3NZNA

The crystal structure of the glutaredoxin from methanosarcina mazei go1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
SNAVNLFGQKDRGNHVSGVDRGKVIMYGLSTCVWCKKTKKLLTDLGVDFDYVYVDRLEGKEEEEAVEEVRRFNPSVSFPTTIINDEKAIVGFKEKEIRESLGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin
publication title The crystal structure of the Glutaredoxin from Methanosarcina mazei Go1
rcsb
source organism Methanosarcina mazei
molecule tags Oxidoreductase
total genus 27
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3nznA00
2RLIA 3KH9A 1T1VA 4O5RA 6GSXA 3GX0A 4IVFA 2RUEA 3KZQA 3KGKA 5ABRA 2DIZA 3UMAA 5J41A 1G6WA 1WP0A 1URMA 1M0UA 1TRWA 1Z7RA 4J2FA 4KAEA 1T7PB 2V32A 2V2GA 3P7XA 1X5DA 3KTBA 4NPBA 1A8YA 3IC4A 3M0FA 5JWRB 4NV2A 1JZRA 2K8SA 2WS2A 4OFNA 4Q5QA 3DMLA 3H8QA 5KN1A 1JZDA 4IJ3A 1PMTA 4P3YB 5AIXA 4EDYA 1GSYA 2I4AA 2YJ7A 5DAKA 2FLSA 1YY7A 3VWUA 3IR4A 3VWXA 2WZ9A 4JR4A 2PGTA 2CVKA 3GYKA 3I69A 2PPTA 3DGQA 3BJ5A 2LS5A 2CT6A 3QMXA 4MDCA 1QK8A 4ECIA 4HUAA 5CREA 2DJ1A 18GSA 2R5GA 17GSA 1SJZA 3TOUA 2PBJA 4FH8A 4FO5A 4WR4A 5B6MA 3LYKA 2H0HA 3D4MA 1EGRA 5GSSA 5DCGA 3DKSA 4EE0A 3G7JA 2DMLA 2EIRA 5HR3A 4IW9A 4NWYA 3ZFLA 2X8HA 2C80A 4IS0A 2C0GA 3D21A 2DJ2A 2XHFA 1FO5A 2CZ3A 2KOKA 1LJRA 2FWFA 2VOCA 4DSSA 4F9ZA 4L0UA 1N8JA 2HNLA 2R2JA 4KCEA 2GQKA 3H79A 2V6OA 1J0FA 3LORA 3IV4A 2HRNA 2XPEA 4I6XA 5AGYA 3LQ7A 1F6MC 3TKSC 5H5RA 2IJYA 2YANA 2F8AA 4PXOA 1S3CA 1PL2A 4V2NA 2HZFA 1XPVA 2CV4A 2HSHA 3GKMA 2GSRA 2L4CA 3W8JA 3EWLA 2YJHA 1WE0A 1GH2A 2GZYA 4TOPA 1TK5B 3C1RA 3ZZXA 3IK9A 3CSIA 1KBNA 5FHIA 4WBRD 2VO4A 3EMXA 2L57A 4YH2A 1OKTA 4KE3A 5HR0A 5CO3A 1MDIA 2K8VA 1TDIA 1UN2A 3D6IA 5ENUA 1EGOA 1B8XA 3WGDA 4WKWA 3GRXA 1AC1A 3MSZA 1GSEA 4X0XA 4YQUA 3O6TA 2RM6A 4EO3A 4ECJA 4V1Ag 1EWXA 4OFTA 4L8EA 4AF2A 2IIYA 3RDWA 5EY6A 2O89A 3M9KA 2MMZA 2R3XA 1GTIA 3ZYWA 3GIXA 8GSSA 2OKAA 3KTLA 3HCZA 3QD9A 1ZL9A 2PWJA 3E0UA 1K0BA 4MF5A 3O76A 2VCZA 4Z7XA 3GSTA 2O87A 3TKSE 1O73A 4TR4A 4OWYA 3GMFA 5HR1A 5IO2A 1GTBA 1PKZA 2H72A 4HI7A 2P5QA 2MZCA 1V9WA 3CRTA 4HJMA 2Z9SA 12GSA 1AQVA 2CZ2A 5CRWA 3LYPA 4BPYA 2G0FA 4MZBA 3KCMA 3SBCA 2H01A 1Z6MA 2FD3A 1MD4A 2BJXA 4IQ1A 3ZL5A 5CYYA 5ID2B 1J08A 2MMNA 2LJKA 2WJUA 3KM6A 2MMOA 2N5FA 5ECOB 2VM1A 2MBTA 1V2AA 3ME7A 4IBPA 1K3YA 4KSMA 3GL5A 2N5BA 1X9SB 4WR5A 1AIUA 1PL1A 2HLSA 4BWSA 4AJ6A 5ECQB 2KLXA 4JRRA 1GLQA 2NTOA 2JSYA 1PA3A 2PMTA 3F4SA 1AQXA 2C3QA 2CVBA 2RM5A 3DWVA 3FZ4A 1WPIA 5KN0A 3U6VA 2H76A 4I2TA 4XIHA 3RBTA 3LSZA 4GLTA 3ZMKA 1V57A 3IHQA 3VWVA 1OYJA 4JZQA 1PSQA 5C04A 1XVQA 4NAXA 4ZL8A 4XTSA 2ON5A 4EVMA 2WB9A 3ED3A 4IHUA 1ERUA 5DJMA 5J9BA 2HZEB 2DJKA 2L6CA 5E59A 1K0OA 5F05A 2WCIA 2CAIA 1DSBA 1GSDA 1XVWA 1G7EA 4GTUA 3LEFA 1A0RP 5ECIB 3GURA 5ECKB 1GP1A 3TOTA 1AUCA 3IBHA 4YAVA 3PINA 1SL1B 2AYTA 3D5JA 1Q4JA 5J3RA 4YQMA 1R4WA 1XZOA 1VF3A 3ERFA 3GUSA 1A2LA 1GNWA 3G7YA 2XC2A 2ALBA 4RI6A 2PVQA 1O6JA 3HHVA 1M99A 3UL3A 20GSA 3I43A 2I1UA 4BVYA 4LLRA 4IP1A 4MK3A 2REMA 2CA8A 3UVTA 2B5YA 16GSA 2OJLA 1SU9A 2V1MA 5ECRB 5LCZA 2YZHA 1SKWB 3WGEA 4KX4A 1ABAA 3LGCA 2CVDA 4XHMA 2H1BA 3M8NA 3F6DA 4HDEA 4O92A 1X9MB 3QAVA 3IAM2 3M9JA 4ZB6A 4LA1A 4IN0A 4XS6A 4JBBA 2YNXA 3HY2A 4WEYA 1X5EA 2O8VB 2OBKA 5FT3A 1QMVA 2ZUPA 4XRDA 5HQPA 1RW1A 4I2UA 3ZFBA 1JHBA 4GSNA 2WGRA 4WBJA 2G2QA 3KXOA 5DALB 1FOVA 1K0CA 4CDOA 5F06A 3CSJA 3K8NA 5ECHB 5G5FA 3ZTLA 3I9V2 2VD0A 1X9WB 5A4VA 2HYXA 2J9HA 3KD0A 2FY6A 1HYUA 3HJMA 4OO4A 5A4UA 3M1GA 2YP6A 3TJJA 4DEJA 3UBKA 3PR8A 3EYTA 3GKXA 2KP1A 3F3QA 1V98A 2VL2A 4QQ7A 3VURA 1WJKA 3A2XA 3H1NA 4D73B 2GQMA 3L0HA 2GT6A 4ILFA 5ELAA 5IMFA 3MNGA 3OR5A 3IK7A 1F2EA 1YKAA 1JZOA 1GSSA 3GV1A 4FIWA 3L9UA 4V1Ap 2AJQB 1G6YA 2GTUA 1GUMA 3TJBA 1ST9A 1ILOA 2GZZA 1QXHA 4RI7A 5GZZB 5KEJA 5CNWA 5AN1A 1O81A 5AISA 4IELA 1TK8B 2A2SA 2K18A 2FHEA 4ZB8A 1FVKA 2HSYA 1Z5YE 4GQFA 2ZCTA 3GA4A 4PUAA 4RQXA 4BL7A 3TDGA 4POBA 4WF5A 2LV3A 3C1SA 2C4JA 5IM9A 3WYWA 2F51A 2A2RA 3CTFA 1HNAA 4OFMA 4RUVA 3ZVJA 4MF7A 1A8LA 1F37A 1HNCA 1YEPA 5ECMB 1TK0B 1TRVA 2BTOT 2AV4A 5H5SA 5J9CA 2WFCA 1Y25A 1T4ZA 3E9JB 4ECCA 1TRSA 1K3OA 5FWGA 1YEXA 3W6GA 3GH6A 1K3LA 2VM2A 3IA1A 3TJGA 4HU9A 3ZRDA 5ECPB 6GSSA 1U3IA 3HVSA 2TRXA 4KCAA 1Z7PA 3VI7A 3LXTA 3S9FA 2VCVA 1WOUA 2CAQA 1XIYA 1H75A 3QR6A 2R6KA 3RPNA 2ES7A 1XBSA 4N0VA 3F6FA 1XWGA 3MDKA 2DJJA 4EDZA 1O8XA 1XW9A 5ECNB 2VCXA 5G2ZA 1SYXA 2LJRA 2R37A 3M3MA 2OE3A 5IO0A 3RHBA 3C7MA 4ISDA 3GHAA 2LQOA 5DJLA 1OE7A 4KSOA 6GSVA 1BJXA 2IMFA 2N5AA 1Z6NA 1JZWA 1XCCA 1O85A 14GSA 1FB6A 3QAWA 2PERA 1U3AA 1X0RA 1OC8A 4GF0A 4QL9A 4MZWA 4E8EA 1O7UA 1TXXA 1ERWA 2NVLA 4K1FA 1SJIA 4J57E 1PX7A 2AB6A 1VF1A 2CX4A 1UA5A 3EINA 2HZEA 2HT9A 2F9SA 2YV9A 4EL1A 4IGJA 3F9UA 4GSSA 5D8IA 1KEBA 2B6MA 1OC9B 5ELGA 1VF4A 4CW9A 4KDXA 4F82A 4GXZA 3J7Yb 5IMDA 4ZB9A 2QC7A 4YQVA 2H1DA 3G7IA 4H86A 5IPGA 2DIYA 3PGTA 3KP8A 1GUKA 1AW9A 4O7HA 3O3TA 4XCSA 2H73A 1VGLA 4JE1A 1I9DA 2GS3A 5COHA 3GH9A 2I9HA 2ZNMA 4KUNA 3FZ9A 3WGXA 2JZRA 3BCKA 1LBKA 4ML6A 1TRUA 3QFAC 1B9YC 4HEA2 2CX3A 4K2DA 3WT1A 1K0DA 3P90A 3UJ1A 2LRCA 3IE3A 3NZNA 1SKRB 5HFGA 4K9ZA 2GSQA 1EEJA 2H30A 1K0NA 13GSA 2B5EA 4MJAA 3KEBA 3HZ8A 5JCUA 1EV4A 3VWWA 3H93A 4HOJA 2JACA 4XS4B 3CBUA 3EE2A 5J4UA 4V2MA 3Q74A 2PN8A 5G1KA 6GSTA 5D96A 2I3YA 1TU8A 2HE3A 2A4VA 2VCQA 1T8EB 1OKDA 2L4QA 2VIMA 4NHZA 2LRNA 4PGTA 1JLWA 3D4TA 4MPGA 3Q6OA 3LWAA 2L5LA 1ZYQB 2YZUA 3HA9A 2MBSA 1JFUA 2YOIA 1AXDA 3NIVA 2XPDA 3ZMLA 3KIJA 4GWRA 5AIVA 5DALA 4AJ8A 1K0AA 3MWHA 1GWCA 3L9SA 1XXUA 1I5GA 2VUPA 3UAPA 4K7OA 3ERGA 5JWQB 3RAZA 3NOFA 3CSHA 1BX9A 5GAND 2L6DA 1Y6EA 5IMAA 1TKDB 4OD7A 2TRCP 2X99A 5IMVA 6GSWA 2B7KA 1AAZA 3QCPA 2H8LA 3GL3A 2FA4A 9GSSA 4HQSA 3TRQA 4D73A 5EL8A 3FYGA 3AY8A 5G5EA 4F0BA 4JEDA 4POLA 3UEMA 3ZREA 1NW2A 1GL8A 4GSTA 1E2YA 4MPFA 1F3BA 4EXJA 1M2AA 5IOXA 4DSSB 1M2DA 4ZL7A 1HQOA 4MCUA 4PURA 1R5PA 5IPHA 3QOUA 1ML6A 4TR1A 2HI7A 3F0IA 2GSSA 3IDVA 5INYA 3Q18A 2JZSA 1CQHA 2DSAA 3F63A 2P5RA 3F4TA 1FVJA 1N2AA 1XWKA 7GSSA 4BA7A 4KDYA 3EU4A 1NHOA 2YWNA 3IXRA 2VLTA 1Z3EA 4AJ7A 4POMA 5CRGA 4O32A 2P31A 4POKA 4HJ2A 4NXIA 1OVNA 3KMOA 1A0FA 3FR6A 1PQNA 1YKCA 4ZBAA 2R4VA 3RPPA 4PX1A 5IOWA 4KNDA 1TP9A 5DVBA 2L59A 5E4WA 2GVPA 2LQQA 2C3TA 2GGTA 2K9FA 4MJEA 4MF6A 4RQRA 2B3SA 4G9HA 4JR6A 3DYRA 2V6KA 2LSTA 1XW5A 1TTZA 3GKNA 2VD1A 3GTUB 4FYCA 5CRDA 2H75A 4KW6A 4G2EA 3G9BA 1ZOFA 4OMVA 5D73A 3HJOA 1K0MA 1YDKA 1SD9A 4ZBBA 3TGZA 3GFKA 3APQA 1ZZYA 4MABA 2H19A 3TCOA 3WT2A 3R2QA 1BAYA 3DEXA 4PNFA 4J56E 5CRHA 2YPMA 1IYIA 2FCHA 3N5OA 1OC3A 2E2GA 4KDUA 2H6ZA 2FNOA 2DJ3A 4LL4B 4TRXA 4KA0A 2OACA 4IQAA 1DE1A 1A2JA 1XOAA 1ZYEA 4ZBDA 1USBA 2VAFA 3TJFA 1SL0B 3GSSA 1FG4A 2E7PA 4Q5FA 4IP6A 4NMUA 4PQHA 3DD3A 2O7KA 2MMAA 2OA7A 1V40A 2JADA 3QPMA 2NBSA 4WXTA 1PKWA 1FB0A 2ON7A 5B8AA 4ML1A 2QSIA 5KN2A 4CHSA 2O85A 2X8CA 1YZXA 4L5OA 5JCWA 3DIEA 4QL7A 4GCIA 2GDRA 3CYNA 2VL3A 5DQYA 19GSA 5HFKA 3A2VA 2YWMA 1SK2A 2NPBA 2XBQA 3DVXA 10GSA 1ON4A 4TVEA 3FRCA 6GSUA 4DSRA 1QQ2A 5HR2A 3HJPA 2QGVA 1XWCA 2WULA 4TR3A 2VLUA 2JU5A 3VPQA 2TIRA 4G10A 3ZITA 4GRFA 1UVZA 2H1GA 3EURA 4K7IA 2E0QA 4I5QA 4PQ1A 4TKYA 2YCDA 4NV5A 2EIOA 3L4NA 4EC0A 4MJBA 2B1LA 5F07A 3ZLPA 3CXGA 2VL2C 3FR9A 1GTAA 3VK9A 1M9BA 1ERVA 1KTEA 2JSZA 4F0CA 2RUFA 1Z9HA 3TRPA 5L71A 3APSA 5JWOB 3FY7A 6GSYA 1PN9A 4XS4A 2V41A 4V2LA 1EOHA 5CAXA 1B4QA 2MYGA 4EF0A 4N30A 1U87A 3VI5A 2OBIA 3VLNA 1XOBA 1GULA 5ECLB 4TN8A 3EVIA 3UBLA 1H4OA 2M72A 11GSA 2KP2A 4N10A 3BOAA 2KHPA 2C1YA 1WRYA 5D9TA 2YN1A 1EEMA 4MJCA 2X64A 1YF0A 1HNBA 2H71A 2H74A 3TKSA 1UC7A 1RK4A 1U88A 5A4WA 4MZCA 1QFNA 3LJRA 3QAGA 4OO5A 3L9VA 5ID2A 5JCGA 4DSQA 1EP8A 4I97A 4EKZA 1GSUA 1F9MA 1R7HA 2C3NA 4LL1B 4ZXGA 2EIQA 2PVOC 2IPAA 3E3EA 22GSA 3FK8A 2GLRA 1ZCPA 2FA8A 2LEGA 3LXZA 3U5RE 2D2ZA 3UARA 1XFLA 3F4RA 3P2AA 1NM3A 3QFBC 2F3MA 1WIKA 3BD2A 3V1WA 2DBCA 1DUGA 1W4VA 2H66A 3GKKA 4F03A 1EP7A 5EPFA 2AAWA 3Q19A 5LD0A 2BMXA 2JL4A 4HU7A 1T4YA 1F3AA 1TW9A 3FR3A 3IPZA 2B5XA 2LRTA 5F0GA 1PD21 2FWHA 1DBYA 4PNGA 3APOA 4MH2A 3ME8A 3BCIA 1S3DA 2H70A 1T3BA 2OE0A 5G30A 2IFQB 4TXOB 3HVVA 1SJ6A 4X43A 1YQ1A 1C72A 4ECBA 4WF4A 1GTUA 1EZKA 1Q98A 3ERWA 4ZL9A 2VLVA 1A24A 1BG5A 1TU7A 1SENA 1GSQA 3JCML 1NSWA 1IYHA 3FZ5A 2FWEA 4PQIA 2AHEA 1U6TA 3DRNA 3GN3A 2DLXA 5DCHA 1OE8A 3ISOA 1FW1A 1M2BA 2IL3A 1HD2A 2GQLA 1KNGA 3GNJA 1THOA 3KP9A 3ZIVA 3VFIA 3FKFA 3GTUA 2P0GA 4GQCA 2E2MA 5D93A 1A23A 3HVXA 1J9BA 3C73A 4OCFA 4LMVA 3KJYA 3HD5A 1G0TA 2FUG2 2VCWA 1SK1A 3US3A 1ZMAA 4X1UA 4HS1A 4KGIA 3ZIJA 4XRAA 4FYUA 5DBQA 3W8SA 3L78A 3PH9A 3FZAA 5LNKe 2M46A 2YWIA 1PRXA 4ACSA 1W89A 3DVWA 3FHKA 1EOGA 3LFLA 2DC5A 4K0NA 3UIWA 4TXVA 5DAKB 1XW6A 1PGTA 3HYPA 3IAS2 5D9XA 1B4PA 2IWTA 1YF1A 1XWBA 2GSTA 1QUWA 3BBYA 5G1LA 4PUFC 1BEDA 4KB3A 2H0GA 3D0ZA 1ACVA 2WRTA 5B8BA 2C8UA 2IMDA 4ZIJA 4FYBA 2X8GA 2C0FA 3UVHA 3A5WA 3H4KA 4MLYA 2B7JA 1QGVA 2HFDA 2GZPA 1TOFA 5GAPD 2IMEA 3EMPA 5H5QA 1SL2B 1GUHA 4Q5RA 5CP1A 5IMCA 4ZILA 4NHWA 5D9WA 4ULXA 4L5LA 1WWJA 2C0DA 5IIZA 3EU3A 4MMMA 4TW5A 3CMIA 3C71A 5A5KA 4ID0A 1GNEA 3CTGA 4N0ZA 3C8EA 2H6YA 3P8WA 1CQGA 5IMZA 1LU4A 3TKQA 3J7Yk 2B1KA 1THXA 2H0IA 4G19A 1SK0A 3IRAA 4HQZA 5EVOA 1T00A 3ZVJD 2CQ9A 3KMNA 4IJIA 4HZ4A 3HZ4A 2IMIA 5ECSA 3VPTA 1O8WA 2YWOA 3TKPA 3IOSA 4F2IA 4BVXA 1MD3A 2GT5A 3HDCA 4K8MA 5F8BA 5DQSA 2IN3A 1M7TA 2HXKA 1S3AA 2WDUA 3KH7A 1X5CA 2IMKA 3A2WA 1JLVA 1B48A 5D9VA 1PX6A 4JU5A 1NHYA 4E8HA 2LJAA 2L5OA 4YAPA 1MTCA 3LG6A 2M80A 1YJ6A 3TJKA 2LNTA 4K6XA 1B9XC 2PU9C 4TR0A 2DMMA 1VRSD 2C0EA 1RQMA 4N11A 1ERTA 1OAZA 1WMJA 3EC3A 4MH3A 2LNSA 2OADA 1SD8A 2JZTA 2K6VA 1XWAA 1DE2A 4MA9A 2QKEA 2EC4A 5J5NA 1AQWA 1V58A 1M9AA 5B6NA 2XBIA 2FGXA 1EV9A 3HKRA 1FAAA 5GSTA 4K7NA 1VF2A 1GLPA 5G31A 2RIIA 3SWLA 4AGSA 2LUSA 2H1AA 4BWQA 4Q5NA 3WD6A 2I81A 3MAKA 2LTKA 4MP4A 1R5AA 2F8FA 5IQYA 1TJDA 4EUYA 3N9JA 1SKSB 1FHEA 4XS1A 1ZGNA 4L0WA 4DVCA 1SYRA 1A2MA 1BQ7A 2J23A 4WETA 3A3TA 3HXSA 3F8UA 3I6AA 1GSFA 3FEUA 2H6XA 4OCEA 3F3RA 3DXBA 3TRXA 2FWGA 1G7OA 1GRXA 3TUEA 3GX8A 1MDJA 2NDOA 3QDNA 2AUVA 4LMWA 2VCTA 1R26A 5C00A 1OC9A 5KN3A 5DDLA 3TB2A 3CRUA 2IFQA 2YV7A 5HFIA 1TI3A 4TXOA 3D22A 3RHCA 2PUKC 4IKHA 1MDKA 2VL9A 1MEKA 1BYEA 4KH7A 2KUCA 2OE1A 5B7CA 2HRFA 2LKUA 4I8BA 4K0GA 4TR1B 3FW2A 3UOMA 1E6BA 4HZ2A 3TKRA 1TI1A 2DJ0A
