  4KND A;  4ECI A;  2C3N A;  4PTS A;  5F05 A;  4OCF A;  1M2A A;  4JBB A;  1ILO A;  1SKS B;  4WR5 A;  2TRC P;  1XBS A;  2CVB A;  4KH7 A;  4L0U A;  22GS A;  1MDK A;  2A4V A;  2DKH A;  2I81 A;  2QA1 A;  3TKQ A;  4WF4 A;  2DJ2 A;  4BWQ A;  2FD3 A;  1EV9 A;  4XRD A;  2VL2 A;  4KDY A;  2PU9 C;  3Q18 A;  4ILF A;  3TOT A;  2CAQ A;  3TKS C;  3HZ8 A;  1A24 A;  5HFG A;  4JRR A;  1SU9 A;  3G9B A;  4KCA A;  2JU5 A;  4G9H A;  1SJI A;  6GST A;  1Z6N A;  4MMM A;  1XWC A;  3IRA A;  2R6K A;  1F37 A;  4ICY A;  5DQY A;  2I4A A;  3IPZ A;  3MDK A;  1TW9 A;  1YZX A;  3I69 A;  5IOX A;  2HZF A;  2XPD A;  4EUY A;  1I9D A;  1K0D A;  4YKF A;  2CAI A;  4XHM A;  6GSS A;  3GA4 A;  3GUR A;  5J5N A;  2JSY A;  2X8C A;  4G0I A;  1WJK A;  2GQL A;  4TRX A;  4WBJ A;  1XPV A;  5ECR B;  3F6D A;  3P8W A;  4KF9 A;  2LQQ A;  4NAX A;  2VCZ A;  1ERW A;  4L5O A;  3UBL A;  1ZYQ B;  4OO4 A;  2C3T A;  1Z7P A;  2GQM A;  2JZS A;  17GS A;  3RPN A;  3LOR A;  3EU3 A;  1MTC A;  1FVJ A;  4EE0 A;  3D0Z A;  1ZYN A;  3APQ A;  3PR8 A;  2V32 A;  4TXO B;  4MF7 A;  1K0C A;  2H01 A;  3QDN A;  2XHF A;  1UC7 A;  5EL8 A;  4NWY A;  4OWY A;  1B4P A;  1PFO A;  5ELG A;  2E0Q A;  2HSH A;  3VI5 A;  1YEP A;  3GH6 A;  4K0G A;  4F0C A;  3LW9 A;  4D73 B;  2L57 A;  4FQU A;  1GSU A;  1TI3 A;  3GL5 A;  2H71 A;  1B9Y C;  3R3E A;  3D5J A;  2I9H A;  3CBU A;  4TXO A;  4GLT A;  3GTU A;  2YAN A;  5IO2 A;  2H66 A;  2IME A;  3HVV A;  1O6J A;  3EYT A;  3F63 A;  10GS A;  2H8L A;  3GYK A;  1PSQ A;  3MNG A;  3O3T A;  1VRS D;  5G1K A;  1BAY A;  3TKS A;  3VWU A;  1O8X A;  4D73 A;  1EWX A;  3QMX A;  1MEK A;  2RII A;  5F8B A;  5KN1 A;  1W4V A;  5G5F A;  3DYR A;  1GLQ A;  2DJJ A;  5IOW A;  1O85 A;  3HHV A;  1RQM A;  3KGK A;  5GSS A;  1ST9 A;  1UVZ A;  3I9V 2;  2DML A;  4MLY A;  3APO A;  2F3M A;  2WB9 A;  2UZ8 A;  1FHE A;  3C7M A;  1AAZ A;  1HNB A;  1Q98 A;  2IFQ B;  1KTE A;  4XS6 A;  3A2W A;  3UMA A;  3M3M A;  1PN9 A;  1PL1 A;  3FW2 A;  5L71 A;  3TJK A;  5ECP B;  4KGI A;  2PVO C;  5HR3 A;  2HRK A;  4X4J A;  5CRE A;  2O7K A;  5ID2 A;  1TRV A;  1GUK A;  4K9Z A;  4ISD A;  2JZT A;  1A0R P;  3ISO A;  3KP8 A;  1NHO A;  5DAK B;  3G7Y A;  2DLX A;  3FEU A;  3A3T A;  3ZIV A;  3GL3 A;  2PGT A;  3NIV A;  3CTF A;  1AIU A;  2DJ1 A;  5FT3 A;  2E7P A;  2HLS A;  1OKD A;  3GH9 A;  4ECC A;  2CQ9 A;  3QOU A;  1R5A A;  2PPT A;  2F9S A;  5DJL A;  4KCE A;  2RUE A;  3I6A A;  1T7P B;  2IL3 A;  2WUL A;  3LSZ A;  5DAK A;  4V1A g;  2YWM A;  4V2N A;  2XPE A;  4YH2 A;  5D9W A;  2FGX A;  2EIQ A;  4WEY A;  1X9W B;  2C0E A;  5AIV A;  3CMI A;  4MH3 A;  3UVH A;  1ZMA A;  1TXX A;  1OE7 A;  4JE1 A;  5G30 A;  3KCM A;  3HVS A;  3DML A;  1K0B A;  3DWV A;  1SYR A;  1GNE A;  3WD6 A;  4MDC A;  4Q5R A;  1PRX A;  3FR6 A;  5B6N A;  1A0F A;  3ZLP A;  2FLS A;  1A8L A;  1DSB A;  5KN3 A;  1U88 A;  4I6X A;  2H1B A;  3H1N A;  3HZ4 A;  1X9S B;  4LMV A;  3KM6 A;  3HXS A;  3UBK A;  3IOS A;  3SBC A;  2VOC A;  3DKS A;  3ZL5 A;  3D22 A;  4OCE A;  1GH2 A;  3TKS E;  2L4Q A;  3ERF A;  3W8J A;  1M9B A;  2GT6 A;  3CRU A;  2CX3 A;  3GKK A;  4HOJ A;  1HNA A;  4MAB A;  5J41 A;  1AQX A;  4H86 A;  1GSF A;  4JED A;  2B1K A;  2VCT A;  5KOW A;  2AAW A;  5J9B A;  2VAF A;  1ACV A;  4PXO A;  4XCS A;  2VUP A;  1PGT A;  4FYB A;  1WIK A;  3IAM 2;  2YWO A;  4XS4 B;  1YF1 A;  4IP1 A;  5DCH A;  3ZVJ D;  2LRC A;  1JZR A;  2A2P A;  2TRX A;  4K8M A;  1ZL9 A;  4F82 A;  2L4C A;  1JLW A;  2F8F A;  4EVM A;  4IKH A;  1X9M B;  1PQN A;  4MH2 A;  3TJB A;  4YQM A;  1NHY A;  4ZIL A;  4XIH A;  5AIS A;  4XS4 A;  4N30 A;  3UVT A;  4QL9 A;  2FWG A;  3IK9 A;  4EXJ A;  4BPY A;  3F4S A;  1AQV A;  3QD9 A;  2IPA A;  3F8U A;  1LJR A;  1TRU A;  3BOA A;  2VCX A;  4HU7 