3JCML

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
SVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3jcmL00
2VCQA 5F8BA 1IYHA 1ERWA 3PGTA 2HFDA 5B8BA 3GIXA 1T00A 4I2UA 4GLTA 5J9BA 1GH2A 1XW6A 3HJPA 4TN8A 1U87A 3UEMA 1PKWA 1TRVA 1VRSD 2WULA 4N11A 2H73A 3TOTA 5IOWA 1EEJA 1FVJA 3R2QA 4BL7A 1FG4A 4GRFA 2J23A 1YDKA 1M0UA 1FOVA 1Z7RA 1ZZYA 4L5LA 2B5YA 2B1LA 2VO4A 2P0GA 5B8AA 1EOHA 2NPBA 5C00A 1PGTA 4V1Ag 3FZ9A 2K18A 2VOCA 3US3A 2V41A 4FO5A 4HEA2 4OFNA 2Z9SA 5CREA 2MMZA 1BAYA 1PQNA 1ILOA 4BWSA 3LORA 1K0CA 2H0IA 1FVKA 5A4UA 1OC3A 2X64A 4O7HA 3N9JA 2KP1A 1SYRA 4MF6A 4MCUA 3TOUA 3RPPA 1GSQA 1F37A 1VF2A 3TCOA 3KP8A 2CQ9A 4AJ8A 3GSSA 1OVNA 3F3QA 2F9SA 1HYUA 3CSHA 1BG5A 3HZ4A 1XIYA 3ME7A 3M9KA 5DBQA 4E8HA 3FZ4A 4FYUA 4N10A 3GKXA 3HHVA 1DBYA 3FEUA 5CNWA 5D9XA 2LTKA 5J3RA 1K0DA 2KP2A 1MDKA 4TRXA 3FR3A 1OYJA 2GVPA 3EWLA 4TVEA 2FNOA 3IC4A 4NV2A 5H5SA 5IMCA 1G7OA 2MMAA 4EO3A 3DXBA 4NHZA 1JLVA 4WETA 4POBA 3TKRA 2REMA 5DDLA 2A2RA 3EYTA 3E0UA 3QFAC 4PURA 3QR6A 3APSA 3J7Yb 20GSA 1TOFA 2C4JA 4ID0A 3TJFA 3QAWA 2QKEA 3TDGA 2GGTA 2H1GA 2V1MA 2K9FA 1XWCA 1O8XA 5CRHA 3UBLA 2F8AA 1XVWA 3LSZA 3DWVA 3QAVA 1WIKA 4EVMA 2H6XA 4ZL8A 4Q5QA 3A2WA 4OFTA 3IHQA 1ACVA 1BQ7A 5CAXA 3RAZA 2PBJA 5GAND 11GSA 3WGEA 3APOA 3DKSA 1G6WA 3L78A 1TK8B 2GSTA 18GSA 4O5RA 1EP7A 4EF0A 2HXKA 4KUNA 1VF3A 3EURA 4E8EA 1X9MB 9GSSA 2LRNA 3IE3A 3ERFA 2VLTA 3C7MA 2FD3A 4GTUA 3RBTA 1PKZA 3J7Yk 1J9BA 4YH2A 3MWHA 5CO3A 3BOAA 2CX3A 5H5QA 4V2LA 2JSYA 4LLRA 3CYNA 3QAGA 4J2FA 3IA1A 3WYWA 3KEBA 5LCZA 5AN1A 4ZIJA 1GLQA 2L57A 1V9WA 4EL1A 3GHAA 2YN1A 2AV4A 2YV7A 4OWYA 1GLPA 3M0FA 4ILFA 1K3LA 1BJXA 2B7KA 5ECQB 2H30A 1MD4A 1VF4A 4XHMA 1UVZA 2NVLA 4ZL7A 4G19A 2GZPA 2L59A 1VF1A 3CBUA 1TU8A 1R26A 1U88A 4KB3A 6GSVA 3KM6A 4JZQA 1USBA 2RLIA 2MMOA 4GQCA 3C71A 2NBSA 5GAPD 4K0GA 4DSRA 