3NZNA

The crystal structure of the glutaredoxin from methanosarcina mazei go1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
SNAVNLFGQKDRGNHVSGVDRGKVIMYGLSTCVWCKKTKKLLTDLGVDFDYVYVDRLEGKEEEEAVEEVRRFNPSVSFPTTIINDEKAIVGFKEKEIRESLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin
publication title The crystal structure of the Glutaredoxin from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
total genus 27
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3nznA00
2H0GA 2V2GA 3ZTLA 1GWCA 4IVFA 1OYJA 2GGTA 4KCEA 4OCFA 1XPVA 3UIWA 4DSRA 3LYKA 4O7HA 1FB0A 1OE8A 4RI6A 1V2AA 3FZ4A 2K8VA 1OKDA 4GRFA 4ECBA 1F3AA 3CRUA 4K2DA 4EVMA 4IBPA 5IMVA 5HR2A 3DRNA 1TK8B 4NXIA 4GLTA 1PSQA 5A4VA 1XOBA 2H1GA 2WZ9A 3G7JA 4RUVA 1BEDA 2HZEA 4JR4A 4OWYA 3ZVJA 2O89A 3DD3A 2PN8A 1SENA 5JWQB 6GSVA 2X8CA 2DIZA 3LEFA 5CP1A 2LJRA 3KP8A 2CVBA 4NV5A 1X5EA 2WFCA 3F4TA 3F8UA 5HFIA 1K0DA 3TJGA 2A4VA 5INYA 3VPQA 5IOXA 1VRSD 2C0FA 3IR4A 2CT6A 3H79A 2H1DA 5IO0A 4I2UA 4G9HA 3IRAA 1LU4A 3MAKA 2JSZA 4TW5A 4IHUA 2CQ9A 3HY2A 1S3DA 3P8WA 4D73B 2MMAA 1B9XC 3LXZA 1ILOA 4NMUA 2B5XA 3O6TA 3QAVA 1XVQA 3LWAA 3CTFA 2GQLA 4F0BA 1EEMA 1A2LA 5IPGA 5JWRB 3A2VA 3ME8A 4PX1A 1J9BA 3MSZA 5G1LA 2PPTA 2X64A 4MZWA 2GQMA 3F3QA 2VM1A 1SU9A 1W89A 5F06A 3HYPA 5H5QA 2DJ2A 1HNAA 5E59A 2HZFA 2LJAA 2LQQA 2HYXA 2JADA 2M46A 1M9AA 1CQHA 3HXSA 4TR0A 3PH9A 2YP6A 4WF4A 1PKWA 1URMA 2OE1A 2TRXA 4TR1A 1GUMA 4BVYA 1WP0A 2VD1A 1XW6A 4HEA2 5J41A 4KDYA 2H6XA 1AW9A 4J2FA 2GSQA 1OE7A 3DXBA 3HKRA 1WE0A 2H6YA 4PUAA 2PVQA 4WBRD 5KN1A 1EZKA 2L5LA 3UOMA 3M1GA 4GWRA 5D93A 1Z7PA 3GKMA 1TI3A 3M0FA 3A3TA 4E8EA 3H4KA 4EXJA 1A2JA 2H6ZA 3GURA 2P0GA 2RM5A 1T4ZA 1TDIA 4J57E 2GQKA 2WGRA 1GTBA 2LRTA 4PQHA 4ZXGA 3HZ4A 1G7OA 1AQVA 5ECOB 3AY8A 2IFQB 4MLYA 5C00A 1K0NA 2P5RA 2YANA 4EUYA 2DIYA 4CHSA 1FB6A 4OFMA 3D4TA 1ZYEA 4V2LA 3EINA 5JCUA 4L0UA 1SL0B 5ID2A 3CTGA 5IO2A 4Q5RA 4AF2A 2VLVA 2WDUA 3H1NA 1O81A 1QK8A 4KDUA 3TJKA 5DALA 2QKEA 1A24A 3Q18A 3D0ZA 1QMVA 3DYRA 4IJ3A 6GSUA 4PQIA 2YOIA 3EVIA 3EMPA 3GUSA 3RAZA 3APQA 3GX0A 3CBUA 3TKSA 1X9MB 3BD2A 1UVZA 1EEJA 5HFGA 2V32A 4MH2A 13GSA 4WR5A 4ZBDA 1X9SB 2VO4A 5ECRB 3QCPA 2IIYA 2LUSA 1V58A 1T1VA 1E2YA 17GSA 5DJMA 2NVLA 2BTOT 1O8XA 4EC0A 5H5RA 4X0XA 2REMA 3A2WA 1VF3A 2B7JA 2TIRA 3LGCA 4G19A 1DE2A 7GSSA 4ZBAA 2VM2A 2O87A 5ECMB 4KNDA 3DIEA 2HRNA 3ZL5A 3EMXA 1DBYA 3ZVJD 2X8HA 2WS2A 16GSA 2YWMA 4EL1A 3TKSC 2K6VA 5ELAA 4MA9A 2L59A 1MEKA 3HJOA 2FUG2 4RI7A 1R5PA 3F4SA 1WMJA 5KN0A 5CREA 1PA3A 1XWKA 2YWIA 1EWXA 2I3YA 3CYNA 4JU5A 1ZOFA 1G6YA 2H76A 2C80A 5J9CA 2C3TA 4Q5QA 1UC7A 4MPGA 4GXZA 2I81A 1TK5B 4TRXA 4POMA 3WYWA 1ERWA 1OKTA 1TRWA 1O6JA 3HCZA 4WETA 4KX4A 2ZUPA 4GSSA 4ACSA 3TJJA 2I1UA 3GL5A 5A5KA 1GTAA 2FLSA 3F63A 3IK7A 2CV4A 3ISOA 4IW9A 3TJBA 1JZOA 1TU7A 4AJ8A 2B5EA 3FZ9A 3M9JA 3F4RA 5CRWA 4MH3A 2C3NA 4DVCA 3J7Yk 2VL2A 2C0GA 1SKRB 3VWVA 2C0DA 2A2SA 5ECHB 4NWYA 4PNFA 1ON4A 5HR0A 1PKZA 3FKFA 3GHAA 2DJ0A 1F9MA 3FZ5A 1THXA 3G7YA 5AISA 1B48A 5COHA 4ILFA 2VAFA 4E8HA 2DJ1A 4JBBA 1OC3A 4I97A 4MP4A 3VWUA 1GSYA 2KHPA 3RBTA 2VCZA 2AJQB 2C1YA 3QPMA 4IN0A 3Q74A 1WRYA 2CAQA 2GT6A 4OMVA 3UEMA 1VF4A 1KEBA 4ZB8A 5D73A 1WJKA 2H1AA 3GX8A 1GULA 3ED3A 4JR6A 1BYEA 2VL2C 1N8JA 1OC9B 2ALBA 2C4JA 5DCHA 4ZB9A 5GSSA 1EGOA 4MJBA 3GMFA 2JACA 3HA9A 5HR1A 5G30A 5CRDA 1A2MA 2WULA 4P3YB 1BQ7A 4NV2A 4TN8A 1T7PB 3EU3A 2OE3A 2QC7A 3EE2A 2MZCA 2NTOA 1GL8A 4PQ1A 4KW6A 1FG4A 5EVOA 3ERWA 5GZZB 1SYRA 2AUVA 1ZYQB 5DAKB 3NZNA 2N5AA 3L4NA 1X5CA 1TTZA 3LG6A 1T3BA 4HDEA 1YZXA 1YF0A 5KN2A 2K18A 4IQ1A 3U6VA 2HRFA 4I2TA 2E2GA 1OC9A 1UA5A 1WPIA 4EDZA 5GSTA 1USBA 2EIQA 1C72A 4HI7A 2OE0A 4O5RA 14GSA 5A4WA 4AJ6A 2FA8A 1YJ6A 2DBCA 4PGTA 5A4UA 1XW9A 1TXXA 5DAKA 4XTSA 1Z9HA 2JU5A 3IC4A 4XHMA 1X9WB 2NDOA 5FT3A 3LFLA 2DSAA 3ZYWA 1PQNA 4AGSA 5ECQB 1RQMA 1JFUA 4LLRA 4BL7A 1O85A 4POBA 4PURA 1FVKA 4MK3A 1KNGA 1XW5A 1QFNA 1SK2A 3GA4A 1VGLA 1YQ1A 5AN1A 2R3XA 4ID0A 2PMTA 3WT2A 4KDXA 1XWBA 1GP1A 4ZILA 1MD3A 4WKWA 5DVBA 3EWLA 2H70A 3DGQA 1EP8A 2RUEA 11GSA 3TGZA 1NHYA 1MDJA 1XBSA 1Z5YE 2PUKC 3DWVA 4KE3A 1JHBA 4KSOA 1GNWA 1A8LA 1FHEA 4BA7A 1K3OA 2DJJA 1XWGA 1H4OA 2PVOC 3ERGA 5F0GA 3D5JA 2B7KA 3ZFLA 3HHVA 2H8LA 3WGEA 4WF5A 3A5WA 4ZL8A 3QD9A 4MJAA 2XBIA 5B8BA 4G10A 2PU9C 3NOFA 3ZIVA 1FO5A 3APOA 4IKHA 3C71A 12GSA 4V2MA 4H86A 2K8SA 4F82A 4JEDA 1TKDB 3QFAC 1NSWA 3FR9A 3C1RA 4FYUA 3IA1A 1CQGA 2KP2A 3VWWA 3LQ7A 3F6FA 2IJYA 2VCVA 1PX6A 3KTBA 2H72A 1SJZA 2WCIA 1ML6A 1QGVA 2GZZA 1N2AA 2WB9A 2IMFA 4WBJA 2CZ2A 2EC4A 2HT9A 4MZCA 5IMZA 3IBHA 1YDKA 4HUAA 1U3IA 3DVXA 3ME7A 3N5OA 2BMXA 1XOAA 3GRXA 3GSTA 4V1Ag 2V41A 1O73A 2IMEA 4TXVA 3TKQA 4D73A 2GT5A 4CDOA 1AQWA 5ABRA 1SD8A 3KMOA 4MJEA 5ECKB 3I69A 3LORA 3TUEA 2FWEA 2OADA 4Q5FA 1UN2A 1XIYA 2OACA 5B6MA 4EE0A 3C73A 2Z9SA 3UJ1A 4OCEA 2H75A 3TJFA 4I8BA 1YEXA 2ON5A 4ZIJA 2KLXA 1JLWA 4DSSB 5J4UA 3WGDA 3S9FA 4FO5A 1KBNA 3IAS2 5EY6A 3HD5A 4MPFA 4V2NA 1AC1A 4TXOB 4F2IA 3GH6A 4HU7A 4YQMA 3L0HA 1Y6EA 1HQOA 1HNCA 1TRUA 4TKYA 2EIRA 2VOCA 1YY7A 3TCOA 2R5GA 3UL3A 2DJKA 2E0QA 3UAPA 1XWCA 2G0FA 1PL2A 4HOJA 4TVEA 1R7HA 5IPHA 2X8GA 2ES7A 1ERUA 1XWAA 1B4PA 5GAPD 1TOFA 1K0BA 5C04A 4F0CA 1T4YA 3P2AA 1SK0A 4K6XA 1QQ2A 2VD0A 1SL1B 3HZ8A 3GTUB 4EDYA 1EV9A 4XIHA 1SK1A 2MBTA 4DSQA 1THOA 3CSIA 3KEBA 3L9SA 2IFQA 5AIVA 4YAPA 2VUPA 3KIJA 2QSIA 2DC5A 4LA1A 2OJLA 4GSTA 1B9YC 3UVHA 1GLQA 4TXOA 1M0UA 1SL2B 1QUWA 3CSHA 4K7NA 4N0ZA 1FW1A 4BWSA 1ST9A 1Z6MA 2LNSA 5DBQA 4N30A 2GDRA 2L57A 4ZBBA 1SYXA 3TRPA 1K0MA 2XPDA 1R5AA 3I43A 4QQ7A 5KEJA 2F3MA 1GUKA 4XS4B 1BJXA 4POLA 3GL3A 1GTIA 3IDVA 4N11A 3GH9A 4OO5A 4KGIA 4OFTA 3FY7A 1K0OA 1OAZA 5D96A 4ECCA 3APSA 4ZL7A 8GSSA 4MDCA 5G2ZA 2AYTA 3K8NA 1FOVA 1AUCA 1NW2A 1G6WA 3O76A 2BJXA 2FD3A 3CSJA 5F8BA 1G0TA 3MDKA 3ZZXA 5F07A 2XBQA 3O3TA 4HU9A 3FK8A 3P90A 2FNOA 2ZNMA 2VCWA 5D9XA 4PNGA 4NHWA 1SKWB 2JSYA 5IOWA 4GQCA 2CX3A 5ECIB 3NIVA 1PMTA 3CMIA 4EO3A 2E7PA 2CX4A 4RQRA 2HE3A 4JE1A 2XPEA 2V6OA 2R6KA 3P7XA 1R4WA 1TRSA 3VFIA 3EC3A 2B1KA 1A0FA 5G5FA 1M2AA 2IPAA 4NHZA 2IMDA 4K7OA 2I9HA 5IMFA 2H74A 3UBKA 2RM6A 3D22A 5DQSA 2LJKA 2MMNA 1YF1A 4LL4B 4XRAA 2WJUA 1GRXA 1TJDA 3VURA 2H30A 3I6AA 2LTKA 2M80A 5IQYA 1GSQA 2GSSA 3RPNA 4GCIA 3JCML 2LS5A 6GSXA 2H1BA 2VIMA 3GN3A 1ERTA 3EU4A 4K0GA 1QXHA 3IHQA 1IYHA 2F51A 2C8UA 2VCQA 3US3A 3VLNA 4FYBA 2YZUA 1MDKA 2R37A 4L0WA 5CAXA 5FHIA 4K0NA 2CZ3A 2GSTA 3BCIA 3LYPA 3KJYA 5D9VA 2ZCTA 2DJ3A 3J7Yb 3KCMA 2C3QA 3ERFA 1EGRA 1JZRA 3L78A 4Q5NA 1A23A 3OR5A 1LBKA 1BG5A 2JZSA 10GSA 2FWHA 3FYGA 1IYIA 5LCZA 3U5RE 1WWJA 1Q4JA 1Y25A 2IWTA 3D6IA 6GSYA 1M2BA 2YV7A 4JZQA 2AAWA 2ON7A 4X43A 3ZRDA 1AXDA 1GSUA 2LV3A 5JCGA 3FEUA 3RDWA 1U3AA 4WR4A 4FH8A 4NAXA 1J08A 2F8FA 4L5LA 2WRTA 2N5FA 3FHKA 1YKCA 4Z7XA 2FWGA 3E0UA 2YJHA 3FR6A 1LJRA 3UVTA 4FYCA 1GH2A 5FWGA 2GS3A 4AJ7A 3C7MA 3SWLA 1BX9A 1ABAA 3LSZA 3G7IA 4K8MA 5DDLA 3TKSE 3I9V2 1K3LA 1A8YA 3A2XA 2L6DA 4IELA 4KCAA 4LMVA 2IN3A 1T00A 2H71A 4HJ2A 2MMZA 4X1UA 2HZEB 4F03A 9GSSA 4TR3A 4ZL9A 6GSWA 3GSSA 2FHEA 3M3MA 1Z6NA 1DE1A 2HFDA 5G31A 5J9BA 5H5SA 1VF1A 4BVXA 1NHOA 3HJMA 3CRTA 2K9FA 3IV4A 1RK4A 1WOUA 5CO3A 2DMMA 2R4VA 5HR3A 3WT1A 2A2RA 2C0EA 3KM6A 4FIWA 5ECLB 4XRDA 4L5OA 4MABA 1M2DA 2CVDA 1FVJA 2X99A 1PN9A 3BJ5A 3N9JA 4PUFC 1V98A 2O85A 1O7UA 3KH7A 2M72A 1Q98A 1OC8A 3DVWA 1OVNA 5CYYA 2H0HA 1XCCA 1PRXA 3PR8A 4IP6A 2CA8A 2HSYA 2O8VB 2RIIA 3ZIJA 1JZWA 4MF6A 1EOGA 5CRHA 3WGXA 3L9VA 2B3SA 3G9BA 4HS1A 1AIUA 1K0CA 4GF0A 3TB2A 1U87A 3TOUA 3GKXA 5G1KA 4I5QA 3HDCA 3GKKA 5IMCA 2LRCA 2LRNA 4YAVA 1GSEA 2MMOA 2AHEA 4HJMA 2VL3A 3BBYA 4MF7A 4K9ZA 2IL3A 1TU8A 3QAGA 2FCHA 5D9WA 3HJPA 4XCSA 1GSSA 4TR1B 4ISDA 3H8QA 3LXTA 5E4WA 4KH7A 5DJLA 3EYTA 5ECNB 3TRQA 5HFKA 1YEPA 3W6GA 4BWQA 2YWOA 1PGTA 1U6TA 2HXKA 1GUHA 1G7EA 1V40A 4N10A 1JZDA 4BPYA 4IQAA 2LKUA 4QL7A 4O92A 4KB3A 2CVKA 3DKSA 4RQXA 1NM3A 2L5OA 1O8WA 3RPPA 1XZOA 4O32A 5B8AA 5CRGA 4GTUA 5CNWA 4MCUA 2LNTA 2YJ7A 3Q6OA 2R2JA 4IJIA 4LL1B 3VWXA 2P5QA 3ZMKA 1ZCPA 3H93A 1SKSB 1M99A 3TKRA 4IS0A 2YNXA 5JCWA 2IMKA 2PWJA 3GYKA 1TW9A 5D9TA 2F9SA 2CAIA 1F3BA 4CW9A 1I9DA 1GSFA 2GZPA 1R26A 1MD4A 2RLIA 1V9WA 5D8IA 2JZTA 3IXRA 5F05A 5ID2B 1GNEA 5IIZA 4OO4A 2MBSA 3IPZA 1YKAA 4KUNA 4HZ2A 4MF5A 5DALB 4YQUA 5LNKe 3MWHA 1ACVA 3ZMLA 3GFKA 1VF2A 2HLSA 4ML1A 2H01A 19GSA 2J9HA 3IE3A 3KH9A 1AQXA 4HZ4A 3C8EA 3ZITA 1XFLA 3QAWA 4XS6A 1X5DA 3M9KA 3WD6A 4ECIA 5JWOB 2V6KA 4MMMA 2LSTA 2DLXA 2OA7A 3BCKA 3M8NA 3QR6A 3CXGA 1ZMAA 3GV1A 4KA0A 3KD0A 1SJ6A 3UBLA 1X0RA 2LQOA 5AIXA 3UARA 4K1FA 1XVWA 1W4VA 3GNJA 2VCXA 4ULXA 2KUCA 2QGVA 2PERA 1ERVA 1S3CA 4YH2A 3DMLA 3IK9A 2VLTA 4DSSA 3UMAA 1EOHA 1B4QA 1JLVA 4MJCA 1TP9A 3W8SA 1Z3EA 5L71A 4IP1A 6GSSA 1EV4A 2YN1A 3VPTA 2PBJA 3RHBA 1MTCA 1K3YA 2EIOA 1EP7A 1PD21 5ELGA 4QL9A 3QMXA 3TDGA 1ZZYA 2OBKA 1H75A 1FAAA 3DEXA 2L4QA 1GSDA 3QFBC 1KTEA 4I6XA 1ZL9A 2OKAA 3GTUA 2H73A 1SD9A 3IOSA 2IMIA 2NBSA 5ECSA 2LEGA 2GSRA 2XHFA 1BAYA 1F37A 3TRXA 1T8EB 2OBIA 5EL8A 2O7KA 1DUGA 3C1SA 5AGYA 4WEYA 1Z7RA 1PX7A 3V1WA 4N0VA 2H0IA 2B6MA 2PGTA 3FW2A 20GSA 3ZFBA 3ZREA 1J0FA 1K0AA 2TRCP 3HVSA 2VCTA 1AAZA 2G2QA 4KSMA 4XS4A 1HD2A 4POKA 3F3RA 4TOPA 4V1Ap 3QOUA 2I4AA 2DMLA 4J56E 4GSNA 2YWNA 4TR4A 2FA4A 5DQYA 3PINA 2VL9A 3E9JB 3R2QA 3QDNA 2FWFA 3KTLA 5GAND 2FGXA 1DSBA 3FR3A 3GIXA 2HI7A 3D21A 3F6DA 5KN3A 5G5EA 4OD7A 2KOKA 5ECPB 3KGKA 4K7IA 2V1MA 5IMAA 4LMWA 1U88A 1TK0B 3TKPA 3Q19A 4WXTA 5B6NA 3VI5A 2XC2A 3GKNA 4G2EA 3BOAA 2YCDA 2RUFA 3E3EA 1RW1A 2VLUA 3MNGA 2GZYA 1XXUA 2N5BA 4ECJA 3KP9A 2F8AA 2JL4A 1A0RP 5EPFA 1HNBA 1V57A 3HVXA 4JRRA 4PXOA 1F6MC 3FRCA 4IGJA 3W8JA 1F2EA 2E2MA 2FY6A 1B8XA 1HYUA 3KMNA 4ZB6A 2AB6A 4EKZA 1TRVA 1SJIA 5B7CA 3PGTA 3F9UA 4YQVA 4L8EA 3VK9A 3RHCA 3TOTA 5IMDA 5DCGA 4KAEA 4F9ZA 3KZQA 1GTUA 3D4MA 4GQFA 4OFNA 3IAM2 1M7TA 5IM9A 4HQSA 5HQPA 3L9UA 4EF0A 1ZGNA 2GVPA 2YV9A 6GSTA 1E6BA 2GLRA 2D2ZA 2B1LA 2H66A 2L6CA 22GSA 3F0IA 3HVVA 2AV4A 2J23A 1TI1A 2GTUA 1S3AA 2YZHA 2HSHA 2HNLA 1MDIA 1WIKA 4HQZA 3SBCA 18GSA 3VI7A 3ZLPA 1PL1A 5ENUA 3FZAA 2H19A 2NPBA 4NPBA 2P31A 1I5GA 2L4CA 2YPMA 4ML6A 4DEJA 5LD0A 4MZBA 2KP1A 3EURA 5J3RA 5J5NA 2JZRA 2MYGA 4XS1A 3KXOA 1M9BA 3LJRA 2B5YA 1GLPA