A;  1GTI A;  4L5L A;  4K5R A;  2LRT A;  4KE3 A;  4V2L A;  5IQY A;  3ERW A;  2AHE A;  1B9X C;  2BTO T;  1TI1 A;  3HDC A;  2L5O A;  4E8E A;  1KEB A;  2CZ2 A;  3BCK A;  1DE1 A;  3CYN A;  5D8I A;  1FOH A;  4BVY A;  5JCG A;  5ECI B;  4AGS A;  2FWE A;  4Z7X A;  2K6V A;  1T3B A;  2IJY A;  2YPM A;  2EIR A;  4AF2 A;  3GST A;  4Z2R A;  1Q4J A;  2HFD A;  5EVO A;  3DIE A;  1T1V A;  4ZL7 A;  3GRX A;  5ELA A;  3GFK A;  2J9H A;  2OE1 A;  1G7E A;  3MWH A;  4ECB A;  4GF0 A;  4HU9 A;  2CT6 A;  5E4W A;  5G5E A;  1JLV A;  1OC9 A;  19GS A;  4EDZ A;  1VGL A;  2F8A A;  3TKR A;  3CQF A;  1X5C A;  1J9B A;  3LQ7 A;  3J7Y b;  5A5K A;  4XRA A;  2KLX A;  3D4M A;  1PN0 A;  4ZB8 A;  3ERG A;  4TR4 A;  1XW6 A;  4K1F A;  3KZQ A;  3ME7 A;  1GUH A;  2GVP A;  1TK0 B;  1U87 A;  4IGJ A;  5ABR A;  1TU8 A;  2N5A A;  4FO5 A;  1X5D A;  2HE3 A;  2VL9 A;  4TW5 A;  2GGT A;  3UEM A;  2R0P A;  4IVF A;  5ECK B;  1G6Y A;  3QCP A;  1THO A;  4RI7 A;  5HR0 A;  3U5R E;  1TK8 B;  3VLN A;  3VWV A;  5DVB A;  2GZP A;  3KH9 A;  2H1G A;  1SK1 A;  3FZA A;  3ME8 A;  4Q5F A;  3UJ1 A;  4ACS A;  4I2U A;  5CNW A;  3ZVJ A;  2MBS A;  4NMU A;  4KSM A;  4MJA A;  3NZN A;  5J9C A;  4GRF A;  3FMW A;  2HYX A;  5B6M A;  4RQX A;  4HS1 A;  3RHB A;  1EEJ A;  2OAD A;  5FWG A;  5AN1 A;  4HUA A;  3P90 A;  1SEN A;  3TRP A;  1XOA A;  4RI6 A;  1LBK A;  1H4O A;  1KBN A;  1YKC A;  4CW9 A;  1U3A A;  1WOU A;  4EIQ A;  9GSS A;  2P0G A;  1RW1 A;  4MJB A;  4RUV A;  4O7H A;  3DVW A;  2GLR A;  3WT1 A;  2Z9S A;  5CRD A;  4HQS A;  2HSY A;  2MMZ A;  1R7H A;  3DEX A;  2KUC A;  1BG5 A;  1USB A;  3IV4 A;  4ZL9 A;  4OO5 A;  4OFT A;  4TVE A;  1H75 A;  4IHU A;  4G19 A;  2WCI A;  1JZO A;  1BJX A;  4DEJ A;  2DMM A;  1F6M C;  16GS A;  4K7O A;  1O81 A;  5KN0 A;  1B8X A;  5GZZ B;  3TOU A;  2KHP A;  2JL4 A;  4WKW A;  1KNG A;  2X99 A;  4ECJ A;  3VI7 A;  5EY6 A;  2B5X A;  2VCV A;  1PKZ A;  4DSQ A;  1PX7 A;  1K0O A;  1A2J A;  1PMT A;  3IAS 2;  1TK5 B;  1Y6E A;  2FWF A;  1EV4 A;  3HCZ A;  4CDO A;  2MMA A;  5H5Q A;  5G2Z A;  4FIW A;  1YDK A;  2B7J A;  2LST A;  3GKX A;  5HR2 A;  4Z2T A;  2HSM A;  2B3S A;  1OVN A;  4P3Y B;  1A23 A;  4ZL8 A;  1YJ6 A;  1Z3E A;  4IN0 A;  3HD5 A;  2LTK A;  3RPP A;  1GTA A;  1I5G A;  3FR9 A;  1OC8 A;  3HKR A;  3FZ4 A;  2OKA A;  3CSI A;  4LL4 B;  2NDO A;  3EIN A;  3GTU B;  3E9J B;  4JR6 A;  8GSS A;  2H1A A;  5IMC A;  4IBP A;  1M99 A;  2PER A;  1GTB A;  3ZMK A;  2HNL A;  2LUS A;  4TOP A;  3ZTL A;  4NHZ A;  5B8A A;  3FKF A;  4MPF A;  1TRS A;  5FHI A;  1Z9H A;  1OE8 A;  3EPT A;  1TRW A;  1V98 A;  2L6D A;  4AJ6 A;  3H4K A;  1THX A;  1XWB A;  2GSS A;  2VO4 A;  2LJR A;  2HZE A;  1T00 A;  5ECN B;  4K2X A;  1WP0 A;  1OKT A;  4IQ1 A;  4YAP A;  3W6G A;  4BIK A;  6GSX A;  2L59 A;  1EEM A;  1QFN A;  1BED A;  3WGE A;  1UA5 A;  3F9U A;  11GS A;  1JHB A;  1M2B A;  2N5B A;  3GV1 A;  5ID2 B;  5KEJ A;  4IS0 A;  1SKR B;  1X5E A;  3MAK A;  3WGX A;  3WT2 A;  4USS A;  2H76 A;  4PQI A;  1NM3 A;  5B7C A;  1GSY A;  3NOF A;  3PH9 A;  1AC1 A;  5EPF A;  3KTL A;  2C4J A;  1SK2 A;  2O8V B;  3TCO A;  4ZBD A;  1QMV A;  3TGZ A;  3HVN A;  1ZCP A;  4KAE A;  2E2M A;  3C1S A;  2KP2 A;  3R2Q A;  4O32 A;  5CRH A;  2R37 A;  2BMX A;  3CRT A;  1EZK A;  2ALB A;  3EMP A;  2FA8 A;  2HRN A;  3P7X A;  2E2G A;  2OBI A;  2H6X A;  3M1G A;  2R5G A;  3LG6 A;  4HJM A;  3A5W A;  2LEG A;  3EC3 A;  1S3D A;  3DVX A;  5ECM B;  2WZ9 A;  2YZU A;  4EF0 A;  1J0F A;  4GWR A;  3TRQ A;  2QKE A;  4KDX A;  1M7T A;  5ECQ B;  4IW9 A;  5BRT A;  1ERU A;  3KMO A;  3IC8 A;  4I97 A;  1EOG A;  4MK3 A;  3IC4 A;  4BVX A;  2IMI A;  2GQK A;  4J57 E;  2XBQ A;  5D9X A;  4GTU A;  2VLU A;  2FY6 A;  2N5F A;  2JAC A;  1SJZ A;  2OJL A;  20GS