chains in the Genus database with same CATH superfamily
2RLIA 3KH9A 4CY6A 1T1VA 4O5RA 6GSXA 3GX0A 4IVFA 2RUEA 3KZQA 3KGKA 5ABRA 2DIZA 3UMAA 1PN0A 5J41A 4USSA 1G6WA 1WP0A 1URMA 1M0UA 1TRWA 1Z7RA 4J2FA 4KAEA 1T7PB 2V32A 2V2GA 3P7XA 5KOXA 1X5DA 3KTBA 4NPBA 1A8YA 3IC4A 3M0FA 5JWRB 4NV2A 1JZRA 2K8SA 2WS2A 4OFNA 4Q5QA 3DMLA 3H8QA 5KN1A 1JZDA 4IJ3A 1PMTA 4P3YB 5AIXA 4EDYA 1GSYA 2I4AA 2YJ7A 5DAKA 2FLSA 1YY7A 3VWUA 3IR4A 3VWXA 2WZ9A 4JR4A 2PGTA 2CVKA 2R0CA 3GYKA 3I69A 2PPTA 3DGQA 3BJ5A 2LS5A 2CT6A 3QMXA 4MDCA 1QK8A 3IHGA 4ECIA 4HUAA 5CREA 2DJ1A 18GSA 2R5GA 17GSA 1SJZA 3TOUA 2PBJA 4FH8A 4FO5A 4WR4A 5B6MA 3LYKA 2H0HA 3D4MA 1EGRA 5GSSA 5DCGA 3DKSA 4EE0A 3G7JA 2DMLA 2EIRA 5HR3A 4MNNA 4IW9A 4NWYA 3ZFLA 2X8HA 2C80A 4IS0A 2C0GA 3D21A 2DJ2A 2XHFA 1FO5A 2CZ3A 2KOKA 4G0KA 1LJRA 2FWFA 2VOCA 4DSSA 4F9ZA 4L0UA 1N8JA 2HNLA 2R2JA 4KCEA 2GQKA 3H79A 2V6OA 1J0FA 3LORA 3IV4A 2HRNA 2XPEA 1XG8A 4I6XA 5AGYA 3LQ7A 1F6MC 3TKSC 5H5RA 2IJYA 2YANA 2F8AA 4PXOA 1S3CA 1PL2A 4V2NA 2HZFA 1XPVA 2CV4A 2HSHA 3GKMA 2GSRA 2L4CA 3W8JA 3EWLA 2YJHA 1WE0A 1GH2A 2GZYA 4TOPA 1TK5B 3C1RA 3ZZXA 3IK9A 3CSIA 1KBNA 5FHIA 4WBRD 2VO4A 3EMXA 2L57A 4YH2A 1OKTA 4KE3A 5HR0A 5CO3A 1MDIA 2K8VA 1TDIA 1UN2A 3D6IA 5ENUA 1EGOA 1B8XA 3WGDA 4WKWA 3GRXA 1AC1A 3MSZA 1GSEA 4X0XA 4YQUA 3O6TA 2RM6A 4EO3A 4ECJA 4V1Ag 1EWXA 4OFTA 4L8EA 4AF2A 2IIYA 3RDWA 5EY6A 2O89A 3M9KA 5BMUA 2MMZA 2HRAA 2R3XA 1GTIA 3ZYWA 3GIXA 8GSSA 2OKAA 3KTLA 3HCZA 3QD9A 1ZL9A 2PWJA 3E0UA 1K0BA 4MF5A 3O76A 2VCZA 4Z7XA 3GSTA 2O87A 3TKSE 1O73A 4TR4A 4OWYA 2DKHA 3GMFA 5HR1A 5IO2A 1GTBA 1PKZA 2H72A 4HI7A 2P5QA 2MZCA 1V9WA 3CRTA 4HJMA 2Z9SA 12GSA 1AQVA 2CZ2A 5CRWA 3LYPA 4BPYA 5BRTA 2G0FA 4MZBA 3KCMA 3SBCA 2H01A 1Z6MA 2FD3A 1MD4A 2BJXA 4IQ1A 3ZL5A 5CYYA 5ID2B 1J08A 2MMNA 2LJKA 2WJUA 3KM6A 2MMOA 2N5FA 5ECOB 2VM1A 2MBTA 1V2AA 3ME7A 4IBPA 1K3YA 4KSMA 3GL5A 2N5BA 1X9SB 4WR5A 1AIUA 4ICYA 1PL1A 2HLSA 4BWSA 4AJ6A 5ECQB 2KLXA 4JRRA 1GLQA 2NTOA 2JSYA 1PA3A 2PMTA 3F4SA 1AQXA 2C3QA 2CVBA 2RM5A 3DWVA 3FZ4A 1WPIA 5KN0A 3U6VA 2H76A 4I2TA 4XIHA 3RBTA 3LSZA 4GLTA 3ZMKA 1V57A 3IHQA 3VWVA 1OYJA 4JZQA 1PSQA 5C04A 1XVQA 4NAXA 4ZL8A 4XTSA 2ON5A 4EVMA 2WB9A 3ED3A 4IHUA 1ERUA 5DJMA 5J9BA 2HZEB 2DJKA 2L6CA 5E59A 1K0OA 5F05A 2WCIA 2CAIA 1DSBA 1GSDA 1XVWA 1G7EA 4GTUA 3LEFA 1A0RP 5ECIB 3GURA 5ECKB 1GP1A 3TOTA 1AUCA 3IBHA 4YAVA 3PINA 1M3JA 1SL1B 2AYTA 3D5JA 1Q4JA 5J3RA 4YQMA 1R4WA 1XZOA 1VF3A 3ERFA 3GUSA 1A2LA 2A4HA 1GNWA 3G7YA 2XC2A 2ALBA 4RI6A 2PVQA 1O6JA 3HHVA 1M99A 3UL3A 20GSA 3I43A 2I1UA 3PPUA 4BVYA 4LLRA 4IP1A 4MK3A 2REMA 2HSMA 2CA8A 3UVTA 2B5YA 16GSA 2OJLA 1SU9A 2V1MA 5ECRB 5LCZA 2YZHA 1SKWB 3WGEA 4KX4A 1ABAA 3LGCA 2CVDA 4XHMA 2H1BA 3M8NA 4O5UA 3F6DA 4HDEA 2R0GA 4O92A 1X9MB 3QAVA 3IAM2 3M9JA 4ZB6A 4LA1A 4IN0A 4XS6A 4JBBA 2YNXA 3HY2A 4WEYA 1X5EA 2O8VB 2OBKA 5FT3A 1QMVA 2ZUPA 4XRDA 5HQPA 1RW1A 4I2UA 3ZFBA 1JHBA 4GSNA 4YKGA 2WGRA 4WBJA 2G2QA 1FOHA 3KXOA 5DALB 1FOVA 1K0CA 4CDOA 5F06A 3CSJA 3K8NA 5ECHB 5G5FA 3ZTLA 3I9V2 2VD0A 1X9WB 5A4VA 2HYXA 2J9HA 3KD0A 2FY6A 1HYUA 3HJMA 4OO4A 5A4UA 3M1GA 2YP6A 3TJJA 4DEJA 3UBKA 3PR8A 3EYTA 3GKXA 2KP1A 3F3QA 1V98A 2VL2A 5KOWA 4QQ7A 3VURA 1WJKA 3A2XA 3H1NA 4D73B 2GQMA 3L0HA 2GT6A 4ILFA 5ELAA 5IMFA 3MNGA 3OR5A 3IK7A 1F2EA 1YKAA 1JZOA 1GSSA 3GV1A 4FIWA 3L9UA 4V1Ap 2AJQB 1G6YA 2GTUA 1GUMA 3TJBA 1ST9A 1ILOA 2GZZA 1QXHA 4RI7A 5GZZB 5KEJA 4BIKA 5CNWA 5AN1A 1O81A 5AISA 4IELA 1TK8B 2A2SA 2K18A 2FHEA 4ZB8A 1FVKA 2HSYA 1Z5YE 4GQFA 2ZCTA 3GA4A 4PUAA 4RQXA 4BL7A 3TDGA 4POBA 4WF5A 2LV3A 3C1SA 2C4JA 5IM9A 3WYWA 2F51A 2A2RA 3CTFA 1HNAA 4OFMA 4RUVA 3ZVJA 4MF7A 1A8LA 4Z2RA 1F37A 3LW9A 1HNCA 1YEPA 5ECMB 1TK0B 1TRVA 2BTOT 2AV4A 5H5SA 5J9CA 2WFCA 1M3IA 1Y25A 1T4ZA 3E9JB 4ECCA 1TRSA 1K3OA 5FWGA 4O5QA 1YEXA 3W6GA 3GH6A 1K3LA 2VM2A 3IA1A 3TJGA 4HU9A 3ZRDA 5ECPB 6GSSA 1U3IA 3HVSA 2TRXA 4KCAA 1Z7PA 3VI7A 3LXTA 2QA1A 3S9FA 2VCVA 1WOUA 2CAQA 1XIYA 1H75A 3QR6A 2R6KA 3RPNA 2ES7A 1XBSA 4N0VA 3F6FA 1XWGA 3MDKA 2DJJA 4EDZA 1O8XA 1XW9A 5ECNB 2VCXA 5G2ZA 1SYXA 2LJRA 2R37A 3M3MA 2OE3A 5IO0A 3RHBA 3C7MA 4ISDA 3GHAA 2LQOA 5DJLA 1OE7A 4KSOA 6GSVA 1BJXA 2IMFA 2N5AA 1Z6NA 1JZWA 1XCCA 1O85A 14GSA 1FB6A 3QAWA 2PERA 1U3AA 1X0RA 1ZYPA 1OC8A 4GF0A 4QL9A 4MZWA 4E8EA 1O7UA 1TXXA 1ERWA 2NVLA 4K1FA 1SJIA 4J57E 1PX7A 2AB6A 1VF1A 2CX4A 1UA5A 3EINA 2HZEA 2HT9A 2F9SA 2YV9A 4EL1A 4IGJA 3F9UA 4GSSA 5D8IA 1KEBA 2B6MA 1OC9B 5ELGA 1VF4A 4CW9A 4KDXA 4F82A 4GXZA 3J7Yb 2X49A 5IMDA 4ZB9A 2QC7A 4YQVA 2H1DA 3G7IA 4H86A 5IPGA 2DIYA 3PGTA 3KP8A 1GUKA 1AW9A 4O7HA 3O3TA 4XCSA 2H73A 1VGLA 4JE1A 4G0LA 1I9DA 2GS3A 5COHA 3GH9A 2I9HA 2ZNMA 4KUNA 3FZ9A 3WGXA 2JZRA 3BCKA 1LBKA 4ML6A 1TRUA 3QFAC 1B9YC 4HEA2 2CX3A 4K2DA 3WT1A 1K0DA 3P90A 3UJ1A 2LRCA 3IE3A 3NZNA 1SKRB 5HFGA 4K9ZA 2GSQA 1EEJA 2H30A 1K0NA 13GSA 2B5EA 4MJAA 3KEBA 3HZ8A 5JCUA 4FQUA 3HVNA 1EV4A 3VWWA 3H93A 4HOJA 2JACA 4XS4B 3CBUA 3EE2A 5J4UA 4V2MA 3Q74A 2PN8A 5G1KA 6GSTA 5D96A 2I3YA 1TU8A 2HE3A 2A4VA 2VCQA 1T8EB 1OKDA 2L4QA 2VIMA 4NHZA 2LRNA 4PGTA 1JLWA 3D4TA 4MPGA 3Q6OA 3LWAA 2L5LA 1ZYQB 2YZUA 3HA9A 2MBSA 4KF9A 1JFUA 2YOIA 1AXDA 3NIVA 2XPDA 3ZMLA 3KIJA 4GWRA 5AIVA 5DALA 4AJ8A 1K0AA 3MWHA 1GWCA 3IC8A 3L9SA 1XXUA 1I5GA 2VUPA 3UAPA 4K7OA 3ERGA 5JWQB 3RAZA 3NOFA 3CSHA 1BX9A 5GAND 2L6DA 1Y6EA 5IMAA 1TKDB 4OD7A 2TRCP 2X99A 5IMVA 6GSWA 2B7KA 1AAZA 3QCPA 2H8LA 3GL3A 2FA4A 9GSSA 4HQSA 3TRQA 4D73A 5EL8A 3FYGA 2X4AA 3AY8A 5G5EA 4F0BA 4JEDA 4POLA 3UEMA 3ZREA 1NW2A 1GL8A 4GSTA 1E2YA 4MPFA 1F3BA 4EXJA 1M2AA 5IOXA 4K5RA 4DSSB 1M2DA 4ZL7A 1HQOA 4MCUA 4PURA 1R5PA 5IPHA 3QOUA 1ML6A 4TR1A 2HI7A 3F0IA 2GSSA 3IDVA 5INYA 3Q18A 2JZSA 1CQHA 2DSAA 3F63A 2P5RA 3F4TA 1FVJA 1N2AA 1XWKA 7GSSA 4BA7A 4KDYA 3FMWA 3EU4A 1NHOA 2YWNA 3IXRA 2VLTA 1Z3EA 4AJ7A 4PTSA 4POMA 5CRGA 4O32A 2P31A 4POKA 4HJ2A 4NXIA 1OVNA 3KMOA 1A0FA 3FR6A 1PQNA 1YKCA 4ZBAA 4Z2UA 2R4VA 3RPPA 4PX1A 5IOWA 4KNDA 1TP9A 5DVBA 2L59A 4K2XA 2GVPA 2LQQA 2C3TA 5E4WA 2GGTA 2K9FA 4MJEA 4MF6A 4RQRA 2B3SA 4G9HA 4JR6A 3DYRA 2V6KA 2LSTA 1XW5A 1TTZA 3GKNA 2VD1A 3GTUB 4FYCA 5CRDA 2H75A 4KW6A 4G2EA 3G9BA 1ZOFA 4OMVA 5D73A 3HJOA 1K0MA 1YDKA 1SD9A 4ZBBA 3TGZA 3GFKA 3APQA 1ZZYA 2QA2A 4MABA 2H19A 3TCOA 3WT2A 3R2QA 1BAYA 3DEXA 4PNFA 4J56E 5CRHA 2YPMA 1IYIA 2FCHA 3N5OA 1OC3A 2E2GA 4KDUA 2H6ZA 2FNOA 2DJ3A 4LL4B 4TRXA 4KA0A 2OACA 4IQAA 1DE1A 1A2JA 1XOAA 1ZYEA 4ZBDA 1USBA 2VAFA 3TJFA 1SL0B 3GSSA 1FG4A 2E7PA 4Q5FA 4IP6A 4NMUA 4PQHA 3DD3A 2O7KA 2MMAA 2OA7A 2R0PA 1V40A 2JADA 3QPMA 2NBSA 4WXTA 1S3RA 1PKWA 1FB0A 2ON7A 5B8AA 2DKIA 4ML1A 2QSIA 5KN2A 4CHSA 2O85A 2X8CA 1YZXA 3R3EA 4L5OA 5JCWA 3DIEA 4QL7A 4GCIA 2GDRA 3CYNA 2VL3A 5DQYA 19GSA 5HFKA 3A2VA 2YWMA 1SK2A 2NPBA 2XBQA 3DVXA 10GSA 1ON4A 4TVEA 3FRCA 6GSUA 4DSRA 1QQ2A 5HR2A 3HJPA 2QGVA 1XWCA 2WULA 4TR3A 2VLUA 2JU5A 3VPQA 2TIRA 4G10A 3ZITA 4GRFA 1UVZA 2H1GA 3EURA 4K7IA 2E0QA 4I5QA 4PQ1A 4TKYA 2A2PA 2YCDA 4NV5A 4EIPA 2EIOA 3L4NA 4BVXB 4EC0A 4MJBA 2B1LA 5F07A 3ZLPA 3CXGA 2VL2C 3FR9A 1GTAA 3VK9A 1M9BA 1ERVA 1KTEA 4A5PA 2JSZA 4F0CA 2RUFA 1Z9HA 3TRPA 5L71A 3APSA 5JWOB 3FY7A 6GSYA 1PN9A 4XS4A 2V41A 4V2LA 1EOHA 5CAXA 4EIQA 1B4QA 2MYGA 4EF0A 4N30A 1U87A 3VI5A 2OBIA 3VLNA 1XOBA 1GULA 5ECLB 4TN8A 3EVIA 3UBLA 1H4OA 2M72A 11GSA 2KP2A 4N10A 4BVYB 3BOAA 3EPTA 4Z2TA 2KHPA 2C1YA 1WRYA 5D9TA 2YN1A 1EEMA 4MJCA 2X64A 1YF0A 1HNBA 2H71A 2H74A 3TKSA 1UC7A 1RK4A 1U88A 5A4WA 4MZCA 1QFNA 3LJRA 3QAGA 4OO5A 3L9VA 5ID2A 5JCGA 4DSQA 1EP8A 4I97A 4EKZA 1GSUA 1F9MA 1R7HA 2C3NA 4LL1B 4ZXGA 2EIQA 2PVOC 2IPAA 3E3EA 22GSA 3FK8A 2GLRA 1ZCPA 2FA8A 2LEGA 3LXZA 3U5RE 4HSCX 2D2ZA 3UARA 1XFLA 3F4RA 3P2AA 1NM3A 3QFBC 4YKFA 2F3MA 1WIKA 3BD2A 3V1WA 2DBCA 1DUGA 1W4VA 2H66A 3GKKA 4F03A 1EP7A 5EPFA 2AAWA 3Q19A 5LD0A 2BMXA 2JL4A 4HU7A 1T4YA 1F3AA 1TW9A 3FR3A 3IPZA 2B5XA 2LRTA 5F0GA 1PD21 2FWHA 1DBYA 4PNGA 3APOA 4MH2A 3ME8A 3BCIA 1S3DA 2H70A 3A5IA 1T3BA 2OE0A 5G30A 2IFQB 4TXOB 3HVVA 1SJ6A 4X43A 1YQ1A 1C72A 4ECBA 4WF4A 1GTUA 1EZKA 1Q98A 3ERWA 4ZL9A 2VLVA 1A24A 1BG5A 1TU7A 1SENA 1GSQA 3JCML 1NSWA 1IYHA 2HRKA 3FZ5A 2FWEA 4PQIA 2AHEA 1U6TA 3DRNA 3GN3A 2DLXA 2UZ8A 5DCHA 1OE8A 3ISOA 1FW1A 1M2BA 2IL3A 1HD2A 2GQLA 1KNGA 3GNJA 1THOA 3KP9A 3ZIVA 3VFIA 3FKFA 3GTUA 4BL7B 2P0GA 4GQCA 2E2MA 5D93A 1A23A 3HVXA 1J9BA 3C73A 4OCFA 4LMVA 3KJYA 3HD5A 1G0TA 2FUG2 2VCWA 1SK1A 3US3A 1ZMAA 4X1UA 4HS1A 4KGIA 3ZIJA 4XRAA 4FYUA 5DBQA 3W8SA 3L78A 3PH9A 3FZAA 5LNKe 2M46A 2YWIA 1PRXA 4ACSA 1W89A 3DVWA 3FHKA 1EOGA 3LFLA 2DC5A 4K0NA 3UIWA 4TXVA 5DAKB 1XW6A 1PGTA 3HYPA 3IAS2 5D9XA 1B4PA 2IWTA 1YF1A 1XWBA 2GSTA 1QUWA 3BBYA 5G1LA 4PUFC 1BEDA 4KB3A 2H0GA 3D0ZA 1ACVA 2WRTA 5B8BA 2C8UA 