chains in the Genus database with same CATH superfamily
2H0GA 2V2GA 3ZTLA 1GWCA 4IVFA 1OYJA 2GGTA 4KCEA 4OCFA 1XPVA 3UIWA 4DSRA 3LYKA 4G0KA 4O7HA 1FB0A 1OE8A 4RI6A 1V2AA 1FOHA 3FZ4A 4PTSA 2K8VA 1OKDA 4GRFA 4ECBA 4ICYA 1F3AA 3CRUA 4K2DA 4EVMA 4IBPA 5IMVA 5HR2A 3DRNA 1TK8B 4NXIA 4GLTA 1PSQA 5A4VA 1XOBA 2H1GA 2WZ9A 3G7JA 4RUVA 1BEDA 2HZEA 4JR4A 4OWYA 3ZVJA 2O89A 3DD3A 2PN8A 1SENA 5JWQB 6GSVA 2X8CA 2DIZA 3LEFA 5CP1A 2LJRA 3KP8A 2CVBA 4NV5A 1X5EA 2WFCA 3F4TA 3F8UA 5HFIA 1K0DA 3TJGA 2A4VA 5INYA 3VPQA 5IOXA 1VRSD 4MNNA 2C0FA 3IR4A 2CT6A 3H79A 2H1DA 4EIPA 5IO0A 4I2UA 4G9HA 3IRAA 1LU4A 3MAKA 2JSZA 4TW5A 4IHUA 2CQ9A 3HY2A 1S3DA 3P8WA 4D73B 2MMAA 1B9XC 3LXZA 1ILOA 4NMUA 2B5XA 3O6TA 3QAVA 1XVQA 3LWAA 3CTFA 2GQLA 4F0BA 1EEMA 1A2LA 5IPGA 5JWRB 3A2VA 3ME8A 4PX1A 1J9BA 3MSZA 5G1LA 2PPTA 2X64A 4MZWA 2GQMA 3F3QA 2VM1A 1SU9A 1W89A 5F06A 3HYPA 5H5QA 2DJ2A 1HNAA 5E59A 2HZFA 2LJAA 2LQQA 2HYXA 2JADA 2M46A 1M9AA 1CQHA 3HXSA 4TR0A 3PH9A 2YP6A 4WF4A 1PKWA 1URMA 2OE1A 2TRXA 4TR1A 1GUMA 4BVYA 1WP0A 2VD1A 1XW6A 4HEA2 5J41A 4KDYA 2H6XA 1AW9A 4USSA 4J2FA 5BMUA 2GSQA 1OE7A 3DXBA 3HKRA 1WE0A 2H6YA 2HSMA 4PUAA 2PVQA 4WBRD 5KN1A 1EZKA 2L5LA 3UOMA 3M1GA 4GWRA 5D93A 1Z7PA 3GKMA 1TI3A 3M0FA 3A3TA 4E8EA 3H4KA 4EXJA 1A2JA 2H6ZA 3GURA 2P0GA 2RM5A 1T4ZA 1TDIA 4J57E 2GQKA 2WGRA 1GTBA 2LRTA 1PN0A 4PQHA 4ZXGA 3HZ4A 1G7OA 1AQVA 5ECOB 3AY8A 2IFQB 4MLYA 5C00A 4Z2TA 1K0NA 2P5RA 2YANA 4EUYA 2DIYA 4CHSA 1FB6A 4OFMA 3D4TA 1ZYEA 4V2LA 3EINA 5JCUA 4L0UA 1SL0B 2X49A 5ID2A 3CTGA 5IO2A 4Q5RA 4AF2A 2VLVA 2WDUA 3H1NA 1O81A 1QK8A 4KDUA 3TJKA 5DALA 2QKEA 1A24A 3Q18A 3D0ZA 1QMVA 3DYRA 4IJ3A 6GSUA 4PQIA 2YOIA 3EVIA 3EMPA 3GUSA 3RAZA 3APQA 3GX0A 3CBUA 3TKSA 1X9MB 3BD2A 1UVZA 1EEJA 5HFGA 4K5SA 2V32A 4MH2A 2A2PA 13GSA 4WR5A 4ZBDA 1X9SB 2VO4A 3QCPA 5ECRB 2IIYA 2LUSA 1V58A 1T1VA 1E2YA 4X4JA 17GSA 5DJMA 2NVLA 2BTOT 1O8XA 4EC0A 5H5RA 4X0XA 2REMA 3A2WA 1VF3A 2B7JA 2TIRA 3LGCA 4G19A 1DE2A 7GSSA 4ZBAA 2VM2A 2O87A 5ECMB 4KNDA 3DIEA 2HRNA 3ZL5A 3EMXA 1DBYA 3ZVJD 2X8HA 2WS2A 16GSA 2YWMA 4EL1A 2DKHA 3TKSC 2K6VA 5ELAA 4MA9A 2L59A 1MEKA 3HJOA 2FUG2 4RI7A 1R5PA 3F4SA 1WMJA 5KN0A 5CREA 1PA3A 1XWKA 2YWIA 1EWXA 2I3YA 3CYNA 4JU5A 1ZOFA 1G6YA 2H76A 2C80A 5J9CA 2C3TA 4Q5QA 1UC7A 4MPGA 4GXZA 2I81A 1TK5B 4TRXA 4POMA 3WYWA 1ERWA 1OKTA 1TRWA 1O6JA 3HCZA 4WETA 4KX4A 2ZUPA 4GSSA 4ACSA 3TJJA 2I1UA 3GL5A 5A5KA 1GTAA 2FLSA 3F63A 3FMWA 3IK7A 2CV4A 3ISOA 4IW9A 3TJBA 4YKGA 1JZOA 1TU7A 4AJ8A 2B5EA 3FZ9A 3M9JA 3F4RA 5CRWA 4MH3A 2C3NA 4DVCA 3J7Yk 2VL2A 2C0GA 1SKRB 3VWVA 2C0DA 2A2SA 5ECHB 4NWYA 4PNFA 1ON4A 5HR0A 1PKZA 3FKFA 3GHAA 2DJ0A 1F9MA 3FZ5A 1THXA 3G7YA 5AISA 1B48A 5COHA 4ILFA 2VAFA 4E8HA 2DJ1A 4JBBA 1XG8A 1OC3A 4I97A 4MP4A 3VWUA 1GSYA 2KHPA 3RBTA 2VCZA 2AJQB 2C1YA 3QPMA 4IN0A 3Q74A 1WRYA 2CAQA 2GT6A 4OMVA 3UEMA 1VF4A 1KEBA 4ZB8A 5D73A 1WJKA 2H1AA 3GX8A 1GULA 3ED3A 3HVNA 4JR6A 1BYEA 2VL2C 1N8JA 1OC9B 2ALBA 2C4JA 5DCHA 4ZB9A 5GSSA 1EGOA 4MJBA 3GMFA 2JACA 3HA9A 5HR1A 5G30A 5CRDA 1A2MA 2WULA 4P3YB 1BQ7A 4NV2A 4TN8A 1T7PB 3EU3A 2OE3A 2QC7A 3EE2A 2MZCA 2NTOA 1GL8A 4PQ1A 4KW6A 1FG4A 5EVOA 3ERWA 5GZZB 1SYRA 2AUVA 1ZYQB 5DAKB 3NZNA 2N5AA 2R0CA 3L4NA 1X5CA 4BVXB 1TTZA 3LG6A 1T3BA 4HDEA 2R0GA 1YZXA 1YF0A 1ZYPA 5KN2A 2K18A 4IQ1A 3U6VA 2HRFA 4I2TA 2E2GA 1OC9A 4Z2RA 1UA5A 1WPIA 4EDZA 5GSTA 1USBA 2EIQA 1C72A 4HI7A 2OE0A 4O5RA 14GSA 5A4WA 4AJ6A 2FA8A 1YJ6A 2DBCA 4PGTA 5A4UA 1XW9A 1TXXA 5DAKA 4XTSA 1Z9HA 2JU5A 5KOWA 3IC4A 4XHMA 1X9WB 2NDOA 5FT3A 3LFLA 2DSAA 3ZYWA 1PQNA 4AGSA 5ECQB 5BRTA 1RQMA 1JFUA 4LLRA 4BL7A 1O85A 4POBA 4PURA 1FVKA 4MK3A 1KNGA 1XW5A 1QFNA 1SK2A 3GA4A 1VGLA 1YQ1A 5AN1A 2R3XA 4ID0A 2PMTA 3WT2A 4KDXA 1XWBA 1GP1A 4ZILA 1MD3A 4WKWA 5DVBA 3EWLA 2H70A 3DGQA 1EP8A 2RUEA 11GSA 3TGZA 1NHYA 1MDJA 1XBSA 1Z5YE 2PUKC 3DWVA 2DKIA 4KE3A 1JHBA 4KSOA 1GNWA 3IHGA 1A8LA 1FHEA 4BA7A 1K3OA 2DJJA 1XWGA 1H4OA 2PVOC 3ERGA 5F0GA 3D5JA 2B7KA 3ZFLA 4G0IA 3HHVA 2H8LA 3WGEA 4WF5A 3A5WA 4ZL8A 3QD9A 4MJAA 2XBIA 4BIKA 5B8BA 4G10A 2PU9C 3NOFA 3ZIVA 1FO5A 3APOA 4IKHA 3C71A 12GSA 4V2MA 4H86A 2K8SA 4F82A 4JEDA 1TKDB 3QFAC 1NSWA 3FR9A 3C1RA 4FYUA 3IA1A 1CQGA 2KP2A 3VWWA 3LQ7A 3F6FA 2IJYA 2VCVA 1PX6A 3KTBA 2H72A 1SJZA 2WCIA 1ML6A 1QGVA 2GZZA 1N2AA 2WB9A 2IMFA 4WBJA 2CZ2A 2EC4A 2HT9A 4MZCA 5IMZA 3IBHA 1YDKA 4HUAA 1U3IA 3DVXA 3ME7A 3N5OA 2BMXA 1XOAA 3GRXA 3GSTA 4V1Ag 2V41A 1O73A 2IMEA 4TXVA 3TKQA 4D73A 2GT5A 4CDOA 2UZ8A 1AQWA 5ABRA 1SD8A 3KMOA 4MJEA 5ECKB 3I69A 3LORA 3TUEA 2FWEA 2OADA 4Q5FA 1UN2A 1XIYA 2OACA 4CY8A 5B6MA 4EE0A 3C73A 2Z9SA 3UJ1A 4OCEA 2H75A 3TJFA 4I8BA 1YEXA 2ON5A 4ZIJA 2KLXA 1JLWA 4DSSB 5J4UA 3WGDA 3S9FA 4FO5A 1KBNA 3IAS2 3HD5A 5EY6A 4MPFA 4V2NA 1AC1A 4TXOB 4F2IA 3GH6A 4HU7A 4YQMA 3L0HA 1Y6EA 1HQOA 1HNCA 1TRUA 4TKYA 5KOXA 2EIRA 2VOCA 1YY7A 3TCOA 2R5GA 3UL3A 2DJKA 2E0QA 3UAPA 1XWCA 2G0FA 1PL2A 4HOJA 4TVEA 1R7HA 5IPHA 2X8GA 2ES7A 1ERUA 1XWAA 1B4PA 5GAPD 1TOFA 1K0BA 5C04A 4F0CA 1T4YA 3P2AA 1SK0A 4K6XA 1QQ2A 2VD0A 1SL1B 3HZ8A 3GTUB 4EDYA 1EV9A 4XIHA 1SK1A 2MBTA 4DSQA 4A5PA 1THOA 3CSIA 2HRAA 3KEBA 3L9SA 2IFQA 5AIVA 4YAPA 2VUPA 3KIJA 2QSIA 2DC5A 4LA1A 2OJLA 4GSTA 1B9YC 3UVHA 1GLQA 4G0LA 3MYDA 4TXOA 1M0UA 1SL2B 1QUWA 3CSHA 4K7NA 4N0ZA 1FW1A 4BWSA 1ST9A 1Z6MA 2LNSA 5DBQA 4N30A 2GDRA 2L57A 4ZBBA 1SYXA 3TRPA 1K0MA 1PFOA 1R5AA 2XPDA 3I43A 4QQ7A 5KEJA 2F3MA 1GUKA 4XS4B 1BJXA 4POLA 3GL3A 1GTIA 3IDVA 4N11A 3GH9A 4OO5A 1M3JA 4KGIA 4OFTA 3FY7A 1K0OA 1OAZA 5D96A 4ECCA 3APSA 4ZL7A 8GSSA 4MDCA 5G2ZA 2AYTA 3K8NA 1FOVA 1AUCA 1NW2A 1G6WA 3O76A 2BJXA 2FD3A 3CSJA 5F8BA 1G0TA 4CY6A 3MDKA 3ZZXA 5F07A 2XBQA 3O3TA 4HU9A 3FK8A 3P90A 2FNOA 2ZNMA 2VCWA 5D9XA 4PNGA 4NHWA 1SKWB 2JSYA 5IOWA 4GQCA 2CX3A 5ECIB 3NIVA 4KF9A 1PMTA 3CMIA 4EO3A 2E7PA 2CX4A 4RQRA 2HE3A 4JE1A 2XPEA 2V6OA 1S3RA 2R6KA 3P7XA 3IC8A 1R4WA 1TRSA 3VFIA 3EC3A 2B1KA 1A0FA 5G5FA 1M2AA 2IPAA 4NHZA 2QA2A 4K2XA 2IMDA 4K7OA 2I9HA 5IMFA 2H74A 3UBKA 2RM6A 3D22A 5DQSA 2LJKA 2MMNA 1YF1A 4LL4B 4XRAA 2WJUA 1GRXA 1TJDA 3VURA 2H30A 3I6AA 2LTKA 2M80A 5IQYA 1GSQA 2GSSA 3RPNA 4GCIA 3JCML 2LS5A 6GSXA 2H1BA 2VIMA 3GN3A 1ERTA 3EU4A 4K0GA 1QXHA 3IHQA 1IYHA 2F51A 2C8UA 2VCQA 3US3A 3VLNA 4FYBA 2YZUA 1MDKA 2R37A 4L0WA 5CAXA 5FHIA 4K0NA 2CZ3A 2GSTA 3BCIA 3LYPA 3KJYA 5D9VA 2ZCTA 2DJ3A 3J7Yb 3KCMA 2C3QA 3ERFA 1EGRA 1JZRA 3L78A 4Q5NA 1A23A 3OR5A 1LBKA 1BG5A 2JZSA 10GSA 2FWHA 3FYGA 1IYIA 5LCZA 3U5RE 1WWJA 3PPUA 1Q4JA 1Y25A 2IWTA 3D6IA 6GSYA 1M2BA 2YV7A 4JZQA 2AAWA 2ON7A 4X43A 3ZRDA 1AXDA 1GSUA 2LV3A 5JCGA 3FEUA 3RDWA 1U3AA 4WR4A 4FH8A 4NAXA 1J08A 2F8FA 4L5LA 2WRTA 2N5FA 3FHKA 1YKCA 4Z7XA 2FWGA 3E0UA 2YJHA 3FR6A 1LJRA 3UVTA 4FYCA 1GH2A 5FWGA 2GS3A 4AJ7A 3C7MA 3SWLA 1BX9A 1ABAA 3LSZA 3G7IA 4K8MA 5DDLA 3TKSE 3I9V2 1K3LA 1A8YA 3A2XA 2L6DA 4IELA 4KCAA 4LMVA 2IN3A 1T00A 2H71A 4HJ2A 2MMZA 4X1UA 2HZEB 4F03A 9GSSA 4TR3A 4ZL9A 6GSWA 3GSSA 2FHEA 3M3MA 1Z6NA 1DE1A 2HFDA 5G31A 5J9BA 5H5SA 1VF1A 4BVXA 1NHOA 3HJMA 3CRTA 2K9FA 3IV4A 1RK4A 1WOUA 5CO3A 2DMMA 2R4VA 5HR3A 3WT1A 2A2RA 2C0EA 3KM6A 4FIWA 5ECLB 4XRDA 4L5OA 4MABA 1M2DA 2CVDA 4O5QA 2A4HA 1FVJA 2X99A 1PN9A 3BJ5A 3N9JA 4PUFC 1V98A 2O85A 1O7UA 3KH7A 2M72A 1Q98A 1OC8A 3DVWA 1OVNA 5CYYA 2H0HA 1XCCA 1PRXA 3PR8A 4IP6A 2CA8A 2HSYA 2O8VB 2RIIA 3ZIJA 1JZWA 4MF6A 1EOGA 5CRHA 3WGXA 3L9VA 2B3SA 3G9BA 4HS1A 1AIUA 1K0CA 4GF0A 3TB2A 1U87A 3TOUA 3GKXA 5G1KA 4I5QA 3HDCA 3GKKA 5IMCA 2LRCA 2LRNA 4YAVA 1GSEA 2MMOA 2AHEA 4HJMA 2VL3A 4HSCX 3BBYA 4MF7A 4K9ZA 2IL3A 1TU8A 4YKFA 3QAGA 2FCHA 5D9WA 3HJPA 4XCSA 1GSSA 4TR1B 4ISDA 4BVYB 3H8QA 3LXTA 5E4WA 4KH7A 5DJLA 3EYTA 5ECNB 3TRQA 5HFKA 1YEPA 3W6GA 4BWQA 2YWOA 1PGTA 1U6TA 2HXKA 1GUHA 1G7EA 1V40A 4N10A 1JZDA 4BPYA 4IQAA 2LKUA 4QL7A 4O92A 4KB3A 2CVKA 3DKSA 4RQXA 1NM3A 2L5OA 1O8WA 3RPPA 1XZOA 4O32A 1M3IA 3MIXA 5CRGA 5B8AA 4GTUA 5CNWA 4MCUA 2LNTA 2YJ7A 3Q6OA 2R2JA 4IJIA 4LL1B 3VWXA 2P5QA 3ZMKA 1ZCPA 3H93A 1SKSB 1M99A 3TKRA 4IS0A 2YNXA 5JCWA 2IMKA 2PWJA 3GYKA 1TW9A 5D9TA 2F9SA 2CAIA 1F3BA 4CW9A 1I9DA 1GSFA 2GZPA 1R26A 1MD4A 2RLIA 1V9WA 5D8IA 2JZTA 3IXRA 5F05A 5ID2B 1GNEA 5IIZA 4OO4A 2MBSA 3IPZA 1YKAA 4KUNA 4HZ2A 4MF5A 5DALB 4YQUA 3EPTA 5LNKe 3MWHA 1ACVA 3ZMLA 2R0PA 3GFKA 1VF2A 2HLSA 4ML1A 2H01A 19GSA 2J9HA 3IE3A 3KH9A 1AQXA 4HZ4A 3C8EA 3ZITA 1XFLA 3QAWA 4XS6A 1X5DA 3M9KA 3WD6A 4ECIA 5JWOB 2V6KA 4MMMA 2LSTA 2DLXA 2OA7A 3BCKA 3M8NA 3QR6A 3CXGA 1ZMAA 3GV1A 4KA0A 3KD0A 1SJ6A 3UBLA 1X0RA 2LQOA 5AIXA 3UARA 4K1FA 1XVWA 1W4VA 3GNJA 2VCXA 4ULXA 2KUCA 2QGVA 2PERA 1ERVA 1S3CA 4YH2A 3DMLA 3IK9A 2VLTA 4DSSA 3UMAA 1EOHA 1B4QA 1JLVA 4MJCA 1TP9A 3W8SA 2X4AA 1Z3EA 5L71A 4IP1A 6GSSA 1EV4A 2YN1A 3VPTA 2PBJA 3RHBA 1MTCA 1K3YA 2EIOA 1EP7A 4EIQA 