A;  1SL2 B;  5D93 A;  4TR3 A;  1UN2 A;  4GQC A;  2L6C A;  3IDV A;  1SL1 B;  4LL1 B;  1GSQ A;  2WDU A;  1ML6 A;  1SJ6 A;  1HQO A;  4I8B A;  1TKD B;  1O7U A;  1F2E A;  1K0A A;  2GZY A;  4JU5 A;  3ED3 A;  4KDU A;  5DJM A;  2R0G A;  3BCI A;  4PUA A;  4Z2U A;  2IWT A;  1VF3 A;  4BA7 A;  5D73 A;  2C0F A;  1GRX A;  3IA1 A;  1YF0 A;  2H73 A;  5DAL A;  4KB3 A;  3IHQ A;  2ON5 A;  4KUN A;  1JZW A;  3VPT A;  1YKA A;  3HA9 A;  1XZO A;  1NSW A;  5GAP D;  4DVC A;  4O5Q A;  2IMK A;  1SD8 A;  2B6M A;  4ML1 A;  1FVK A;  2K9F A;  3APS A;  2H0G A;  3QR6 A;  2WS2 A;  5E59 A;  5CRW A;  5IMZ A;  1IYI A;  2K8V A;  4AJ7 A;  2VCQ A;  4AJ8 A;  4N11 A;  2H0H A;  2DIY A;  2H6Z A;  3ZFB A;  3SWL A;  5JWR B;  5ENU A;  2RUF A;  14GS A;  3Q6O A;  5LD0 A;  3A5I A;  1T8E B;  1B4Q A;  4BVY B;  2B1L A;  2JAD A;  5AGY A;  1TOF A;  3VPQ A;  3ZZX A;  4QQ7 A;  4ULX A;  2PVQ A;  1ABA A;  3KH7 A;  4NV2 A;  3J7Y k;  4BWS A;  3M9K A;  3UAP A;  4HEA 2;  4TR1 B;  4WBR D;  3FHK A;  4L8E A;  2HRF A;  3GX0 A;  3CSH A;  3OR5 A;  5IMD A;  3LYP A;  2FUG 2;  1ZOF A;  1R26 A;  3WYW A;  4O5U A;  2I3Y A;  1PKW A;  3A2V A;  1OC9 B;  4ZB9 A;  2H70 A;  13GS A;  5JCW A;  1XWG A;  3FZ9 A;  4K5S A;  3C73 A;  3L9V A;  5D9T A;  2CZ3 A;  4NV5 A;  4PQ1 A;  4J2F A;  1V9W A;  2QSI A;  5F0G A;  2OBK A;  2WRT A;  5ECH B;  3DXB A;  4TR1 A;  5GAN D;  1N8J A;  2JSZ A;  1TTZ A;  2HT9 A;  1VF1 A;  4K0N A;  4HZ2 A;  2LQO A;  1RK4 A;  1XCC A;  4NPB A;  1O8W A;  2V41 A;  3IR4 A;  2FCH A;  3DRN A;  3KMN A;  3KIJ A;  4PNG A;  2V1M A;  3U6V A;  4EIP A;  3L0H A;  4MNN A;  1WE0 A;  5INY A;  1N2A A;  1U3I A;  5JWO B;  3BD2 A;  2VL2 C;  3HY2 A;  3N5O A;  1GSE A;  1FAA A;  3QAW A;  2GTU A;  4G10 A;  1J08 A;  1ON4 A;  4DSR A;  2GDR A;  4IJ3 A;  5BMU A;  2DIZ A;  2O89 A;  1EGR A;  2CX4 A;  3L4N A;  3IHG A;  12GS A;  3L9S A;  4HJ2 A;  3C1R A;  2V6O A;  4OMV A;  5GST A;  3QFB C;  1IYH A;  3EU4 A;  1XG8 A;  3FZ5 A;  3O76 A;  2V6K A;  2C0G A;  2EC4 A;  4CY8 A;  2YJ7 A;  3KP9 A;  2H1D A;  2R0C A;  1G6W A;  4RQR A;  2DJ0 A;  2YV7 A;  4O92 A;  2REM A;  4MF6 A;  3HYP A;  1S3R A;  2VLT A;  3D21 A;  5CAX A;  1TJD A;  4F03 A;  5ECS A;  3H79 A;  4X1U A;  3FY7 A;  2LKU A;  3GKN A;  1QXH A;  4KA0 A;  3G7I A;  1NW2 A;  4WF5 A;  2CA8 A;  3M9J A;  2PBJ A;  5ECL B;  3D4T A;  2H30 A;  3FRC A;  1JZD A;  3E3E A;  3GMF A;  3EVI A;  1M3I A;  1M2D A;  2DJK A;  4POL A;  1OC3 A;  2VM2 A;  1XIY A;  2H74 A;  5D96 A;  4V1A p;  2B5Y A;  4CY6 A;  2HRA A;  1ERV A;  5G31 A;  2HI7 A;  2C8U A;  3LGC A;  1JFU A;  4NHW A;  2H6Y A;  2TIR A;  2X4A A;  2NVL A;  2PN8 A;  3ZRE A;  1HD2 A;  1GTU A;  1QK8 A;  4YQV A;  2B7K A;  4GCI A;  3V1W A;  3PPU A;  2GSR A;  4IQA A;  1XWK A;  6GSV A;  1E6B A;  1TDI A;  2C3Q A;  3IK7 A;  3FYG A;  2OAC A;  3IXR A;  1FB6 A;  4BL7 B;  1PX6 A;  1YEX A;  2QGV A;  1PA3 A;  2WGR A;  1XVW A;  4FYC A;  4K7I A;  4PNF A;  1B48 A;  1K3Y A;  5IMV A;  2IN3 A;  4ID0 A;  4X0X A;  1XXU A;  2PWJ A;  1AXD A;  1K0N A;  5IMF A;  3VK9 A;  5CP1 A;  4PX1 A;  2A2S A;  4POM A;  3TKP A;  4KW6 A;  2ZCT A;  4LLR A;  2DBC A;  2A2R A;  2D2Z A;  2HZE B;  2I1U A;  3N9J A;  5LNK e;  2P5Q A;  2P31 A;  3VWW A;  4BL7 A;  2FA4 A;  1PL2 A;  5D9V A;  2VCW A;  4L0W A;  2KP1 A;  4A5P A;  2YWN A;  1SD9 A;  5J4U A;  2K18 A;  1SKW B;  3LFL A;  5KOX A;  3IE3 A;  2ZUP A;  3C8E A;  3DD3 A;  4E8H A;  4HSC X;  4JR4 A;  1V58 A;  5IPH A;  2CV4 A;  5DQS A;  3RAZ A;  1M9A A;  3KEB A;  3M0F A;  1HNC A;  4J56 E;  1R5P A;  2X64 A;  3CSJ A;  3PGT A;  1EGO A;  3GX8 A;  1V57 A;  2OE0 A;  2H75 A;  5IMA A;  2YOI A;  2JZR A;  3F4R A;  4ZB6 A;  4N10 A;  2PMT A;  4MZB A;  1QUW A;  1XVQ A;  2C80 A;  3GUS A;  3VWX A;  2GST A;  4GQF