2IMDA 3MYDA 4ZIJA 4FYBA 2X8GA 2C0FA 3UVHA 3A5WA 4K5SA 3H4KA 4MLYA 2B7JA 1QGVA 2HFDA 2GZPA 4G0IA 1TOFA 5GAPD 2IMEA 3EMPA 5H5QA 1SL2B 1GUHA 4Q5RA 5CP1A 5IMCA 4ZILA 4NHWA 5D9WA 4ULXA 4L5LA 1WWJA 2C0DA 5IIZA 3EU3A 4MMMA 4TW5A 3CMIA 3C71A 5A5KA 4ID0A 1GNEA 3CTGA 4N0ZA 3C8EA 2H6YA 3P8WA 1CQGA 5IMZA 1LU4A 3TKQA 3J7Yk 2B1KA 1THXA 4CY8A 2H0IA 4G19A 1SK0A 3IRAA 4HQZA 5EVOA 1T00A 3ZVJD 3MIXA 2CQ9A 3KMNA 4IJIA 4HZ4A 3HZ4A 2IMIA 5ECSA 3VPTA 1O8WA 2YWOA 3TKPA 3IOSA 4F2IA 4BVXA 1MD3A 2GT5A 3HDCA 4K8MA 5F8BA 5DQSA 2IN3A 1M7TA 2HXKA 1S3AA 2WDUA 3KH7A 1X5CA 2IMKA 3A2WA 1JLVA 1B48A 5D9VA 1PX6A 4JU5A 1NHYA 4E8HA 2LJAA 2L5OA 4YAPA 1MTCA 3LG6A 2M80A 1YJ6A 3TJKA 2LNTA 4K6XA 1B9XC 2PU9C 4TR0A 2DMMA 1VRSD 2C0EA 1RQMA 4N11A 1ERTA 1OAZA 1WMJA 3EC3A 4MH3A 2LNSA 2OADA 1SD8A 2JZTA 2K6VA 4X4JA 1XWAA 1DE2A 4MA9A 2QKEA 2EC4A 5J5NA 1AQWA 1V58A 1M9AA 5B6NA 2XBIA 2FGXA 1EV9A 3HKRA 1FAAA 5GSTA 3CQFA 4K7NA 1VF2A 1GLPA 1ZYNA 5G31A 2RIIA 3SWLA 4AGSA 2LUSA 2H1AA 4BWQA 4Q5NA 3WD6A 2I81A 3MAKA 2LTKA 4MP4A 1R5AA 2F8FA 5IQYA 1TJDA 4EUYA 3N9JA 1SKSB 1FHEA 4XS1A 1ZGNA 4L0WA 4DVCA 1SYRA 1A2MA 1BQ7A 2J23A 4WETA 3A3TA 3HXSA 3F8UA 3I6AA 1GSFA 3FEUA 2H6XA 4OCEA 3F3RA 3DXBA 3TRXA 2FWGA 1G7OA 1GRXA 3TUEA 3GX8A 1MDJA 2NDOA 3QDNA 2AUVA 4LMWA 2VCTA 1R26A 5C00A 1OC9A 5KN3A 5DDLA 3TB2A 3CRUA 2IFQA 2YV7A 5HFIA 1TI3A 4TXOA 3D22A 3RHCA 2PUKC 4IKHA 1MDKA 2VL9A 1MEKA 1BYEA 4KH7A 2KUCA 2OE1A 5B7CA 2HRFA 2LKUA 4I8BA 4K0GA 4TR1B 3FW2A 3UOMA 1E6BA 4HZ2A 3TKRA 1PFOA 1TI1A 2DJ0A
chains in the Genus database with same CATH topology
2RLIA 3KH9A 4CY6A 1T1VA 4O5RA 6GSXA 3GX0A 4IVFA 2RUEA 3KZQA 3KGKA 5ABRA 2DIZA 3UMAA 1PN0A 5J41A 4USSA 1G6WA 1WP0A 1URMA 1M0UA 1TRWA 1Z7RA 4J2FA 4KAEA 1T7PB 2V32A 2V2GA 3P7XA 5KOXA 1X5DA 3KTBA 4NPBA 1A8YA 3IC4A 3M0FA 5JWRB 4NV2A 1JZRA 2K8SA 2WS2A 4OFNA 4Q5QA 3DMLA 3H8QA 5KN1A 1JZDA 4IJ3A 1PMTA 4P3YB 5AIXA 4EDYA 1GSYA 2I4AA 2YJ7A 5DAKA 2FLSA 1YY7A 3VWUA 3IR4A 3VWXA 2WZ9A 4JR4A 2PGTA 2CVKA 2R0CA 3GYKA 3I69A 2PPTA 3DGQA 3BJ5A 2LS5A 2CT6A 3QMXA 4MDCA 1QK8A 3IHGA 4ECIA 4HUAA 5CREA 2DJ1A 18GSA 2R5GA 17GSA 1SJZA 3TOUA 2PBJA 4FH8A 4FO5A 4WR4A 5B6MA 3LYKA 2H0HA 3D4MA 1EGRA 5GSSA 5DCGA 3DKSA 4EE0A 3G7JA 2DMLA 2EIRA 5HR3A 4MNNA 4IW9A 4NWYA 3ZFLA 2X8HA 2C80A 4IS0A 2C0GA 3D21A 2DJ2A 2XHFA 1FO5A 2CZ3A 2KOKA 4G0KA 1LJRA 2FWFA 2VOCA 4DSSA 4F9ZA 4L0UA 1N8JA 2HNLA 2R2JA 4KCEA 2GQKA 3H79A 2V6OA 1J0FA 3LORA 3IV4A 2HRNA 2XPEA 4I6XA 5AGYA 3LQ7A 1F6MC 3TKSC 5H5RA 2IJYA 2YANA 2F8AA 4PXOA 1S3CA 1PL2A 4V2NA 2HZFA 1XPVA 2CV4A 2HSHA 3GKMA 2GSRA 2L4CA 3W8JA 3EWLA 2YJHA 1WE0A 1GH2A 2GZYA 4TOPA 1TK5B 3C1RA 3ZZXA 3IK9A 3CSIA 1KBNA 5FHIA 4WBRD 2VO4A 3EMXA 2L57A 4YH2A 1OKTA 4KE3A 5HR0A 5CO3A 1MDIA 2K8VA 1TDIA 1UN2A 3D6IA 5ENUA 1EGOA 1B8XA 3WGDA 4WKWA 3GRXA 1AC1A 3MSZA 1GSEA 4X0XA 4YQUA 3O6TA 2RM6A 4EO3A 4ECJA 4V1Ag 1EWXA 4OFTA 4L8EA 4AF2A 2IIYA 3RDWA 5EY6A 2O89A 3M9KA 5BMUA 2MMZA 2HRAA 2R3XA 1GTIA 3ZYWA 3GIXA 8GSSA 2OKAA 3KTLA 3HCZA 3QD9A 1ZL9A 2PWJA 3E0UA 1K0BA 4MF5A 3O76A 2VCZA 4Z7XA 3GSTA 2O87A 3TKSE 1O73A 4TR4A 4OWYA 2DKHA 3GMFA 5HR1A 5IO2A 1GTBA 1PKZA 2H72A 4HI7A 2P5QA 2MZCA 1V9WA 3CRTA 4HJMA 2Z9SA 12GSA 1AQVA 2CZ2A 5CRWA 3LYPA 4BPYA 5BRTA 2G0FA 4MZBA 3KCMA 3SBCA 2H01A 1Z6MA 2FD3A 1MD4A 2BJXA 4IQ1A 3ZL5A 5CYYA 5ID2B 1J08A 2MMNA 2LJKA 2WJUA 3KM6A 2MMOA 2N5FA 5ECOB 2VM1A 2MBTA 1V2AA 3ME7A 4IBPA 1K3YA 4KSMA 3GL5A 2N5BA 1X9SB 4WR5A 1AIUA 4ICYA 1PL1A 2HLSA 4BWSA 4AJ6A 5ECQB 2KLXA 4JRRA 1GLQA 2NTOA 2JSYA 1PA3A 2PMTA 3F4SA 1AQXA 2C3QA 2CVBA 2RM5A 3DWVA 3FZ4A 1WPIA 5KN0A 3U6VA 2H76A 4I2TA 4XIHA 3RBTA 3LSZA 4GLTA 3ZMKA 1V57A 3IHQA 3VWVA 1OYJA 4JZQA 1PSQA 5C04A 1XVQA 4NAXA 4ZL8A 4XTSA 2ON5A 4EVMA 2WB9A 3ED3A 4IHUA 1ERUA 5DJMA 5J9BA 2HZEB 2DJKA 2L6CA 5E59A 1K0OA 5F05A 2WCIA 2CAIA 1DSBA 1GSDA 1XVWA 1G7EA 4GTUA 3LEFA 1A0RP 5ECIB 3GURA 5ECKB 1GP1A 3TOTA 1AUCA 3IBHA 4YAVA 3PINA 1SL1B 2AYTA 3D5JA 1Q4JA 5J3RA 4YQMA 1R4WA 1XZOA 1VF3A 3ERFA 3GUSA 1A2LA 2A4HA 1GNWA 3G7YA 2XC2A 2ALBA 4RI6A 2PVQA 1O6JA 3HHVA 1M99A 3UL3A 20GSA 3I43A 2I1UA 3PPUA 4BVYA 4LLRA 4IP1A 4MK3A 2REMA 2HSMA 2CA8A 3UVTA 2B5YA 16GSA 2OJLA 1SU9A 2V1MA 5ECRB 5LCZA 2YZHA 1SKWB 3WGEA 4KX4A 1ABAA 3LGCA 2CVDA 4XHMA 2H1BA 3M8NA 4O5UA 3F6DA 4HDEA 2R0GA 4O92A 1X9MB 3QAVA 3IAM2 3M9JA 4ZB6A 4LA1A 4IN0A 4XS6A 4JBBA 2YNXA 3HY2A 4WEYA 1X5EA 2O8VB 2OBKA 5FT3A 1QMVA 2ZUPA 4XRDA 5HQPA 1RW1A 4I2UA 3ZFBA 1JHBA 4GSNA 4YKGA 2WGRA 4WBJA 2G2QA 1FOHA 3KXOA 5DALB 1FOVA 1K0CA 4CDOA 5F06A 3CSJA 3K8NA 5ECHB 5G5FA 3ZTLA 3I9V2 2VD0A 1X9WB 5A4VA 2HYXA 2J9HA 3KD0A 2FY6A 1HYUA 3HJMA 4OO4A 5A4UA 3M1GA 2YP6A 3TJJA 4DEJA 3UBKA 3PR8A 3EYTA 3GKXA 2KP1A 3F3QA 1V98A 2VL2A 5KOWA 4QQ7A 3VURA 1WJKA 3A2XA 3H1NA 4D73B 2GQMA 3L0HA 2GT6A 4ILFA 5ELAA 5IMFA 3MNGA 3OR5A 3IK7A 1F2EA 1YKAA 1JZOA 1GSSA 3GV1A 4FIWA 3L9UA 4V1Ap 2AJQB 1G6YA 2GTUA 1GUMA 3TJBA 1ST9A 1ILOA 2GZZA 1QXHA 4RI7A 5GZZB 5KEJA 5CNWA 5AN1A 1O81A 5AISA 4IELA 1TK8B 2A2SA 2K18A 2FHEA 4ZB8A 1FVKA 2HSYA 1Z5YE 4GQFA 2ZCTA 3GA4A 4PUAA 4RQXA 4BL7A 3TDGA 4POBA 4WF5A 2LV3A 3C1SA 2C4JA 5IM9A 3WYWA 2F51A 2A2RA 3CTFA 1HNAA 4OFMA 4RUVA 3ZVJA 4MF7A 1A8LA 4Z2RA 1F37A 3LW9A 1HNCA 1YEPA 5ECMB 1TK0B 1TRVA 2BTOT 2AV4A 5H5SA 5J9CA 2WFCA 1Y25A 1T4ZA 3E9JB 4ECCA 1TRSA 1K3OA 5FWGA 4O5QA 1YEXA 3W6GA 3GH6A 1K3LA 2VM2A 3IA1A 3TJGA 4HU9A 3ZRDA 5ECPB 6GSSA 1U3IA 3HVSA 2TRXA 4KCAA 1Z7PA 3VI7A 3LXTA 2QA1A 3S9FA 2VCVA 1WOUA 2CAQA 1XIYA 1H75A 3QR6A 2R6KA 3RPNA 2ES7A 1XBSA 4N0VA 3F6FA 1XWGA 3MDKA 2DJJA 4EDZA 1O8XA 1XW9A 5ECNB 2VCXA 5G2ZA 1SYXA 2LJRA 2R37A 3M3MA 2OE3A 5IO0A 3RHBA 3C7MA 4ISDA 3GHAA 2LQOA 5DJLA 1OE7A 4KSOA 6GSVA 1BJXA 2IMFA 2N5AA 1Z6NA 1JZWA 1XCCA 1O85A 14GSA 1FB6A 3QAWA 2PERA 1U3AA 1X0RA 1ZYPA 1OC8A 4GF0A 4QL9A 4MZWA 4E8EA 1O7UA 1TXXA 1ERWA 2NVLA 4K1FA 1SJIA 4J57E 1PX7A 2AB6A 1VF1A 2CX4A 1UA5A 3EINA 2HZEA 2HT9A 2F9SA 2YV9A 4EL1A 4IGJA 3F9UA 4GSSA 5D8IA 1KEBA 2B6MA 1OC9B 5ELGA 1VF4A 4CW9A 4KDXA 4F82A 4GXZA 3J7Yb 2X49A 5IMDA 4ZB9A 2QC7A 4YQVA 2H1DA 3G7IA 4H86A 5IPGA 2DIYA 3PGTA 3KP8A 1GUKA 1AW9A 4O7HA 3O3TA 4XCSA 2H73A 1VGLA 4JE1A 4G0LA 1I9DA 2GS3A 5COHA 3GH9A 2I9HA 2ZNMA 4KUNA 3FZ9A 3WGXA 2JZRA 3BCKA 1LBKA 4ML6A 1TRUA 3QFAC 1B9YC 4HEA2 2CX3A 4K2DA 3WT1A 1K0DA 3P90A 3UJ1A 2LRCA 3IE3A 3NZNA 1SKRB 5HFGA 4K9ZA 2GSQA 1EEJA 2H30A 1K0NA 13GSA 2B5EA 4MJAA 3KEBA 3HZ8A 5JCUA 4FQUA 1EV4A 3VWWA 3H93A 4HOJA 2JACA 4XS4B 3CBUA 3EE2A 5J4UA 4V2MA 3Q74A 2PN8A 5G1KA 6GSTA 5D96A 2I3YA 1TU8A 2HE3A 2A4VA 2VCQA 1T8EB 1OKDA 2L4QA 2VIMA 4NHZA 2LRNA 4PGTA 1JLWA 3D4TA 4MPGA 3Q6OA 3LWAA 2L5LA 1ZYQB 2YZUA 3HA9A 2MBSA 4KF9A 1JFUA 2YOIA 1AXDA 3NIVA 2XPDA 3ZMLA 3KIJA 4GWRA 5AIVA 5DALA 4AJ8A 1K0AA 3MWHA 1GWCA 3IC8A 3L9SA 1XXUA 1I5GA 2VUPA 3UAPA 4K7OA 3ERGA 5JWQB 3RAZA 3NOFA 3CSHA 1BX9A 5GAND 2L6DA 1Y6EA 5IMAA 1TKDB 4OD7A 2TRCP 2X99A 5IMVA 6GSWA 2B7KA 1AAZA 3QCPA 2H8LA 3GL3A 2FA4A 9GSSA 4HQSA 3TRQA 4D73A 5EL8A 3FYGA 2X4AA 3AY8A 5G5EA 4F0BA 4JEDA 4POLA 3UEMA 3ZREA 1NW2A 1GL8A 4GSTA 1E2YA 4MPFA 1F3BA 4EXJA 1M2AA 5IOXA 4K5RA 4DSSB 1M2DA 4ZL7A 1HQOA 4MCUA 4PURA 1R5PA 5IPHA 3QOUA 1ML6A 4TR1A 2HI7A 3F0IA 2GSSA 3IDVA 5INYA 3Q18A 2JZSA 1CQHA 2DSAA 3F63A 2P5RA 3F4TA 1FVJA 1N2AA 1XWKA 7GSSA 4BA7A 4KDYA 3FMWA 3EU4A 1NHOA 2YWNA 3IXRA 2VLTA 1Z3EA 4AJ7A 4PTSA 4POMA 5CRGA 4O32A 2P31A 4POKA 4HJ2A 4NXIA 1OVNA 3KMOA 1A0FA 3FR6A 1PQNA 1YKCA 4ZBAA 4Z2UA 2R4VA 3RPPA 4PX1A 5IOWA 4KNDA 1TP9A 5DVBA 2L59A 4K2XA 2GVPA 2LQQA 2C3TA 5E4WA 2GGTA 2K9FA 4MJEA 4MF6A 4RQRA 2B3SA 4G9HA 4JR6A 3DYRA 2V6KA 2LSTA 1XW5A 1TTZA 3GKNA 2VD1A 3GTUB 4FYCA 5CRDA 2H75A 4KW6A 4G2EA 3G9BA 1ZOFA 4OMVA 5D73A 3HJOA 1K0MA 1YDKA 1SD9A 4ZBBA 3TGZA 3GFKA 3APQA 1ZZYA 2QA2A 4MABA 2H19A 3TCOA 3WT2A 3R2QA 1BAYA 3DEXA 4PNFA 4J56E 5CRHA 2YPMA 1IYIA 2FCHA 3N5OA 1OC3A 2E2GA 4KDUA 2H6ZA 2FNOA 2DJ3A 4LL4B 4TRXA 4KA0A 2OACA 4IQAA 1DE1A 1A2JA 1XOAA 1ZYEA 4ZBDA 1USBA 2VAFA 3TJFA 1SL0B 3GSSA 1FG4A 2E7PA 4Q5FA 4IP6A 4NMUA 4PQHA 3DD3A 2O7KA 2MMAA 2OA7A 2R0PA 1V40A 2JADA 3QPMA 2NBSA 4WXTA 1PKWA 1FB0A 2ON7A 5B8AA 2DKIA 4ML1A 2QSIA 5KN2A 4CHSA 2O85A 2X8CA 1YZXA 3R3EA 4L5OA 5JCWA 3DIEA 4QL7A 4GCIA 2GDRA 3CYNA 2VL3A 5DQYA 19GSA 5HFKA 3A2VA 2YWMA 1SK2A 2NPBA 2XBQA 3DVXA 10GSA 1ON4A 4TVEA 3FRCA 6GSUA 4DSRA 1QQ2A 5HR2A 3HJPA 2QGVA 1XWCA 2WULA 4TR3A 2VLUA 2JU5A 3VPQA 2TIRA 4G10A 3ZITA 4GRFA 1UVZA 2H1GA 3EURA 4K7IA 2E0QA 4I5QA 4PQ1A 4TKYA 2A2PA 2YCDA 4NV5A 4EIPA 2EIOA 3L4NA 4BVXB 4EC0A 4MJBA 2B1LA 5F07A 3ZLPA 3CXGA 2VL2C 3FR9A 1GTAA 3VK9A 1M9BA 1ERVA 1KTEA 4A5PA 2JSZA 4F0CA 2RUFA 1Z9HA 3TRPA 5L71A 3APSA 5JWOB 3FY7A 6GSYA 1PN9A 4XS4A 2V41A 4V2LA 1EOHA 5CAXA 4EIQA 1B4QA 2MYGA 4EF0A 4N30A 1U87A 3VI5A 2OBIA 3VLNA 1XOBA 1GULA 5ECLB 4TN8A 3EVIA 3UBLA 1H4OA 2M72A 11GSA 2KP2A 4N10A 4BVYB 3BOAA 3EPTA 4Z2TA 2KHPA 2C1YA 1WRYA 5D9TA 2YN1A 1EEMA 4MJCA 2X64A 1YF0A 1HNBA 2H71A 2H74A 3TKSA 1UC7A 1RK4A 1U88A 5A4WA 4MZCA 1QFNA 3LJRA 3QAGA 4OO5A 3L9VA 5ID2A 5JCGA 4DSQA 1EP8A 4I97A 4EKZA 1GSUA 1F9MA 1R7HA 2C3NA 4LL1B 4ZXGA 2EIQA 2PVOC 2IPAA 3E3EA 22GSA 3FK8A 2GLRA 1ZCPA 2FA8A 2LEGA 3LXZA 3U5RE 2D2ZA 3UARA 1XFLA 3F4RA 3P2AA 1NM3A 3QFBC 4YKFA 2F3MA 1WIKA 3BD2A 3V1WA 2DBCA 1DUGA 1W4VA 2H66A 3GKKA 4F03A 1EP7A 5EPFA 2AAWA 3Q19A 5LD0A 2BMXA 2JL4A 4HU7A 1T4YA 1F3AA 1TW9A 3FR3A 3IPZA 2B5XA 2LRTA 5F0GA 1PD21 2FWHA 1DBYA 4PNGA 3APOA 4MH2A 3ME8A 3BCIA 1S3DA 2H70A 3A5IA 1T3BA 2OE0A 5G30A 2IFQB 4TXOB 3HVVA 1SJ6A 4X43A 1YQ1A 1C72A 4ECBA 4WF4A 