1PD21 5ELGA 4QL9A 3QMXA 3TDGA 1ZZYA 4O5UA 2OBKA 1H75A 1FAAA 3DEXA 2L4QA 1GSDA 3QFBC 1KTEA 4I6XA 1ZL9A 2OKAA 3GTUA 2H73A 1SD9A 3IOSA 2IMIA 2NBSA 5ECSA 2LEGA 2GSRA 4FQUA 2XHFA 4K5RA 1BAYA 1F37A 3TRXA 1T8EB 2OBIA 5EL8A 2O7KA 1DUGA 3C1SA 5AGYA 4WEYA 1Z7RA 1PX7A 3V1WA 4N0VA 2H0IA 2B6MA 3LW9A 2PGTA 3A5IA 3FW2A 20GSA 3ZFBA 3ZREA 1J0FA 1K0AA 2TRCP 3HVSA 2VCTA 1AAZA 2G2QA 4KSMA 4XS4A 1HD2A 4POKA 3F3RA 4TOPA 4V1Ap 3QOUA 2I4AA 2DMLA 4J56E 4GSNA 2YWNA 4TR4A 2FA4A 5DQYA 3PINA 2VL9A 3E9JB 3R2QA 3QDNA 2FWFA 3KTLA 5GAND 2FGXA 1DSBA 3FR3A 3GIXA 2HI7A 3D21A 3F6DA 5KN3A 5G5EA 4OD7A 2KOKA 5ECPB 2HRKA 3KGKA 4K7IA 2V1MA 5IMAA 4LMWA 1U88A 1TK0B 3TKPA 3Q19A 4WXTA 5B6NA 3VI5A 2XC2A 3GKNA 4G2EA 3BOAA 2YCDA 2RUFA 3E3EA 1RW1A 2VLUA 3MNGA 2GZYA 1ZYNA 1XXUA 2N5BA 4ECJA 3KP9A 2F8AA 2JL4A 1A0RP 1HNBA 5EPFA 1V57A 3HVXA 4JRRA 4PXOA 1F6MC 3FRCA 4IGJA 3W8JA 1F2EA 2E2MA 2FY6A 4Z2UA 1B8XA 1HYUA 3KMNA 4ZB6A 2AB6A 4EKZA 1TRVA 1SJIA 5B7CA 3PGTA 3F9UA 4YQVA 4L8EA 3VK9A 3RHCA 3TOTA 5IMDA 5DCGA 4KAEA 4F9ZA 3KZQA 1GTUA 3D4MA 4GQFA 4OFNA 3IAM2 1M7TA 5IM9A 4HQSA 5HQPA 3L9UA 4EF0A 1ZGNA 2GVPA 2YV9A 6GSTA 1E6BA 2GLRA 2D2ZA 2B1LA 2H66A 2L6CA 22GSA 3F0IA 3HVVA 2AV4A 2J23A 1TI1A 2GTUA 1S3AA 2YZHA 2HSHA 2HNLA 1MDIA 1WIKA 4HQZA 3SBCA 18GSA 3VI7A 3ZLPA 1PL1A 5ENUA 3FZAA 2H19A 2NPBA 4NPBA 4BL7B 2P31A 1I5GA 2L4CA 2YPMA 2QA1A 4ML6A 3CQFA 4DEJA 3R3EA 5LD0A 4MZBA 2KP1A 3EURA 5J3RA 5J5NA 2JZRA 2MYGA 4XS1A 3KXOA 1M9BA 3LJRA 2B5YA 1GLPA
chains in the Genus database with same CATH topology
2H0GA 2V2GA 3ZTLA 1GWCA 4IVFA 1OYJA 2GGTA 4KCEA 4OCFA 1XPVA 3UIWA 4DSRA 3LYKA 4G0KA 4O7HA 1FB0A 1OE8A 4RI6A 1V2AA 1FOHA 3FZ4A 4PTSA 2K8VA 1OKDA 4GRFA 4ECBA 4ICYA 1F3AA 3CRUA 4K2DA 4EVMA 4IBPA 5IMVA 5HR2A 3DRNA 1TK8B 4NXIA 4GLTA 1PSQA 5A4VA 1XOBA 2H1GA 2WZ9A 3G7JA 4RUVA 1BEDA 2HZEA 4JR4A 4OWYA 3ZVJA 2O89A 3DD3A 2PN8A 1SENA 5JWQB 6GSVA 2X8CA 2DIZA 3LEFA 5CP1A 2LJRA 3KP8A 2CVBA 4NV5A 1X5EA 2WFCA 3F4TA 3F8UA 5HFIA 1K0DA 3TJGA 2A4VA 5INYA 3VPQA 5IOXA 1VRSD 4MNNA 2C0FA 3IR4A 2CT6A 3H79A 2H1DA 4EIPA 5IO0A 4I2UA 4G9HA 3IRAA 1LU4A 3MAKA 2JSZA 4TW5A 4IHUA 2CQ9A 3HY2A 1S3DA 3P8WA 4D73B 2MMAA 1B9XC 3LXZA 1ILOA 4NMUA 2B5XA 3O6TA 3QAVA 1XVQA 3LWAA 3CTFA 2GQLA 4F0BA 1EEMA 1A2LA 5IPGA 5JWRB 3A2VA 3ME8A 4PX1A 1J9BA 3MSZA 5G1LA 2PPTA 2X64A 4MZWA 2GQMA 3F3QA 2VM1A 1SU9A 1W89A 5F06A 3HYPA 5H5QA 2DJ2A 1HNAA 5E59A 2HZFA 2LJAA 2LQQA 2HYXA 2JADA 2M46A 1M9AA 1CQHA 3HXSA 4TR0A 3PH9A 2YP6A 4WF4A 1PKWA 1URMA 2OE1A 2TRXA 4TR1A 1GUMA 4BVYA 1WP0A 2VD1A 1XW6A 4HEA2 5J41A 4KDYA 2H6XA 1AW9A 4USSA 4J2FA 5BMUA 2GSQA 1OE7A 3DXBA 3HKRA 1WE0A 2H6YA 2HSMA 4PUAA 2PVQA 4WBRD 5KN1A 1EZKA 2L5LA 3UOMA 3M1GA 4GWRA 5D93A 1Z7PA 3GKMA 1TI3A 3M0FA 3A3TA 4E8EA 3H4KA 4EXJA 1A2JA 2H6ZA 3GURA 2P0GA 2RM5A 1T4ZA 1TDIA 4J57E 2GQKA 2WGRA 1GTBA 2LRTA 1PN0A 4PQHA 4ZXGA 3HZ4A 1G7OA 1AQVA 5ECOB 3AY8A 2IFQB 4MLYA 5C00A 4Z2TA 1K0NA 2P5RA 2YANA 4EUYA 2DIYA 4CHSA 1FB6A 4OFMA 3D4TA 1ZYEA 4V2LA 3EINA 5JCUA 4L0UA 1SL0B 2X49A 5ID2A 3CTGA 5IO2A 4Q5RA 4AF2A 2VLVA 2WDUA 3H1NA 1O81A 1QK8A 4KDUA 3TJKA 5DALA 2QKEA 1A24A 3Q18A 3D0ZA 1QMVA 3DYRA 4IJ3A 6GSUA 4PQIA 2YOIA 3EVIA 3EMPA 3GUSA 3RAZA 3APQA 3GX0A 3CBUA 3TKSA 1X9MB 3BD2A 1UVZA 1EEJA 5HFGA 4K5SA 2V32A 4MH2A 2A2PA 13GSA 4WR5A 4ZBDA 1X9SB 2VO4A 3QCPA 5ECRB 2IIYA 2LUSA 1V58A 1T1VA 1E2YA 4X4JA 17GSA 5DJMA 2NVLA 2BTOT 1O8XA 4EC0A 5H5RA 4X0XA 2REMA 3A2WA 1VF3A 2B7JA 2TIRA 3LGCA 4G19A 1DE2A 7GSSA 4ZBAA 2VM2A 2O87A 5ECMB 4KNDA 3DIEA 2HRNA 3ZL5A 3EMXA 1DBYA 3ZVJD 2X8HA 2WS2A 16GSA 2YWMA 4EL1A 2DKHA 3TKSC 2K6VA 5ELAA 4MA9A 2L59A 1MEKA 3HJOA 2FUG2 4RI7A 1R5PA 3F4SA 1WMJA 5KN0A 5CREA 1PA3A 1XWKA 2YWIA 1EWXA 2I3YA 3CYNA 4JU5A 1ZOFA 1G6YA 2H76A 2C80A 5J9CA 2C3TA 4Q5QA 1UC7A 4MPGA 4GXZA 2I81A 1TK5B 4TRXA 4POMA 3WYWA 1ERWA 1OKTA 1TRWA 1O6JA 3HCZA 4WETA 4KX4A 2ZUPA 4GSSA 4ACSA 3TJJA 2I1UA 3GL5A 5A5KA 1GTAA 2FLSA 3F63A 3FMWA 3IK7A 2CV4A 3ISOA 4IW9A 3TJBA 4YKGA 1JZOA 1TU7A 4AJ8A 2B5EA 3FZ9A 3M9JA 3F4RA 5CRWA 4MH3A 2C3NA 4DVCA 3J7Yk 2VL2A 2C0GA 1SKRB 3VWVA 2C0DA 2A2SA 5ECHB 4NWYA 4PNFA 1ON4A 5HR0A 1PKZA 3FKFA 3GHAA 2DJ0A 1F9MA 3FZ5A 1THXA 3G7YA 5AISA 1B48A 5COHA 4ILFA 2VAFA 4E8HA 2DJ1A 4JBBA 1OC3A 4I97A 4MP4A 3VWUA 1GSYA 2KHPA 3RBTA 2VCZA 2AJQB 2C1YA 3QPMA 4IN0A 3Q74A 1WRYA 2CAQA 2GT6A 4OMVA 3UEMA 1VF4A 1KEBA 4ZB8A 5D73A 1WJKA 2H1AA 3GX8A 1GULA 3ED3A 4JR6A 1BYEA 2VL2C 1N8JA 1OC9B 2ALBA 2C4JA 5DCHA 4ZB9A 5GSSA 1EGOA 4MJBA 3GMFA 2JACA 3HA9A 5HR1A 5G30A 5CRDA 1A2MA 2WULA 4P3YB 1BQ7A 4NV2A 4TN8A 1T7PB 3EU3A 2OE3A 2QC7A 3EE2A 2MZCA 2NTOA 1GL8A 4PQ1A 4KW6A 1FG4A 5EVOA 3ERWA 5GZZB 1SYRA 2AUVA 1ZYQB 5DAKB 3NZNA 2N5AA 2R0CA 3L4NA 1X5CA 4BVXB 1TTZA 3LG6A 1T3BA 4HDEA 2R0GA 1YZXA 1YF0A 1ZYPA 5KN2A 2K18A 4IQ1A 3U6VA 2HRFA 4I2TA 2E2GA 1OC9A 4Z2RA 1UA5A 1WPIA 4EDZA 5GSTA 1USBA 2EIQA 1C72A 4HI7A 2OE0A 4O5RA 14GSA 5A4WA 4AJ6A 2FA8A 1YJ6A 2DBCA 4PGTA 5A4UA 1XW9A 1TXXA 5DAKA 4XTSA 1Z9HA 2JU5A 5KOWA 3IC4A 4XHMA 1X9WB 2NDOA 5FT3A 3LFLA 2DSAA 3ZYWA 1PQNA 4AGSA 5ECQB 5BRTA 1RQMA 1JFUA 4LLRA 4BL7A 1O85A 4POBA 4PURA 1FVKA 4MK3A 1KNGA 1XW5A 1QFNA 1SK2A 3GA4A 1VGLA 1YQ1A 5AN1A 2R3XA 4ID0A 2PMTA 3WT2A 4KDXA 1XWBA 1GP1A 4ZILA 1MD3A 4WKWA 5DVBA 3EWLA 2H70A 3DGQA 1EP8A 2RUEA 11GSA 3TGZA 1NHYA 1MDJA 1XBSA 1Z5YE 2PUKC 3DWVA 2DKIA 4KE3A 1JHBA 4KSOA 1GNWA 3IHGA 1A8LA 1FHEA 4BA7A 1K3OA 2DJJA 1XWGA 1H4OA 2PVOC 3ERGA 5F0GA 3D5JA 2B7KA 3ZFLA 4G0IA 3HHVA 2H8LA 3WGEA 4WF5A 3A5WA 4ZL8A 3QD9A 4MJAA 2XBIA 5B8BA 4G10A 2PU9C 3NOFA 3ZIVA 1FO5A 3APOA 4IKHA 3C71A 12GSA 4V2MA 4H86A 2K8SA 4F82A 4JEDA 1TKDB 3QFAC 1NSWA 3FR9A 3C1RA 4FYUA 3IA1A 1CQGA 2KP2A 3VWWA 3LQ7A 3F6FA 2IJYA 2VCVA 1PX6A 3KTBA 2H72A 1SJZA 2WCIA 1ML6A 1QGVA 2GZZA 1N2AA 2WB9A 2IMFA 4WBJA 2CZ2A 2EC4A 2HT9A 4MZCA 5IMZA 3IBHA 1YDKA 4HUAA 1U3IA 3DVXA 3ME7A 3N5OA 2BMXA 1XOAA 3GRXA 3GSTA 4V1Ag 2V41A 1O73A 2IMEA 4TXVA 3TKQA 4D73A 2GT5A 4CDOA 2UZ8A 1AQWA 5ABRA 1SD8A 3KMOA 4MJEA 5ECKB 3I69A 3LORA 3TUEA 2FWEA 2OADA 4Q5FA 1UN2A 1XIYA 2OACA 4CY8A 5B6MA 4EE0A 3C73A 2Z9SA 3UJ1A 4OCEA 2H75A 3TJFA 4I8BA 1YEXA 2ON5A 4ZIJA 2KLXA 1JLWA 4DSSB 5J4UA 3WGDA 3S9FA 4FO5A 1KBNA 3IAS2 3HD5A 5EY6A 4MPFA 4V2NA 1AC1A 4TXOB 4F2IA 3GH6A 4HU7A 4YQMA 3L0HA 1Y6EA 1HQOA 1HNCA 1TRUA 4TKYA 5KOXA 2EIRA 2VOCA 1YY7A 3TCOA 2R5GA 3UL3A 2DJKA 2E0QA 3UAPA 1XWCA 2G0FA 1PL2A 4HOJA 4TVEA 1R7HA 5IPHA 2X8GA 2ES7A 1ERUA 1XWAA 1B4PA 5GAPD 1TOFA 1K0BA 5C04A 4F0CA 1T4YA 3P2AA 1SK0A 4K6XA 1QQ2A 2VD0A 1SL1B 3HZ8A 3GTUB 4EDYA 1EV9A 4XIHA 1SK1A 2MBTA 4DSQA 4A5PA 1THOA 3CSIA 2HRAA 3KEBA 3L9SA 2IFQA 5AIVA 4YAPA 2VUPA 3KIJA 2QSIA 2DC5A 4LA1A 2OJLA 4GSTA 1B9YC 3UVHA 1GLQA 4G0LA 3MYDA 4TXOA 1M0UA 1SL2B 1QUWA 3CSHA 4K7NA 4N0ZA 1FW1A 4BWSA 1ST9A 1Z6MA 2LNSA 5DBQA 4N30A 2GDRA 2L57A 4ZBBA 1SYXA 3TRPA 1K0MA 2XPDA 1R5AA 3I43A 4QQ7A 5KEJA 2F3MA 1GUKA 4XS4B 1BJXA 4POLA 3GL3A 1GTIA 3IDVA 4N11A 3GH9A 4OO5A 4KGIA 4OFTA 3FY7A 1K0OA 1OAZA 5D96A 4ECCA 3APSA 4ZL7A 8GSSA 4MDCA 5G2ZA 2AYTA 3K8NA 1FOVA 1AUCA 1NW2A 1G6WA 3O76A 2BJXA 2FD3A 3CSJA 5F8BA 1G0TA 4CY6A 3MDKA 3ZZXA 5F07A 2XBQA 3O3TA 4HU9A 3FK8A 3P90A 2FNOA 2ZNMA 2VCWA 5D9XA 4PNGA 4NHWA 1SKWB 2JSYA 5IOWA 4GQCA 2CX3A 5ECIB 3NIVA 4KF9A 1PMTA 3CMIA 4EO3A 2E7PA 2CX4A 4RQRA 2HE3A 4JE1A 2XPEA 2V6OA 2R6KA 3P7XA 3IC8A 1R4WA 1TRSA 3VFIA 3EC3A 2B1KA 1A0FA 5G5FA 1M2AA 2IPAA 4NHZA 2QA2A 4K2XA 2IMDA 4K7OA 2I9HA 5IMFA 2H74A 3UBKA 2RM6A 3D22A 5DQSA 2LJKA 2MMNA 1YF1A 4LL4B 4XRAA 2WJUA 1GRXA 1TJDA 3VURA 2H30A 3I6AA 2LTKA 2M80A 5IQYA 1GSQA 2GSSA 3RPNA 4GCIA 3JCML 2LS5A 6GSXA 2H1BA 2VIMA 3GN3A 1ERTA 3EU4A 4K0GA 1QXHA 3IHQA 1IYHA 2F51A 2C8UA 2VCQA 3US3A 3VLNA 4FYBA 2YZUA 1MDKA 2R37A 4L0WA 5CAXA 5FHIA 4K0NA 2CZ3A 2GSTA 3BCIA 3LYPA 3KJYA 5D9VA 2ZCTA 2DJ3A 3J7Yb 3KCMA 2C3QA 3ERFA 1EGRA 1JZRA 3L78A 4Q5NA 1A23A 3OR5A 1LBKA 1BG5A 2JZSA 10GSA 2FWHA 3FYGA 1IYIA 5LCZA 3U5RE 1WWJA 3PPUA 1Q4JA 1Y25A 2IWTA 3D6IA 6GSYA 1M2BA 2YV7A 4JZQA 2AAWA 2ON7A 4X43A 3ZRDA 1AXDA 1GSUA 2LV3A 5JCGA 3FEUA 3RDWA 1U3AA 4WR4A 4FH8A 4NAXA 1J08A 2F8FA 4L5LA 2WRTA 2N5FA 3FHKA 1YKCA 4Z7XA 2FWGA 3E0UA 2YJHA 3FR6A 1LJRA 3UVTA 4FYCA 1GH2A 5FWGA 2GS3A 4AJ7A 3C7MA 3SWLA 1BX9A 1ABAA 3LSZA 3G7IA 4K8MA 5DDLA 3TKSE 3I9V2 1K3LA 1A8YA 3A2XA 2L6DA 4IELA 4KCAA 4LMVA 2IN3A 1T00A 2H71A 4HJ2A 2MMZA 4X1UA 2HZEB 4F03A 9GSSA 4TR3A 4ZL9A 6GSWA 3GSSA 2FHEA 3M3MA 1Z6NA 1DE1A 2HFDA 5G31A 5J9BA 5H5SA 1VF1A 4BVXA 1NHOA 3HJMA 3CRTA 2K9FA 3IV4A 1RK4A 1WOUA 5CO3A 2DMMA 2R4VA 5HR3A 3WT1A 2A2RA 2C0EA 3KM6A 4FIWA 5ECLB 4XRDA 4L5OA 4MABA 1M2DA 2CVDA 4O5QA 2A4HA 1FVJA 2X99A 1PN9A 3BJ5A 3N9JA 4PUFC 1V98A 2O85A 1O7UA 3KH7A 2M72A 1Q98A 1OC8A 3DVWA 1OVNA 5CYYA 2H0HA 1XCCA 1PRXA 3PR8A 4IP6A 2CA8A 2HSYA 2O8VB 2RIIA 3ZIJA 1JZWA 4MF6A 1EOGA 5CRHA 3WGXA 3L9VA 2B3SA 3G9BA 4HS1A 1AIUA 1K0CA 4GF0A 3TB2A 1U87A 3TOUA 3GKXA 5G1KA 4I5QA 3HDCA 3GKKA 5IMCA 2LRCA 2LRNA 4YAVA 1GSEA 2MMOA 2AHEA 4HJMA 2VL3A 3BBYA 4MF7A 4K9ZA 2IL3A 1TU8A 4YKFA 3QAGA 2FCHA 5D9WA 3HJPA 4XCSA 1GSSA 4TR1B 4ISDA 4BVYB 3H8QA 3LXTA 5E4WA 4KH7A 5DJLA 3EYTA 5ECNB 3TRQA 5HFKA 1YEPA 3W6GA 4BWQA 2YWOA 1PGTA 1U6TA 2HXKA 1GUHA 1G7EA 1V40A 4N10A 1JZDA 4BPYA 4IQAA 2LKUA 4QL7A 4O92A 4KB3A 2CVKA 3DKSA 4RQXA 1NM3A 2L5OA 1O8WA 3RPPA 1XZOA 4O32A 3MIXA 5CRGA 5B8AA 4GTUA 5CNWA 4MCUA 2LNTA 2YJ7A 3Q6OA 2R2JA 4IJIA 4LL1B 3VWXA 2P5QA 3ZMKA 1ZCPA 3H93A 1SKSB 1M99A 3TKRA 4IS0A 2YNXA 5JCWA 2IMKA 2PWJA 3GYKA 1TW9A 5D9TA 2F9SA 2CAIA 1F3BA 