A;  1M3J A;  1FOV A;  6GSW A;  2DKI A;  1AQW A;  1E2Y A;  3TJJ A;  1DBY A;  2IIY A;  2K8S A;  4N0Z A;  2NTO A;  2LV3 A;  5DCG A;  3JCM L;  3GHA A;  5A4U A;  2MMO A;  1SL0 B;  1QQ2 A;  3WGD A;  2DJ3 A;  3G7J A;  3ZRD A;  1M0U A;  2GZZ A;  4POB A;  2CVK A;  4GXZ A;  2AB6 A;  6GSY A;  3EE2 A;  1A2L A;  4GSN A;  5IIZ A;  4TKY A;  4TXV A;  4MF5 A;  1SK0 A;  1XW5 A;  3LXT A;  6GSU A;  3TB2 A;  3H8Q A;  2FNO A;  3UAR A;  3RBT A;  2A4H A;  4BVX B;  4WXT A;  1WRY A;  5HR1 A;  2AJQ B;  5B8B A;  4GSS A;  5G1L A;  2IFQ A;  2YV9 A;  1YY7 A;  1F3A A;  3MYD A;  2LS5 A;  4Q5Q A;  1TU7 A;  3Q74 A;  3TJF A;  4I2T A;  1AW9 A;  1URM A;  3A2X A;  1PD2 1;  1Z6M A;  3KTB A;  1Z5Y E;  2X8H A;  3QPM A;  3AY8 A;  4JZQ A;  4TR0 A;  2AUV A;  5DBQ A;  2MMN A;  1FG4 A;  3P2A A;  5F07 A;  5F06 A;  4MA9 A;  2KOK A;  3C71 A;  3LYK A;  3E0U A;  4G2E A;  4CHS A;  4MZW A;  4KX4 A;  4HI7 A;  7GSS A;  3GIX A;  5DAL B;  2HXK A;  1BX9 A;  4EDY A;  3ZYW A;  1GP1 A;  2YJH A;  3DGQ A;  3KD0 A;  4O5R A;  1ZYP A;  2YNX A;  1GUM A;  2MZC A;  4G0L A;  3RHC A;  5CO3 A;  3TUE A;  1V2A A;  4HZ4 A;  3UOM A;  1GLP A;  1EP7 A;  5A4V A;  4LA1 A;  2YN1 A;  1GNW A;  2LRN A;  3S9F A;  2VLV A;  5IPG A;  2IMD A;  4MJE A;  4Q5N A;  2MYG A;  4OD7 A;  2ZNM A;  2XC2 A;  3VUR A;  4ZBB A;  1FW1 A;  2WFC A;  4ZBA A;  2R3X A;  4YKG A;  4EL1 A;  1QGV A;  4FH8 A;  4ZXG A;  5C04 A;  2H0I A;  1MDJ A;  5C00 A;  2LNS A;  4QL7 A;  2FHE A;  3FR3 A;  4ZIJ A;  3GKM A;  3LWA A;  3HVX A;  3Q19 A;  1WMJ A;  2M46 A;  5J3R A;  1LU4 A;  1DE2 A;  2ES7 A;  1F9M A;  3O6T A;  4MJC A;  1U6T A;  4XS1 A;  1AUC A;  2LJK A;  2H72 A;  1K3L A;  2IMF A;  1XOB A;  4K6X A;  3GNJ A;  4N0V A;  4POK A;  2EIO A;  1ZZY A;  1T4Y A;  1X0R A;  3KXO A;  2R2J A;  2GS3 A;  2AV4 A;  2BJX A;  2VL3 A;  1G0T A;  1SYX A;  2P5R A;  3L9U A;  3IBH A;  5HQP A;  1R4W A;  1WPI A;  2X8G A;  3CXG A;  2DSA A;  4GST A;  1ZGN A;  4PUR A;  4MPG A;  1S3A A;  18GS A;  1VF4 A;  1OYJ A;  4OFN A;  4X43 A;  1A8Y A;  3H93 A;  5KN2 A;  4HDE A;  3D6I A;  4PQH A;  2RM6 A;  3K8N A;  3MSZ A;  4F0B A;  1BYE A;  5AIX A;  2L5L A;  4YQU A;  3GSS A;  2YZH A;  1EOH A;  1CQH A;  1EP8 A;  3ZML A;  2G0F A;  5JCU A;  4EC0 A;  1ZYE A;  2VIM A;  1FB0 A;  4DSS B;  3TDG A;  1MD3 A;  3LEF A;  4TN8 A;  4EKZ A;  3ZIJ A;  4HQZ A;  3VFI A;  2MBT A;  2OE3 A;  1Y25 A;  1MD4 A;  3FK8 A;  5HFK A;  2M80 A;  1GSD A;  4IP6 A;  5JWQ B;  4WET A;  1VF2 A;  1GUL A;  4PGT A;  5H5R A;  4FYU A;  4IEL A;  3TJG A;  1HYU A;  2YP6 A;  1V40 A;  4ML6 A;  2V2G A;  4WR4 A;  1WWJ A;  4F9Z A;  1GSS A;  1YQ1 A;  2QC7 A;  3GN3 A;  2YCD A;  4DSS A;  4PUF C;  5ECO B;  2CVD A;  1XFL A;  3HJP A;  5LCZ A;  2NBS A;  4G0K A;  1MDI A;  3KJY A;  3EUR A;  4MCU A;  3QAV A;  2PUK C;  3HJM A;  1XW9 A;  1C72 A;  2X49 A;  3EMX A;  4I5Q A;  2C1Y A;  4NXI A;  2WJU A;  2M72 A;  4KSO A;  3UIW A;  5IM9 A;  1GWC A;  1W89 A;  4IJI A;  3ZFL A;  2NPB A;  2O85 A;  4LMW A;  4K7N A;  3ZIT A;  2C0D A;  2VD1 A;  5DDL A;  1T4Z A;  2OA7 A;  2QA2 A;  2VM1 A;  3F3Q A;  2LNT A;  3MIX A;  2J23 A;  1DUG A;  3QAG A;  4EO3 A;  2GSQ A;  1FO5 A;  3US3 A;  2FWH A;  5COH A;  4MP4 A;  1F3B A;  4MZC A;  1CQG A;  2G2Q A;  2RM5 A;  1Z7R A;  4OFM A;  4K2D A;  1K3O A;  2LJA A;  1A2M A;  3EWL A;  3CTG A;  2AYT A;  2XBI A;  3PIN A;  3UL3 A;  5A4W A;  3F0I A;  5HFI A;  1OAZ A;  3RDW A;  2R4V A;  4V2M A;  2F51 A;  3M8N A;  3LXZ A;  3L78 A;  2B5E A;  1G7O A;  5CYY A;  3W8S A;  1K0M A;  3QFA C;  3HJO A;  2GT5 A;  5H5S A;  3F3R A;  3LJR A;  1O73 A;  1XWA A;  1ERT A;  1BQ7 A;  1S3C A;  3F4T A;  2YWI A;  4F2I A;  3BBY A;  2H19 A; 
#chains in the Genus database with same CATH homology