1GTUA 1EZKA 1Q98A 3ERWA 4ZL9A 2VLVA 1A24A 1BG5A 1TU7A 1SENA 1GSQA 3JCML 1NSWA 1IYHA 2HRKA 3FZ5A 2FWEA 4PQIA 2AHEA 1U6TA 3DRNA 3GN3A 2DLXA 2UZ8A 5DCHA 1OE8A 3ISOA 1FW1A 1M2BA 2IL3A 1HD2A 2GQLA 1KNGA 3GNJA 1THOA 3KP9A 3ZIVA 3VFIA 3FKFA 3GTUA 4BL7B 2P0GA 4GQCA 2E2MA 5D93A 1A23A 3HVXA 1J9BA 3C73A 4OCFA 4LMVA 3KJYA 3HD5A 1G0TA 2FUG2 2VCWA 1SK1A 3US3A 1ZMAA 4X1UA 4HS1A 4KGIA 3ZIJA 4XRAA 4FYUA 5DBQA 3W8SA 3L78A 3PH9A 3FZAA 5LNKe 2M46A 2YWIA 1PRXA 4ACSA 1W89A 3DVWA 3FHKA 1EOGA 3LFLA 2DC5A 4K0NA 3UIWA 4TXVA 5DAKB 1XW6A 1PGTA 3HYPA 3IAS2 5D9XA 1B4PA 2IWTA 1YF1A 1XWBA 2GSTA 1QUWA 3BBYA 5G1LA 4PUFC 1BEDA 4KB3A 2H0GA 3D0ZA 1ACVA 2WRTA 5B8BA 2C8UA 2IMDA 3MYDA 4ZIJA 4FYBA 2X8GA 2C0FA 3UVHA 3A5WA 4K5SA 3H4KA 4MLYA 2B7JA 1QGVA 2HFDA 2GZPA 4G0IA 1TOFA 5GAPD 2IMEA 3EMPA 5H5QA 1SL2B 1GUHA 4Q5RA 5CP1A 5IMCA 4ZILA 4NHWA 5D9WA 4ULXA 4L5LA 1WWJA 2C0DA 5IIZA 3EU3A 4MMMA 4TW5A 3CMIA 3C71A 5A5KA 4ID0A 1GNEA 3CTGA 4N0ZA 3C8EA 2H6YA 3P8WA 1CQGA 5IMZA 1LU4A 3TKQA 3J7Yk 2B1KA 1THXA 4CY8A 2H0IA 4G19A 1SK0A 3IRAA 4HQZA 5EVOA 1T00A 3ZVJD 3MIXA 2CQ9A 3KMNA 4IJIA 4HZ4A 3HZ4A 2IMIA 5ECSA 3VPTA 1O8WA 2YWOA 3TKPA 3IOSA 4F2IA 4BVXA 1MD3A 2GT5A 3HDCA 4K8MA 5F8BA 5DQSA 2IN3A 1M7TA 2HXKA 1S3AA 2WDUA 3KH7A 1X5CA 2IMKA 3A2WA 1JLVA 1B48A 5D9VA 1PX6A 4JU5A 1NHYA 4E8HA 2LJAA 2L5OA 4YAPA 1MTCA 3LG6A 2M80A 1YJ6A 3TJKA 2LNTA 4K6XA 1B9XC 2PU9C 4TR0A 2DMMA 1VRSD 2C0EA 1RQMA 4N11A 1ERTA 1OAZA 1WMJA 3EC3A 4MH3A 2LNSA 2OADA 1SD8A 2JZTA 2K6VA 4X4JA 1XWAA 1DE2A 4MA9A 2QKEA 2EC4A 5J5NA 1AQWA 1V58A 1M9AA 5B6NA 2XBIA 2FGXA 1EV9A 3HKRA 1FAAA 5GSTA 4K7NA 1VF2A 1GLPA 1ZYNA 5G31A 2RIIA 3SWLA 4AGSA 2LUSA 2H1AA 4BWQA 4Q5NA 3WD6A 2I81A 3MAKA 2LTKA 4MP4A 1R5AA 2F8FA 5IQYA 1TJDA 4EUYA 3N9JA 1SKSB 1FHEA 4XS1A 1ZGNA 4L0WA 4DVCA 1SYRA 1A2MA 1BQ7A 2J23A 4WETA 3A3TA 3HXSA 3F8UA 3I6AA 1GSFA 3FEUA 2H6XA 4OCEA 3F3RA 3DXBA 3TRXA 2FWGA 1G7OA 1GRXA 3TUEA 3GX8A 1MDJA 2NDOA 3QDNA 2AUVA 4LMWA 2VCTA 1R26A 5C00A 1OC9A 5KN3A 5DDLA 3TB2A 3CRUA 2IFQA 2YV7A 5HFIA 1TI3A 4TXOA 3D22A 3RHCA 2PUKC 4IKHA 1MDKA 2VL9A 1MEKA 1BYEA 4KH7A 2KUCA 2OE1A 5B7CA 2HRFA 2LKUA 4I8BA 4K0GA 4TR1B 3FW2A 3UOMA 1E6BA 4HZ2A 3TKRA 1TI1A 2DJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RLI A;  3KH9 A;  1T1V A;  4O5R A;  6GSX A;  3GX0 A;  4IVF A;  2RUE A;  3KZQ A;  3KGK A;  5ABR A;  2DIZ A;  3UMA A;  5J41 A;  1G6W A;  1WP0 A;  1URM A;  1M0U A;  1TRW A;  1Z7R A;  4J2F A;  4KAE A;  1T7P B;  2V32 A;  2V2G A;  3P7X A;  1X5D A;  3KTB A;  4NPB A;  1A8Y A;  3IC4 A;  3M0F A;  5JWR B;  4NV2 A;  1JZR A;  2K8S A;  2WS2 A;  4OFN A;  4Q5Q A;  3DML A;  3H8Q A;  5KN1 A;  1JZD A;  4IJ3 A;  1PMT A;  4P3Y B;  5AIX A;  4EDY A;  1GSY A;  2I4A A;  2YJ7 A;  5DAK A;  2FLS A;  1YY7 A;  3VWU A;  3IR4 A;  3VWX A;  2WZ9 A;  4JR4 A;  2PGT A;  2CVK A;  3GYK A;  3I69 A;  2PPT A;  3DGQ A;  3BJ5 A;  2LS5 A;  2CT6 A;  3QMX A;  4MDC A;  1QK8 A;  4ECI A;  4HUA A;  5CRE A;  2DJ1 A;  18GS A;  2R5G A;  17GS A;  1SJZ A;  3TOU A;  2PBJ A;  4FH8 A;  4FO5 A;  4WR4 A;  5B6M A;  3LYK A;  2H0H A;  3D4M A;  1EGR A;  5GSS A;  5DCG A;  3DKS A;  4EE0 A;  3G7J A;  2DML A;  2EIR A;  5HR3 A;  4IW9 A;  4NWY A;  3ZFL A;  2X8H A;  2C80 A;  4IS0 A;  2C0G A;  3D21 A;  2DJ2 A;  2XHF A;  1FO5 A;  2CZ3 A;  2KOK A;  1LJR A;  2FWF A;  2VOC A;  4DSS A;  4F9Z A;  4L0U A;  1N8J A;  2HNL A;  2R2J A;  4KCE A;  2GQK A;  3H79 A;  2V6O A;  1J0F A;  3LOR A;  3IV4 A;  2HRN A;  2XPE A;  4I6X A;  5AGY A;  3LQ7 A;  1F6M C;  3TKS C;  5H5R A;  2IJY A;  2YAN A;  2F8A A;  4PXO A;  1S3C A;  1PL2 A;  4V2N A;  2HZF A;  1XPV A;  2CV4 A;  2HSH A;  3GKM A;  2GSR A;  2L4C A;  3W8J A;  3EWL A;  2YJH A;  1WE0 A;  1GH2 A;  2GZY A;  4TOP A;  1TK5 B;  3C1R A;  3ZZX A;  3IK9 A;  3CSI A;  1KBN A;  5FHI A;  4WBR D;  2VO4 A;  3EMX A;  2L57 A;  4YH2 A;  1OKT A;  4KE3 A;  5HR0 A;  5CO3 A;  1MDI A;  2K8V A;  1TDI A;  1UN2 A;  3D6I A;  5ENU A;  1EGO A;  1B8X A;  3WGD A;  4WKW A;  3GRX A;  1AC1 A;  3MSZ A;  1GSE A;  4X0X A;  4YQU A;  3O6T A;  2RM6 A;  4EO3 A;  4ECJ A;  4V1A g;  1EWX A;  4OFT A;  4L8E A;  4AF2 A;  2IIY A;  3RDW A;  5EY6 A;  2O89 A;  3M9K A;  2MMZ A;  2R3X A;  1GTI A;  3ZYW A;  3GIX A;  8GSS A;  2OKA A;  3KTL A;  3HCZ A;  3QD9 A;  1ZL9 A;  2PWJ A;  3E0U A;  1K0B A;  4MF5 A;  3O76 A;  2VCZ A;  4Z7X A;  3GST A;  2O87 A;  3TKS E;  1O73 A;  4TR4 A;  4OWY A;  3GMF A;  5HR1 A;  5IO2 A;  1GTB A;  1PKZ A;  2H72 A;  4HI7 A;  2P5Q A;  2MZC A;  1V9W A;  3CRT A;  4HJM A;  2Z9S A;  12GS A;  1AQV A;  2CZ2 A;  5CRW A;  3LYP A;  4BPY A;  2G0F A;  4MZB A;  3KCM A;  3SBC A;  2H01 A;  1Z6M A;  2FD3 A;  1MD4 A;  2BJX A;  4IQ1 A;  3ZL5 A;  5CYY A;  5ID2 B;  1J08 A;  2MMN A;  2LJK A;  2WJU A;  3KM6 A;  2MMO A;  2N5F A;  5ECO B;  2VM1 A;  2MBT A;  1V2A A;  3ME7 A;  4IBP A;  1K3Y A;  4KSM A;  3GL5 A;  2N5B A;  1X9S B;  4WR5 A;  1AIU A;  1PL1 A;  2HLS A;  4BWS A;  4AJ6 A;  5ECQ B;  2KLX A;  4JRR A;  1GLQ A;  2NTO A;  2JSY A;  1PA3 A;  2PMT A;  3F4S A;  1AQX A;  2C3Q A;  2CVB A;  2RM5 A;  3DWV A;  3FZ4 A;  1WPI A;  5KN0 A;  3U6V A;  2H76 A;  4I2T A;  4XIH A;  3RBT A;  3LSZ A;  4GLT A;  3ZMK A;  1V57 A;  3IHQ A;  3VWV A;  1OYJ A;  4JZQ A;  1PSQ A;  5C04 A;  1XVQ A;  4NAX A;  4ZL8 A;  4XTS A;  2ON5 A;  4EVM A;  2WB9 A;  3ED3 A;  4IHU A;  1ERU A;  5DJM A;  5J9B A;  2HZE B;  2DJK A;  2L6C A;  5E59 A;  1K0O A;  5F05 A;  2WCI A;  2CAI A;  1DSB A;  1GSD A;  1XVW A;  1G7E A;  4GTU A;  3LEF A;  1A0R P;  5ECI B;  3GUR A;  5ECK B;  1GP1 A;  3TOT A;  1AUC A;  3IBH A;  4YAV A;  3PIN A;  1SL1 B;  2AYT A;  3D5J A;  1Q4J A;  5J3R A;  4YQM A;  1R4W A;  1XZO A;  1VF3 A;  3ERF A;  3GUS A;  1A2L A;  1GNW A;  3G7Y A;  2XC2 A;  2ALB A;  4RI6 A;  2PVQ A;  1O6J A;  3HHV A;  1M99 A;  3UL3 A;  20GS A;  3I43 A;  2I1U A;  4BVY A;  4LLR A;  4IP1 A;  4MK3 A;  2REM A;  2CA8 A;  3UVT A;  2B5Y A;  16GS A;  2OJL A;  1SU9 A;  2V1M A;  5ECR B;  5LCZ A;  2YZH A;  1SKW B;  3WGE A;  4KX4 A;  1ABA A;  3LGC A;  2CVD A;  4XHM A;  2H1B A;  3M8N A;  3F6D A;  4HDE A;  4O92 A;  1X9M B;  3QAV A;  3IAM 2;  3M9J A;  4ZB6 A;  4LA1 A;  4IN0 A;  4XS6 A;  4JBB A;  2YNX A;  3HY2 A;  4WEY A;  1X5E A;  2O8V B;  2OBK A;  5FT3 A;  1QMV A;  2ZUP A;  4XRD A;  5HQP A;  1RW1 A;  4I2U A;  3ZFB A;  1JHB A;  4GSN A;  2WGR A;  4WBJ A;  2G2Q A;  3KXO A;  5DAL B;  1FOV A;  1K0C A;  4CDO A;  5F06 A;  3CSJ A;  3K8N A;  5ECH B;  5G5F A;  3ZTL A;  3I9V 2;  2VD0 A;  1X9W B;  5A4V A;  2HYX A;  2J9H A;  3KD0 A;  2FY6 A;  1HYU A;  3HJM A;  4OO4 A;  5A4U A;  3M1G A;  2YP6 A;  3TJJ A;  4DEJ A;  3UBK A;  3PR8 A;  3EYT A;  3GKX A;  2KP1 A;  3F3Q A;  1V98 A;  2VL2 A;  4QQ7 A;  3VUR A;  1WJK A;  3A2X A;  3H1N A;  4D73 B;  2GQM A;  3L0H A;  2GT6 A;  4ILF A;  5ELA A;  5IMF A;  3MNG A;  3OR5 A;  3IK7 A;  1F2E A;  1YKA A;  1JZO A;  1GSS A;  3GV1 A;  4FIW A;  3L9U A;  4V1A p;  2AJQ B;  1G6Y A;  2GTU A;  1GUM A;  3TJB A;  1ST9 A;  1ILO A;  2GZZ A;  1QXH A;  4RI7 A;  5GZZ B;  5KEJ A;  5CNW A;  5AN1 A;  1O81 A;  5AIS A;  4IEL A;  1TK8 B;  2A2S A;  2K18 A;  2FHE A;  4ZB8 A;  1FVK A;  2HSY A;  1Z5Y E;  4GQF A;  2ZCT A;  3GA4 A;  4PUA A;  4RQX A;  4BL7 A;  3TDG A;  4POB A;  4WF5 A;  2LV3 A;  3C1S A;  2C4J A;  5IM9 A;  3WYW A;  2F51 A;  2A2R A;  3CTF A;  1HNA A;  4OFM A;  4RUV A;  3ZVJ A;  4MF7 A;  1A8L A;  1F37 A;  1HNC A;  1YEP A;  5ECM B;  1TK0 B;  1TRV A;  2BTO T;  2AV4 A;  5H5S A;  5J9C A;  2WFC A;  1Y25 A;  1T4Z A;  3E9J B;  4ECC A;  1TRS A;  1K3O A;  5FWG A;  1YEX A;  3W6G A;  3GH6 A;  1K3L A;  2VM2 A;  3IA1 A;  3TJG A;  4HU9 A;  3ZRD A;  5ECP B;  6GSS A;  1U3I A;  3HVS A;  2TRX A;  4KCA A;  1Z7P A;  3VI7 A;  3LXT A;  3S9F A;  2VCV A;  1WOU A;  2CAQ A;  1XIY A;  1H75 A;  3QR6 A;  2R6K A;  3RPN A;  2ES7 A;  1XBS A;  4N0V A;  3F6F A;  1XWG A;  3MDK A;  2DJJ A;  4EDZ A;  1O8X A;  1XW9 A;  5ECN B;  2VCX A;  5G2Z A;  1SYX A;  2LJR A;  2R37 A;  3M3M A;  2OE3 A;  5IO0 A;  3RHB A;  3C7M A;  4ISD A;  3GHA A;  2LQO A;  5DJL A;  1OE7 A;  4KSO A;  6GSV A;  1BJX A;  2IMF A;  2N5A A;  1Z6N A;  1JZW A;  1XCC A;  1O85 A;  14GS A;  1FB6 A;  3QAW A;  2PER A;  1U3A A;  1X0R A;  1OC8 A;  4GF0 A;  4QL9 A;  4MZW A;  4E8E A;  1O7U A;  1TXX A;  1ERW A;  2NVL A;  4K1F A;  1SJI A;  4J57 E;  1PX7 A;  2AB6 A;  1VF1 A;  2CX4 A;  1UA5 A;  3EIN A;  2HZE A;  2HT9 A;  2F9S A;  2YV9 A;  4EL1 A;  4IGJ A;  3F9U A;  4GSS A;  5D8I A;  1KEB A;  2B6M A;  1OC9 B;  5ELG A;  1VF4 A;  4CW9 A;  4KDX A;  4F82 A;  4GXZ A;  3J7Y b;  5IMD A;  4ZB9 A;  2QC7 A;  4YQV A;  2H1D A;  3G7I A;  4H86 A;  5IPG A;  2DIY A;  3PGT A;  3KP8 A;  1GUK A;  1AW9 A;  4O7H A;  3O3T A;  4XCS A;  2H73 A;  1VGL A;  4JE1 A;  1I9D A;  2GS3 A;  5COH A;  3GH9 A;  2I9H A;  2ZNM A;  4KUN A;  3FZ9 A;  3WGX A;  2JZR A;  3BCK A;  1LBK A;  4ML6 A;  1TRU A;  3QFA C;  1B9Y C;  4HEA 2;  2CX3 A;  4K2D A;  3WT1 A;  1K0D A;  3P90 A;  3UJ1 A;  2LRC A;  3IE3 A;  3NZN A;  1SKR B;  5HFG A;  4K9Z A;  2GSQ A;  1EEJ A;  2H30 A;  1K0N A;  13GS A;  2B5E A;  4MJA A;  3KEB A;  3HZ8 A;  5JCU A;  1EV4 A;  3VWW A;  3H93 A;  4HOJ A;  2JAC A;  4XS4 B;  3CBU A;  3EE2 A;  5J4U A;  4V2M A;  3Q74 A;  2PN8 A;  5G1K A;  6GST A;  5D96 A;  2I3Y A;  1TU8 A;  2HE3 A;  2A4V A;  2VCQ A;  1T8E B;  1OKD A;  2L4Q A;  2VIM A;  4NHZ A;  2LRN A;  4PGT A;  1JLW A;  3D4T A;  4MPG A;  3Q6O