4CW9A 1I9DA 1GSFA 2GZPA 1R26A 1MD4A 2RLIA 1V9WA 5D8IA 2JZTA 3IXRA 5F05A 5ID2B 1GNEA 5IIZA 4OO4A 2MBSA 3IPZA 1YKAA 4KUNA 4HZ2A 4MF5A 5DALB 4YQUA 3EPTA 5LNKe 3MWHA 1ACVA 3ZMLA 2R0PA 3GFKA 1VF2A 2HLSA 4ML1A 2H01A 19GSA 2J9HA 3IE3A 3KH9A 1AQXA 4HZ4A 3C8EA 3ZITA 1XFLA 3QAWA 4XS6A 1X5DA 3M9KA 3WD6A 4ECIA 5JWOB 2V6KA 4MMMA 2LSTA 2DLXA 2OA7A 3BCKA 3M8NA 3QR6A 3CXGA 1ZMAA 3GV1A 4KA0A 3KD0A 1SJ6A 3UBLA 1X0RA 2LQOA 5AIXA 3UARA 4K1FA 1XVWA 1W4VA 3GNJA 2VCXA 4ULXA 2KUCA 2QGVA 2PERA 1ERVA 1S3CA 4YH2A 3DMLA 3IK9A 2VLTA 4DSSA 3UMAA 1EOHA 1B4QA 1JLVA 4MJCA 1TP9A 3W8SA 2X4AA 1Z3EA 5L71A 4IP1A 6GSSA 1EV4A 2YN1A 3VPTA 2PBJA 3RHBA 1MTCA 1K3YA 2EIOA 1EP7A 4EIQA 1PD21 5ELGA 4QL9A 3QMXA 3TDGA 1ZZYA 4O5UA 2OBKA 1H75A 1FAAA 3DEXA 2L4QA 1GSDA 3QFBC 1KTEA 4I6XA 1ZL9A 2OKAA 3GTUA 2H73A 1SD9A 3IOSA 2IMIA 2NBSA 5ECSA 2LEGA 2GSRA 4FQUA 2XHFA 4K5RA 1BAYA 1F37A 3TRXA 1T8EB 2OBIA 5EL8A 2O7KA 1DUGA 3C1SA 5AGYA 4WEYA 1Z7RA 1PX7A 3V1WA 4N0VA 2H0IA 2B6MA 3LW9A 2PGTA 3A5IA 3FW2A 20GSA 3ZFBA 3ZREA 1J0FA 1K0AA 2TRCP 3HVSA 2VCTA 1AAZA 2G2QA 4KSMA 4XS4A 1HD2A 4POKA 3F3RA 4TOPA 4V1Ap 3QOUA 2I4AA 2DMLA 4J56E 4GSNA 2YWNA 4TR4A 2FA4A 5DQYA 3PINA 2VL9A 3E9JB 3R2QA 3QDNA 2FWFA 3KTLA 5GAND 2FGXA 1DSBA 3FR3A 3GIXA 2HI7A 3D21A 3F6DA 5KN3A 5G5EA 4OD7A 2KOKA 5ECPB 2HRKA 3KGKA 4K7IA 2V1MA 5IMAA 4LMWA 1U88A 1TK0B 3TKPA 3Q19A 4WXTA 5B6NA 3VI5A 2XC2A 3GKNA 4G2EA 3BOAA 2YCDA 2RUFA 3E3EA 1RW1A 2VLUA 3MNGA 2GZYA 1ZYNA 1XXUA 2N5BA 4ECJA 3KP9A 2F8AA 2JL4A 1A0RP 1HNBA 5EPFA 1V57A 3HVXA 4JRRA 4PXOA 1F6MC 3FRCA 4IGJA 3W8JA 1F2EA 2E2MA 2FY6A 4Z2UA 1B8XA 1HYUA 3KMNA 4ZB6A 2AB6A 4EKZA 1TRVA 1SJIA 5B7CA 3PGTA 3F9UA 4YQVA 4L8EA 3VK9A 3RHCA 3TOTA 5IMDA 5DCGA 4KAEA 4F9ZA 3KZQA 1GTUA 3D4MA 4GQFA 4OFNA 3IAM2 1M7TA 5IM9A 4HQSA 5HQPA 3L9UA 4EF0A 1ZGNA 2GVPA 2YV9A 6GSTA 1E6BA 2GLRA 2D2ZA 2B1LA 2H66A 2L6CA 22GSA 3F0IA 3HVVA 2AV4A 2J23A 1TI1A 2GTUA 1S3AA 2YZHA 2HSHA 2HNLA 1MDIA 1WIKA 4HQZA 3SBCA 18GSA 3VI7A 3ZLPA 1PL1A 5ENUA 3FZAA 2H19A 2NPBA 4NPBA 4BL7B 2P31A 1I5GA 2L4CA 2YPMA 2QA1A 4ML6A 4DEJA 3R3EA 5LD0A 4MZBA 2KP1A 3EURA 5J3RA 5J5NA 2JZRA 2MYGA 4XS1A 3KXOA 1M9BA 3LJRA 2B5YA 1GLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0G A;  2V2G A;  3ZTL A;  1GWC A;  4IVF A;  1OYJ A;  2GGT A;  4KCE A;  4OCF A;  1XPV A;  3UIW A;  4DSR A;  3LYK A;  4O7H A;  1FB0 A;  1OE8 A;  4RI6 A;  1V2A A;  3FZ4 A;  2K8V A;  1OKD A;  4GRF A;  4ECB A;  1F3A A;  3CRU A;  4K2D A;  4EVM A;  4IBP A;  5IMV A;  5HR2 A;  3DRN A;  1TK8 B;  4NXI A;  4GLT A;  1PSQ A;  5A4V A;  1XOB A;  2H1G A;  2WZ9 A;  3G7J A;  4RUV A;  1BED A;  2HZE A;  4JR4 A;  4OWY A;  3ZVJ A;  2O89 A;  3DD3 A;  2PN8 A;  1SEN A;  5JWQ B;  6GSV A;  2X8C A;  2DIZ A;  3LEF A;  5CP1 A;  2LJR A;  3KP8 A;  2CVB A;  4NV5 A;  1X5E A;  2WFC A;  3F4T A;  3F8U A;  5HFI A;  1K0D A;  3TJG A;  2A4V A;  5INY A;  3VPQ A;  5IOX A;  1VRS D;  2C0F A;  3IR4 A;  2CT6 A;  3H79 A;  2H1D A;  5IO0 A;  4I2U A;  4G9H A;  3IRA A;  1LU4 A;  3MAK A;  2JSZ A;  4TW5 A;  4IHU A;  2CQ9 A;  3HY2 A;  1S3D A;  3P8W A;  4D73 B;  2MMA A;  1B9X C;  3LXZ A;  1ILO A;  4NMU A;  2B5X A;  3O6T A;  3QAV A;  1XVQ A;  3LWA A;  3CTF A;  2GQL A;  4F0B A;  1EEM A;  1A2L A;  5IPG A;  5JWR B;  3A2V A;  3ME8 A;  4PX1 A;  1J9B A;  3MSZ A;  5G1L A;  2PPT A;  2X64 A;  4MZW A;  2GQM A;  3F3Q A;  2VM1 A;  1SU9 A;  1W89 A;  5F06 A;  3HYP A;  5H5Q A;  2DJ2 A;  1HNA A;  5E59 A;  2HZF A;  2LJA A;  2LQQ A;  2HYX A;  2JAD A;  2M46 A;  1M9A A;  1CQH A;  3HXS A;  4TR0 A;  3PH9 A;  2YP6 A;  4WF4 A;  1PKW A;  1URM A;  2OE1 A;  2TRX A;  4TR1 A;  1GUM A;  4BVY A;  1WP0 A;  2VD1 A;  1XW6 A;  4HEA 2;  5J41 A;  4KDY A;  2H6X A;  1AW9 A;  4J2F A;  2GSQ A;  1OE7 A;  3DXB A;  3HKR A;  1WE0 A;  2H6Y A;  4PUA A;  2PVQ A;  4WBR D;  5KN1 A;  1EZK A;  2L5L A;  3UOM A;  3M1G A;  4GWR A;  5D93 A;  1Z7P A;  3GKM A;  1TI3 A;  3M0F A;  3A3T A;  4E8E A;  3H4K A;  4EXJ A;  1A2J A;  2H6Z A;  3GUR A;  2P0G A;  2RM5 A;  1T4Z A;  1TDI A;  4J57 E;  2GQK A;  2WGR A;  1GTB A;  2LRT A;  4PQH A;  4ZXG A;  3HZ4 A;  1G7O A;  1AQV A;  5ECO B;  3AY8 A;  2IFQ B;  4MLY A;  5C00 A;  1K0N A;  2P5R A;  2YAN A;  4EUY A;  2DIY A;  4CHS A;  1FB6 A;  4OFM A;  3D4T A;  1ZYE A;  4V2L A;  3EIN A;  5JCU A;  4L0U A;  1SL0 B;  5ID2 A;  3CTG A;  5IO2 A;  4Q5R A;  4AF2 A;  2VLV A;  2WDU A;  3H1N A;  1O81 A;  1QK8 A;  4KDU A;  3TJK A;  5DAL A;  2QKE A;  1A24 A;  3Q18 A;  3D0Z A;  1QMV A;  3DYR A;  4IJ3 A;  6GSU A;  4PQI A;  2YOI A;  3EVI A;  3EMP A;  3GUS A;  3RAZ A;  3APQ A;  3GX0 A;  3CBU A;  3TKS A;  1X9M B;  3BD2 A;  1UVZ A;  1EEJ A;  5HFG A;  2V32 A;  4MH2 A;  13GS A;  4WR5 A;  4ZBD A;  1X9S B;  2VO4 A;  5ECR B;  3QCP A;  2IIY A;  2LUS A;  1V58 A;  1T1V A;  1E2Y A;  17GS A;  5DJM A;  2NVL A;  2BTO T;  1O8X A;  4EC0 A;  5H5R A;  4X0X A;  2REM A;  3A2W A;  1VF3 A;  2B7J A;  2TIR A;  3LGC A;  4G19 A;  1DE2 A;  7GSS A;  4ZBA A;  2VM2 A;  2O87 A;  5ECM B;  4KND A;  3DIE A;  2HRN A;  3ZL5 A;  3EMX A;  1DBY A;  3ZVJ D;  2X8H A;  2WS2 A;  16GS A;  2YWM A;  4EL1 A;  3TKS C;  2K6V A;  5ELA A;  4MA9 A;  2L59 A;  1MEK A;  3HJO A;  2FUG 2;  4RI7 A;  1R5P A;  3F4S A;  1WMJ A;  5KN0 A;  5CRE A;  1PA3 A;  1XWK A;  2YWI A;  1EWX A;  2I3Y A;  3CYN A;  4JU5 A;  1ZOF A;  1G6Y A;  2H76 A;  2C80 A;  5J9C A;  2C3T A;  4Q5Q A;  1UC7 A;  4MPG A;  4GXZ A;  2I81 A;  1TK5 B;  4TRX A;  4POM A;  3WYW A;  1ERW A;  1OKT A;  1TRW A;  1O6J A;  3HCZ A;  4WET A;  4KX4 A;  2ZUP A;  4GSS A;  4ACS A;  3TJJ A;  2I1U A;  3GL5 A;  5A5K A;  1GTA A;  2FLS A;  3F63 A;  3IK7 A;  2CV4 A;  3ISO A;  4IW9 A;  3TJB A;  1JZO A;  1TU7 A;  4AJ8 A;  2B5E A;  3FZ9 A;  3M9J A;  3F4R A;  5CRW A;  4MH3 A;  2C3N A;  4DVC A;  3J7Y k;  2VL2 A;  2C0G A;  1SKR B;  3VWV A;  2C0D A;  2A2S A;  5ECH B;  4NWY A;  4PNF A;  1ON4 A;  5HR0 A;  1PKZ A;  3FKF A;  3GHA A;  2DJ0 A;  1F9M A;  3FZ5 A;  1THX A;  3G7Y A;  5AIS A;  1B48 A;  5COH A;  4ILF A;  2VAF A;  4E8H A;  2DJ1 A;  4JBB A;  1OC3 A;  4I97 A;  4MP4 A;  3VWU A;  1GSY A;  2KHP A;  3RBT A;  2VCZ A;  2AJQ B;  2C1Y A;  3QPM A;  4IN0 A;  3Q74 A;  1WRY A;  2CAQ A;  2GT6 A;  4OMV A;  3UEM A;  1VF4 A;  1KEB A;  4ZB8 A;  5D73 A;  1WJK A;  2H1A A;  3GX8 A;  1GUL A;  3ED3 A;  4JR6 A;  1BYE A;  2VL2 C;  1N8J A;  1OC9 B;  2ALB A;  2C4J A;  5DCH A;  4ZB9 A;  5GSS A;  1EGO A;  4MJB A;  3GMF A;  2JAC A;  3HA9 A;  5HR1 A;  5G30 A;  5CRD A;  1A2M A;  2WUL A;  4P3Y B;  1BQ7 A;  4NV2 A;  4TN8 A;  1T7P B;  3EU3 A;  2OE3 A;  2QC7 A;  3EE2 A;  2MZC A;  2NTO A;  1GL8 A;  4PQ1 A;  4KW6 A;  1FG4 A;  5EVO A;  3ERW A;  5GZZ B;  1SYR A;  2AUV A;  1ZYQ B;  5DAK B;  3NZN A;  2N5A A;  3L4N A;  1X5C A;  1TTZ A;  3LG6 A;  1T3B A;  4HDE A;  1YZX A;  1YF0 A;  5KN2 A;  2K18 A;  4IQ1 A;  3U6V A;  2HRF A;  4I2T A;  2E2G A;  1OC9 A;  1UA5 A;  1WPI A;  4EDZ A;  5GST A;  1USB A;  2EIQ A;  1C72 A;  4HI7 A;  2OE0 A;  4O5R A;  14GS A;  5A4W A;  4AJ6 A;  2FA8 A;  1YJ6 A;  2DBC A;  4PGT A;  5A4U A;  1XW9 A;  1TXX A;  5DAK A;  4XTS A;  1Z9H A;  2JU5 A;  3IC4 A;  4XHM A;  1X9W B;  2NDO A;  5FT3 A;  3LFL A;  2DSA A;  3ZYW A;  1PQN A;  4AGS A;  5ECQ B;  1RQM A;  1JFU A;  4LLR A;  4BL7 A;  1O85 A;  4POB A;  4PUR A;  1FVK A;  4MK3 A;  1KNG A;  1XW5 A;  1QFN A;  1SK2 A;  3GA4 A;  1VGL A;  1YQ1 A;  5AN1 A;  2R3X A;  4ID0 A;  2PMT A;  3WT2 A;  4KDX A;  1XWB A;  1GP1 A;  4ZIL A;  1MD3 A;  4WKW A;  5DVB A;  3EWL A;  2H70 A;  3DGQ A;  1EP8 A;  2RUE A;  11GS A;  3TGZ A;  1NHY A;  1MDJ A;  1XBS A;  1Z5Y E;  2PUK C;  3DWV A;  4KE3 A;  1JHB A;  4KSO A;  1GNW A;  1A8L A;  1FHE A;  4BA7 A;  1K3O A;  2DJJ A;  1XWG A;  1H4O A;  2PVO C;  3ERG A;  5F0G A;  3D5J A;  2B7K A;  3ZFL A;  3HHV A;  2H8L A;  3WGE A;  4WF5 A;  3A5W A;  4ZL8 A;  3QD9 A;  4MJA A;  2XBI A;  5B8B A;  4G10 A;  2PU9 C;  3NOF A;  3ZIV A;  1FO5 A;  3APO A;  4IKH A;  3C71 A;  12GS A;  4V2M A;  4H86 A;  2K8S A;  4F82 A;  4JED A;  1TKD B;  3QFA C;  1NSW A;  3FR9 A;  3C1R A;  4FYU A;  3IA1 A;  1CQG A;  2KP2 A;  3VWW A;  3LQ7 A;  3F6F A;  2IJY A;  2VCV A;  1PX6 A;  3KTB A;  2H72 A;  1SJZ A;  2WCI A;  1ML6 A;  1QGV A;  2GZZ A;  1N2A A;  2WB9 A;  2IMF A;  4WBJ A;  2CZ2 A;  2EC4 A;  2HT9 A;  4MZC A;  5IMZ A;  3IBH A;  1YDK A;  4HUA A;  1U3I A;  3DVX A;  3ME7 A;  3N5O A;  2BMX A;  1XOA A;  3GRX A;  3GST A;  4V1A g;  2V41 A;  1O73 A;  2IME A;  4TXV A;  3TKQ A;  4D73 A;  2GT5 A;  4CDO A;  1AQW A;  5ABR A;  1SD8 A;  3KMO A;  4MJE A;  5ECK B;  3I69 A;  3LOR A;  3TUE A;  2FWE A;  2OAD A;  4Q5F A;  1UN2 A;  1XIY A;  2OAC A;  5B6M A;  4EE0 A;  3C73 A;  2Z9S A;  3UJ1 A;  4OCE A;  2H75 A;  3TJF A;  4I8B A;  1YEX A;  2ON5 A;  4ZIJ A;  2KLX A;  1JLW A;  4DSS B;  5J4U A;  3WGD A;  3S9F A;  4FO5 A;  1KBN A;  3IAS 2;  5EY6 A;  3HD5 A;  4MPF A;  4V2N A;  1AC1 A;  4TXO B;  4F2I A;  3GH6 A;  4HU7 A;  4YQM A;  3L0H A;  1Y6E A;  1HQO A;  1HNC A;  1TRU A;  4TKY A;  2EIR A;  2VOC A;  1YY7 A;  3TCO A;  2R5G A;  3UL3 A;  2DJK A;  2E0Q A;  3UAP A;  1XWC A;  2G0F A;  1PL2 A;  4HOJ A;  4TVE A;  1R7H A;  5IPH A;  2X8G A;  2ES7 A;  1ERU A;  1XWA A;  1B4P A;  5GAP D;  1TOF A;  1K0B A;  5C04 A;  4F0C A;  1T4Y A;  3P2A A;  1SK0 A;  4K6X A;  1QQ2 A;  2VD0 A;  1SL1 B;  3HZ8 A;  3GTU B;  4EDY A;  1EV9 A;  4XIH A;  1SK1 A;  2MBT A;  4DSQ A;  1THO A;  3CSI A;  3KEB A;  