 2DC5 A;  3TRX A;  2VD0 A;  4XTS A;  2RLI A;  1TP9 A;  2ON7 A;  3F6F A;  1GL8 A;  3I43 A;  5CRG A;  5IO0 A;  2O87 A;  4YAV A;  3BJ5 A;  4KND A;  4ECI A;  2C3N A;  4PTS A;  5F05 A;  4OCF A;  1M2A A;  4JBB A;  1ILO A;  1SKS B;  4WR5 A;  2TRC P;  1XBS A;  2CVB A;  4KH7 A;  4L0U A;  22GS A;  1MDK A;  2A4V A;  2DKH A;  2I81 A;  2QA1 A;  3TKQ A;  4WF4 A;  2DJ2 A;  4BWQ A;  2FD3 A;  1EV9 A;  4XRD A;  2VL2 A;  4KDY A;  2PU9 C;  3Q18 A;  4ILF A;  3TOT A;  2CAQ A;  3TKS C;  3HZ8 A;  1A24 A;  5HFG A;  4JRR A;  1SU9 A;  3G9B A;  4KCA A;  2JU5 A;  4G9H A;  1SJI A;  6GST A;  1Z6N A;  4MMM A;  1XWC A;  3IRA A;  2R6K A;  1F37 A;  4ICY A;  5DQY A;  2I4A A;  3IPZ A;  3MDK A;  1TW9 A;  1YZX A;  3I69 A;  5IOX A;  2HZF A;  2XPD A;  4EUY A;  1I9D A;  1K0D A;  4YKF A;  2CAI A;  4XHM A;  6GSS A;  3GA4 A;  3GUR A;  5J5N A;  2JSY A;  2X8C A;  4G0I A;  1WJK A;  2GQL A;  4TRX A;  4WBJ A;  1XPV A;  5ECR B;  3F6D A;  3P8W A;  4KF9 A;  2LQQ A;  4NAX A;  2VCZ A;  1ERW A;  4L5O A;  3UBL A;  1ZYQ B;  4OO4 A;  2C3T A;  1Z7P A;  2GQM A;  2JZS A;  17GS A;  3RPN A;  3LOR A;  3EU3 A;  1MTC A;  1FVJ A;  4EE0 A;  3D0Z A;  1ZYN A;  3APQ A;  3PR8 A;  2V32 A;  4TXO B;  4MF7 A;  1K0C A;  2H01 A;  3QDN A;  2XHF A;  1UC7 A;  5EL8 A;  4NWY A;  4OWY A;  1B4P A;  5ELG A;  2E0Q A;  2HSH A;  3VI5 A;  1YEP A;  3GH6 A;  4K0G A;  4F0C A;  3LW9 A;  4D73 B;  2L57 A;  4FQU A;  1GSU A;  1TI3 A;  3GL5 A;  2H71 A;  1B9Y C;  3R3E A;  3D5J A;  2I9H A;  3CBU A;  4TXO A;  4GLT A;  3GTU A;  2YAN A;  5IO2 A;  2H66 A;  2IME A;  3HVV A;  1O6J A;  3EYT A;  3F63 A;  10GS A;  2H8L A;  3GYK A;  1PSQ A;  3MNG A;  3O3T A;  1VRS D;  5G1K A;  1BAY A;  3TKS A;  3VWU A;  1O8X A;  4D73 A;  1EWX A;  3QMX A;  1MEK A;  2RII A;  5F8B A;  5KN1 A;  1W4V A;  5G5F A;  3DYR A;  1GLQ A;  2DJJ A;  5IOW A;  1O85 A;  3HHV A;  1RQM A;  3KGK A;  5GSS A;  1ST9 A;  1UVZ A;  3I9V 2;  2DML A;  4MLY A;  3APO A;  2F3M A;  2WB9 A;  2UZ8 A;  1FHE A;  3C7M A;  1AAZ A;  1HNB A;  1Q98 A;  2IFQ B;  1KTE A;  4XS6 A;  3A2W A;  3UMA A;  3M3M A;  1PN9 A;  1PL1 A;  3FW2 A;  5L71 A;  3TJK A;  5ECP B;  4KGI A;  2PVO C;  5HR3 A;  2HRK A;  4X4J A;  5CRE A;  2O7K A;  5ID2 A;  1TRV A;  1GUK A;  4K9Z A;  4ISD A;  2JZT A;  1A0R P;  3ISO A;  3KP8 A;  1NHO A;  5DAK B;  3G7Y A;  2DLX A;  3FEU A;  3A3T A;  3ZIV A;  3GL3 A;  2PGT A;  3NIV A;  3CTF A;  1AIU A;  2DJ1 A;  5FT3 A;  2E7P A;  2HLS A;  1OKD A;  3GH9 A;  4ECC A;  2CQ9 A;  3QOU A;  1R5A A;  2PPT A;  2F9S A;  5DJL A;  4KCE A;  2RUE A;  3I6A A;  1T7P B;  2IL3 A;  2WUL A;  3LSZ A;  5DAK A;  4V1A g;  2YWM A;  4V2N A;  2XPE A;  4YH2 A;  5D9W A;  2FGX A;  2EIQ A;  4WEY A;  1X9W B;  2C0E A;  5AIV A;  3CMI A;  4MH3 A;  3UVH A;  1ZMA A;  1TXX A;  1OE7 A;  4JE1 A;  5G30 A;  3KCM A;  3HVS A;  3DML A;  1K0B A;  3DWV A;  1SYR A;  1GNE A;  3WD6 A;  4MDC A;  4Q5R A;  1PRX A;  3FR6 A;  5B6N A;  1A0F A;  3ZLP A;  2FLS A;  1A8L A;  1DSB A;  5KN3 A;  1U88 A;  4I6X A;  2H1B A;  3H1N A;  3HZ4 A;  1X9S B;  4LMV A;  3KM6 A;  3HXS A;  3UBK A;  3IOS A;  3SBC A;  2VOC A;  3DKS A;  3ZL5 A;  3D22 A;  4OCE A;  1GH2 A;  3TKS E;  2L4Q A;  3ERF A;  3W8J A;  1M9B A;  2GT6 A;  3CRU A;  2CX3 A;  3GKK A;  4HOJ A;  1HNA A;  4MAB A;  5J41 A;  1AQX A;  4H86 A;  1GSF A;  4JED A;  2B1K A;  2VCT A;  5KOW A;  2AAW A;  5J9B A;  2VAF A;  1ACV A;  4PXO A;  4XCS A;  2VUP A;  1PGT A;  4FYB A;  1WIK A;  3IAM 2;  2YWO A;  4XS4 B;  1YF1 A;  4IP1 A;  5DCH A;  3ZVJ D;  2LRC A;  1JZR A;  2A2P A;  2TRX A;  4K8M A;  1ZL9 A;  4F82 A;  2L4C A;  1JLW A;  2F8F A;  4EVM A;  4IKH A;  1X9M B;  1PQN A;  4MH2 A;  3TJB A;  4YQM A;  1NHY A;  4ZIL A;  4XIH A;  5AIS A;  4XS4 A;  4N30 A;  3UVT A;  4QL9 A;  2FWG A;  3IK9 A;  4EXJ A;  4BPY A;  3F4S A;  1AQV A;  3QD9 A;  2IPA A;  3F8U A;  1LJR A;  1TRU A;  3BOA A;  2VCX A;  4HU7 A;  1GTI A;  4L5L A;  4K5R A;  2LRT A;  4KE3 A;  4V2L A;  5IQY A;  3ERW A;  2AHE A;  1B9X C;  2BTO T;  1TI1 A;  3HDC A;  2L5O A;  4E8E A;  1KEB A;  2CZ2 A;  3BCK A;  1DE1 A;  3CYN A;  5D8I A;  1FOH A;  4BVY A;  5JCG A;  5ECI B;  4AGS A;  2FWE A;  4Z7X A;  2K6V A;  1T3B A;  2IJY A;  2YPM A;  2EIR A;  4AF2 A;  3GST A;  4Z2R A;  1Q4J A;  2HFD A;  5EVO A;  3DIE A;  1T1V A;  4ZL7 A;  3GRX A;  5ELA A;  3GFK A;  2J9H A;  2OE1 A;  1G7E A;  3MWH A;  4ECB A;  4GF0 A;  4HU9 A;  2CT6 A;  5E4W A;  5G5E A;  1JLV A;  1OC9 A;  19GS A;  4EDZ A;  1VGL A;  2F8A A;  3TKR A;  1X5C A;  1J9B A;  3LQ7 A;  3J7Y b;  5A5K A;  4XRA A;  2KLX A;  3D4M A;  1PN0 A;  4ZB8 A;  3ERG A;  4TR4 A;  1XW6 A;  4K1F A;  3KZQ A;  3ME7 A;  1GUH A;  2GVP A;  1TK0 B;  1U87 A;  4IGJ A;  5ABR A;  1TU8 A;  2N5A A;  4FO5 A;  1X5D A;  2HE3 A;  2VL9 A;  4TW5 A;  2GGT A;  3UEM A;  2R0P A;  4IVF A;  5ECK B;  1G6Y A;  3QCP A;  1THO A;  4RI7 A;  5HR0 A;  3U5R E;  1TK8 B;  3VLN A;  3VWV A;  5DVB A;  2GZP A;  3KH9 A;  2H1G A;  1SK1 A;  3FZA A;  3ME8 A;  4Q5F A;  3UJ1 A;  4ACS A;  4I2U A;  5CNW A;  3ZVJ A;  2MBS A;  4NMU A;  4KSM A;  4MJA A;  3NZN A;  5J9C A;  4GRF A;  3FMW A;  2HYX A;  5B6M A;  4RQX A;  4HS1 A;  3RHB A;  1EEJ A;  2OAD A;  5FWG A;  5AN1 A;  4HUA A;  3P90 A;  1SEN A;  3TRP A;  1XOA A;  4RI6 A;  1LBK A;  1H4O A;  1KBN A;  1YKC A;  4CW9 A;  1U3A A;  1WOU A;  4EIQ A;  9GSS A;  2P0G A;  1RW1 A;  4MJB A;  4RUV A;  4O7H A;  3DVW A;  2GLR A;  3WT1 A;  2Z9S A;  5CRD A;  4HQS A;  2HSY A;  2MMZ A;  1R7H A;  3DEX A;  2KUC A;  1BG5 A;  1USB A;  3IV4 A;  4ZL9 A;  4OO5 A;  4OFT A;  4TVE A;  1H75 A;  4IHU A;  4G19 A;  2WCI A;  1JZO A;  1BJX A;  4DEJ A;  2DMM A;  1F6M C;  16GS A;  4K7O A;  1O81 A;  5KN0 A;  1B8X A;  5GZZ B;  3TOU A;  2KHP A;  2JL4 A;  4WKW A;  1KNG A;  2X99 A;  4ECJ A;  3VI7 A;  5EY6 A;  2B5X A;  2VCV A;  1PKZ A;  4DSQ A;  1PX7 A;  1K0O A;  1A2J A;  1PMT A;  3IAS 2;  1TK5 B;  1Y6E A;  2FWF A;  1EV4 A;  3HCZ A;  4CDO A;  2MMA A;  5H5Q A;  5G2Z A;  4FIW A;  1YDK A;  2B7J A;  2LST A;  3GKX A;  5HR2 A;  4Z2T A;  2HSM A;  2B3S A;  1OVN A;  4P3Y B;  1A23 A;  4ZL8 A;  1YJ6 A;  1Z3E A;  4IN0 A;  3HD5 A;  2LTK A;  3RPP A;  1GTA A;  1I5G A;  3FR9 A;  1OC8 A;  3HKR A;  3FZ4 A;  2OKA A;  3CSI A;  4LL4 B;  2NDO A;  3EIN A;  3GTU B;  3E9J B;  4JR6 A;  8GSS A;  2H1A A;  5IMC A;  4IBP A;  1M99 A;  2PER A;  1GTB A;  3ZMK A;  2HNL A;  2LUS A;  4TOP A;  3ZTL A;  4NHZ A;  5B8A A;  3FKF A;  4MPF A;  1TRS A;  5FHI A;  1Z9H A;  1OE8 A;  3EPT A;  1TRW A;  1V98 A;  2L6D A;  4AJ6 A;  3H4K A;  1THX A;  1XWB A;  2GSS A;  2VO4 A;  2LJR A;  2HZE A;  1T00 A;  5ECN B;  4K2X A;  1WP0 A;  1OKT A;  4IQ1 A;  4YAP A;  3W6G A;  6GSX A;  2L59 A;  1EEM A;  1QFN A;  1BED A;  3WGE A;  1UA5 A;  3F9U A;  11GS A;  1JHB A;  1M2B A;  2N5B A;  3GV1 A;  5ID2 B;  5KEJ A;  4IS0 A;  1SKR B;  1X5E A;  3MAK A;  3WGX A;  3WT2 A;  4USS A;  2H76 A;  4PQI A;  1NM3 A;  5B7C A;  1GSY A;  3NOF A;  3PH9 A;  1AC1 A;  5EPF A;  3KTL A;  2C4J A;  1SK2 A;  2O8V B;  3TCO A;  4ZBD A;  1QMV A;  3TGZ A;  1ZCP A;  4KAE A;  2E2M A;  3C1S A;  2KP2 A;  3R2Q A;  4O32 A;  5CRH A;  2R37 A;  2BMX A;  3CRT A;  1EZK A;  2ALB A;  3EMP A;  2FA8 A;  2HRN A;  3P7X A;  2E2G A;  2OBI A;  2H6X A;  3M1G A;  2R5G A;  3LG6 A;  4HJM A;  3A5W A;  2LEG A;  3EC3 A;  1S3D A;  3DVX A;  5ECM B;  2WZ9 A;  2YZU A;  4EF0 A;  1J0F A;  4GWR A;  3TRQ A;  2QKE A;  4KDX A;  1M7T A;  5ECQ B;  4IW9 A;  5BRT A;  1ERU A;  3KMO A;  3IC8 A;  4I97 A;  1EOG A;  4MK3 A;  3IC4 A;  4BVX A;  2IMI A;  2GQK A;  4J57 E;  2XBQ A;  5D9X