A;  3LWA A;  2L5L A;  1ZYQ B;  2YZU A;  3HA9 A;  2MBS A;  1JFU A;  2YOI A;  1AXD A;  3NIV A;  2XPD A;  3ZML A;  3KIJ A;  4GWR A;  5AIV A;  5DAL A;  4AJ8 A;  1K0A A;  3MWH A;  1GWC A;  3L9S A;  1XXU A;  1I5G A;  2VUP A;  3UAP A;  4K7O A;  3ERG A;  5JWQ B;  3RAZ A;  3NOF A;  3CSH A;  1BX9 A;  5GAN D;  2L6D A;  1Y6E A;  5IMA A;  1TKD B;  4OD7 A;  2TRC P;  2X99 A;  5IMV A;  6GSW A;  2B7K A;  1AAZ A;  3QCP A;  2H8L A;  3GL3 A;  2FA4 A;  9GSS A;  4HQS A;  3TRQ A;  4D73 A;  5EL8 A;  3FYG A;  3AY8 A;  5G5E A;  4F0B A;  4JED A;  4POL A;  3UEM A;  3ZRE A;  1NW2 A;  1GL8 A;  4GST A;  1E2Y A;  4MPF A;  1F3B A;  4EXJ A;  1M2A A;  5IOX A;  4DSS B;  1M2D A;  4ZL7 A;  1HQO A;  4MCU A;  4PUR A;  1R5P A;  5IPH A;  3QOU A;  1ML6 A;  4TR1 A;  2HI7 A;  3F0I A;  2GSS A;  3IDV A;  5INY A;  3Q18 A;  2JZS A;  1CQH A;  2DSA A;  3F63 A;  2P5R A;  3F4T A;  1FVJ A;  1N2A A;  1XWK A;  7GSS A;  4BA7 A;  4KDY A;  3EU4 A;  1NHO A;  2YWN A;  3IXR A;  2VLT A;  1Z3E A;  4AJ7 A;  4POM A;  5CRG A;  4O32 A;  2P31 A;  4POK A;  4HJ2 A;  4NXI A;  1OVN A;  3KMO A;  1A0F A;  3FR6 A;  1PQN A;  1YKC A;  4ZBA A;  2R4V A;  3RPP A;  4PX1 A;  5IOW A;  4KND A;  1TP9 A;  5DVB A;  2L59 A;  5E4W A;  2GVP A;  2LQQ A;  2C3T A;  2GGT A;  2K9F A;  4MJE A;  4MF6 A;  4RQR A;  2B3S A;  4G9H A;  4JR6 A;  3DYR A;  2V6K A;  2LST A;  1XW5 A;  1TTZ A;  3GKN A;  2VD1 A;  3GTU B;  4FYC A;  5CRD A;  2H75 A;  4KW6 A;  4G2E A;  3G9B A;  1ZOF A;  4OMV A;  5D73 A;  3HJO A;  1K0M A;  1YDK A;  1SD9 A;  4ZBB A;  3TGZ A;  3GFK A;  3APQ A;  1ZZY A;  4MAB A;  2H19 A;  3TCO A;  3WT2 A;  3R2Q A;  1BAY A;  3DEX A;  4PNF A;  4J56 E;  5CRH A;  2YPM A;  1IYI A;  2FCH A;  3N5O A;  1OC3 A;  2E2G A;  4KDU A;  2H6Z A;  2FNO A;  2DJ3 A;  4LL4 B;  4TRX A;  4KA0 A;  2OAC A;  4IQA A;  1DE1 A;  1A2J A;  1XOA A;  1ZYE A;  4ZBD A;  1USB A;  2VAF A;  3TJF A;  1SL0 B;  3GSS A;  1FG4 A;  2E7P A;  4Q5F A;  4IP6 A;  4NMU A;  4PQH A;  3DD3 A;  2O7K A;  2MMA A;  2OA7 A;  1V40 A;  2JAD A;  3QPM A;  2NBS A;  4WXT A;  1PKW A;  1FB0 A;  2ON7 A;  5B8A A;  4ML1 A;  2QSI A;  5KN2 A;  4CHS A;  2O85 A;  2X8C A;  1YZX A;  4L5O A;  5JCW A;  3DIE A;  4QL7 A;  4GCI A;  2GDR A;  3CYN A;  2VL3 A;  5DQY A;  19GS A;  5HFK A;  3A2V A;  2YWM A;  1SK2 A;  2NPB A;  2XBQ A;  3DVX A;  10GS A;  1ON4 A;  4TVE A;  3FRC A;  6GSU A;  4DSR A;  1QQ2 A;  5HR2 A;  3HJP A;  2QGV A;  1XWC A;  2WUL A;  4TR3 A;  2VLU A;  2JU5 A;  3VPQ A;  2TIR A;  4G10 A;  3ZIT A;  4GRF A;  1UVZ A;  2H1G A;  3EUR A;  4K7I A;  2E0Q A;  4I5Q A;  4PQ1 A;  4TKY A;  2YCD A;  4NV5 A;  2EIO A;  3L4N A;  4EC0 A;  4MJB A;  2B1L A;  5F07 A;  3ZLP A;  3CXG A;  2VL2 C;  3FR9 A;  1GTA A;  3VK9 A;  1M9B A;  1ERV A;  1KTE A;  2JSZ A;  4F0C A;  2RUF A;  1Z9H A;  3TRP A;  5L71 A;  3APS A;  5JWO B;  3FY7 A;  6GSY A;  1PN9 A;  4XS4 A;  2V41 A;  4V2L A;  1EOH A;  5CAX A;  1B4Q A;  2MYG A;  4EF0 A;  4N30 A;  1U87 A;  3VI5 A;  2OBI A;  3VLN A;  1XOB A;  1GUL A;  5ECL B;  4TN8 A;  3EVI A;  3UBL A;  1H4O A;  2M72 A;  11GS A;  2KP2 A;  4N10 A;  3BOA A;  2KHP A;  2C1Y A;  1WRY A;  5D9T A;  2YN1 A;  1EEM A;  4MJC A;  2X64 A;  1YF0 A;  1HNB A;  2H71 A;  2H74 A;  3TKS A;  1UC7 A;  1RK4 A;  1U88 A;  5A4W A;  4MZC A;  1QFN A;  3LJR A;  3QAG A;  4OO5 A;  3L9V A;  5ID2 A;  5JCG A;  4DSQ A;  1EP8 A;  4I97 A;  4EKZ A;  1GSU A;  1F9M A;  1R7H A;  2C3N A;  4LL1 B;  4ZXG A;  2EIQ A;  2PVO C;  2IPA A;  3E3E A;  22GS A;  3FK8 A;  2GLR A;  1ZCP A;  2FA8 A;  2LEG A;  3LXZ A;  3U5R E;  2D2Z A;  3UAR A;  1XFL A;  3F4R A;  3P2A A;  1NM3 A;  3QFB C;  2F3M A;  1WIK A;  3BD2 A;  3V1W A;  2DBC A;  1DUG A;  1W4V A;  2H66 A;  3GKK A;  4F03 A;  1EP7 A;  5EPF A;  2AAW A;  3Q19 A;  5LD0 A;  2BMX A;  2JL4 A;  4HU7 A;  1T4Y A;  1F3A A;  1TW9 A;  3FR3 A;  3IPZ A;  2B5X A;  2LRT A;  5F0G A;  1PD2 1;  2FWH A;  1DBY A;  4PNG A;  3APO A;  4MH2 A;  3ME8 A;  3BCI A;  1S3D A;  2H70 A;  1T3B A;  2OE0 A;  5G30 A;  2IFQ B;  4TXO B;  3HVV A;  1SJ6 A;  4X43 A;  1YQ1 A;  1C72 A;  4ECB A;  4WF4 A;  1GTU A;  1EZK A;  1Q98 A;  3ERW A;  4ZL9 A;  2VLV A;  1A24 A;  1BG5 A;  1TU7 A;  1SEN A;  1GSQ A;  3JCM L;  1NSW A;  1IYH A;  3FZ5 A;  2FWE A;  4PQI A;  2AHE A;  1U6T A;  3DRN A;  3GN3 A;  2DLX A;  5DCH A;  1OE8 A;  3ISO A;  1FW1 A;  1M2B A;  2IL3 A;  1HD2 A;  2GQL A;  1KNG A;  3GNJ A;  1THO A;  3KP9 A;  3ZIV A;  3VFI A;  3FKF A;  3GTU A;  2P0G A;  4GQC A;  2E2M A;  5D93 A;  1A23 A;  3HVX A;  1J9B A;  3C73 A;  4OCF A;  4LMV A;  3KJY A;  3HD5 A;  1G0T A;  2FUG 2;  2VCW A;  1SK1 A;  3US3 A;  1ZMA A;  4X1U A;  4HS1 A;  4KGI A;  3ZIJ A;  4XRA A;  4FYU A;  5DBQ A;  3W8S A;  3L78 A;  3PH9 A;  3FZA A;  5LNK e;  2M46 A;  2YWI A;  1PRX A;  4ACS A;  1W89 A;  3DVW A;  3FHK A;  1EOG A;  3LFL A;  2DC5 A;  4K0N A;  3UIW A;  4TXV A;  5DAK B;  1XW6 A;  1PGT A;  3HYP A;  3IAS 2;  5D9X A;  1B4P A;  2IWT A;  1YF1 A;  1XWB A;  2GST A;  1QUW A;  3BBY A;  5G1L A;  4PUF C;  1BED A;  4KB3 A;  2H0G A;  3D0Z A;  1ACV A;  2WRT A;  5B8B A;  2C8U A;  2IMD A;  4ZIJ A;  4FYB A;  2X8G A;  2C0F A;  3UVH A;  3A5W A;  3H4K A;  4MLY A;  2B7J A;  1QGV A;  2HFD A;  2GZP A;  1TOF A;  5GAP D;  2IME A;  3EMP A;  5H5Q A;  1SL2 B;  1GUH A;  4Q5R A;  5CP1 A;  5IMC A;  4ZIL A;  4NHW A;  5D9W A;  4ULX A;  4L5L A;  1WWJ A;  2C0D A;  5IIZ A;  3EU3 A;  4MMM A;  4TW5 A;  3CMI A;  3C71 A;  5A5K A;  4ID0 A;  1GNE A;  3CTG A;  4N0Z A;  3C8E A;  2H6Y A;  3P8W A;  1CQG A;  5IMZ A;  1LU4 A;  3TKQ A;  3J7Y k;  2B1K A;  1THX A;  2H0I A;  4G19 A;  1SK0 A;  3IRA A;  4HQZ A;  5EVO A;  1T00 A;  3ZVJ D;  2CQ9 A;  3KMN A;  4IJI A;  4HZ4 A;  3HZ4 A;  2IMI A;  5ECS A;  3VPT A;  1O8W A;  2YWO A;  3TKP A;  3IOS A;  4F2I A;  4BVX A;  1MD3 A;  2GT5 A;  3HDC A;  4K8M A;  5F8B A;  5DQS A;  2IN3 A;  1M7T A;  2HXK A;  1S3A A;  2WDU A;  3KH7 A;  1X5C A;  2IMK A;  3A2W A;  1JLV A;  1B48 A;  5D9V A;  1PX6 A;  4JU5 A;  1NHY A;  4E8H A;  2LJA A;  2L5O A;  4YAP A;  1MTC A;  3LG6 A;  2M80 A;  1YJ6 A;  3TJK A;  2LNT A;  4K6X A;  1B9X C;  2PU9 C;  4TR0 A;  2DMM A;  1VRS D;  2C0E A;  1RQM A;  4N11 A;  1ERT A;  1OAZ A;  1WMJ A;  3EC3 A;  4MH3 A;  2LNS A;  2OAD A;  1SD8 A;  2JZT A;  2K6V A;  1XWA A;  1DE2 A;  4MA9 A;  2QKE A;  2EC4 A;  5J5N A;  1AQW A;  1V58 A;  1M9A A;  5B6N A;  2XBI A;  2FGX A;  1EV9 A;  3HKR A;  1FAA A;  5GST A;  4K7N A;  1VF2 A;  1GLP A;  5G31 A;  2RII A;  3SWL A;  4AGS A;  2LUS A;  2H1A A;  4BWQ A;  4Q5N A;  3WD6 A;  2I81 A;  3MAK A;  2LTK A;  4MP4 A;  1R5A A;  2F8F A;  5IQY A;  1TJD A;  4EUY A;  3N9J A;  1SKS B;  1FHE A;  4XS1 A;  1ZGN A;  4L0W A;  4DVC A;  1SYR A;  1A2M A;  1BQ7 A;  2J23 A;  4WET A;  3A3T A;  3HXS A;  3F8U A;  3I6A A;  1GSF A;  3FEU A;  2H6X A;  4OCE A;  3F3R A;  3DXB A;  3TRX A;  2FWG A;  1G7O A;  1GRX A;  3TUE A;  3GX8 A;  1MDJ A;  2NDO A;  3QDN A;  2AUV A;  4LMW A;  2VCT A;  1R26 A;  5C00 A;  1OC9 A;  5KN3 A;  5DDL A;  3TB2 A;  3CRU A;  2IFQ A;  2YV7 A;  5HFI A;  1TI3 A;  4TXO A;  3D22 A;  3RHC A;  2PUK C;  4IKH A;  1MDK A;  2VL9 A;  1MEK A;  1BYE A;  4KH7 A;  2KUC A;  2OE1 A;  5B7C A;  2HRF A;  2LKU A;  4I8B A;  4K0G A;  4TR1 B;  3FW2 A;  3UOM A;  1E6B A;  4HZ2 A;  3TKR A;  1TI1 A;  2DJ0 A; 
#chains in the Genus database with same CATH topology
 2RLI A;  3KH9 A;  4CY6 A;  1T1V A;  4O5R A;  6GSX A;  3GX0 A;  4IVF A;  2RUE A;  3KZQ A;  3KGK A;  5ABR A;  2DIZ A;  3UMA A;  1PN0 A;  5J41 A;  4USS A;  1G6W A;  1WP0 A;  1URM A;  1M0U A;  1TRW A;  1Z7R A;  4J2F A;  4KAE A;  1T7P B;  2V32 A;  2V2G A;  3P7X A;  5KOX A;  1X5D A;  3KTB A;  4NPB A;  1A8Y A;  3IC4 A;  3M0F A;  5JWR B;  4NV2 A;  1JZR A;  2K8S A;  2WS2 A;  4OFN A;  4Q5Q A;  3DML A;  3H8Q A;  5KN1 A;  1JZD A;  4IJ3 A;  1PMT A;  4P3Y B;  5AIX A;  4EDY A;  1GSY A;  2I4A A;  2YJ7 A;  5DAK A;  2FLS A;  1YY7 A;  3VWU A;  3IR4 A;  3VWX A;  2WZ9 A;  4JR4 A;  2PGT A;  2CVK A;  2R0C A;  3GYK A;  3I69 A;  2PPT A;  3DGQ A;  3BJ5 A;  2LS5 A;  2CT6 A;  3QMX A;  4MDC A;  1QK8 A;  3IHG A;  4ECI A;  4HUA A;  5CRE A;  2DJ1 A;  18GS A;  2R5G A;  17GS A;  1SJZ A;  3TOU A;  2PBJ A;  4FH8 A;  4FO5 A;  4WR4 A;  5B6M A;  3LYK A;  2H0H A;  3D4M A;  1EGR A;  5GSS A;  5DCG A;  3DKS A;  4EE0 A;  3G7J A;  2DML A;  2EIR A;  5HR3 A;  4MNN A;  4IW9 A;  4NWY A;  3ZFL A;  2X8H A;  2C80 A;  4IS0 A;  2C0G A;  3D21 A;  2DJ2 A;  2XHF A;  1FO5 A;  2CZ3 A;  2KOK A;  4G0K A;  1LJR A;  2FWF A;  2VOC A;  4DSS A;  4F9Z A;  4L0U A;  1N8J A;  2HNL A;  2R2J A;  4KCE A;  2GQK A;  3H79 A;  2V6O A;  1J0F A;  3LOR A;  3IV4 A;  2HRN A;  2XPE A;  1XG8 A;  4I6X A;  5AGY A;  3LQ7 A;  1F6M C;  3TKS C;  5H5R A;  2IJY A;  2YAN A;  2F8A A;  4PXO A;  1S3C A;  1PL2 A;  4V2N A;  2HZF A;  1XPV A;  2CV4 A;  2HSH A;  3GKM A;  2GSR A;  2L4C A;  3W8J A;  3EWL A;  2YJH A;  1WE0 A;  1GH2 A;  2GZY A;  4TOP A;  1TK5 B;  3C1R A;  3ZZX A;  3IK9 A;  3CSI A;  1KBN A;  5FHI A;  4WBR D;  2VO4 A;  3EMX A;  2L57 A;  4YH2 A;  1OKT A;  4KE3 A;  5HR0 A;  5CO3 A;  1MDI A;  2K8V A;  1TDI A;  1UN2 A;  3D6I A;  5ENU A;  1EGO A;  1B8X A;  3WGD A;  4WKW A;  3GRX A;  1AC1 A;  3MSZ A;  1GSE A;  4X0X A;  4YQU A;  3O6T A;  2RM6 A;  4EO3 A;  4ECJ A;  4V1A g;  1EWX A;  4OFT A;  4L8E A;  4AF2 A;  2IIY A;  3RDW A;  5EY6 A;  2O89 A;  3M9K A;  5BMU A;  2MMZ A;  2HRA A;  2R3X A;  