3L9S A;  2IFQ A;  5AIV A;  4YAP A;  2VUP A;  3KIJ A;  2QSI A;  2DC5 A;  4LA1 A;  2OJL A;  4GST A;  1B9Y C;  3UVH A;  1GLQ A;  4TXO A;  1M0U A;  1SL2 B;  1QUW A;  3CSH A;  4K7N A;  4N0Z A;  1FW1 A;  4BWS A;  1ST9 A;  1Z6M A;  2LNS A;  5DBQ A;  4N30 A;  2GDR A;  2L57 A;  4ZBB A;  1SYX A;  3TRP A;  1K0M A;  2XPD A;  1R5A A;  3I43 A;  4QQ7 A;  5KEJ A;  2F3M A;  1GUK A;  4XS4 B;  1BJX A;  4POL A;  3GL3 A;  1GTI A;  3IDV A;  4N11 A;  3GH9 A;  4OO5 A;  4KGI A;  4OFT A;  3FY7 A;  1K0O A;  1OAZ A;  5D96 A;  4ECC A;  3APS A;  4ZL7 A;  8GSS A;  4MDC A;  5G2Z A;  2AYT A;  3K8N A;  1FOV A;  1AUC A;  1NW2 A;  1G6W A;  3O76 A;  2BJX A;  2FD3 A;  3CSJ A;  5F8B A;  1G0T A;  3MDK A;  3ZZX A;  5F07 A;  2XBQ A;  3O3T A;  4HU9 A;  3FK8 A;  3P90 A;  2FNO A;  2ZNM A;  2VCW A;  5D9X A;  4PNG A;  4NHW A;  1SKW B;  2JSY A;  5IOW A;  4GQC A;  2CX3 A;  5ECI B;  3NIV A;  1PMT A;  3CMI A;  4EO3 A;  2E7P A;  2CX4 A;  4RQR A;  2HE3 A;  4JE1 A;  2XPE A;  2V6O A;  2R6K A;  3P7X A;  1R4W A;  1TRS A;  3VFI A;  3EC3 A;  2B1K A;  1A0F A;  5G5F A;  1M2A A;  2IPA A;  4NHZ A;  2IMD A;  4K7O A;  2I9H A;  5IMF A;  2H74 A;  3UBK A;  2RM6 A;  3D22 A;  5DQS A;  2LJK A;  2MMN A;  1YF1 A;  4LL4 B;  4XRA A;  2WJU A;  1GRX A;  1TJD A;  3VUR A;  2H30 A;  3I6A A;  2LTK A;  2M80 A;  5IQY A;  1GSQ A;  2GSS A;  3RPN A;  4GCI A;  3JCM L;  2LS5 A;  6GSX A;  2H1B A;  2VIM A;  3GN3 A;  1ERT A;  3EU4 A;  4K0G A;  1QXH A;  3IHQ A;  1IYH A;  2F51 A;  2C8U A;  2VCQ A;  3US3 A;  3VLN A;  4FYB A;  2YZU A;  1MDK A;  2R37 A;  4L0W A;  5CAX A;  5FHI A;  4K0N A;  2CZ3 A;  2GST A;  3BCI A;  3LYP A;  3KJY A;  5D9V A;  2ZCT A;  2DJ3 A;  3J7Y b;  3KCM A;  2C3Q A;  3ERF A;  1EGR A;  1JZR A;  3L78 A;  4Q5N A;  1A23 A;  3OR5 A;  1LBK A;  1BG5 A;  2JZS A;  10GS A;  2FWH A;  3FYG A;  1IYI A;  5LCZ A;  3U5R E;  1WWJ A;  1Q4J A;  1Y25 A;  2IWT A;  3D6I A;  6GSY A;  1M2B A;  2YV7 A;  4JZQ A;  2AAW A;  2ON7 A;  4X43 A;  3ZRD A;  1AXD A;  1GSU A;  2LV3 A;  5JCG A;  3FEU A;  3RDW A;  1U3A A;  4WR4 A;  4FH8 A;  4NAX A;  1J08 A;  2F8F A;  4L5L A;  2WRT A;  2N5F A;  3FHK A;  1YKC A;  4Z7X A;  2FWG A;  3E0U A;  2YJH A;  3FR6 A;  1LJR A;  3UVT A;  4FYC A;  1GH2 A;  5FWG A;  2GS3 A;  4AJ7 A;  3C7M A;  3SWL A;  1BX9 A;  1ABA A;  3LSZ A;  3G7I A;  4K8M A;  5DDL A;  3TKS E;  3I9V 2;  1K3L A;  1A8Y A;  3A2X A;  2L6D A;  4IEL A;  4KCA A;  4LMV A;  2IN3 A;  1T00 A;  2H71 A;  4HJ2 A;  2MMZ A;  4X1U A;  2HZE B;  4F03 A;  9GSS A;  4TR3 A;  4ZL9 A;  6GSW A;  3GSS A;  2FHE A;  3M3M A;  1Z6N A;  1DE1 A;  2HFD A;  5G31 A;  5J9B A;  5H5S A;  1VF1 A;  4BVX A;  1NHO A;  3HJM A;  3CRT A;  2K9F A;  3IV4 A;  1RK4 A;  1WOU A;  5CO3 A;  2DMM A;  2R4V A;  5HR3 A;  3WT1 A;  2A2R A;  2C0E A;  3KM6 A;  4FIW A;  5ECL B;  4XRD A;  4L5O A;  4MAB A;  1M2D A;  2CVD A;  1FVJ A;  2X99 A;  1PN9 A;  3BJ5 A;  3N9J A;  4PUF C;  1V98 A;  2O85 A;  1O7U A;  3KH7 A;  2M72 A;  1Q98 A;  1OC8 A;  3DVW A;  1OVN A;  5CYY A;  2H0H A;  1XCC A;  1PRX A;  3PR8 A;  4IP6 A;  2CA8 A;  2HSY A;  2O8V B;  2RII A;  3ZIJ A;  1JZW A;  4MF6 A;  1EOG A;  5CRH A;  3WGX A;  3L9V A;  2B3S A;  3G9B A;  4HS1 A;  1AIU A;  1K0C A;  4GF0 A;  3TB2 A;  1U87 A;  3TOU A;  3GKX A;  5G1K A;  4I5Q A;  3HDC A;  3GKK A;  5IMC A;  2LRC A;  2LRN A;  4YAV A;  1GSE A;  2MMO A;  2AHE A;  4HJM A;  2VL3 A;  3BBY A;  4MF7 A;  4K9Z A;  2IL3 A;  1TU8 A;  3QAG A;  2FCH A;  5D9W A;  3HJP A;  4XCS A;  1GSS A;  4TR1 B;  4ISD A;  3H8Q A;  3LXT A;  5E4W A;  4KH7 A;  5DJL A;  3EYT A;  5ECN B;  3TRQ A;  5HFK A;  1YEP A;  3W6G A;  4BWQ A;  2YWO A;  1PGT A;  1U6T A;  2HXK A;  1GUH A;  1G7E A;  1V40 A;  4N10 A;  1JZD A;  4BPY A;  4IQA A;  2LKU A;  4QL7 A;  4O92 A;  4KB3 A;  2CVK A;  3DKS A;  4RQX A;  1NM3 A;  2L5O A;  1O8W A;  3RPP A;  1XZO A;  4O32 A;  5B8A A;  5CRG A;  4GTU A;  5CNW A;  4MCU A;  2LNT A;  2YJ7 A;  3Q6O A;  2R2J A;  4IJI A;  4LL1 B;  3VWX A;  2P5Q A;  3ZMK A;  1ZCP A;  3H93 A;  1SKS B;  1M99 A;  3TKR A;  4IS0 A;  2YNX A;  5JCW A;  2IMK A;  2PWJ A;  3GYK A;  1TW9 A;  5D9T A;  2F9S A;  2CAI A;  1F3B A;  4CW9 A;  1I9D A;  1GSF A;  2GZP A;  1R26 A;  1MD4 A;  2RLI A;  1V9W A;  5D8I A;  2JZT A;  3IXR A;  5F05 A;  5ID2 B;  1GNE A;  5IIZ A;  4OO4 A;  2MBS A;  3IPZ A;  1YKA A;  4KUN A;  4HZ2 A;  4MF5 A;  5DAL B;  4YQU A;  5LNK e;  3MWH A;  1ACV A;  3ZML A;  3GFK A;  1VF2 A;  2HLS A;  4ML1 A;  2H01 A;  19GS A;  2J9H A;  3IE3 A;  3KH9 A;  1AQX A;  4HZ4 A;  3C8E A;  3ZIT A;  1XFL A;  3QAW A;  4XS6 A;  1X5D A;  3M9K A;  3WD6 A;  4ECI A;  5JWO B;  2V6K A;  4MMM A;  2LST A;  2DLX A;  2OA7 A;  3BCK A;  3M8N A;  3QR6 A;  3CXG A;  1ZMA A;  3GV1 A;  4KA0 A;  3KD0 A;  1SJ6 A;  3UBL A;  1X0R A;  2LQO A;  5AIX A;  3UAR A;  4K1F A;  1XVW A;  1W4V A;  3GNJ A;  2VCX A;  4ULX A;  2KUC A;  2QGV A;  2PER A;  1ERV A;  1S3C A;  4YH2 A;  3DML A;  3IK9 A;  2VLT A;  4DSS A;  3UMA A;  1EOH A;  1B4Q A;  1JLV A;  4MJC A;  1TP9 A;  3W8S A;  1Z3E A;  5L71 A;  4IP1 A;  6GSS A;  1EV4 A;  2YN1 A;  3VPT A;  2PBJ A;  3RHB A;  1MTC A;  1K3Y A;  2EIO A;  1EP7 A;  1PD2 1;  5ELG A;  4QL9 A;  3QMX A;  3TDG A;  1ZZY A;  2OBK A;  1H75 A;  1FAA A;  3DEX A;  2L4Q A;  1GSD A;  3QFB C;  1KTE A;  4I6X A;  1ZL9 A;  2OKA A;  3GTU A;  2H73 A;  1SD9 A;  3IOS A;  2IMI A;  2NBS A;  5ECS A;  2LEG A;  2GSR A;  2XHF A;  1BAY A;  1F37 A;  3TRX A;  1T8E B;  2OBI A;  5EL8 A;  2O7K A;  1DUG A;  3C1S A;  5AGY A;  4WEY A;  1Z7R A;  1PX7 A;  3V1W A;  4N0V A;  2H0I A;  2B6M A;  2PGT A;  3FW2 A;  20GS A;  3ZFB A;  3ZRE A;  1J0F A;  1K0A A;  2TRC P;  3HVS A;  2VCT A;  1AAZ A;  2G2Q A;  4KSM A;  4XS4 A;  1HD2 A;  4POK A;  3F3R A;  4TOP A;  4V1A p;  3QOU A;  2I4A A;  2DML A;  4J56 E;  4GSN A;  2YWN A;  4TR4 A;  2FA4 A;  5DQY A;  3PIN A;  2VL9 A;  3E9J B;  3R2Q A;  3QDN A;  2FWF A;  3KTL A;  5GAN D;  2FGX A;  1DSB A;  3FR3 A;  3GIX A;  2HI7 A;  3D21 A;  3F6D A;  5KN3 A;  5G5E A;  4OD7 A;  2KOK A;  5ECP B;  3KGK A;  4K7I A;  2V1M A;  5IMA A;  4LMW A;  1U88 A;  1TK0 B;  3TKP A;  3Q19 A;  4WXT A;  5B6N A;  3VI5 A;  2XC2 A;  3GKN A;  4G2E A;  3BOA A;  2YCD A;  2RUF A;  3E3E A;  1RW1 A;  2VLU A;  3MNG A;  2GZY A;  1XXU A;  2N5B A;  4ECJ A;  3KP9 A;  2F8A A;  2JL4 A;  1A0R P;  5EPF A;  1HNB A;  1V57 A;  3HVX A;  4JRR A;  4PXO A;  1F6M C;  3FRC A;  4IGJ A;  3W8J A;  1F2E A;  2E2M A;  2FY6 A;  1B8X A;  1HYU A;  3KMN A;  4ZB6 A;  2AB6 A;  4EKZ A;  1TRV A;  1SJI A;  5B7C A;  3PGT A;  3F9U A;  4YQV A;  4L8E A;  3VK9 A;  3RHC A;  3TOT A;  5IMD A;  5DCG A;  4KAE A;  4F9Z A;  3KZQ A;  1GTU A;  3D4M A;  4GQF A;  4OFN A;  3IAM 2;  1M7T A;  5IM9 A;  4HQS A;  5HQP A;  3L9U A;  4EF0 A;  1ZGN A;  2GVP A;  2YV9 A;  6GST A;  1E6B A;  2GLR A;  2D2Z A;  2B1L A;  2H66 A;  2L6C A;  22GS A;  3F0I A;  3HVV A;  2AV4 A;  2J23 A;  1TI1 A;  2GTU A;  1S3A A;  2YZH A;  2HSH A;  2HNL A;  1MDI A;  1WIK A;  4HQZ A;  3SBC A;  18GS A;  3VI7 A;  3ZLP A;  1PL1 A;  5ENU A;  3FZA A;  2H19 A;  2NPB A;  4NPB A;  2P31 A;  1I5G A;  2L4C A;  2YPM A;  4ML6 A;  4DEJ A;  5LD0 A;  4MZB A;  2KP1 A;  3EUR A;  5J3R A;  5J5N A;  2JZR A;  2MYG A;  4XS1 A;  3KXO A;  1M9B A;  3LJR A;  2B5Y A;  1GLP A; 
#chains in the Genus database with same CATH topology
 2H0G A;  2V2G A;  3ZTL A;  1GWC A;  4IVF A;  1OYJ A;  2GGT A;  4KCE A;  4OCF A;  1XPV A;  3UIW A;  4DSR A;  3LYK A;  4G0K A;  4O7H A;  1FB0 A;  1OE8 A;  4RI6 A;  1V2A A;  1FOH A;  3FZ4 A;  4PTS A;  2K8V A;  1OKD A;  4GRF A;  4ECB A;  4ICY A;  1F3A A;  3CRU A;  4K2D A;  4EVM A;  4IBP A;  5IMV A;  5HR2 A;  3DRN A;  1TK8 B;  4NXI A;  4GLT A;  1PSQ A;  5A4V A;  1XOB A;  2H1G A;  2WZ9 A;  3G7J A;  4RUV A;  1BED A;  2HZE A;  4JR4 A;  4OWY A;  3ZVJ A;  2O89 A;  3DD3 A;  2PN8 A;  1SEN A;  5JWQ B;  6GSV A;  2X8C A;  2DIZ A;  3LEF A;  5CP1 A;  2LJR A;  3KP8 A;  2CVB A;  4NV5 A;  1X5E A;  2WFC A;  3F4T A;  3F8U A;  5HFI A;  1K0D A;  3TJG A;  2A4V A;  5INY A;  3VPQ A;  5IOX A;  1VRS D;  4MNN A;  2C0F A;  3IR4 A;  2CT6 A;  3H79 A;  2H1D A;  4EIP A;  5IO0 A;  4I2U A;  4G9H A;  3IRA A;  1LU4 A;  3MAK A;  2JSZ A;  4TW5 A;  4IHU A;  2CQ9 A;  3HY2 A;  1S3D A;  3P8W A;  4D73 B;  2MMA A;  1B9X C;  3LXZ A;  1ILO A;  4NMU A;  2B5X A;  3O6T A;  3QAV A;  1XVQ A;  3LWA A;  3CTF A;  2GQL A;  4F0B A;  1EEM A;  1A2L A;  5IPG A;  5JWR B;  3A2V A;  3ME8 A;  4PX1 A;  1J9B A;  3MSZ A;  5G1L A;  2PPT A;  2X64 A;  4MZW A;  2GQM A;  3F3Q A;  2VM1 A;  1SU9 A;  1W89 A;  5F06 A;  3HYP A;  5H5Q A;  2DJ2 A;  1HNA A;  5E59 A;  2HZF A;  2LJA A;  2LQQ A;  2HYX A;  2JAD A;  2M46 A;  1M9A A;  1CQH A;  3HXS A;  4TR0 A;  3PH9 A;  2YP6 A;  4WF4 A;  1PKW A;  1URM A;  2OE1 A;  2TRX A;  4TR1 A;  1GUM A;  4BVY A;  1WP0 A;  2VD1 A;  1XW6 A;  4HEA 2;  5J41 A;  4KDY A;  2H6X A;  1AW9 A;  4USS A;  4J2F A;  5BMU A;  2GSQ A;  1OE7 A;  3DXB A;  3HKR A;  1WE0 A;  2H6Y A;  2HSM A;  4PUA A;  2PVQ A;  4WBR D;  5KN1 A;  1EZK A;  2L5L A;  3UOM A;  3M1G A;  4GWR A;  5D93 A;  1Z7P A;  3GKM A;  1TI3 A;  3M0F A;  3A3T A;  4E8E A;  3H4K A;  4EXJ A;  1A2J A;  2H6Z A;  3GUR A;  2P0G A;  2RM5 A;  1T4Z A;  1TDI A;  4J57 E;  2GQK A;  2WGR A;  1GTB A;  2LRT A;  1PN0 A;  4PQH A;  4ZXG A;  3HZ4 A;  1G7O A;  1AQV A;  5ECO B;  3AY8 A;  2IFQ B;  4MLY A;  5C00 A;  4Z2T A;  1K0N A;  2P5R A;  