5DCHA 2O89A 2ON5A 4NHWA 1SK2A 2F51A 2R5GA 5AGYA 4L0UA 2H72A 3HVXA 4WR4A 2E7PA 2AHEA 5CP1A 2AJQB 4POLA 2C80A 2VL3A 3CXGA 4KNDA 5DJLA 4DEJA 4HJ2A 2FWGA 2H19A 4YAVA 2IL3A 3KH7A 1M9AA 4WF4A 1EV9A 2HZEA 2H1DA 1K0AA 5ECSA 1W89A 3VWUA 2MZCA 4F9ZA 5HR3A 2C0FA 3EU3A 2YWIA 3RHCA 2L6DA 5HQPA 3IAS2 1NHYA 1ZL9A 3U5RE 2C3NA 3QD9A 5ECPB 4ULXA 1FB6A 3O76A 4RI6A 3PR8A 2OBKA 3M9JA 4F82A 1CQHA 4PX1A 2EIRA 1YF1A 5KN1A 2RM6A 2R4VA 2IMIA 2C1YA 3GX0A 1YEPA 4MJCA 1GSUA 5ECIB 3FZAA 1MDIA 4OO5A 1U3AA 2H8LA 3G9BA 1YKAA 3HKRA 4IHUA 2YZHA 2IIYA 4KA0A 1G7EA 4K6XA 2FWEA 2G2QA 1IYIA 2HSYA 5D73A 1XWBA 4XIHA 3IXRA 4CW9A 2CZ3A 1QFNA 5DALA 4K1FA 3H1NA 4ZBBA 2DIYA 1JZOA 1A0RP 5DVBA 3A2XA 1E6BA 2EC4A 8GSSA 3GURA 4ECCA 5KN2A 3ZFBA 1O81A 2R6KA 1PL2A 1K3OA 1WRYA 5D96A 3L4NA 1HNCA 5KN0A 3EE2A 1ZYEA 1AIUA 2OE3A 3FHKA 3TKQA 2FHEA 2GZZA 3L0HA 2VCVA 2O7KA 1F6MC 5ELAA 4KCAA 2I9HA 5J4UA 1FB0A 2C3QA 2H0HA 1XW9A 4P3YB 2AAWA 4LL4B 4JBBA 5AIVA 1NW2A 4NMUA 3F63A 2MBTA 2K6VA 3GN3A 1PRXA 4TXOB 3H8QA 1RQMA 1GTBA 2HRFA 2CAQA 4TXOA 1HNBA 2B7JA 3KJYA 1K0OA 1SU9A 1F3AA 4F0CA 2YANA 1YF0A 2WZ9A 2LV3A 1MDJA 3DEXA 2I81A 1T8EB 5HR2A 1LBKA 1AXDA 1XWAA 2YWNA 1TJDA 3WGXA 1MEKA 2GQKA 2B5EA 2RUEA 5FHIA 2YV9A 1K0MA 1U6TA 1X5EA 1JZDA 5B6MA 4KSOA 1SKSB 1XXUA 3HVSA 2GLRA 2I3YA 1A2MA 2LQOA 3ZVJA 2WJUA 4N0VA 4NXIA 1ABAA 1YZXA 3APQA 4IS0A 5H5RA 4KW6A 2FLSA 5G5EA 5G1KA 4GSNA 3Q74A 3SBCA 2PN8A 1Z6MA 3H79A 3HCZA 4WR5A 3CRUA 4HDEA 4J56E 3ISOA 3DRNA 3DIEA 3MSZA 4GCIA 1EOGA 4Q5NA 2VCTA 2C0DA 4TR4A 3V1WA 3RDWA 2H66A 3HJMA 1M99A 1RK4A 5G1LA 2ALBA 1R4WA 1HNAA 1DSBA 2IWTA 1TP9A 1H75A 4HOJA 3EVIA 4MA9A 1TTZA 3LXTA 5HR0A 2FA8A 2H6YA 3CRTA 2XC2A 2HZFA 1QGVA 4IJIA 2XPEA 4BWQA 3IV4A 1OKTA 22GSA 4O92A 5EVOA 3EU4A 3GV1A 4ACSA 2MYGA 1B4PA 2E2GA 3UBKA 5ECLB 2PGTA 4EKZA 5IM9A 4MJEA 3HXSA 3VK9A 4X1UA 4DSSB 3D4TA 4XRDA 3ZFLA 4DVCA 1GSDA 2VM1A 5A5KA 2P5QA 5F07A 4DSSA 1KNGA 1QUWA 3GRXA 2WS2A 1TDIA 5D9TA 4TKYA 1HD2A 1QK8A 3NOFA 3ERWA 1XOAA 3UOMA 1F2EA 1B9XC 2DBCA 4HZ2A 3C73A 3D0ZA 3IR4A 4KAEA 5E59A 5ENUA 3W8JA 5ELGA 4XS6A 2YWOA 2YP6A 2DJ0A 4JRRA 3HZ8A 5EPFA 1V57A 1LJRA 5ID2B 1TU7A 2EIQA 2YNXA 5CYYA 5JCGA 1YKCA 3UAPA 5ID2A 3I43A 1I9DA 1Z5YE 1YJ6A 1GULA 2N5BA 4F03A 1JZWA 2IMFA 3A5WA 4YAPA 3F9UA 5JWOB 4X0XA 4AGSA 4MPFA 2H74A 4MMMA 4GXZA 1V98A 2O85A 4OD7A 3GTUB 3C1SA 4FYCA 2YJ7A 5IO2A 3HJOA 3DVWA 1Y6EA 4BA7A 1J0FA 4FIWA 4KH7A 2BMXA 4MLYA 3KZQA 2JU5A 3MDKA 2CVDA 5A4WA 4TOPA 5LD0A 4IKHA 5DCGA 4MPGA 1KEBA 1V58A 1ST9A 4KDYA 1JFUA 1ZCPA 5AISA 4YQMA 1QQ2A 5GZZB 2VCXA 2VL2A 2R3XA 1SYXA 3G7IA 1GUMA 5C04A 1T3BA 1UA5A 4HZ4A 2GDRA 2RUFA 4K2DA 1T7PB 3TJKA 5COHA 2AUVA 3F6DA 4RQRA 3DGQA 5J5NA 3ZLPA 1M2AA 2MMNA 4WF5A 5INYA 1JLWA 4MZBA 2DC5A 1KTEA 1TI1A 1XW5A 5A4VA 2N5AA 5FT3A 2DMLA 4V2MA 3GNJA 5DQYA 1UN2A 2DLXA 2ZUPA 4EUYA 5F06A 1XOBA 3DMLA 1AQVA 4TW5A 2PUKC 2PU9C 3P90A 1ZYQB 2YWMA 3CSIA 6GSUA 2LJAA 5ECNB 2WFCA 5IQYA 3TRQA 1O8WA 2E0QA 2LNTA 3IBHA 4OMVA 2H0GA 1URMA 3VI5A 3F0IA 5KEJA 3L9VA 4IBPA 1EGOA 3K8NA 3IOSA 1XWKA 4F0BA 2YJHA 4HUAA 5D9WA 2C3TA 3ERGA 5IPGA 1T1VA 3TKSA 2H01A 4I5QA 1C72A 4ISDA 1WMJA 1EWXA 2CT6A 3BBYA 1O85A 1WE0A 4I8BA 3KIJA 1GUHA 4HU9A 1DE1A 4IN0A 5IMFA 1PN9A 3LEFA 1SK1A 5IMVA 4ZXGA 3GA4A 1A2LA 4TXVA 1OE8A 10GSA 2HLSA 2CV4A 4N0ZA 3L9SA 4I2TA 2LJRA 5JCUA 1YY7A 2VL2C 2GZYA 1FHEA 3KTBA 3ZZXA 4D73B 2M46A 3FYGA 4TR1B 2J9HA 2PVQA 2PMTA 3GH9A 3MNGA 2FA4A 2QC7A 3QOUA 4TR1A 2JADA 3QCPA 3VURA 1A8YA 5IMDA 3LYPA 3KMOA 2F8FA 1SJZA 1SKRB 3TJGA 3RPNA 2LSTA 4YQVA 3QPMA 3WGDA 2XPDA 3F4RA 3ZRDA 2VCWA 4IELA 2JZSA 3KP9A 1ZOFA 3ZVJD 4NWYA 2NTOA 3O3TA 4MJBA 2HYXA 2FWHA 1XPVA 5ABRA 3OR5A 1TK5B 3LJRA 1GNEA 1N8JA 3M3MA 2LKUA 2X8HA 4KE3A 3FZ5A 3BCIA 