A;  4GTU A;  2VLU A;  2FY6 A;  2N5F A;  2JAC A;  1SJZ A;  2OJL A;  20GS A;  1SL2 B;  5D93 A;  4TR3 A;  1UN2 A;  4GQC A;  2L6C A;  3IDV A;  1SL1 B;  4LL1 B;  1GSQ A;  2WDU A;  1ML6 A;  1SJ6 A;  1HQO A;  4I8B A;  1TKD B;  1O7U A;  1F2E A;  1K0A A;  2GZY A;  4JU5 A;  3ED3 A;  4KDU A;  5DJM A;  2R0G A;  3BCI A;  4PUA A;  4Z2U A;  2IWT A;  1VF3 A;  4BA7 A;  5D73 A;  2C0F A;  1GRX A;  3IA1 A;  1YF0 A;  2H73 A;  5DAL A;  4KB3 A;  3IHQ A;  2ON5 A;  4KUN A;  1JZW A;  3VPT A;  1YKA A;  3HA9 A;  1XZO A;  1NSW A;  5GAP D;  4DVC A;  4O5Q A;  2IMK A;  1SD8 A;  2B6M A;  4ML1 A;  1FVK A;  2K9F A;  3APS A;  2H0G A;  3QR6 A;  2WS2 A;  5E59 A;  5CRW A;  5IMZ A;  1IYI A;  2K8V A;  4AJ7 A;  2VCQ A;  4AJ8 A;  4N11 A;  2H0H A;  2DIY A;  2H6Z A;  3ZFB A;  3SWL A;  5JWR B;  5ENU A;  2RUF A;  14GS A;  3Q6O A;  5LD0 A;  3A5I A;  1T8E B;  1B4Q A;  4BVY B;  2B1L A;  2JAD A;  5AGY A;  1TOF A;  3VPQ A;  3ZZX A;  4QQ7 A;  4ULX A;  2PVQ A;  1ABA A;  3KH7 A;  4NV2 A;  3J7Y k;  4BWS A;  3M9K A;  3UAP A;  4HEA 2;  4TR1 B;  4WBR D;  3FHK A;  4L8E A;  2HRF A;  3GX0 A;  3CSH A;  3OR5 A;  5IMD A;  3LYP A;  2FUG 2;  1ZOF A;  1R26 A;  3WYW A;  4O5U A;  2I3Y A;  1PKW A;  3A2V A;  1OC9 B;  4ZB9 A;  2H70 A;  13GS A;  5JCW A;  1XWG A;  3FZ9 A;  4K5S A;  3C73 A;  3L9V A;  5D9T A;  2CZ3 A;  4NV5 A;  4PQ1 A;  4J2F A;  1V9W A;  2QSI A;  5F0G A;  2OBK A;  2WRT A;  5ECH B;  3DXB A;  4TR1 A;  5GAN D;  1N8J A;  2JSZ A;  1TTZ A;  2HT9 A;  1VF1 A;  4K0N A;  4HZ2 A;  2LQO A;  1RK4 A;  1XCC A;  4NPB A;  1O8W A;  2V41 A;  3IR4 A;  2FCH A;  3DRN A;  3KMN A;  3KIJ A;  4PNG A;  2V1M A;  3U6V A;  4EIP A;  3L0H A;  4MNN A;  1WE0 A;  5INY A;  1N2A A;  1U3I A;  5JWO B;  3BD2 A;  2VL2 C;  3HY2 A;  3N5O A;  1GSE A;  1FAA A;  3QAW A;  2GTU A;  4G10 A;  1J08 A;  1ON4 A;  4DSR A;  2GDR A;  4IJ3 A;  5BMU A;  2DIZ A;  2O89 A;  1EGR A;  2CX4 A;  3L4N A;  3IHG A;  12GS A;  3L9S A;  4HJ2 A;  3C1R A;  2V6O A;  4OMV A;  5GST A;  3QFB C;  1IYH A;  3EU4 A;  3FZ5 A;  3O76 A;  2V6K A;  2C0G A;  2EC4 A;  4CY8 A;  2YJ7 A;  3KP9 A;  2H1D A;  2R0C A;  1G6W A;  4RQR A;  2DJ0 A;  2YV7 A;  4O92 A;  2REM A;  4MF6 A;  3HYP A;  2VLT A;  3D21 A;  5CAX A;  1TJD A;  4F03 A;  5ECS A;  3H79 A;  4X1U A;  3FY7 A;  2LKU A;  3GKN A;  1QXH A;  4KA0 A;  3G7I A;  1NW2 A;  4WF5 A;  2CA8 A;  3M9J A;  2PBJ A;  5ECL B;  3D4T A;  2H30 A;  3FRC A;  1JZD A;  3E3E A;  3GMF A;  3EVI A;  1M2D A;  2DJK A;  4POL A;  1OC3 A;  2VM2 A;  1XIY A;  2H74 A;  5D96 A;  4V1A p;  2B5Y A;  4CY6 A;  2HRA A;  1ERV A;  5G31 A;  2HI7 A;  2C8U A;  3LGC A;  1JFU A;  4NHW A;  2H6Y A;  2TIR A;  2X4A A;  2NVL A;  2PN8 A;  3ZRE A;  1HD2 A;  1GTU A;  1QK8 A;  4YQV A;  2B7K A;  4GCI A;  3V1W A;  3PPU A;  2GSR A;  4IQA A;  1XWK A;  6GSV A;  1E6B A;  1TDI A;  2C3Q A;  3IK7 A;  3FYG A;  2OAC A;  3IXR A;  1FB6 A;  4BL7 B;  1PX6 A;  1YEX A;  2QGV A;  1PA3 A;  2WGR A;  1XVW A;  4FYC A;  4K7I A;  4PNF A;  1B48 A;  1K3Y A;  5IMV A;  2IN3 A;  4ID0 A;  4X0X A;  1XXU A;  2PWJ A;  1AXD A;  1K0N A;  5IMF A;  3VK9 A;  5CP1 A;  4PX1 A;  2A2S A;  4POM A;  3TKP A;  4KW6 A;  2ZCT A;  4LLR A;  2DBC A;  2A2R A;  2D2Z A;  2HZE B;  2I1U A;  3N9J A;  5LNK e;  2P5Q A;  2P31 A;  3VWW A;  4BL7 A;  2FA4 A;  1PL2 A;  5D9V A;  2VCW A;  4L0W A;  2KP1 A;  4A5P A;  2YWN A;  1SD9 A;  5J4U A;  2K18 A;  1SKW B;  3LFL A;  5KOX A;  3IE3 A;  2ZUP A;  3C8E A;  3DD3 A;  4E8H A;  4JR4 A;  1V58 A;  5IPH A;  2CV4 A;  5DQS A;  3RAZ A;  1M9A A;  3KEB A;  3M0F A;  1HNC A;  4J56 E;  1R5P A;  2X64 A;  3CSJ A;  3PGT A;  1EGO A;  3GX8 A;  1V57 A;  2OE0 A;  2H75 A;  5IMA A;  2YOI A;  2JZR A;  3F4R A;  4ZB6 A;  4N10 A;  2PMT A;  4MZB A;  1QUW A;  1XVQ A;  2C80 