2YAN A;  4EUY A;  2DIY A;  4CHS A;  1FB6 A;  4OFM A;  3D4T A;  1ZYE A;  4V2L A;  3EIN A;  5JCU A;  4L0U A;  1SL0 B;  2X49 A;  5ID2 A;  3CTG A;  5IO2 A;  4Q5R A;  4AF2 A;  2VLV A;  2WDU A;  3H1N A;  1O81 A;  1QK8 A;  4KDU A;  3TJK A;  5DAL A;  2QKE A;  1A24 A;  3Q18 A;  3D0Z A;  1QMV A;  3DYR A;  4IJ3 A;  6GSU A;  4PQI A;  2YOI A;  3EVI A;  3EMP A;  3GUS A;  3RAZ A;  3APQ A;  3GX0 A;  3CBU A;  3TKS A;  1X9M B;  3BD2 A;  1UVZ A;  1EEJ A;  5HFG A;  4K5S A;  2V32 A;  4MH2 A;  2A2P A;  13GS A;  4WR5 A;  4ZBD A;  1X9S B;  2VO4 A;  3QCP A;  5ECR B;  2IIY A;  2LUS A;  1V58 A;  1T1V A;  1E2Y A;  4X4J A;  17GS A;  5DJM A;  2NVL A;  2BTO T;  1O8X A;  4EC0 A;  5H5R A;  4X0X A;  2REM A;  3A2W A;  1VF3 A;  2B7J A;  2TIR A;  3LGC A;  4G19 A;  1DE2 A;  7GSS A;  4ZBA A;  2VM2 A;  2O87 A;  5ECM B;  4KND A;  3DIE A;  2HRN A;  3ZL5 A;  3EMX A;  1DBY A;  3ZVJ D;  2X8H A;  2WS2 A;  16GS A;  2YWM A;  4EL1 A;  2DKH A;  3TKS C;  2K6V A;  5ELA A;  4MA9 A;  2L59 A;  1MEK A;  3HJO A;  2FUG 2;  4RI7 A;  1R5P A;  3F4S A;  1WMJ A;  5KN0 A;  5CRE A;  1PA3 A;  1XWK A;  2YWI A;  1EWX A;  2I3Y A;  3CYN A;  4JU5 A;  1ZOF A;  1G6Y A;  2H76 A;  2C80 A;  5J9C A;  2C3T A;  4Q5Q A;  1UC7 A;  4MPG A;  4GXZ A;  2I81 A;  1TK5 B;  4TRX A;  4POM A;  3WYW A;  1ERW A;  1OKT A;  1TRW A;  1O6J A;  3HCZ A;  4WET A;  4KX4 A;  2ZUP A;  4GSS A;  4ACS A;  3TJJ A;  2I1U A;  3GL5 A;  5A5K A;  1GTA A;  2FLS A;  3F63 A;  3FMW A;  3IK7 A;  2CV4 A;  3ISO A;  4IW9 A;  3TJB A;  4YKG A;  1JZO A;  1TU7 A;  4AJ8 A;  2B5E A;  3FZ9 A;  3M9J A;  3F4R A;  5CRW A;  4MH3 A;  2C3N A;  4DVC A;  3J7Y k;  2VL2 A;  2C0G A;  1SKR B;  3VWV A;  2C0D A;  2A2S A;  5ECH B;  4NWY A;  4PNF A;  1ON4 A;  5HR0 A;  1PKZ A;  3FKF A;  3GHA A;  2DJ0 A;  1F9M A;  3FZ5 A;  1THX A;  3G7Y A;  5AIS A;  1B48 A;  5COH A;  4ILF A;  2VAF A;  4E8H A;  2DJ1 A;  4JBB A;  1XG8 A;  1OC3 A;  4I97 A;  4MP4 A;  3VWU A;  1GSY A;  2KHP A;  3RBT A;  2VCZ A;  2AJQ B;  2C1Y A;  3QPM A;  4IN0 A;  3Q74 A;  1WRY A;  2CAQ A;  2GT6 A;  4OMV A;  3UEM A;  1VF4 A;  1KEB A;  4ZB8 A;  5D73 A;  1WJK A;  2H1A A;  3GX8 A;  1GUL A;  3ED3 A;  3HVN A;  4JR6 A;  1BYE A;  2VL2 C;  1N8J A;  1OC9 B;  2ALB A;  2C4J A;  5DCH A;  4ZB9 A;  5GSS A;  1EGO A;  4MJB A;  3GMF A;  2JAC A;  3HA9 A;  5HR1 A;  5G30 A;  5CRD A;  1A2M A;  2WUL A;  4P3Y B;  1BQ7 A;  4NV2 A;  4TN8 A;  1T7P B;  3EU3 A;  2OE3 A;  2QC7 A;  3EE2 A;  2MZC A;  2NTO A;  1GL8 A;  4PQ1 A;  4KW6 A;  1FG4 A;  5EVO A;  3ERW A;  5GZZ B;  1SYR A;  2AUV A;  1ZYQ B;  5DAK B;  3NZN A;  2N5A A;  2R0C A;  3L4N A;  1X5C A;  4BVX B;  1TTZ A;  3LG6 A;  1T3B A;  4HDE A;  2R0G A;  1YZX A;  1YF0 A;  1ZYP A;  5KN2 A;  2K18 A;  4IQ1 A;  3U6V A;  2HRF A;  4I2T A;  2E2G A;  1OC9 A;  4Z2R A;  1UA5 A;  1WPI A;  4EDZ A;  5GST A;  1USB A;  2EIQ A;  1C72 A;  4HI7 A;  2OE0 A;  4O5R A;  14GS A;  5A4W A;  4AJ6 A;  2FA8 A;  1YJ6 A;  2DBC A;  4PGT A;  5A4U A;  1XW9 A;  1TXX A;  5DAK A;  4XTS A;  1Z9H A;  2JU5 A;  5KOW A;  3IC4 A;  4XHM A;  1X9W B;  2NDO A;  5FT3 A;  3LFL A;  2DSA A;  3ZYW A;  1PQN A;  4AGS A;  5ECQ B;  5BRT A;  1RQM A;  1JFU A;  4LLR A;  4BL7 A;  1O85 A;  4POB A;  4PUR A;  1FVK A;  4MK3 A;  1KNG A;  1XW5 A;  1QFN A;  1SK2 A;  3GA4 A;  1VGL A;  1YQ1 A;  5AN1 A;  2R3X A;  4ID0 A;  2PMT A;  3WT2 A;  4KDX A;  1XWB A;  1GP1 A;  4ZIL A;  1MD3 A;  4WKW A;  5DVB A;  3EWL A;  2H70 A;  3DGQ A;  1EP8 A;  2RUE A;  11GS A;  3TGZ A;  1NHY A;  1MDJ A;  1XBS A;  1Z5Y E;  2PUK C;  3DWV A;  2DKI A;  4KE3 A;  1JHB A;  4KSO A;  1GNW A;  3IHG A;  1A8L A;  1FHE A;  4BA7 A;  1K3O A;  2DJJ A;  1XWG A;  1H4O A;  2PVO C;  3ERG A;  5F0G A;  3D5J A;  2B7K A;  3ZFL A;  4G0I A;  3HHV A;  2H8L A;  3WGE A;  4WF5 A;  3A5W A;  4ZL8 A;  3QD9 A;  4MJA A;  2XBI A;  4BIK A;  5B8B A;  4G10 A;  2PU9 C;  3NOF A;  3ZIV A;  1FO5 A;  3APO A;  4IKH A;  3C71 A;  12GS A;  4V2M A;  4H86 A;  2K8S A;  4F82 A;  4JED A;  1TKD B;  3QFA C;  1NSW A;  3FR9 A;  3C1R A;  4FYU A;  3IA1 A;  1CQG A;  2KP2 A;  3VWW A;  3LQ7 A;  3F6F A;  2IJY A;  2VCV A;  1PX6 A;  3KTB A;  2H72 A;  1SJZ A;  2WCI A;  1ML6 A;  1QGV A;  2GZZ A;  1N2A A;  2WB9 A;  2IMF A;  4WBJ A;  2CZ2 A;  2EC4 A;  2HT9 A;  4MZC A;  5IMZ A;  3IBH A;  1YDK A;  4HUA A;  1U3I A;  3DVX A;  3ME7 A;  3N5O A;  2BMX A;  1XOA A;  3GRX A;  3GST A;  4V1A g;  2V41 A;  1O73 A;  2IME A;  4TXV A;  3TKQ A;  4D73 A;  2GT5 A;  4CDO A;  2UZ8 A;  1AQW A;  5ABR A;  1SD8 A;  3KMO A;  4MJE A;  5ECK B;  3I69 A;  3LOR A;  3TUE A;  2FWE A;  2OAD A;  4Q5F A;  1UN2 A;  1XIY A;  2OAC A;  4CY8 A;  5B6M A;  4EE0 A;  3C73 A;  2Z9S A;  3UJ1 A;  4OCE A;  2H75 A;  3TJF A;  4I8B A;  1YEX A;  2ON5 A;  4ZIJ A;  2KLX A;  1JLW A;  4DSS B;  5J4U A;  3WGD A;  3S9F A;  4FO5 A;  1KBN A;  3IAS 2;  3HD5 A;  5EY6 A;  4MPF A;  4V2N A;  1AC1 A;  4TXO B;  4F2I A;  3GH6 A;  4HU7 A;  4YQM A;  3L0H A;  1Y6E A;  1HQO A;  1HNC A;  1TRU A;  4TKY A;  5KOX A;  2EIR A;  2VOC A;  1YY7 A;  3TCO A;  2R5G A;  3UL3 A;  2DJK A;  2E0Q A;  3UAP A;  1XWC A;  2G0F A;  1PL2 A;  4HOJ A;  4TVE A;  1R7H A;  5IPH A;  2X8G A;  2ES7 A;  1ERU A;  1XWA A;  1B4P A;  5GAP D;  1TOF A;  1K0B A;  5C04 A;  4F0C A;  1T4Y A;  3P2A A;  1SK0 A;  4K6X A;  1QQ2 A;  2VD0 A;  1SL1 B;  3HZ8 A;  3GTU B;  4EDY A;  1EV9 A;  4XIH A;  1SK1 A;  2MBT A;  4DSQ A;  4A5P A;  1THO A;  3CSI A;  2HRA A;  3KEB A;  3L9S A;  2IFQ A;  5AIV A;  4YAP A;  2VUP A;  3KIJ A;  2QSI A;  2DC5 A;  4LA1 A;  2OJL A;  4GST A;  1B9Y C;  3UVH A;  1GLQ A;  4G0L A;  3MYD A;  4TXO A;  1M0U A;  1SL2 B;  1QUW A;  3CSH A;  4K7N A;  4N0Z A;  1FW1 A;  4BWS A;  1ST9 A;  1Z6M A;  2LNS A;  5DBQ A;  4N30 A;  2GDR A;  2L57 A;  4ZBB A;  1SYX A;  3TRP A;  1K0M A;  1PFO A;  1R5A A;  2XPD A;  3I43 A;  4QQ7 A;  5KEJ A;  2F3M A;  1GUK A;  4XS4 B;  1BJX A;  4POL A;  3GL3 A;  1GTI A;  3IDV A;  4N11 A;  3GH9 A;  4OO5 A;  1M3J A;  4KGI A;  4OFT A;  3FY7 A;  1K0O A;  1OAZ A;  5D96 A;  4ECC A;  3APS A;  4ZL7 A;  8GSS A;  4MDC A;  5G2Z A;  2AYT A;  3K8N A;  1FOV A;  1AUC A;  1NW2 A;  1G6W A;  3O76 A;  2BJX A;  2FD3 A;  3CSJ A;  5F8B A;  1G0T A;  4CY6 A;  3MDK A;  3ZZX A;  5F07 A;  2XBQ A;  3O3T A;  4HU9 A;  3FK8 A;  3P90 A;  2FNO A;  2ZNM A;  2VCW A;  5D9X A;  4PNG A;  4NHW A;  1SKW B;  2JSY A;  5IOW A;  4GQC A;  2CX3 A;  5ECI B;  3NIV A;  4KF9 A;  1PMT A;  3CMI A;  4EO3 A;  2E7P A;  2CX4 A;  4RQR A;  2HE3 A;  4JE1 A;  2XPE A;  2V6O A;  1S3R A;  2R6K A;  3P7X A;  3IC8 A;  1R4W A;  1TRS A;  3VFI A;  3EC3 A;  2B1K A;  1A0F A;  5G5F A;  1M2A A;  2IPA A;  4NHZ A;  2QA2 A;  4K2X A;  2IMD A;  4K7O A;  2I9H A;  5IMF A;  2H74 A;  3UBK A;  2RM6 A;  3D22 A;  5DQS A;  2LJK A;  2MMN A;  1YF1 A;  4LL4 B;  4XRA A;  2WJU A;  1GRX A;  1TJD A;  3VUR A;  2H30 A;  3I6A A;  2LTK A;  2M80 A;  5IQY A;  1GSQ A;  2GSS A;  3RPN A;  4GCI A;  3JCM L;  2LS5 A;  6GSX A;  2H1B A;  2VIM A;  3GN3 A;  1ERT A;  3EU4 A;  4K0G A;  1QXH A;  3IHQ A;  1IYH A;  2F51 A;  2C8U A;  2VCQ A;  3US3 A;  3VLN A;  4FYB A;  2YZU A;  1MDK A;  2R37 A;  4L0W A;  5CAX A;  5FHI A;  4K0N A;  2CZ3 A;  2GST A;  3BCI A;  3LYP A;  3KJY A;  5D9V A;  2ZCT A;  2DJ3 A;  3J7Y b;  3KCM A;  2C3Q A;  3ERF A;  1EGR A;  1JZR A;  3L78 A;  4Q5N A;  1A23 A;  3OR5 A;  1LBK A;  1BG5 A;  2JZS A;  10GS A;  2FWH A;  3FYG A;  1IYI A;  5LCZ A;  3U5R E;  1WWJ A;  3PPU A;  1Q4J A;  1Y25 A;  2IWT A;  3D6I A;  6GSY A;  1M2B A;  2YV7 A;  4JZQ A;  2AAW A;  2ON7 A;  4X43 A;  3ZRD A;  1AXD A;  1GSU A;  2LV3 A;  5JCG A;  3FEU A;  3RDW A;  1U3A A;  4WR4 A;  4FH8 A;  4NAX A;  1J08 A;  2F8F A;  4L5L A;  2WRT A;  2N5F A;  3FHK A;  1YKC A;  4Z7X A;  2FWG A;  3E0U A;  2YJH A;  3FR6 A;  1LJR A;  3UVT A;  4FYC A;  1GH2 A;  5FWG A;  2GS3 A;  4AJ7 A;  3C7M A;  3SWL A;  1BX9 A;  1ABA A;  3LSZ A;  3G7I A;  4K8M A;  5DDL A;  3TKS E;  3I9V 2;  1K3L A;  1A8Y A;  3A2X A;  2L6D A;  4IEL A;  4KCA A;  4LMV A;  2IN3 A;  1T00 A;  2H71 A;  4HJ2 A;  2MMZ A;  4X1U A;  2HZE B;  4F03 A;  9GSS A;  4TR3 A;  4ZL9 A;  6GSW A;  3GSS A;  2FHE A;  3M3M A;  1Z6N A;  1DE1 A;  2HFD A;  5G31 A;  5J9B A;  5H5S A;  1VF1 A;  4BVX A;  1NHO A;  3HJM A;  3CRT A;  2K9F A;  3IV4 A;  1RK4 A;  1WOU A;  5CO3 A;  2DMM A;  2R4V A;  5HR3 A;  3WT1 A;  2A2R A;  2C0E A;  3KM6 A;  4FIW A;  5ECL B;  4XRD A;  4L5O A;  4MAB A;  1M2D A;  2CVD A;  4O5Q A;  2A4H A;  1FVJ A;  2X99 A;  1PN9 A;  3BJ5 A;  3N9J A;  4PUF C;  1V98 A;  2O85 A;  1O7U A;  3KH7 A;  2M72 A;  1Q98 A;  1OC8 A;  3DVW A;  1OVN A;  5CYY A;  2H0H A;  1XCC A;  1PRX A;  3PR8 A;  4IP6 A;  2CA8 A;  2HSY A;  2O8V B;  2RII A;  3ZIJ A;  1JZW A;  4MF6 A;  1EOG A;  5CRH A;  3WGX A;  3L9V A;  2B3S A;  3G9B A;  4HS1 A;  1AIU A;  1K0C A;  4GF0 A;  3TB2 A;  1U87 A;  3TOU A;  3GKX A;  5G1K A;  4I5Q A;  3HDC A;  3GKK A;  5IMC A;  2LRC A;  2LRN A;  4YAV A;  1GSE A;  2MMO A;  2AHE A;  4HJM A;  2VL3 A;  4HSC X;  3BBY A;  4MF7 A;  4K9Z A;  2IL3 A;  1TU8 A;  4YKF A;  3QAG A;  2FCH A;  5D9W A;  3HJP A;  4XCS A;  1GSS A;  4TR1 B;  4ISD A;  4BVY B;  3H8Q A;  3LXT A;  5E4W A;  4KH7 A;  5DJL A;  3EYT A;  5ECN B;  3TRQ A;  5HFK A;  1YEP A;  3W6G A;  4BWQ A;  2YWO A;  1PGT A;  1U6T A;  2HXK A;  1GUH A;  1G7E A;  1V40 A;  4N10 A;  1JZD A;  4BPY A;  4IQA A;  2LKU A;  4QL7 A;  4O92 A;  4KB3 A;  2CVK A;  