7GSSA 2KUCA 2GQLA 4KX4A 4XS4B 3S9FA 2R2JA 2OA7A 1M2BA 4IVFA 6GSSA 1JHBA 2HE3A 4XS4A 1QMVA 4QL9A 1EV4A 3ZL5A 4WKWA 1XCCA 5IPHA 2YOIA 3LXZA 1GNWA 3TKSC 3C1RA 2P5RA 1GP1A 2ZNMA 3GUSA 2FWFA 2WGRA 3NZNA 2K8VA 1A2JA 2LNSA 3I6AA 2KOKA 2CVBA 4MF5A 4JU5A 3VPTA 1Z3EA 1Z9HA 3M8NA 3EMPA 1THOA 2L5LA 1XBSA 2X8CA 2MBSA 3QDNA 5IMZA 4Z7XA 4PUFC 1X9SB 5FWGA 2FCHA 2IFQB 3TJBA 1WP0A 2RIIA 3F3RA 5LNKe 3Q6OA 2OE0A 1QXHA 2R37A 3TRPA 1U3IA 3RHBA 2ES7A 5HFGA 3VWWA 1ERTA 1BX9A 4EXJA 6GSTA 4WXTA 2O8VB 2DJ1A 4O32A 4AJ6A 1RW1A 2YPMA 2WDUA 3DYRA 1S3AA 2LRTA 3GKNA 1GSEA 2PERA 4JEDA 2JZRA 2ZCTA 5IMAA 5HR1A 3Q19A 1M9BA 3CSJA 3H93A 1B4QA 1TRUA 1ERUA 4L0WA 4MH2A 1K0BA 1Z6NA 3FR6A 3KD0A 2OKAA 4TR0A 2D2ZA 5D9VA 1V2AA 2L6CA 3CTGA 3O6TA 2H1BA 5DQSA 5L71A 4G10A 3TKSE 3ZREA 4EDZA 2L4CA 1ON4A 5AIXA 2CZ2A 12GSA 2GT5A 4BPYA 4POKA 4QQ7A 1GWCA 3TUEA 1UC7A 4LA1A 5EL8A 1SKWB 1AQXA 4OO4A 3HA9A 5KN3A 3IPZA 3ZITA 4IGJA 4WBRD 4L5OA 4ZILA 4ZBDA 4ECJA 3GL3A 3H4KA 2C8UA 4GSTA 5JCWA 3TGZA 1NHOA 3F4SA 4KGIA 1WOUA 1PSQA 1AUCA 2IMDA 4K0NA 5G2ZA 4H86A 4BVYA 3GH6A 3GYKA 1O73A 3TJJA 4IP6A 3UVHA 1FAAA 6GSWA 3UL3A 4RI7A 1MD3A 3UMAA 2FGXA 1A24A 2B1KA 3VLNA 3UIWA 4K7NA 3VI7A 3BJ5A 2ON7A 1OC8A 1FO5A 1SJ6A 4DSQA 4PUAA 3W8SA 1A8LA 3L9UA 5G31A 1M7TA 4GQFA 2L5OA 4RUVA 2VUPA 1M2DA 4HQSA 5CRGA 3SWLA 1PX6A 5ECKB 3IAM2 4MH3A 4MZWA 1EP8A 1TRSA 1PMTA 4PNFA 4IJ3A 2IMKA 2DJJA 3G7YA 4CHSA 4MF7A 1SL0B 1ZMAA 2DSAA 3LYKA 4K8MA 4Q5FA 3VWXA 4MP4A 2TRCP 4MZCA 2OBIA 4PXOA 3KCMA 3MAKA 3EINA 3HD5A 5ECMB 4FYBA 5ECRB 4K7OA 5B6NA 4TR3A 1XZOA 4K9ZA 1B8XA 5D8IA 14GSA 4RQXA 3VWVA 3PINA 1TXXA 1O6JA 2IJYA 2LRCA 4WEYA 4I97A 3HYPA 4HU7A 3ZTLA 3LFLA 4JR4A 1V40A 4AJ7A 4OCEA 4PQ1A 2XBQA 5E4WA 3GSTA 1BYEA 1XFLA 4ML6A 3KGKA 6GSYA 1VGLA 1GTUA 2G0FA 1R5AA 2H75A 2XBIA 4PQIA 1BEDA 1AQWA 3UVTA 1A23A 1E2YA 1T4YA 2OJLA 