1GTI A;  3ZYW A;  3GIX A;  8GSS A;  2OKA A;  3KTL A;  3HCZ A;  3QD9 A;  1ZL9 A;  2PWJ A;  3E0U A;  1K0B A;  4MF5 A;  3O76 A;  2VCZ A;  4Z7X A;  3GST A;  2O87 A;  3TKS E;  1O73 A;  4TR4 A;  4OWY A;  2DKH A;  3GMF A;  5HR1 A;  5IO2 A;  1GTB A;  1PKZ A;  2H72 A;  4HI7 A;  2P5Q A;  2MZC A;  1V9W A;  3CRT A;  4HJM A;  2Z9S A;  12GS A;  1AQV A;  2CZ2 A;  5CRW A;  3LYP A;  4BPY A;  5BRT A;  2G0F A;  4MZB A;  3KCM A;  3SBC A;  2H01 A;  1Z6M A;  2FD3 A;  1MD4 A;  2BJX A;  4IQ1 A;  3ZL5 A;  5CYY A;  5ID2 B;  1J08 A;  2MMN A;  2LJK A;  2WJU A;  3KM6 A;  2MMO A;  2N5F A;  5ECO B;  2VM1 A;  2MBT A;  1V2A A;  3ME7 A;  4IBP A;  1K3Y A;  4KSM A;  3GL5 A;  2N5B A;  1X9S B;  4WR5 A;  1AIU A;  4ICY A;  1PL1 A;  2HLS A;  4BWS A;  4AJ6 A;  5ECQ B;  2KLX A;  4JRR A;  1GLQ A;  2NTO A;  2JSY A;  1PA3 A;  2PMT A;  3F4S A;  1AQX A;  2C3Q A;  2CVB A;  2RM5 A;  3DWV A;  3FZ4 A;  1WPI A;  5KN0 A;  3U6V A;  2H76 A;  4I2T A;  4XIH A;  3RBT A;  3LSZ A;  4GLT A;  3ZMK A;  1V57 A;  3IHQ A;  3VWV A;  1OYJ A;  4JZQ A;  1PSQ A;  5C04 A;  1XVQ A;  4NAX A;  4ZL8 A;  4XTS A;  2ON5 A;  4EVM A;  2WB9 A;  3ED3 A;  4IHU A;  1ERU A;  5DJM A;  5J9B A;  2HZE B;  2DJK A;  2L6C A;  5E59 A;  1K0O A;  5F05 A;  2WCI A;  2CAI A;  1DSB A;  1GSD A;  1XVW A;  1G7E A;  4GTU A;  3LEF A;  1A0R P;  5ECI B;  3GUR A;  5ECK B;  1GP1 A;  3TOT A;  1AUC A;  3IBH A;  4YAV A;  3PIN A;  1M3J A;  1SL1 B;  2AYT A;  3D5J A;  1Q4J A;  5J3R A;  4YQM A;  1R4W A;  1XZO A;  1VF3 A;  3ERF A;  3GUS A;  1A2L A;  2A4H A;  1GNW A;  3G7Y A;  2XC2 A;  2ALB A;  4RI6 A;  2PVQ A;  1O6J A;  3HHV A;  1M99 A;  3UL3 A;  20GS A;  3I43 A;  2I1U A;  3PPU A;  4BVY A;  4LLR A;  4IP1 A;  4MK3 A;  2REM A;  2HSM A;  2CA8 A;  3UVT A;  2B5Y A;  16GS A;  2OJL A;  1SU9 A;  2V1M A;  5ECR B;  5LCZ A;  2YZH A;  1SKW B;  3WGE A;  4KX4 A;  1ABA A;  3LGC A;  2CVD A;  4XHM A;  2H1B A;  3M8N A;  4O5U A;  3F6D A;  4HDE A;  2R0G A;  4O92 A;  1X9M B;  3QAV A;  3IAM 2;  3M9J A;  4ZB6 A;  4LA1 A;  4IN0 A;  4XS6 A;  4JBB A;  2YNX A;  3HY2 A;  4WEY A;  1X5E A;  2O8V B;  2OBK A;  5FT3 A;  1QMV A;  2ZUP A;  4XRD A;  5HQP A;  1RW1 A;  4I2U A;  3ZFB A;  1JHB A;  4GSN A;  4YKG A;  2WGR A;  4WBJ A;  2G2Q A;  1FOH A;  3KXO A;  5DAL B;  1FOV A;  1K0C A;  4CDO A;  5F06 A;  3CSJ A;  3K8N A;  5ECH B;  5G5F A;  3ZTL A;  3I9V 2;  2VD0 A;  1X9W B;  5A4V A;  2HYX A;  2J9H A;  3KD0 A;  2FY6 A;  1HYU A;  3HJM A;  4OO4 A;  5A4U A;  3M1G A;  2YP6 A;  3TJJ A;  4DEJ A;  3UBK A;  3PR8 A;  3EYT A;  3GKX A;  2KP1 A;  3F3Q A;  1V98 A;  2VL2 A;  5KOW A;  4QQ7 A;  3VUR A;  1WJK A;  3A2X A;  3H1N A;  4D73 B;  2GQM A;  3L0H A;  2GT6 A;  4ILF A;  5ELA A;  5IMF A;  3MNG A;  3OR5 A;  3IK7 A;  1F2E A;  1YKA A;  1JZO A;  1GSS A;  3GV1 A;  4FIW A;  3L9U A;  4V1A p;  2AJQ B;  1G6Y A;  2GTU A;  1GUM A;  3TJB A;  1ST9 A;  1ILO A;  2GZZ A;  1QXH A;  4RI7 A;  5GZZ B;  5KEJ A;  4BIK A;  5CNW A;  5AN1 A;  1O81 A;  5AIS A;  4IEL A;  1TK8 B;  2A2S A;  2K18 A;  2FHE A;  4ZB8 A;  1FVK A;  2HSY A;  1Z5Y E;  4GQF A;  2ZCT A;  3GA4 A;  4PUA A;  4RQX A;  4BL7 A;  3TDG A;  4POB A;  4WF5 A;  2LV3 A;  3C1S A;  2C4J A;  5IM9 A;  3WYW A;  2F51 A;  2A2R A;  3CTF A;  1HNA A;  4OFM A;  4RUV A;  3ZVJ A;  4MF7 A;  1A8L A;  4Z2R A;  1F37 A;  3LW9 A;  1HNC A;  1YEP A;  5ECM B;  1TK0 B;  1TRV A;  2BTO T;  2AV4 A;  5H5S A;  5J9C A;  2WFC A;  1M3I A;  1Y25 A;  1T4Z A;  3E9J B;  4ECC A;  1TRS A;  1K3O A;  5FWG A;  4O5Q A;  1YEX A;  3W6G A;  3GH6 A;  1K3L A;  2VM2 A;  3IA1 A;  3TJG A;  4HU9 A;  3ZRD A;  5ECP B;  6GSS A;  1U3I A;  3HVS A;  2TRX A;  4KCA A;  1Z7P A;  3VI7 A;  3LXT A;  2QA1 A;  3S9F A;  2VCV A;  1WOU A;  2CAQ A;  1XIY A;  1H75 A;  3QR6 A;  2R6K A;  3RPN A;  2ES7 A;  1XBS A;  4N0V A;  3F6F A;  1XWG A;  3MDK A;  2DJJ A;  4EDZ A;  1O8X A;  1XW9 A;  5ECN B;  2VCX A;  5G2Z A;  1SYX A;  2LJR A;  2R37 A;  3M3M A;  2OE3 A;  5IO0 A;  3RHB A;  3C7M A;  4ISD A;  3GHA A;  2LQO A;  5DJL A;  1OE7 A;  4KSO A;  6GSV A;  1BJX A;  2IMF A;  2N5A A;  1Z6N A;  1JZW A;  1XCC A;  1O85 A;  14GS A;  1FB6 A;  3QAW A;  2PER A;  1U3A A;  1X0R A;  1ZYP A;  1OC8 A;  4GF0 A;  4QL9 A;  4MZW A;  4E8E A;  1O7U A;  1TXX A;  1ERW A;  2NVL A;  4K1F A;  1SJI A;  4J57 E;  1PX7 A;  2AB6 A;  1VF1 A;  2CX4 A;  1UA5 A;  3EIN A;  2HZE A;  2HT9 A;  2F9S A;  2YV9 A;  4EL1 A;  4IGJ A;  3F9U A;  4GSS A;  5D8I A;  1KEB A;  2B6M A;  1OC9 B;  5ELG A;  1VF4 A;  4CW9 A;  4KDX A;  4F82 A;  4GXZ A;  3J7Y b;  2X49 A;  5IMD A;  4ZB9 A;  2QC7 A;  4YQV A;  2H1D A;  3G7I A;  4H86 A;  5IPG A;  2DIY A;  3PGT A;  3KP8 A;  1GUK A;  1AW9 A;  4O7H A;  3O3T A;  4XCS A;  2H73 A;  1VGL A;  4JE1 A;  4G0L A;  1I9D A;  2GS3 A;  5COH A;  3GH9 A;  2I9H A;  2ZNM A;  4KUN A;  3FZ9 A;  3WGX A;  2JZR A;  3BCK A;  1LBK A;  4ML6 A;  1TRU A;  3QFA C;  1B9Y C;  4HEA 2;  2CX3 A;  4K2D A;  3WT1 A;  1K0D A;  3P90 A;  3UJ1 A;  2LRC A;  3IE3 A;  3NZN A;  1SKR B;  5HFG A;  4K9Z A;  2GSQ A;  1EEJ A;  2H30 A;  1K0N A;  13GS A;  2B5E A;  4MJA A;  3KEB A;  3HZ8 A;  5JCU A;  4FQU A;  3HVN A;  1EV4 A;  3VWW A;  3H93 A;  4HOJ A;  2JAC A;  4XS4 B;  3CBU A;  3EE2 A;  5J4U A;  4V2M A;  3Q74 A;  2PN8 A;  5G1K A;  6GST A;  5D96 A;  2I3Y A;  1TU8 A;  2HE3 A;  2A4V A;  2VCQ A;  1T8E B;  1OKD A;  2L4Q A;  2VIM A;  4NHZ A;  2LRN A;  4PGT A;  1JLW A;  3D4T A;  4MPG A;  3Q6O A;  3LWA A;  2L5L A;  1ZYQ B;  2YZU A;  3HA9 A;  2MBS A;  4KF9 A;  1JFU A;  2YOI A;  1AXD A;  3NIV A;  2XPD A;  3ZML A;  3KIJ A;  4GWR A;  5AIV A;  5DAL A;  4AJ8 A;  1K0A A;  3MWH A;  1GWC A;  3IC8 A;  3L9S A;  1XXU A;  1I5G A;  2VUP A;  3UAP A;  4K7O A;  3ERG A;  5JWQ B;  3RAZ A;  3NOF A;  3CSH A;  1BX9 A;  5GAN D;  2L6D A;  1Y6E A;  5IMA A;  1TKD B;  4OD7 A;  2TRC P;  2X99 A;  5IMV A;  6GSW A;  2B7K A;  1AAZ A;  3QCP A;  2H8L A;  3GL3 A;  2FA4 A;  9GSS A;  4HQS A;  3TRQ A;  4D73 A;  5EL8 A;  3FYG A;  2X4A A;  3AY8 A;  5G5E A;  4F0B A;  4JED A;  4POL A;  3UEM A;  3ZRE A;  1NW2 A;  1GL8 A;  4GST A;  1E2Y A;  4MPF A;  1F3B A;  4EXJ A;  1M2A A;  5IOX A;  4K5R A;  4DSS B;  1M2D A;  4ZL7 A;  1HQO A;  4MCU A;  4PUR A;  1R5P A;  5IPH A;  3QOU A;  1ML6 A;  4TR1 A;  2HI7 A;  3F0I A;  2GSS A;  3IDV A;  5INY A;  3Q18 A;  2JZS A;  1CQH A;  2DSA A;  3F63 A;  2P5R A;  3F4T A;  1FVJ A;  1N2A A;  1XWK A;  7GSS A;  4BA7 A;  4KDY A;  3FMW A;  3EU4 A;  1NHO A;  2YWN A;  3IXR A;  2VLT A;  1Z3E A;  4AJ7 A;  4PTS A;  4POM A;  5CRG A;  4O32 A;  2P31 A;  4POK A;  4HJ2 A;  4NXI A;  1OVN A;  3KMO A;  1A0F A;  3FR6 A;  1PQN A;  1YKC A;  4ZBA A;  4Z2U A;  2R4V A;  3RPP A;  4PX1 A;  5IOW A;  4KND A;  1TP9 A;  5DVB A;  2L59 A;  4K2X A;  2GVP A;  2LQQ A;  2C3T A;  5E4W A;  2GGT A;  2K9F A;  4MJE A;  4MF6 A;  4RQR A;  2B3S A;  4G9H A;  4JR6 A;  3DYR A;  2V6K A;  2LST A;  1XW5 A;  1TTZ A;  3GKN A;  2VD1 A;  3GTU B;  4FYC A;  5CRD A;  2H75 A;  4KW6 A;  4G2E A;  3G9B A;  1ZOF A;  4OMV A;  5D73 A;  3HJO A;  1K0M A;  1YDK A;  1SD9 A;  4ZBB A;  3TGZ A;  3GFK A;  3APQ A;  1ZZY A;  2QA2 A;  4MAB A;  2H19 A;  3TCO A;  3WT2 A;  3R2Q A;  1BAY A;  3DEX A;  4PNF A;  4J56 E;  5CRH A;  2YPM A;  1IYI A;  2FCH A;  3N5O A;  1OC3 A;  2E2G A;  4KDU A;  2H6Z A;  2FNO A;  2DJ3 A;  4LL4 B;  4TRX A;  4KA0 A;  2OAC A;  4IQA A;  1DE1 A;  1A2J A;  1XOA A;  1ZYE A;  4ZBD A;  1USB A;  2VAF A;  3TJF A;  1SL0 B;  3GSS A;  1FG4 A;  2E7P A;  4Q5F A;  4IP6 A;  4NMU A;  4PQH A;  3DD3 A;  2O7K A;  2MMA A;  2OA7 A;  2R0P A;  1V40 A;  2JAD A;  3QPM A;  2NBS A;  4WXT A;  1S3R A;  1PKW A;  1FB0 A;  2ON7 A;  5B8A A;  2DKI A;  4ML1 A;  2QSI A;  5KN2 A;  4CHS A;  2O85 A;  2X8C A;  1YZX A;  3R3E A;  4L5O A;  5JCW A;  3DIE A;  4QL7 A;  4GCI A;  2GDR A;  3CYN A;  2VL3 A;  5DQY A;  19GS A;  5HFK A;  3A2V A;  2YWM A;  1SK2 A;  2NPB A;  2XBQ A;  3DVX A;  10GS A;  1ON4 A;  4TVE A;  3FRC A;  6GSU A;  4DSR A;  1QQ2 A;  5HR2 A;  3HJP A;  2QGV A;  1XWC A;  2WUL A;  4TR3 A;  2VLU A;  2JU5 A;  3VPQ A;  2TIR A;  4G10 A;  3ZIT A;  4GRF A;  1UVZ A;  2H1G A;  3EUR A;  4K7I A;  2E0Q A;  4I5Q A;  4PQ1 A;  4TKY A;  2A2P A;  2YCD A;  4NV5 A;  4EIP A;  2EIO A;  3L4N A;  4BVX B;  4EC0 A;  4MJB A;  2B1L A;  5F07 A;  3ZLP A;  3CXG A;  2VL2 C;  3FR9 A;  1GTA A;  3VK9 A;  1M9B A;  1ERV A;  1KTE A;  4A5P A;  2JSZ A;  4F0C A;  2RUF A;  1Z9H A;  3TRP A;  5L71 A;  3APS A;  5JWO B;  3FY7 A;  6GSY A;  1PN9 A;  4XS4 A;  2V41 A;  4V2L A;  1EOH A;  5CAX A;  4EIQ A;  1B4Q A;  2MYG A;  4EF0 A;  4N30 A;  1U87 A;  3VI5 A;  2OBI A;  3VLN A;  1XOB A;  1GUL A;  5ECL B;  4TN8 A;  3EVI A;  3UBL A;  1H4O A;  2M72 A;  11GS A;  2KP2 A;  4N10 A;  4BVY B;  3BOA A;  3EPT A;  4Z2T A;  2KHP A;  2C1Y A;  1WRY A;  5D9T A;  2YN1 A;  1EEM A;  4MJC A;  2X64 A;  1YF0 A;  1HNB A;  2H71 A;  2H74 A;  3TKS A;  1UC7 A;  1RK4 A;  1U88 A;  5A4W A;  4MZC A;  1QFN A;  3LJR A;  3QAG A;  4OO5 A;  3L9V A;  5ID2 A;  5JCG A;  4DSQ A;  1EP8 A;  4I97 A;  4EKZ A;  1GSU A;  1F9M A;  1R7H A;  2C3N A;  4LL1 B;  4ZXG A;  2EIQ A;  2PVO C;  2IPA A;  3E3E A;  22GS A;  3FK8 A;  2GLR A;  1ZCP A;  2FA8 A;  2LEG A;  3LXZ A;  3U5R E;  4HSC X;  2D2Z A;  3UAR A;  1XFL A;  3F4R A;  3P2A A;  1NM3 A;  3QFB C;  4YKF A;  2F3M A;  1WIK A;  3BD2 A;  3V1W A;  2DBC A;  1DUG A;  1W4V A;  2H66 A;  3GKK A;  4F03 A;  1EP7 A;  5EPF A;  2AAW