3DKS A;  4RQX A;  1NM3 A;  2L5O A;  1O8W A;  3RPP A;  1XZO A;  4O32 A;  1M3I A;  3MIX A;  5CRG A;  5B8A A;  4GTU A;  5CNW A;  4MCU A;  2LNT A;  2YJ7 A;  3Q6O A;  2R2J A;  4IJI A;  4LL1 B;  3VWX A;  2P5Q A;  3ZMK A;  1ZCP A;  3H93 A;  1SKS B;  1M99 A;  3TKR A;  4IS0 A;  2YNX A;  5JCW A;  2IMK A;  2PWJ A;  3GYK A;  1TW9 A;  5D9T A;  2F9S A;  2CAI A;  1F3B A;  4CW9 A;  1I9D A;  1GSF A;  2GZP A;  1R26 A;  1MD4 A;  2RLI A;  1V9W A;  5D8I A;  2JZT A;  3IXR A;  5F05 A;  5ID2 B;  1GNE A;  5IIZ A;  4OO4 A;  2MBS A;  3IPZ A;  1YKA A;  4KUN A;  4HZ2 A;  4MF5 A;  5DAL B;  4YQU A;  3EPT A;  5LNK e;  3MWH A;  1ACV A;  3ZML A;  2R0P A;  3GFK A;  1VF2 A;  2HLS A;  4ML1 A;  2H01 A;  19GS A;  2J9H A;  3IE3 A;  3KH9 A;  1AQX A;  4HZ4 A;  3C8E A;  3ZIT A;  1XFL A;  3QAW A;  4XS6 A;  1X5D A;  3M9K A;  3WD6 A;  4ECI A;  5JWO B;  2V6K A;  4MMM A;  2LST A;  2DLX A;  2OA7 A;  3BCK A;  3M8N A;  3QR6 A;  3CXG A;  1ZMA A;  3GV1 A;  4KA0 A;  3KD0 A;  1SJ6 A;  3UBL A;  1X0R A;  2LQO A;  5AIX A;  3UAR A;  4K1F A;  1XVW A;  1W4V A;  3GNJ A;  2VCX A;  4ULX A;  2KUC A;  2QGV A;  2PER A;  1ERV A;  1S3C A;  4YH2 A;  3DML A;  3IK9 A;  2VLT A;  4DSS A;  3UMA A;  1EOH A;  1B4Q A;  1JLV A;  4MJC A;  1TP9 A;  3W8S A;  2X4A A;  1Z3E A;  5L71 A;  4IP1 A;  6GSS A;  1EV4 A;  2YN1 A;  3VPT A;  2PBJ A;  3RHB A;  1MTC A;  1K3Y A;  2EIO A;  1EP7 A;  4EIQ A;  1PD2 1;  5ELG A;  4QL9 A;  3QMX A;  3TDG A;  1ZZY A;  4O5U A;  2OBK A;  1H75 A;  1FAA A;  3DEX A;  2L4Q A;  1GSD A;  3QFB C;  1KTE A;  4I6X A;  1ZL9 A;  2OKA A;  3GTU A;  2H73 A;  1SD9 A;  3IOS A;  2IMI A;  2NBS A;  5ECS A;  2LEG A;  2GSR A;  4FQU A;  2XHF A;  4K5R A;  1BAY A;  1F37 A;  3TRX A;  1T8E B;  2OBI A;  5EL8 A;  2O7K A;  1DUG A;  3C1S A;  5AGY A;  4WEY A;  1Z7R A;  1PX7 A;  3V1W A;  4N0V A;  2H0I A;  2B6M A;  3LW9 A;  2PGT A;  3A5I A;  3FW2 A;  20GS A;  3ZFB A;  3ZRE A;  1J0F A;  1K0A A;  2TRC P;  3HVS A;  2VCT A;  1AAZ A;  2G2Q A;  4KSM A;  4XS4 A;  1HD2 A;  4POK A;  3F3R A;  4TOP A;  4V1A p;  3QOU A;  2I4A A;  2DML A;  4J56 E;  4GSN A;  2YWN A;  4TR4 A;  2FA4 A;  5DQY A;  3PIN A;  2VL9 A;  3E9J B;  3R2Q A;  3QDN A;  2FWF A;  3KTL A;  5GAN D;  2FGX A;  1DSB A;  3FR3 A;  3GIX A;  2HI7 A;  3D21 A;  3F6D A;  5KN3 A;  5G5E A;  4OD7 A;  2KOK A;  5ECP B;  2HRK A;  3KGK A;  4K7I A;  2V1M A;  5IMA A;  4LMW A;  1U88 A;  1TK0 B;  3TKP A;  3Q19 A;  4WXT A;  5B6N A;  3VI5 A;  2XC2 A;  3GKN A;  4G2E A;  3BOA A;  2YCD A;  2RUF A;  3E3E A;  1RW1 A;  2VLU A;  3MNG A;  2GZY A;  1ZYN A;  1XXU A;  2N5B A;  4ECJ A;  3KP9 A;  2F8A A;  2JL4 A;  1A0R P;  1HNB A;  5EPF A;  1V57 A;  3HVX A;  4JRR A;  4PXO A;  1F6M C;  3FRC A;  4IGJ A;  3W8J A;  1F2E A;  2E2M A;  2FY6 A;  4Z2U A;  1B8X A;  1HYU A;  3KMN A;  4ZB6 A;  2AB6 A;  4EKZ A;  1TRV A;  1SJI A;  5B7C A;  3PGT A;  3F9U A;  4YQV A;  4L8E A;  3VK9 A;  3RHC A;  3TOT A;  5IMD A;  5DCG A;  4KAE A;  4F9Z A;  3KZQ A;  1GTU A;  3D4M A;  4GQF A;  4OFN A;  3IAM 2;  1M7T A;  5IM9 A;  4HQS A;  5HQP A;  3L9U A;  4EF0 A;  1ZGN A;  2GVP A;  2YV9 A;  6GST A;  1E6B A;  2GLR A;  2D2Z A;  2B1L A;  2H66 A;  2L6C A;  22GS A;  3F0I A;  3HVV A;  2AV4 A;  2J23 A;  1TI1 A;  2GTU A;  1S3A A;  2YZH A;  2HSH A;  2HNL A;  1MDI A;  1WIK A;  4HQZ A;  3SBC A;  18GS A;  3VI7 A;  3ZLP A;  1PL1 A;  5ENU A;  3FZA A;  2H19 A;  2NPB A;  4NPB A;  4BL7 B;  2P31 A;  1I5G A;  2L4C A;  2YPM A;  2QA1 A;  4ML6 A;  3CQF A;  4DEJ A;  3R3E A;  5LD0 A;  4MZB A;  2KP1 A;  3EUR A;  5J3R A;  5J5N A;  2JZR A;  2MYG A;  4XS1 A;  3KXO A;  1M9B A;  3LJR A;  2B5Y A;  1GLP A; 
#chains in the Genus database with same CATH homology
 2H0G A;  2V2G A;  3ZTL A;  1GWC A;  4IVF A;  1OYJ A;  2GGT A;  4KCE A;  4OCF A;  1XPV A;  3UIW A;  4DSR A;  3LYK A;  4G0K A;  4O7H A;  1FB0 A;  1OE8 A;  4RI6 A;  1V2A A;  1FOH A;  3FZ4 A;  4PTS A;  2K8V A;  1OKD A;  4GRF A;  4ECB A;  4ICY A;  1F3A A;  3CRU A;  4K2D A;  4EVM A;  4IBP A;  5IMV A;  5HR2 A;  3DRN A;  1TK8 B;  4NXI A;  4GLT A;  1PSQ A;  5A4V A;  1XOB A;  2H1G A;  2WZ9 A;  3G7J A;  4RUV A;  1BED A;  2HZE A;  4JR4 A;  4OWY A;  3ZVJ A;  2O89 A;  3DD3 A;  2PN8 A;  1SEN A;  5JWQ B;  6GSV A;  2X8C A;  2DIZ A;  3LEF A;  5CP1 A;  2LJR A;  3KP8 A;  2CVB A;  4NV5 A;  1X5E A;  2WFC A;  3F4T A;  3F8U A;  5HFI A;  1K0D A;  3TJG A;  2A4V A;  5INY A;  3VPQ A;  5IOX A;  1VRS D;  4MNN A;  2C0F A;  3IR4 A;  2CT6 A;  3H79 A;  2H1D A;  4EIP A;  5IO0 A;  4I2U A;  4G9H A;  3IRA A;  1LU4 A;  3MAK A;  2JSZ A;  4TW5 A;  4IHU A;  2CQ9 A;  3HY2 A;  1S3D A;  3P8W A;  4D73 B;  2MMA A;  1B9X C;  3LXZ A;  1ILO A;  4NMU A;  2B5X A;  3O6T A;  3QAV A;  1XVQ A;  3LWA A;  3CTF A;  2GQL A;  4F0B A;  1EEM A;  1A2L A;  5IPG A;  5JWR B;  3A2V A;  3ME8 A;  4PX1 A;  1J9B A;  3MSZ A;  5G1L A;  2PPT A;  2X64 A;  4MZW A;  2GQM A;  3F3Q A;  2VM1 A;  1SU9 A;  1W89 A;  5F06 A;  3HYP A;  5H5Q A;  2DJ2 A;  1HNA A;  5E59 A;  2HZF A;  2LJA A;  2LQQ A;  2HYX A;  2JAD A;  2M46 A;  1M9A A;  1CQH A;  3HXS A;  4TR0 A;  3PH9 A;  2YP6 A;  4WF4 A;  1PKW A;  1URM A;  2OE1 A;  2TRX A;  4TR1 A;  1GUM A;  4BVY A;  1WP0 A;  2VD1 A;  1XW6 A;  4HEA 2;  5J41 A;  4KDY A;  2H6X A;  1AW9 A;  4USS A;  4J2F A;  5BMU A;  2GSQ A;  1OE7 A;  3DXB A;  3HKR A;  1WE0 A;  2H6Y A;  2HSM A;  4PUA A;  2PVQ A;  4WBR D;  5KN1 A;  1EZK A;  2L5L A;  3UOM A;  3M1G A;  4GWR A;  5D93 A;  1Z7P A;  3GKM A;  1TI3 A;  3M0F A;  3A3T A;  4E8E A;  3H4K A;  4EXJ A;  1A2J A;  2H6Z A;  3GUR A;  2P0G A;  2RM5 A;  1T4Z A;  1TDI A;  4J57 E;  2GQK A;  2WGR A;  1GTB A;  2LRT A;  1PN0 A;  4PQH A;  4ZXG A;  3HZ4 A;  1G7O A;  1AQV A;  5ECO B;  3AY8 A;  2IFQ B;  4MLY A;  5C00 A;  4Z2T A;  1K0N A;  2P5R A;  2YAN A;  4EUY A;  2DIY A;  4CHS A;  1FB6 A;  4OFM A;  3D4T A;  1ZYE A;  4V2L A;  3EIN A;  5JCU A;  4L0U A;  1SL0 B;  2X49 A;  5ID2 A;  3CTG A;  5IO2 A;  4Q5R A;  4AF2 A;  2VLV A;  2WDU A;  3H1N A;  1O81 A;  1QK8 A;  4KDU A;  3TJK A;  5DAL A;  2QKE A;  1A24 A;  3Q18 A;  3D0Z A;  1QMV A;  3DYR A;  4IJ3 A;  6GSU A;  4PQI A;  2YOI A;  3EVI A;  3EMP A;  3GUS A;  3RAZ A;  3APQ A;  3GX0 A;  3CBU A;  3TKS A;  1X9M B;  3BD2 A;  1UVZ A;  1EEJ A;  5HFG A;  4K5S A;  2V32 A;  4MH2 A;  2A2P A;  13GS A;  4WR5 A;  4ZBD A;  1X9S B;  2VO4 A;  3QCP A;  5ECR B;  2IIY A;  2LUS A;  1V58 A;  1T1V A;  1E2Y A;  4X4J A;  17GS A;  5DJM A;  2NVL A;  2BTO T;  1O8X A;  4EC0 A;  5H5R A;  4X0X A;  2REM A;  3A2W A;  1VF3 A;  2B7J A;  2TIR A;  3LGC A;  4G19 A;  1DE2 A;  7GSS A;  4ZBA A;  2VM2 A;  2O87 A;  5ECM B;  4KND A;  3DIE A;  2HRN A;  3ZL5 A;  3EMX A;  1DBY A;  3ZVJ D;  2X8H A;  2WS2 A;  16GS A;  2YWM A;  4EL1 A;  2DKH A;  3TKS C;  2K6V A;  5ELA A;  4MA9 A;  2L59 A;  1MEK A;  3HJO A;  2FUG 2;  4RI7 A;  1R5P A;  3F4S A;  1WMJ A;  5KN0 A;  5CRE A;  1PA3 A;  1XWK A;  2YWI A;  1EWX A;  2I3Y A;  3CYN A;  4JU5 A;  1ZOF A;  1G6Y A;  2H76 A;  2C80 A;  5J9C A;  2C3T A;  4Q5Q A;  1UC7 A;  4MPG A;  4GXZ A;  2I81 A;  1TK5 B;  4TRX A;  4POM A;  3WYW A;  1ERW A;  1OKT A;  1TRW A;  1O6J A;  3HCZ A;  4WET A;  4KX4 A;  2ZUP A;  4GSS A;  4ACS A;  3TJJ A;  2I1U A;  3GL5 A;  5A5K A;  1GTA A;  2FLS A;  3F63 A;  3FMW A;  3IK7 A;  2CV4 A;  3ISO A;  4IW9 A;  3TJB A;  4YKG A;  1JZO A;  1TU7 A;  4AJ8 A;  2B5E A;  3FZ9 A;  3M9J A;  3F4R A;  5CRW A;  4MH3 A;  2C3N A;  4DVC A;  3J7Y k;  2VL2 A;  2C0G A;  1SKR B;  3VWV A;  2C0D A;  2A2S A;  5ECH B;  4NWY A;  4PNF A;  1ON4 A;  5HR0 A;  1PKZ A;  3FKF A;  3GHA A;  2DJ0 A;  1F9M A;  3FZ5 A;  1THX A;  3G7Y A;  5AIS A;  1B48 A;  5COH A;  4ILF A;  2VAF A;  4E8H A;  2DJ1 A;  4JBB A;  1OC3 A;  4I97 A;  4MP4 A;  3VWU A;  1GSY A;  2KHP A;  3RBT A;  2VCZ A;  2AJQ B;  2C1Y A;  3QPM A;  4IN0 A;  3Q74 A;  1WRY A;  2CAQ A;  2GT6 A;  4OMV A;  3UEM A;  1VF4 A;  1KEB A;  4ZB8 A;  5D73 A;  1WJK A;  2H1A A;  3GX8 A;  1GUL A;  3ED3 A;  4JR6 A;  1BYE A;  2VL2 C;  1N8J A;  1OC9 B;  2ALB A;  2C4J A;  5DCH A;  4ZB9 A;  5GSS A;  1EGO A;  4MJB A;  3GMF A;  2JAC A;  3HA9 A;  5HR1 A;  5G30 A;  5CRD A;  1A2M A;  2WUL A;  4P3Y B;  1BQ7 A;  4NV2 A;  4TN8 A;  1T7P B;  3EU3 A;  2OE3 A;  2QC7 A;  3EE2 A;  2MZC A;  2NTO A;  1GL8 A;  4PQ1 A;  4KW6 A;  1FG4 A;  5EVO A;  3ERW A;  5GZZ B;  1SYR A;  2AUV A;  1ZYQ B;  5DAK B;  3NZN A;  2N5A A;  2R0C A;  3L4N A;  1X5C A;  4BVX B;  1TTZ A;  3LG6 A;  1T3B A;  4HDE A;  2R0G A;  1YZX A;  1YF0 A;  1ZYP A;  5KN2 A;  2K18 A;  4IQ1 A;  3U6V A;  2HRF A;  4I2T A;  2E2G A;  1OC9 A;  4Z2R A;  1UA5 A;  1WPI A;  4EDZ A;  5GST A;  1USB A;  2EIQ A;  1C72 A;  4HI7 A;  2OE0 A;  4O5R A;  14GS A;  5A4W A;  4AJ6 A;  2FA8 A;  1YJ6 A;  2DBC A;  4PGT A;  5A4U A;  1XW9 A;  1TXX A;  5DAK A;  4XTS A;  1Z9H A;  2JU5 A;  5KOW A;  3IC4 A;  4XHM A;  1X9W B;  2NDO A;  5FT3 A;  3LFL A;  2DSA A;  3ZYW A;  1PQN A;  4AGS A;  5ECQ B;  5BRT A;  1RQM A;  1JFU A;  4LLR A;  4BL7 A;  1O85 A;  4POB A;  4PUR A;  1FVK A;  4MK3 A;  1KNG A;  1XW5 A;  1QFN A;  1SK2 A;  3GA4 A;  1VGL A;  1YQ1 A;  5AN1 A;  2R3X A;  4ID0 A;  2PMT A;  3WT2 A;  4KDX A;  1XWB A;  1GP1 A;  4ZIL A;  1MD3 A;  4WKW A;  5DVB A;  3EWL A;  2H70 A;  3DGQ A;  1EP8 A;  2RUE A;  11GS A;  3TGZ A;  1NHY A;  1MDJ A;  1XBS A;  1Z5Y E;  2PUK C;  3DWV A;  2DKI A;  4KE3 A;  1JHB A;  4KSO A;  1GNW A;  3IHG A;  1A8L A;  1FHE