3E9JB 13GSA 1MTCA 3GTUA 3TKPA 1TI3A 5IOXA 5J41A 4QL7A 1CQGA 5D93A 3QFBC 3D22A 3IK9A 4JE1A 2B3SA 2GS3A 3BD2A 1TW9A 3HDCA 1DE2A 3CMIA 3D4MA 3WD6A 1S3CA 1Q98A 2IN3A 1Y25A 1X0RA 1B48A 4KDXA 2JL4A 2DJKA 2LEGA 2IPAA 1TK0B 2K8SA 3BCKA 2VL9A 3A3TA 5JWQB 2GQMA 1H4OA 4HQZA 2IMEA 4PQHA 3C8EA 2H71A 2GTUA 3ZIVA 4ECBA 3DVXA 4OFMA 4GF0A 2O87A 2OACA 3FW2A 4HI7A 1SD8A 2OADA 2VAFA 4XCSA 4G2EA 3TB2A 5GSSA 4ZBAA 2EIOA 5JWRB 2VLUA 2VCZA 4HS1A 2YCDA 4J57E 2GSSA 1SENA 3IK7A 1ERVA 2I4AA 3JCML 2CAIA 1XVQA 1WWJA 3ZIJA 3NIVA 1THXA 1SJIA 1R7HA 4L8EA 3WT2A 1PA3A 2YZUA 1A0FA 2AB6A 1O7UA 3G7JA 4ECIA 1SL1B 1EZKA 1Z7PA 19GSA 1EGRA 2A2SA 2M80A 2VM2A 1X5CA 4F2IA 1W4VA 2CX4A 5F05A 4XS1A 1GRXA 1NM3A 3LG6A 4N30A 1ML6A 2PWJA 1F3BA 3D21A 1YEXA 4ZB6A 4X43A 4MJAA 1HQOA 4MK3A 4IQ1A 2DJ2A 5HFIA 4K7IA 4IW9A 3LWAA 1Q4JA 3FK8A 1OC9B 2LUSA 4D73A 2PPTA 2WCIA 4GSSA 3VFIA 2P31A 3ZMLA 1OAZA 1OC9A 5IIZA 1LU4A 5G5FA 3I69A 4ZB8A 2HZEB 3ED3A 1B9YC 2V6KA 1WJKA 3P7XA 5J9CA 3DD3A 5EY6A 2F3MA 2HNLA 3E3EA 4POMA 2FY6A 2JSZA 4FH8A 1DUGA 4BVXA 5HFKA 1I5GA 4AF2A 5ECHB 1OE7A 4LL1B 3F6FA 1GSFA 1K3YA 2H6ZA 3EMXA 1G6YA 5CRWA 3Q18A 4EC0A 2V2GA 4EE0A 3M1GA 3I9V2 4ZB9A 3WT1A 5G30A 5CRDA 1X5DA 2I1UA 1K0NA 4Q5RA 2H76A 3UARA 4LMWA 1ZGNA 3FR9A 3KTLA 3GL5A 3HY2A 2DIZA 1AAZA 1OKDA 2CA8A 3P2AA 5DALB 5F0GA 2A4VA 4PGTA 2RM5A 4IQAA 2H1AA 3W6GA 2V32A 3A2VA 2AYTA 1TRWA 17GSA 3GMFA 5ECOB 2GSQA 4V2NA 2GSRA 4KCEA 4WBJA 2IFQA 1GSYA 1YQ1A 2HSHA 2LQQA 1SK0A 3ZYWA 3FKFA 2NDOA 1F9MA 2VD1A 1AW9A 1PL1A 2BJXA 4GWRA 4ML1A 2E2MA 4EDYA 2JACA 2KHPA 4IP1A 3N5OA 1GSSA 2GT6A 2OE1A 3FRCA 5GSTA 2HT9A 3KH9A 2B5XA 1J08A 1T4ZA 3IDVA 2QSIA 2VIMA 2XHFA 4JR6A 2TIRA 4ZL9A 2QGVA 1TKDB 2TRXA 5DJMA 2PVOC 1X9WB 2CVKA 1EEMA 4LMVA 4YQUA 4XRAA 4G9HA 1JZRA 2BTOT 2H70A 2V6OA 3F4TA 2DMMA 2FUG2 4MDCA 2DJ3A 3PH9A 4XTSA 1GL8A 4V1Ap 5B7CA 