A;  3Q19 A;  5LD0 A;  2BMX A;  2JL4 A;  4HU7 A;  1T4Y A;  1F3A A;  1TW9 A;  3FR3 A;  3IPZ A;  2B5X A;  2LRT A;  5F0G A;  1PD2 1;  2FWH A;  1DBY A;  4PNG A;  3APO A;  4MH2 A;  3ME8 A;  3BCI A;  1S3D A;  2H70 A;  3A5I A;  1T3B A;  2OE0 A;  5G30 A;  2IFQ B;  4TXO B;  3HVV A;  1SJ6 A;  4X43 A;  1YQ1 A;  1C72 A;  4ECB A;  4WF4 A;  1GTU A;  1EZK A;  1Q98 A;  3ERW A;  4ZL9 A;  2VLV A;  1A24 A;  1BG5 A;  1TU7 A;  1SEN A;  1GSQ A;  3JCM L;  1NSW A;  1IYH A;  2HRK A;  3FZ5 A;  2FWE A;  4PQI A;  2AHE A;  1U6T A;  3DRN A;  3GN3 A;  2DLX A;  2UZ8 A;  5DCH A;  1OE8 A;  3ISO A;  1FW1 A;  1M2B A;  2IL3 A;  1HD2 A;  2GQL A;  1KNG A;  3GNJ A;  1THO A;  3KP9 A;  3ZIV A;  3VFI A;  3FKF A;  3GTU A;  4BL7 B;  2P0G A;  4GQC A;  2E2M A;  5D93 A;  1A23 A;  3HVX A;  1J9B A;  3C73 A;  4OCF A;  4LMV A;  3KJY A;  3HD5 A;  1G0T A;  2FUG 2;  2VCW A;  1SK1 A;  3US3 A;  1ZMA A;  4X1U A;  4HS1 A;  4KGI A;  3ZIJ A;  4XRA A;  4FYU A;  5DBQ A;  3W8S A;  3L78 A;  3PH9 A;  3FZA A;  5LNK e;  2M46 A;  2YWI A;  1PRX A;  4ACS A;  1W89 A;  3DVW A;  3FHK A;  1EOG A;  3LFL A;  2DC5 A;  4K0N A;  3UIW A;  4TXV A;  5DAK B;  1XW6 A;  1PGT A;  3HYP A;  3IAS 2;  5D9X A;  1B4P A;  2IWT A;  1YF1 A;  1XWB A;  2GST A;  1QUW A;  3BBY A;  5G1L A;  4PUF C;  1BED A;  4KB3 A;  2H0G A;  3D0Z A;  1ACV A;  2WRT A;  5B8B A;  2C8U A;  2IMD A;  3MYD A;  4ZIJ A;  4FYB A;  2X8G A;  2C0F A;  3UVH A;  3A5W A;  4K5S A;  3H4K A;  4MLY A;  2B7J A;  1QGV A;  2HFD A;  2GZP A;  4G0I A;  1TOF A;  5GAP D;  2IME A;  3EMP A;  5H5Q A;  1SL2 B;  1GUH A;  4Q5R A;  5CP1 A;  5IMC A;  4ZIL A;  4NHW A;  5D9W A;  4ULX A;  4L5L A;  1WWJ A;  2C0D A;  5IIZ A;  3EU3 A;  4MMM A;  4TW5 A;  3CMI A;  3C71 A;  5A5K A;  4ID0 A;  1GNE A;  3CTG A;  4N0Z A;  3C8E A;  2H6Y A;  3P8W A;  1CQG A;  5IMZ A;  1LU4 A;  3TKQ A;  3J7Y k;  2B1K A;  1THX A;  4CY8 A;  2H0I A;  4G19 A;  1SK0 A;  3IRA A;  4HQZ A;  5EVO A;  1T00 A;  3ZVJ D;  3MIX A;  2CQ9 A;  3KMN A;  4IJI A;  4HZ4 A;  3HZ4 A;  2IMI A;  5ECS A;  3VPT A;  1O8W A;  2YWO A;  3TKP A;  3IOS A;  4F2I A;  4BVX A;  1MD3 A;  2GT5 A;  3HDC A;  4K8M A;  5F8B A;  5DQS A;  2IN3 A;  1M7T A;  2HXK A;  1S3A A;  2WDU A;  3KH7 A;  1X5C A;  2IMK A;  3A2W A;  1JLV A;  1B48 A;  5D9V A;  1PX6 A;  4JU5 A;  1NHY A;  4E8H A;  2LJA A;  2L5O A;  4YAP A;  1MTC A;  3LG6 A;  2M80 A;  1YJ6 A;  3TJK A;  2LNT A;  4K6X A;  1B9X C;  2PU9 C;  4TR0 A;  2DMM A;  1VRS D;  2C0E A;  1RQM A;  4N11 A;  1ERT A;  1OAZ A;  1WMJ A;  3EC3 A;  4MH3 A;  2LNS A;  2OAD A;  1SD8 A;  2JZT A;  2K6V A;  4X4J A;  1XWA A;  1DE2 A;  4MA9 A;  2QKE A;  2EC4 A;  5J5N A;  1AQW A;  1V58 A;  1M9A A;  5B6N A;  2XBI A;  2FGX A;  1EV9 A;  3HKR A;  1FAA A;  5GST A;  3CQF A;  4K7N A;  1VF2 A;  1GLP A;  1ZYN A;  5G31 A;  2RII A;  3SWL A;  4AGS A;  2LUS A;  2H1A A;  4BWQ A;  4Q5N A;  3WD6 A;  2I81 A;  3MAK A;  2LTK A;  4MP4 A;  1R5A A;  2F8F A;  5IQY A;  1TJD A;  4EUY A;  3N9J A;  1SKS B;  1FHE A;  4XS1 A;  1ZGN A;  4L0W A;  4DVC A;  1SYR A;  1A2M A;  1BQ7 A;  2J23 A;  4WET A;  3A3T A;  3HXS A;  3F8U A;  3I6A A;  1GSF A;  3FEU A;  2H6X A;  4OCE A;  3F3R A;  3DXB A;  3TRX A;  2FWG A;  1G7O A;  1GRX A;  3TUE A;  3GX8 A;  1MDJ A;  2NDO A;  3QDN A;  2AUV A;  4LMW A;  2VCT A;  1R26 A;  5C00 A;  1OC9 A;  5KN3 A;  5DDL A;  3TB2 A;  3CRU A;  2IFQ A;  2YV7 A;  5HFI A;  1TI3 A;  4TXO A;  3D22 A;  3RHC A;  2PUK C;  4IKH A;  1MDK A;  2VL9 A;  1MEK A;  1BYE A;  4KH7 A;  2KUC A;  2OE1 A;  5B7C A;  2HRF A;  2LKU A;  4I8B A;  4K0G A;  4TR1 B;  3FW2 A;  3UOM A;  1E6B A;  4HZ2 A;  3TKR A;  1PFO A;  1TI1 A;  2DJ0 A; 
#chains in the Genus database with same CATH homology
 2RLI A;  3KH9 A;  4CY6 A;  1T1V A;  4O5R A;  6GSX A;  3GX0 A;  4IVF A;  2RUE A;  3KZQ A;  3KGK A;  5ABR A;  2DIZ A;  3UMA A;  1PN0 A;  5J41 A;  4USS A;  1G6W A;  1WP0 A;  1URM A;  1M0U A;  1TRW A;  1Z7R A;  4J2F A;  4KAE A;  1T7P B;  2V32 A;  2V2G A;  3P7X A;  5KOX A;  1X5D A;  3KTB A;  4NPB A;  1A8Y A;  3IC4 A;  3M0F A;  5JWR B;  4NV2 A;  1JZR A;  2K8S A;  2WS2 A;  4OFN A;  4Q5Q A;  3DML A;  3H8Q A;  5KN1 A;  1JZD A;  4IJ3 A;  1PMT A;  4P3Y B;  5AIX A;  4EDY A;  1GSY A;  2I4A A;  2YJ7 A;  5DAK A;  2FLS A;  1YY7 A;  3VWU A;  3IR4 A;  3VWX A;  2WZ9 A;  4JR4 A;  2PGT A;  2CVK A;  2R0C A;  3GYK A;  3I69 A;  2PPT A;  3DGQ A;  3BJ5 A;  2LS5 A;  2CT6 A;  3QMX A;  4MDC A;  1QK8 A;  3IHG A;  4ECI A;  4HUA A;  5CRE A;  2DJ1 A;  18GS A;  2R5G A;  17GS A;  1SJZ A;  3TOU A;  2PBJ A;  4FH8 A;  4FO5 A;  4WR4 A;  5B6M A;  3LYK A;  2H0H A;  3D4M A;  1EGR A;  5GSS A;  5DCG A;  3DKS A;  4EE0 A;  3G7J A;  2DML A;  2EIR A;  5HR3 A;  4MNN A;  4IW9 A;  4NWY A;  3ZFL A;  2X8H A;  2C80 A;  4IS0 A;  2C0G A;  3D21 A;  2DJ2 A;  2XHF A;  1FO5 A;  2CZ3 A;  2KOK A;  4G0K A;  1LJR A;  2FWF A;  2VOC A;  4DSS A;  4F9Z A;  4L0U A;  1N8J A;  2HNL A;  2R2J A;  4KCE A;  2GQK A;  3H79 A;  2V6O A;  1J0F A;  3LOR A;  3IV4 A;  2HRN A;  2XPE A;  4I6X A;  5AGY A;  3LQ7 A;  1F6M C;  3TKS C;  5H5R A;  2IJY A;  2YAN A;  2F8A A;  4PXO A;  1S3C A;  1PL2 A;  4V2N A;  2HZF A;  1XPV A;  2CV4 A;  2HSH A;  3GKM A;  2GSR A;  2L4C A;  3W8J A;  3EWL A;  2YJH A;  1WE0 A;  1GH2 A;  2GZY A;  4TOP A;  1TK5 B;  3C1R A;  3ZZX A;  3IK9 A;  3CSI A;  1KBN A;  5FHI A;  4WBR D;  2VO4 A;  3EMX A;  2L57 A;  4YH2 A;  1OKT A;  4KE3 A;  5HR0 A;  5CO3 A;  1MDI A;  2K8V A;  1TDI A;  1UN2 A;  3D6I A;  5ENU A;  1EGO A;  1B8X A;  3WGD A;  4WKW A;  3GRX A;  1AC1 A;  3MSZ A;  1GSE A;  4X0X A;  4YQU A;  3O6T A;  2RM6 A;  4EO3 A;  4ECJ A;  4V1A g;  1EWX A;  4OFT A;  4L8E A;  4AF2 A;  2IIY A;  3RDW A;  5EY6 A;  2O89 A;  3M9K A;  5BMU A;  2MMZ A;  2HRA A;  2R3X A;  1GTI A;  3ZYW A;  3GIX A;  8GSS A;  2OKA A;  3KTL A;  3HCZ A;  3QD9 A;  1ZL9 A;  2PWJ A;  3E0U A;  1K0B A;  4MF5 A;  3O76 A;  2VCZ A;  4Z7X A;  3GST A;  2O87 A;  3TKS E;  1O73 A;  4TR4 A;  4OWY A;  2DKH A;  3GMF A;  5HR1 A;  5IO2 A;  1GTB A;  1PKZ A;  2H72 A;  4HI7 A;  2P5Q A;  2MZC A;  1V9W A;  3CRT A;  4HJM A;  2Z9S A;  12GS A;  1AQV A;  2CZ2 A;  5CRW A;  3LYP A;  4BPY A;  5BRT A;  2G0F A;  4MZB A;  3KCM A;  3SBC A;  2H01 A;  1Z6M A;  2FD3 A;  1MD4 A;  2BJX A;  4IQ1 A;  3ZL5 A;  5CYY A;  5ID2 B;  1J08 A;  2MMN A;  2LJK A;  2WJU A;  3KM6 A;  2MMO A;  2N5F A;  5ECO B;  2VM1 A;  2MBT A;  1V2A A;  3ME7 A;  4IBP A;  1K3Y A;  4KSM A;  3GL5 A;  2N5B A;  1X9S B;  4WR5 A;  1AIU A;  4ICY A;  1PL1 A;  2HLS A;  4BWS A;  4AJ6 A;  5ECQ B;  2KLX A;  4JRR A;  1GLQ A;  2NTO A;  2JSY A;  1PA3 A;  2PMT A;  3F4S A;  1AQX A;  2C3Q A;  2CVB A;  2RM5 A;  3DWV A;  3FZ4 A;  1WPI A;  5KN0 A;  3U6V A;  2H76 A;  4I2T A;  4XIH A;  3RBT A;  3LSZ A;  4GLT A;  3ZMK A;  1V57 A;  3IHQ A;  3VWV A;  1OYJ A;  4JZQ A;  1PSQ A;  5C04 A;  1XVQ A;  4NAX A;  4ZL8 A;  4XTS A;  2ON5 A;  4EVM A;  2WB9 A;  3ED3 A;  4IHU A;  1ERU A;  5DJM A;  5J9B A;  2HZE B;  2DJK A;  2L6C A;  5E59 A;  1K0O A;  5F05 A;  2WCI A;  2CAI A;  1DSB A;  1GSD A;  1XVW A;  1G7E A;  4GTU A;  3LEF A;  1A0R P;  5ECI B;  3GUR A;  5ECK B;  1GP1 A;  3TOT A;  1AUC A;  3IBH A;  4YAV A;  3PIN A;  1SL1 B;  2AYT A;  3D5J A;  1Q4J A;  5J3R A;  4YQM A;  1R4W A;  1XZO A;  1VF3 A;  3ERF A;  3GUS A;  1A2L A;  2A4H A;  1GNW A;  3G7Y A;  2XC2 A;  2ALB A;  4RI6 A;  2PVQ A;  1O6J A;  3HHV A;  1M99 A;  3UL3 A;  20GS A;  3I43 A;  2I1U A;  3PPU A;  4BVY A;  4LLR A;  4IP1 A;  4MK3 A;  2REM A;  2HSM A;  2CA8 A;  3UVT A;  2B5Y A;  16GS A;  2OJL A;  1SU9 A;  2V1M A;  5ECR B;  5LCZ A;  2YZH A;  1SKW B;  3WGE A;  4KX4 A;  1ABA A;  3LGC A;  2CVD A;  4XHM A;  2H1B A;  3M8N A;  4O5U A;  3F6D A;  4HDE A;  2R0G A;  4O92 A;  1X9M B;  3QAV A;  3IAM 2;  3M9J A;  4ZB6 A;  4LA1 A;  4IN0 A;  4XS6 A;  4JBB A;  2YNX A;  3HY2 A;  4WEY A;  1X5E A;  2O8V B;  2OBK A;  5FT3 A;  1QMV A;  2ZUP A;  4XRD A;  5HQP A;  1RW1 A;  4I2U A;  3ZFB A;  1JHB A;  4GSN A;  4YKG A;  2WGR A;  4WBJ A;  2G2Q A;  1FOH A;  3KXO A;  5DAL B;  1FOV A;  1K0C A;  4CDO A;  5F06 A;  3CSJ A;  3K8N A;  5ECH B;  5G5F A;  3ZTL A;  3I9V 2;  2VD0 A;  1X9W B;  5A4V A;  2HYX A;  2J9H A;  3KD0 A;  2FY6 A;  1HYU A;  3HJM A;  4OO4 A;  5A4U A;  3M1G A;  2YP6 A;  3TJJ A;  4DEJ A;  3UBK A;  3PR8 A;  3EYT A;  3GKX A;  2KP1 A;  3F3Q A;  1V98 A;  2VL2 A;  5KOW A;  4QQ7 A;  3VUR A;  1WJK A;  3A2X A;  3H1N A;  4D73 B;  2GQM A;  3L0H A;  2GT6 A;  4ILF A;  5ELA A;  5IMF A;  3MNG A;  3OR5 A;  3IK7 A;  1F2E A;  1YKA A;  1JZO A;  1GSS A;  3GV1 A;  4FIW A;  3L9U A;  4V1A p;  2AJQ B;  1G6Y A;  2GTU A;  1GUM A;  3TJB A;  1ST9 A;  1ILO A;  2GZZ A;  1QXH A;  4RI7 A;  5GZZ B;  5KEJ A;  5CNW A;  5AN1 A;  1O81 A;  5AIS A;  4IEL A;  1TK8 B;  2A2S A;  2K18 A;  2FHE A;  4ZB8 A;  1FVK A;  2HSY A;  1Z5Y E;  4GQF A;  2ZCT A;  3GA4 A;  4PUA A;  4RQX A;  4BL7 A;  3TDG A;  4POB A;  4WF5 A;  2LV3 A;  3C1S A;  2C4J A;  5IM9 A;  3WYW A;  2F51 A;  2A2R A;  3CTF A;  1HNA A;  4OFM A;  4RUV A;  3ZVJ A;  4MF7 A;  1A8L A;  4Z2R A;  1F37 A;  3LW9 A;  1HNC A;  1YEP A;  5ECM B;  1TK0 B;  1TRV A;  2BTO T;  2AV4 A;  5H5S A;  5J9C A;  2WFC A;  1Y25 A;  1T4Z A;  3E9J B;  4ECC A;  1TRS A;  1K3O A;  5FWG A;  4O5Q A;  1YEX A;  3W6G A;  3GH6 A;  1K3L A;  2VM2 A;  3IA1 A;  3TJG A;  4HU9 A;  3ZRD A;  5ECP B;  6GSS A;  1U3I A;  3HVS A;  2TRX A;  4KCA A;  1Z7P A;  