A;  4BA7 A;  1K3O A;  2DJJ A;  1XWG A;  1H4O A;  2PVO C;  3ERG A;  5F0G A;  3D5J A;  2B7K A;  3ZFL A;  4G0I A;  3HHV A;  2H8L A;  3WGE A;  4WF5 A;  3A5W A;  4ZL8 A;  3QD9 A;  4MJA A;  2XBI A;  5B8B A;  4G10 A;  2PU9 C;  3NOF A;  3ZIV A;  1FO5 A;  3APO A;  4IKH A;  3C71 A;  12GS A;  4V2M A;  4H86 A;  2K8S A;  4F82 A;  4JED A;  1TKD B;  3QFA C;  1NSW A;  3FR9 A;  3C1R A;  4FYU A;  3IA1 A;  1CQG A;  2KP2 A;  3VWW A;  3LQ7 A;  3F6F A;  2IJY A;  2VCV A;  1PX6 A;  3KTB A;  2H72 A;  1SJZ A;  2WCI A;  1ML6 A;  1QGV A;  2GZZ A;  1N2A A;  2WB9 A;  2IMF A;  4WBJ A;  2CZ2 A;  2EC4 A;  2HT9 A;  4MZC A;  5IMZ A;  3IBH A;  1YDK A;  4HUA A;  1U3I A;  3DVX A;  3ME7 A;  3N5O A;  2BMX A;  1XOA A;  3GRX A;  3GST A;  4V1A g;  2V41 A;  1O73 A;  2IME A;  4TXV A;  3TKQ A;  4D73 A;  2GT5 A;  4CDO A;  2UZ8 A;  1AQW A;  5ABR A;  1SD8 A;  3KMO A;  4MJE A;  5ECK B;  3I69 A;  3LOR A;  3TUE A;  2FWE A;  2OAD A;  4Q5F A;  1UN2 A;  1XIY A;  2OAC A;  4CY8 A;  5B6M A;  4EE0 A;  3C73 A;  2Z9S A;  3UJ1 A;  4OCE A;  2H75 A;  3TJF A;  4I8B A;  1YEX A;  2ON5 A;  4ZIJ A;  2KLX A;  1JLW A;  4DSS B;  5J4U A;  3WGD A;  3S9F A;  4FO5 A;  1KBN A;  3IAS 2;  3HD5 A;  5EY6 A;  4MPF A;  4V2N A;  1AC1 A;  4TXO B;  4F2I A;  3GH6 A;  4HU7 A;  4YQM A;  3L0H A;  1Y6E A;  1HQO A;  1HNC A;  1TRU A;  4TKY A;  5KOX A;  2EIR A;  2VOC A;  1YY7 A;  3TCO A;  2R5G A;  3UL3 A;  2DJK A;  2E0Q A;  3UAP A;  1XWC A;  2G0F A;  1PL2 A;  4HOJ A;  4TVE A;  1R7H A;  5IPH A;  2X8G A;  2ES7 A;  1ERU A;  1XWA A;  1B4P A;  5GAP D;  1TOF A;  1K0B A;  5C04 A;  4F0C A;  1T4Y A;  3P2A A;  1SK0 A;  4K6X A;  1QQ2 A;  2VD0 A;  1SL1 B;  3HZ8 A;  3GTU B;  4EDY A;  1EV9 A;  4XIH A;  1SK1 A;  2MBT A;  4DSQ A;  4A5P A;  1THO A;  3CSI A;  2HRA A;  3KEB A;  3L9S A;  2IFQ A;  5AIV A;  4YAP A;  2VUP A;  3KIJ A;  2QSI A;  2DC5 A;  4LA1 A;  2OJL A;  4GST A;  1B9Y C;  3UVH A;  1GLQ A;  4G0L A;  3MYD A;  4TXO A;  1M0U A;  1SL2 B;  1QUW A;  3CSH A;  4K7N A;  4N0Z A;  1FW1 A;  4BWS A;  1ST9 A;  1Z6M A;  2LNS A;  5DBQ A;  4N30 A;  2GDR A;  2L57 A;  4ZBB A;  1SYX A;  3TRP A;  1K0M A;  2XPD A;  1R5A A;  3I43 A;  4QQ7 A;  5KEJ A;  2F3M A;  1GUK A;  4XS4 B;  1BJX A;  4POL A;  3GL3 A;  1GTI A;  3IDV A;  4N11 A;  3GH9 A;  4OO5 A;  4KGI A;  4OFT A;  3FY7 A;  1K0O A;  1OAZ A;  5D96 A;  4ECC A;  3APS A;  4ZL7 A;  8GSS A;  4MDC A;  5G2Z A;  2AYT A;  3K8N A;  1FOV A;  1AUC A;  1NW2 A;  1G6W A;  3O76 A;  2BJX A;  2FD3 A;  3CSJ A;  5F8B A;  1G0T A;  4CY6 A;  3MDK A;  3ZZX A;  5F07 A;  2XBQ A;  3O3T A;  4HU9 A;  3FK8 A;  3P90 A;  2FNO A;  2ZNM A;  2VCW A;  5D9X A;  4PNG A;  4NHW A;  1SKW B;  2JSY A;  5IOW A;  4GQC A;  2CX3 A;  5ECI B;  3NIV A;  4KF9 A;  1PMT A;  3CMI A;  4EO3 A;  2E7P A;  2CX4 A;  4RQR A;  2HE3 A;  4JE1 A;  2XPE A;  2V6O A;  2R6K A;  3P7X A;  3IC8 A;  1R4W A;  1TRS A;  3VFI A;  3EC3 A;  2B1K A;  1A0F A;  5G5F A;  1M2A A;  2IPA A;  4NHZ A;  2QA2 A;  4K2X A;  2IMD A;  4K7O A;  2I9H A;  5IMF A;  2H74 A;  3UBK A;  2RM6 A;  3D22 A;  5DQS A;  2LJK A;  2MMN A;  1YF1 A;  4LL4 B;  4XRA A;  2WJU A;  1GRX A;  1TJD A;  3VUR A;  2H30 A;  3I6A A;  2LTK A;  2M80 A;  5IQY A;  1GSQ A;  2GSS A;  3RPN A;  4GCI A;  3JCM L;  2LS5 A;  6GSX A;  2H1B A;  2VIM A;  3GN3 A;  1ERT A;  3EU4 A;  4K0G A;  1QXH A;  3IHQ A;  1IYH A;  2F51 A;  2C8U A;  2VCQ A;  3US3 A;  3VLN A;  4FYB A;  2YZU A;  1MDK A;  2R37 A;  4L0W A;  5CAX A;  5FHI A;  4K0N A;  2CZ3 A;  2GST A;  3BCI A;  3LYP A;  3KJY A;  5D9V A;  2ZCT A;  2DJ3 A;  3J7Y b;  3KCM A;  2C3Q A;  3ERF A;  1EGR A;  1JZR A;  3L78 A;  4Q5N A;  1A23 A;  3OR5 A;  1LBK A;  1BG5 A;  2JZS A;  10GS A;  2FWH A;  3FYG A;  1IYI A;  5LCZ A;  3U5R E;  1WWJ A;  3PPU A;  1Q4J A;  1Y25 A;  2IWT A;  3D6I A;  6GSY A;  1M2B A;  2YV7 A;  4JZQ A;  2AAW A;  2ON7 A;  4X43 A;  3ZRD A;  1AXD A;  1GSU A;  2LV3 A;  5JCG A;  3FEU A;  3RDW A;  1U3A A;  4WR4 A;  4FH8 A;  4NAX A;  1J08 A;  2F8F A;  4L5L A;  2WRT A;  2N5F A;  3FHK A;  1YKC A;  4Z7X A;  2FWG A;  3E0U A;  2YJH A;  3FR6 A;  1LJR A;  3UVT A;  4FYC A;  1GH2 A;  5FWG A;  2GS3 A;  4AJ7 A;  3C7M A;  3SWL A;  1BX9 A;  1ABA A;  3LSZ A;  3G7I A;  4K8M A;  5DDL A;  3TKS E;  3I9V 2;  1K3L A;  1A8Y A;  3A2X A;  2L6D A;  4IEL A;  4KCA A;  4LMV A;  2IN3 A;  1T00 A;  2H71 A;  4HJ2 A;  2MMZ A;  4X1U A;  2HZE B;  4F03 A;  9GSS A;  4TR3 A;  4ZL9 A;  6GSW A;  3GSS A;  2FHE A;  3M3M A;  1Z6N A;  1DE1 A;  2HFD A;  5G31 A;  5J9B A;  5H5S A;  1VF1 A;  4BVX A;  1NHO A;  3HJM A;  3CRT A;  2K9F A;  3IV4 A;  1RK4 A;  1WOU A;  5CO3 A;  2DMM A;  2R4V A;  5HR3 A;  3WT1 A;  2A2R A;  2C0E A;  3KM6 A;  4FIW A;  5ECL B;  4XRD A;  4L5O A;  4MAB A;  1M2D A;  2CVD A;  4O5Q A;  2A4H A;  1FVJ A;  2X99 A;  1PN9 A;  3BJ5 A;  3N9J A;  4PUF C;  1V98 A;  2O85 A;  1O7U A;  3KH7 A;  2M72 A;  1Q98 A;  1OC8 A;  3DVW A;  1OVN A;  5CYY A;  2H0H A;  1XCC A;  1PRX A;  3PR8 A;  4IP6 A;  2CA8 A;  2HSY A;  2O8V B;  2RII A;  3ZIJ A;  1JZW A;  4MF6 A;  1EOG A;  5CRH A;  3WGX A;  3L9V A;  2B3S A;  3G9B A;  4HS1 A;  1AIU A;  1K0C A;  4GF0 A;  3TB2 A;  1U87 A;  3TOU A;  3GKX A;  5G1K A;  4I5Q A;  3HDC A;  3GKK A;  5IMC A;  2LRC A;  2LRN A;  4YAV A;  1GSE A;  2MMO A;  2AHE A;  4HJM A;  2VL3 A;  3BBY A;  4MF7 A;  4K9Z A;  2IL3 A;  1TU8 A;  4YKF A;  3QAG A;  2FCH A;  5D9W A;  3HJP A;  4XCS A;  1GSS A;  4TR1 B;  4ISD A;  4BVY B;  3H8Q A;  3LXT A;  5E4W A;  4KH7 A;  5DJL A;  3EYT A;  5ECN B;  3TRQ A;  5HFK A;  1YEP A;  3W6G A;  4BWQ A;  2YWO A;  1PGT A;  1U6T A;  2HXK A;  1GUH A;  1G7E A;  1V40 A;  4N10 A;  1JZD A;  4BPY A;  4IQA A;  2LKU A;  4QL7 A;  4O92 A;  4KB3 A;  2CVK A;  3DKS A;  4RQX A;  1NM3 A;  2L5O A;  1O8W A;  3RPP A;  1XZO A;  4O32 A;  3MIX A;  5CRG A;  5B8A A;  4GTU A;  5CNW A;  4MCU A;  2LNT A;  2YJ7 A;  3Q6O A;  2R2J A;  4IJI A;  4LL1 B;  3VWX A;  2P5Q A;  3ZMK A;  1ZCP A;  3H93 A;  1SKS B;  1M99 A;  3TKR A;  4IS0 A;  2YNX A;  5JCW A;  2IMK A;  2PWJ A;  3GYK A;  1TW9 A;  5D9T A;  2F9S A;  2CAI A;  1F3B A;  4CW9 A;  1I9D A;  1GSF A;  2GZP A;  1R26 A;  1MD4 A;  2RLI A;  1V9W A;  5D8I A;  2JZT A;  3IXR A;  5F05 A;  5ID2 B;  1GNE A;  5IIZ A;  4OO4 A;  2MBS A;  3IPZ A;  1YKA A;  4KUN A;  4HZ2 A;  4MF5 A;  5DAL B;  4YQU A;  3EPT A;  5LNK e;  3MWH A;  1ACV A;  3ZML A;  2R0P A;  3GFK A;  1VF2 A;  2HLS A;  4ML1 A;  2H01 A;  19GS A;  2J9H A;  3IE3 A;  3KH9 A;  1AQX A;  4HZ4 A;  3C8E A;  3ZIT A;  1XFL A;  3QAW A;  4XS6 A;  1X5D A;  3M9K A;  3WD6 A;  4ECI A;  5JWO B;  2V6K A;  4MMM A;  2LST A;  2DLX A;  2OA7 A;  3BCK A;  3M8N A;  3QR6 A;  3CXG A;  1ZMA A;  3GV1 A;  4KA0 A;  3KD0 A;  1SJ6 A;  3UBL A;  1X0R A;  2LQO A;  5AIX A;  3UAR A;  4K1F A;  1XVW A;  1W4V A;  3GNJ A;  2VCX A;  4ULX A;  2KUC A;  2QGV A;  2PER A;  1ERV A;  1S3C A;  4YH2 A;  3DML A;  3IK9 A;  2VLT A;  4DSS A;  3UMA A;  1EOH A;  1B4Q A;  1JLV A;  4MJC A;  1TP9 A;  3W8S A;  2X4A A;  1Z3E A;  5L71 A;  4IP1 A;  6GSS A;  1EV4 A;  2YN1 A;  3VPT A;  2PBJ A;  3RHB A;  1MTC A;  1K3Y A;  2EIO A;  1EP7 A;  4EIQ A;  1PD2 1;  5ELG A;  4QL9 A;  3QMX A;  3TDG A;  1ZZY A;  4O5U A;  2OBK A;  1H75 A;  1FAA A;  3DEX A;  2L4Q A;  1GSD A;  3QFB C;  1KTE A;  4I6X A;  1ZL9 A;  2OKA A;  3GTU A;  2H73 A;  1SD9 A;  3IOS A;  2IMI A;  2NBS A;  5ECS A;  2LEG A;  2GSR A;  4FQU A;  2XHF A;  4K5R A;  1BAY A;  1F37 A;  3TRX A;  1T8E B;  2OBI A;  5EL8 A;  2O7K A;  1DUG A;  3C1S A;  5AGY A;  4WEY A;  1Z7R A;  1PX7 A;  3V1W A;  4N0V A;  2H0I A;  2B6M A;  3LW9 A;  2PGT A;  3A5I A;  3FW2 A;  20GS A;  3ZFB A;  3ZRE A;  1J0F A;  1K0A A;  2TRC P;  3HVS A;  2VCT A;  1AAZ A;  2G2Q A;  4KSM A;  4XS4 A;  1HD2 A;  4POK A;  3F3R A;  4TOP A;  4V1A p;  3QOU A;  2I4A A;  2DML A;  4J56 E;  4GSN A;  2YWN A;  4TR4 A;  2FA4 A;  5DQY A;  3PIN A;  2VL9 A;  3E9J B;  3R2Q A;  3QDN A;  2FWF A;  3KTL A;  5GAN D;  2FGX A;  1DSB A;  3FR3 A;  3GIX A;  2HI7 A;  3D21 A;  3F6D A;  5KN3 A;  5G5E A;  4OD7 A;  2KOK A;  5ECP B;  2HRK A;  3KGK A;  4K7I A;  2V1M A;  5IMA A;  4LMW A;  1U88 A;  1TK0 B;  3TKP A;  3Q19 A;  4WXT A;  5B6N A;  3VI5 A;  2XC2 A;  3GKN A;  4G2E A;  3BOA A;  2YCD A;  2RUF A;  3E3E A;  1RW1 A;  2VLU A;  3MNG A;  2GZY A;  1ZYN A;  1XXU A;  2N5B A;  4ECJ A;  3KP9 A;  2F8A A;  2JL4 A;  1A0R P;  1HNB A;  5EPF A;  1V57 A;  3HVX A;  4JRR A;  4PXO A;  1F6M C;  3FRC A;  4IGJ A;  3W8J A;  1F2E A;  2E2M A;  2FY6 A;  4Z2U A;  1B8X A;  1HYU A;  3KMN A;  4ZB6 A;  2AB6 A;  4EKZ A;  1TRV A;  1SJI A;  5B7C A;  3PGT A;  3F9U A;  4YQV A;  4L8E A;  3VK9 A;  3RHC A;  3TOT A;  5IMD A;  5DCG A;  4KAE A;  4F9Z A;  3KZQ A;  1GTU A;  3D4M A;  4GQF A;  4OFN A;  3IAM 2;  1M7T A;  5IM9 A;  4HQS A;  5HQP A;  3L9U A;  4EF0 A;  1ZGN A;  2GVP A;  2YV9 A;  6GST A;  1E6B A;  2GLR A;  2D2Z A;  2B1L A;  2H66 A;  2L6C A;  22GS A;  3F0I A;  3HVV A;  2AV4 A;  2J23 A;  1TI1 A;  2GTU A;  1S3A A;  2YZH A;  2HSH A;  2HNL A;  1MDI A;  1WIK A;  4HQZ A;  3SBC A;  18GS A;  3VI7 A;  3ZLP A;  1PL1 A;  5ENU A;  3FZA A;  2H19 A;  2NPB A;  4NPB A;  4BL7 B;  2P31 A;  1I5G A;  2L4C A;  2YPM A;  2QA1 A;  4ML6 A;  4DEJ A;  3R3E A;  5LD0 A;  4MZB A;  2KP1 A;  3EUR A;  5J3R A;  5J5N A;  2JZR A;  2MYG A;  4XS1 A;  3KXO A;  1M9B A;  3LJR A;  2B5Y A;  1GLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...