1PD21 4PNGA 4KSMA 2VLVA 3TRXA 16GSA 1GUKA 2C0EA 3D6IA 3GKKA 2B6MA 2HRNA 3U6VA 4KDUA 3F8UA 1FW1A 2M72A 2C0GA 1N2AA 3ME8A 5DAKB 3CTFA 3VPQA 5DAKA 1S3DA 2X99A 3UJ1A 3KXOA 3GFKA 5IO0A 1AC1A 2WB9A 1KBNA 3D5JA 3AY8A 2HI7A 3LGCA 1PX7A 2N5FA 4MABA 4CDOA 4NV5A 1SD9A 2X8GA 3P8WA 3GKMA 1R5PA 3EC3A 1G0TA 4NAXA 1GTIA 3GX8A 1XWGA 3FY7A 3QMXA 4NPBA 2LJKA 2JZTA 1GTAA 3IRAA 2L4QA 2KLXA 6GSXA 2VD0A 3KMNA 4I6XA 4HJMA 1NSWA 3ZMKA 1WPIA 1SL2B 4OCFA 3LQ7A 2WRTA 2LS5A 3HVVA
chains in the Genus database with same CATH superfamily
2VCQA 5F8BA 1IYHA 1ERWA 3PGTA 2HFDA 5B8BA 3GIXA 1T00A 4I2UA 4GLTA 5J9BA 1GH2A 1XW6A 3HJPA 4TN8A 1U87A 3UEMA 1PKWA 1TRVA 1VRSD 2WULA 4BL7B 1PFOA 4N11A 2R0PA 2H73A 3TOTA 5IOWA 1EEJA 1FVJA 3R2QA 4BL7A 1FG4A 4GRFA 2J23A 1YDKA 1M0UA 1FOVA 4G0LA 1Z7RA 1ZZYA 4L5LA 2B5YA 2B1LA 2VO4A 2P0GA 5B8AA 1EOHA 2NPBA 5C00A 1PGTA 4V1Ag 3FZ9A 2K18A 2VOCA 3US3A 2V41A 4FO5A 4HEA2 4OFNA 2Z9SA 5CREA 2MMZA 1BAYA 1PQNA 1ILOA 4BWSA 3LORA 1K0CA 2H0IA 1FVKA 5A4UA 1OC3A 2X64A 4O7HA 3N9JA 2KP1A 3FMWA 1SYRA 4MF6A 4MCUA 3TOUA 3RPPA 1GSQA 1F37A 1VF2A 3TCOA 3KP8A 2CQ9A 4AJ8A 3GSSA 1OVNA 3F3QA 2F9SA 1HYUA 3CSHA 1BG5A 3HZ4A 1XIYA 3ME7A 3M9KA 5DBQA 4E8HA 3FZ4A 4FYUA 4N10A 3GKXA 3HHVA 1DBYA 3FEUA 5CNWA 5D9XA 2LTKA 5J3RA 1K0DA 2KP2A 1MDKA 4TRXA 3FR3A 1OYJA 2GVPA 3EWLA 4TVEA 2FNOA 3IC4A 4NV2A 5H5SA 5IMCA 1G7OA 2MMAA 4EO3A 3DXBA 4NHZA 1JLVA 4WETA 4POBA 3TKRA 2REMA 5DDLA 4EIPA 2A2RA 3EYTA 3E0UA 3QFAC 4PURA 3QR6A 3APSA 3J7Yb 20GSA 1TOFA 2C4JA 4ID0A 3TJFA 3QAWA 2QKEA 3TDGA 2GGTA 2H1GA 2V1MA 2K9FA 1XWCA 1O8XA 5CRHA 3UBLA 2F8AA 1XVWA 3LSZA 3DWVA 3QAVA 1WIKA 4EVMA 2H6XA 4ZL8A 4Q5QA 3A2WA 4OFTA 3IHQA 1ACVA 1BQ7A 5CAXA 3RAZA 2PBJA 5GAND 11GSA 3WGEA 3APOA 3DKSA 4A5PA 1G6WA 3L78A 1TK8B 2GSTA 18GSA 4O5RA 1EP7A 4EF0A 2HXKA 4KUNA 1VF3A 3EURA 4E8EA 1X9MB 9GSSA 2LRNA 