3VI7 A;  3LXT A;  2QA1 A;  3S9F A;  2VCV A;  1WOU A;  2CAQ A;  1XIY A;  1H75 A;  3QR6 A;  2R6K A;  3RPN A;  2ES7 A;  1XBS A;  4N0V A;  3F6F A;  1XWG A;  3MDK A;  2DJJ A;  4EDZ A;  1O8X A;  1XW9 A;  5ECN B;  2VCX A;  5G2Z A;  1SYX A;  2LJR A;  2R37 A;  3M3M A;  2OE3 A;  5IO0 A;  3RHB A;  3C7M A;  4ISD A;  3GHA A;  2LQO A;  5DJL A;  1OE7 A;  4KSO A;  6GSV A;  1BJX A;  2IMF A;  2N5A A;  1Z6N A;  1JZW A;  1XCC A;  1O85 A;  14GS A;  1FB6 A;  3QAW A;  2PER A;  1U3A A;  1X0R A;  1ZYP A;  1OC8 A;  4GF0 A;  4QL9 A;  4MZW A;  4E8E A;  1O7U A;  1TXX A;  1ERW A;  2NVL A;  4K1F A;  1SJI A;  4J57 E;  1PX7 A;  2AB6 A;  1VF1 A;  2CX4 A;  1UA5 A;  3EIN A;  2HZE A;  2HT9 A;  2F9S A;  2YV9 A;  4EL1 A;  4IGJ A;  3F9U A;  4GSS A;  5D8I A;  1KEB A;  2B6M A;  1OC9 B;  5ELG A;  1VF4 A;  4CW9 A;  4KDX A;  4F82 A;  4GXZ A;  3J7Y b;  2X49 A;  5IMD A;  4ZB9 A;  2QC7 A;  4YQV A;  2H1D A;  3G7I A;  4H86 A;  5IPG A;  2DIY A;  3PGT A;  3KP8 A;  1GUK A;  1AW9 A;  4O7H A;  3O3T A;  4XCS A;  2H73 A;  1VGL A;  4JE1 A;  4G0L A;  1I9D A;  2GS3 A;  5COH A;  3GH9 A;  2I9H A;  2ZNM A;  4KUN A;  3FZ9 A;  3WGX A;  2JZR A;  3BCK A;  1LBK A;  4ML6 A;  1TRU A;  3QFA C;  1B9Y C;  4HEA 2;  2CX3 A;  4K2D A;  3WT1 A;  1K0D A;  3P90 A;  3UJ1 A;  2LRC A;  3IE3 A;  3NZN A;  1SKR B;  5HFG A;  4K9Z A;  2GSQ A;  1EEJ A;  2H30 A;  1K0N A;  13GS A;  2B5E A;  4MJA A;  3KEB A;  3HZ8 A;  5JCU A;  4FQU A;  1EV4 A;  3VWW A;  3H93 A;  4HOJ A;  2JAC A;  4XS4 B;  3CBU A;  3EE2 A;  5J4U A;  4V2M A;  3Q74 A;  2PN8 A;  5G1K A;  6GST A;  5D96 A;  2I3Y A;  1TU8 A;  2HE3 A;  2A4V A;  2VCQ A;  1T8E B;  1OKD A;  2L4Q A;  2VIM A;  4NHZ A;  2LRN A;  4PGT A;  1JLW A;  3D4T A;  4MPG A;  3Q6O A;  3LWA A;  2L5L A;  1ZYQ B;  2YZU A;  3HA9 A;  2MBS A;  4KF9 A;  1JFU A;  2YOI A;  1AXD A;  3NIV A;  2XPD A;  3ZML A;  3KIJ A;  4GWR A;  5AIV A;  5DAL A;  4AJ8 A;  1K0A A;  3MWH A;  1GWC A;  3IC8 A;  3L9S A;  1XXU A;  1I5G A;  2VUP A;  3UAP A;  4K7O A;  3ERG A;  5JWQ B;  3RAZ A;  3NOF A;  3CSH A;  1BX9 A;  5GAN D;  2L6D A;  1Y6E A;  5IMA A;  1TKD B;  4OD7 A;  2TRC P;  2X99 A;  5IMV A;  6GSW A;  2B7K A;  1AAZ A;  3QCP A;  2H8L A;  3GL3 A;  2FA4 A;  9GSS A;  4HQS A;  3TRQ A;  4D73 A;  5EL8 A;  3FYG A;  2X4A A;  3AY8 A;  5G5E A;  4F0B A;  4JED A;  4POL A;  3UEM A;  3ZRE A;  1NW2 A;  1GL8 A;  4GST A;  1E2Y A;  4MPF A;  1F3B A;  4EXJ A;  1M2A A;  5IOX A;  4K5R A;  4DSS B;  1M2D A;  4ZL7 A;  1HQO A;  4MCU A;  4PUR A;  1R5P A;  5IPH A;  3QOU A;  1ML6 A;  4TR1 A;  2HI7 A;  3F0I A;  2GSS A;  3IDV A;  5INY A;  3Q18 A;  2JZS A;  1CQH A;  2DSA A;  3F63 A;  2P5R A;  3F4T A;  1FVJ A;  1N2A A;  1XWK A;  7GSS A;  4BA7 A;  4KDY A;  3FMW A;  3EU4 A;  1NHO A;  2YWN A;  3IXR A;  2VLT A;  1Z3E A;  4AJ7 A;  4PTS A;  4POM A;  5CRG A;  4O32 A;  2P31 A;  4POK A;  4HJ2 A;  4NXI A;  1OVN A;  3KMO A;  1A0F A;  3FR6 A;  1PQN A;  1YKC A;  4ZBA A;  4Z2U A;  2R4V A;  3RPP A;  4PX1 A;  5IOW A;  4KND A;  1TP9 A;  5DVB A;  2L59 A;  4K2X A;  2GVP A;  2LQQ A;  2C3T A;  5E4W A;  2GGT A;  2K9F A;  4MJE A;  4MF6 A;  4RQR A;  2B3S A;  4G9H A;  4JR6 A;  3DYR A;  2V6K A;  2LST A;  1XW5 A;  1TTZ A;  3GKN A;  2VD1 A;  3GTU B;  4FYC A;  5CRD A;  2H75 A;  4KW6 A;  4G2E A;  3G9B A;  1ZOF A;  4OMV A;  5D73 A;  3HJO A;  1K0M A;  1YDK A;  1SD9 A;  4ZBB A;  3TGZ A;  3GFK A;  3APQ A;  1ZZY A;  2QA2 A;  4MAB A;  2H19 A;  3TCO A;  3WT2 A;  3R2Q A;  1BAY A;  3DEX A;  4PNF A;  4J56 E;  5CRH A;  2YPM A;  1IYI A;  2FCH A;  3N5O A;  1OC3 A;  2E2G A;  4KDU A;  2H6Z A;  2FNO A;  2DJ3 A;  4LL4 B;  4TRX A;  4KA0 A;  2OAC A;  4IQA A;  1DE1 A;  1A2J A;  1XOA A;  1ZYE A;  4ZBD A;  1USB A;  2VAF A;  3TJF A;  1SL0 B;  3GSS A;  1FG4 A;  2E7P A;  4Q5F A;  4IP6 A;  4NMU A;  4PQH A;  3DD3 A;  2O7K A;  2MMA A;  2OA7 A;  2R0P A;  1V40 A;  2JAD A;  3QPM A;  2NBS A;  4WXT A;  1PKW A;  1FB0 A;  2ON7 A;  5B8A A;  2DKI A;  4ML1 A;  2QSI A;  5KN2 A;  4CHS A;  2O85 A;  2X8C A;  1YZX A;  3R3E A;  4L5O A;  5JCW A;  3DIE A;  4QL7 A;  4GCI A;  2GDR A;  3CYN A;  2VL3 A;  5DQY A;  19GS A;  5HFK A;  3A2V A;  2YWM A;  1SK2 A;  2NPB A;  2XBQ A;  3DVX A;  10GS A;  1ON4 A;  4TVE A;  3FRC A;  6GSU A;  4DSR A;  1QQ2 A;  5HR2 A;  3HJP A;  2QGV A;  1XWC A;  2WUL A;  4TR3 A;  2VLU A;  2JU5 A;  3VPQ A;  2TIR A;  4G10 A;  3ZIT A;  4GRF A;  1UVZ A;  2H1G A;  3EUR A;  4K7I A;  2E0Q A;  4I5Q A;  4PQ1 A;  4TKY A;  2A2P A;  2YCD A;  4NV5 A;  4EIP A;  2EIO A;  3L4N A;  4BVX B;  4EC0 A;  4MJB A;  2B1L A;  5F07 A;  3ZLP A;  3CXG A;  2VL2 C;  3FR9 A;  1GTA A;  3VK9 A;  1M9B A;  1ERV A;  1KTE A;  4A5P A;  2JSZ A;  4F0C A;  2RUF A;  1Z9H A;  3TRP A;  5L71 A;  3APS A;  5JWO B;  3FY7 A;  6GSY A;  1PN9 A;  4XS4 A;  2V41 A;  4V2L A;  1EOH A;  5CAX A;  4EIQ A;  1B4Q A;  2MYG A;  4EF0 A;  4N30 A;  1U87 A;  3VI5 A;  2OBI A;  3VLN A;  1XOB A;  1GUL A;  5ECL B;  4TN8 A;  3EVI A;  3UBL A;  1H4O A;  2M72 A;  11GS A;  2KP2 A;  4N10 A;  4BVY B;  3BOA A;  3EPT A;  4Z2T A;  2KHP A;  2C1Y A;  1WRY A;  5D9T A;  2YN1 A;  1EEM A;  4MJC A;  2X64 A;  1YF0 A;  1HNB A;  2H71 A;  2H74 A;  3TKS A;  1UC7 A;  1RK4 A;  1U88 A;  5A4W A;  4MZC A;  1QFN A;  3LJR A;  3QAG A;  4OO5 A;  3L9V A;  5ID2 A;  5JCG A;  4DSQ A;  1EP8 A;  4I97 A;  4EKZ A;  1GSU A;  1F9M A;  1R7H A;  2C3N A;  4LL1 B;  4ZXG A;  2EIQ A;  2PVO C;  2IPA A;  3E3E A;  22GS A;  3FK8 A;  2GLR A;  1ZCP A;  2FA8 A;  2LEG A;  3LXZ A;  3U5R E;  2D2Z A;  3UAR A;  1XFL A;  3F4R A;  3P2A A;  1NM3 A;  3QFB C;  4YKF A;  2F3M A;  1WIK A;  3BD2 A;  3V1W A;  2DBC A;  1DUG A;  1W4V A;  2H66 A;  3GKK A;  4F03 A;  1EP7 A;  5EPF A;  2AAW A;  3Q19 A;  5LD0 A;  2BMX A;  2JL4 A;  4HU7 A;  1T4Y A;  1F3A A;  1TW9 A;  3FR3 A;  3IPZ A;  2B5X A;  2LRT A;  5F0G A;  1PD2 1;  2FWH A;  1DBY A;  4PNG A;  3APO A;  4MH2 A;  3ME8 A;  3BCI A;  1S3D A;  2H70 A;  3A5I A;  1T3B A;  2OE0 A;  5G30 A;  2IFQ B;  4TXO B;  3HVV A;  1SJ6 A;  4X43 A;  1YQ1 A;  1C72 A;  4ECB A;  4WF4 A;  1GTU A;  1EZK A;  1Q98 A;  3ERW A;  4ZL9 A;  2VLV A;  1A24 A;  1BG5 A;  1TU7 A;  1SEN A;  1GSQ A;  3JCM L;  1NSW A;  1IYH A;  2HRK A;  3FZ5 A;  2FWE A;  4PQI A;  2AHE A;  1U6T A;  3DRN A;  3GN3 A;  2DLX A;  2UZ8 A;  5DCH A;  1OE8 A;  3ISO A;  1FW1 A;  1M2B A;  2IL3 A;  1HD2 A;  2GQL A;  1KNG A;  3GNJ A;  1THO A;  3KP9 A;  3ZIV A;  3VFI A;  3FKF A;  3GTU A;  4BL7 B;  2P0G A;  4GQC A;  2E2M A;  5D93 A;  1A23 A;  3HVX A;  1J9B A;  3C73 A;  4OCF A;  4LMV A;  3KJY A;  3HD5 A;  1G0T A;  2FUG 2;  2VCW A;  1SK1 A;  3US3 A;  1ZMA A;  4X1U A;  4HS1 A;  4KGI A;  3ZIJ A;  4XRA A;  4FYU A;  5DBQ A;  3W8S A;  3L78 A;  3PH9 A;  3FZA A;  5LNK e;  2M46 A;  2YWI A;  1PRX A;  4ACS A;  1W89 A;  3DVW A;  3FHK A;  1EOG A;  3LFL A;  2DC5 A;  4K0N A;  3UIW A;  4TXV A;  5DAK B;  1XW6 A;  1PGT A;  3HYP A;  3IAS 2;  5D9X A;  1B4P A;  2IWT A;  1YF1 A;  1XWB A;  2GST A;  1QUW A;  3BBY A;  5G1L A;  4PUF C;  1BED A;  4KB3 A;  2H0G A;  3D0Z A;  1ACV A;  2WRT A;  5B8B A;  2C8U A;  2IMD A;  3MYD A;  4ZIJ A;  4FYB A;  2X8G A;  2C0F A;  3UVH A;  3A5W A;  4K5S A;  3H4K A;  4MLY A;  2B7J A;  1QGV A;  2HFD A;  2GZP A;  4G0I A;  1TOF A;  5GAP D;  2IME A;  3EMP A;  5H5Q A;  1SL2 B;  1GUH A;  4Q5R A;  5CP1 A;  5IMC A;  4ZIL A;  4NHW A;  5D9W A;  4ULX A;  4L5L A;  1WWJ A;  2C0D A;  5IIZ A;  3EU3 A;  4MMM A;  4TW5 A;  3CMI A;  3C71 A;  5A5K A;  4ID0 A;  1GNE A;  3CTG A;  4N0Z A;  3C8E A;  2H6Y A;  3P8W A;  1CQG A;  5IMZ A;  1LU4 A;  3TKQ A;  3J7Y k;  2B1K A;  1THX A;  4CY8 A;  2H0I A;  4G19 A;  1SK0 A;  3IRA A;  4HQZ A;  5EVO A;  1T00 A;  3ZVJ D;  3MIX A;  2CQ9 A;  3KMN A;  4IJI A;  4HZ4 A;  3HZ4 A;  2IMI A;  5ECS A;  3VPT A;  1O8W A;  2YWO A;  3TKP A;  3IOS A;  4F2I A;  4BVX A;  1MD3 A;  2GT5 A;  3HDC A;  4K8M A;  5F8B A;  5DQS A;  2IN3 A;  1M7T A;  2HXK A;  1S3A A;  2WDU A;  3KH7 A;  1X5C A;  2IMK A;  3A2W A;  1JLV A;  1B48 A;  5D9V A;  1PX6 A;  4JU5 A;  1NHY A;  4E8H A;  2LJA A;  2L5O A;  4YAP A;  1MTC A;  3LG6 A;  2M80 A;  1YJ6 A;  3TJK A;  2LNT A;  4K6X A;  1B9X C;  2PU9 C;  4TR0 A;  2DMM A;  1VRS D;  2C0E A;  1RQM A;  4N11 A;  1ERT A;  1OAZ A;  1WMJ A;  3EC3 A;  4MH3 A;  2LNS A;  2OAD A;  1SD8 A;  2JZT A;  2K6V A;  4X4J A;  1XWA A;  1DE2 A;  4MA9 A;  2QKE A;  2EC4 A;  5J5N A;  1AQW A;  1V58 A;  1M9A A;  5B6N A;  2XBI A;  2FGX A;  1EV9 A;  3HKR A;  1FAA A;  5GST A;  4K7N A;  1VF2 A;  1GLP A;  1ZYN A;  5G31 A;  2RII A;  3SWL A;  4AGS A;  2LUS A;  2H1A A;  4BWQ A;  4Q5N A;  3WD6 A;  2I81 A;  3MAK A;  2LTK A;  4MP4 A;  1R5A A;  2F8F A;  5IQY A;  1TJD A;  4EUY A;  3N9J A;  1SKS B;  1FHE A;  4XS1 A;  1ZGN A;  4L0W A;  4DVC A;  1SYR A;  1A2M A;  1BQ7 A;  2J23 A;  4WET A;  3A3T A;  3HXS A;  3F8U A;  3I6A A;  1GSF A;  3FEU A;  2H6X A;  4OCE A;  3F3R A;  3DXB A;  3TRX A;  2FWG A;  1G7O A;  1GRX A;  3TUE A;  3GX8 A;  1MDJ A;  2NDO A;  3QDN A;  2AUV A;  4LMW A;  2VCT A;  1R26 A;  5C00 A;  1OC9 A;  5KN3 A;  5DDL A;  3TB2 A;  3CRU A;  2IFQ A;  2YV7 A;  5HFI A;  1TI3 A;  4TXO A;  3D22 A;  3RHC A;  2PUK C;  4IKH A;  1MDK A;  2VL9 A;  1MEK A;  1BYE A;  4KH7 A;  2KUC A;  2OE1 A;  5B7C A;  2HRF A;  2LKU A;  4I8B A;  4K0G A;  4TR1 B;  3FW2 A;  3UOM A;  1E6B A;  4HZ2 A;  3TKR A;  1TI1 A;  2DJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...