A;  3GUS A;  3VWX A;  2GST A;  4GQF A;  1FOV A;  6GSW A;  2DKI A;  1AQW A;  1E2Y A;  3TJJ A;  1DBY A;  2IIY A;  2K8S A;  4N0Z A;  2NTO A;  2LV3 A;  5DCG A;  3JCM L;  3GHA A;  5A4U A;  2MMO A;  1SL0 B;  1QQ2 A;  3WGD A;  2DJ3 A;  3G7J A;  3ZRD A;  1M0U A;  2GZZ A;  4POB A;  2CVK A;  4GXZ A;  2AB6 A;  6GSY A;  3EE2 A;  1A2L A;  4GSN A;  5IIZ A;  4TKY A;  4TXV A;  4MF5 A;  1SK0 A;  1XW5 A;  3LXT A;  6GSU A;  3TB2 A;  3H8Q A;  2FNO A;  3UAR A;  3RBT A;  2A4H A;  4BVX B;  4WXT A;  1WRY A;  5HR1 A;  2AJQ B;  5B8B A;  4GSS A;  5G1L A;  2IFQ A;  2YV9 A;  1YY7 A;  1F3A A;  3MYD A;  2LS5 A;  4Q5Q A;  1TU7 A;  3Q74 A;  3TJF A;  4I2T A;  1AW9 A;  1URM A;  3A2X A;  1PD2 1;  1Z6M A;  3KTB A;  1Z5Y E;  2X8H A;  3QPM A;  3AY8 A;  4JZQ A;  4TR0 A;  2AUV A;  5DBQ A;  2MMN A;  1FG4 A;  3P2A A;  5F07 A;  5F06 A;  4MA9 A;  2KOK A;  3C71 A;  3LYK A;  3E0U A;  4G2E A;  4CHS A;  4MZW A;  4KX4 A;  4HI7 A;  7GSS A;  3GIX A;  5DAL B;  2HXK A;  1BX9 A;  4EDY A;  3ZYW A;  1GP1 A;  2YJH A;  3DGQ A;  3KD0 A;  4O5R A;  1ZYP A;  2YNX A;  1GUM A;  2MZC A;  4G0L A;  3RHC A;  5CO3 A;  3TUE A;  1V2A A;  4HZ4 A;  3UOM A;  1GLP A;  1EP7 A;  5A4V A;  4LA1 A;  2YN1 A;  1GNW A;  2LRN A;  3S9F A;  2VLV A;  5IPG A;  2IMD A;  4MJE A;  4Q5N A;  2MYG A;  4OD7 A;  2ZNM A;  2XC2 A;  3VUR A;  4ZBB A;  1FW1 A;  2WFC A;  4ZBA A;  2R3X A;  4YKG A;  4EL1 A;  1QGV A;  4FH8 A;  4ZXG A;  5C04 A;  2H0I A;  1MDJ A;  5C00 A;  2LNS A;  4QL7 A;  2FHE A;  3FR3 A;  4ZIJ A;  3GKM A;  3LWA A;  3HVX A;  3Q19 A;  1WMJ A;  2M46 A;  5J3R A;  1LU4 A;  1DE2 A;  2ES7 A;  1F9M A;  3O6T A;  4MJC A;  1U6T A;  4XS1 A;  1AUC A;  2LJK A;  2H72 A;  1K3L A;  2IMF A;  1XOB A;  4K6X A;  3GNJ A;  4N0V A;  4POK A;  2EIO A;  1ZZY A;  1T4Y A;  1X0R A;  3KXO A;  2R2J A;  2GS3 A;  2AV4 A;  2BJX A;  2VL3 A;  1G0T A;  1SYX A;  2P5R A;  3L9U A;  3IBH A;  5HQP A;  1R4W A;  1WPI A;  2X8G A;  3CXG A;  2DSA A;  4GST A;  1ZGN A;  4PUR A;  4MPG A;  1S3A A;  18GS A;  1VF4 A;  1OYJ A;  4OFN A;  4X43 A;  1A8Y A;  3H93 A;  5KN2 A;  4HDE A;  3D6I A;  4PQH A;  2RM6 A;  3K8N A;  3MSZ A;  4F0B A;  1BYE A;  5AIX A;  2L5L A;  4YQU A;  3GSS A;  2YZH A;  1EOH A;  1CQH A;  1EP8 A;  3ZML A;  2G0F A;  5JCU A;  4EC0 A;  1ZYE A;  2VIM A;  1FB0 A;  4DSS B;  3TDG A;  1MD3 A;  3LEF A;  4TN8 A;  4EKZ A;  3ZIJ A;  4HQZ A;  3VFI A;  2MBT A;  2OE3 A;  1Y25 A;  1MD4 A;  3FK8 A;  5HFK A;  2M80 A;  1GSD A;  4IP6 A;  5JWQ B;  4WET A;  1VF2 A;  1GUL A;  4PGT A;  5H5R A;  4FYU A;  4IEL A;  3TJG A;  1HYU A;  2YP6 A;  1V40 A;  4ML6 A;  2V2G A;  4WR4 A;  1WWJ A;  4F9Z A;  1GSS A;  1YQ1 A;  2QC7 A;  3GN3 A;  2YCD A;  4DSS A;  4PUF C;  5ECO B;  2CVD A;  1XFL A;  3HJP A;  5LCZ A;  2NBS A;  4G0K A;  1MDI A;  3KJY A;  3EUR A;  4MCU A;  3QAV A;  2PUK C;  3HJM A;  1XW9 A;  1C72 A;  2X49 A;  3EMX A;  4I5Q A;  2C1Y A;  4NXI A;  2WJU A;  2M72 A;  4KSO A;  3UIW A;  5IM9 A;  1GWC A;  1W89 A;  4IJI A;  3ZFL A;  2NPB A;  2O85 A;  4LMW A;  4K7N A;  3ZIT A;  2C0D A;  2VD1 A;  5DDL A;  1T4Z A;  2OA7 A;  2QA2 A;  2VM1 A;  3F3Q A;  2LNT A;  3MIX A;  2J23 A;  1DUG A;  3QAG A;  4EO3 A;  2GSQ A;  1FO5 A;  3US3 A;  2FWH A;  5COH A;  4MP4 A;  1F3B A;  4MZC A;  1CQG A;  2G2Q A;  2RM5 A;  1Z7R A;  4OFM A;  4K2D A;  1K3O A;  2LJA A;  1A2M A;  3EWL A;  3CTG A;  2AYT A;  2XBI A;  3PIN A;  3UL3 A;  5A4W A;  3F0I A;  5HFI A;  1OAZ A;  3RDW A;  2R4V A;  4V2M A;  2F51 A;  3M8N A;  3LXZ A;  3L78 A;  2B5E A;  1G7O A;  5CYY A;  3W8S A;  1K0M A;  3QFA C;  3HJO A;  2GT5 A;  5H5S A;  3F3R A;  3LJR A;  1O73 A;  1XWA A;  1ERT A;  1BQ7 A;  1S3C A;  3F4T A;  2YWI A;  4F2I A;  3BBY A;  2H19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...