3IE3A 3ERFA 2VLTA 3MIXA 3C7MA 2FD3A 4GTUA 3RBTA 1PKZA 3J7Yk 1J9BA 4YH2A 3MWHA 5CO3A 3BOAA 2CX3A 5H5QA 4V2LA 2JSYA 4LLRA 3CYNA 3QAGA 4J2FA 3IA1A 3WYWA 3KEBA 5LCZA 5AN1A 4ZIJA 1GLQA 2L57A 1V9WA 4EL1A 3GHAA 2YN1A 2AV4A 2YV7A 1M3IA 4OWYA 1GLPA 3M0FA 4ILFA 1K3LA 1BJXA 2B7KA 5ECQB 2H30A 1MD4A 1VF4A 4XHMA 1UVZA 2NVLA 4ZL7A 4G19A 2GZPA 2L59A 1VF1A 3CBUA 1TU8A 1R26A 1U88A 4KB3A 6GSVA 3KM6A 4JZQA 1USBA 2RLIA 2MMOA 4GQCA 3C71A 2NBSA 5GAPD 4K0GA 4DSRA 5DCHA 2O89A 2ON5A 4NHWA 1SK2A 2F51A 2R5GA 5AGYA 4L0UA 2H72A 3HVXA 4WR4A 2E7PA 2AHEA 5CP1A 2AJQB 4POLA 2C80A 2VL3A 3CXGA 4KNDA 5DJLA 4PTSA 4DEJA 4HJ2A 2FWGA 2H19A 4YAVA 2IL3A 3KH7A 1M9AA 4WF4A 1EV9A 1M3JA 2HZEA 2H1DA 2R0GA 1K0AA 5ECSA 1W89A 3VWUA 2MZCA 4F9ZA 5HR3A 2C0FA 3EU3A 3LW9A 2YWIA 3RHCA 2L6DA 5HQPA 3IAS2 1NHYA 1ZL9A 3U5RE 2C3NA 3QD9A 5ECPB 4ULXA 1FB6A 3O76A 4RI6A 3PR8A 2OBKA 3M9JA 4F82A 1CQHA 2R0CA 4PX1A 2EIRA 1YF1A 4G0IA 5KN1A 2RM6A 2R4VA 2IMIA 2C1YA 3GX0A 1YEPA 4MJCA 1GSUA 5ECIB 3FZAA 1MDIA 4OO5A 1U3AA 2H8LA 3G9BA 1YKAA 3HKRA 4IHUA 2YZHA 2IIYA 4KA0A 1G7EA 4K6XA 2FWEA 2G2QA 4MNNA 1IYIA 2HSYA 5D73A 1XWBA 4XIHA 3IXRA 4CW9A 2CZ3A 1QFNA 5DALA 4K1FA 3H1NA 4ZBBA 2DIYA 1JZOA 1A0RP 2A2PA 5DVBA 4FQUA 3A2XA 1E6BA 2EC4A 8GSSA 3GURA 4ECCA 5KN2A 3ZFBA 1O81A 2R6KA 1PL2A 1K3OA 1WRYA 5D96A 3L4NA 1HNCA 5KN0A 3EE2A 1ZYEA 1AIUA 2OE3A 3FHKA 3TKQA 2FHEA 2GZZA 3L0HA 5KOXA 2VCVA 2O7KA 1F6MC 5ELAA 4KCAA 2I9HA 5J4UA 1FB0A 2C3QA 2H0HA 1XW9A 4P3YB 2AAWA 4LL4B 4JBBA 5AIVA 4O5UA 1NW2A 4NMUA 3F63A 2MBTA 2K6VA 3GN3A 1PRXA 4TXOB 3H8QA 1RQMA 1GTBA 2HRFA 2CAQA 4TXOA 1HNBA 2B7JA 3KJYA 1K0OA 1SU9A 1F3AA 4F0CA 2YANA 1YF0A 2WZ9A 2LV3A 1MDJA 3DEXA 2I81A 1T8EB 5HR2A 1LBKA 1AXDA 1XWAA 2YWNA 1TJDA 3WGXA 1MEKA 2GQKA 2B5EA 4BIKA 2RUEA 3EPTA 5FHIA 2YV9A 1K0MA 1U6TA 1X5EA 1JZDA 5B6MA 4KSOA 1SKSB 1XG8A 1XXUA 3HVSA 2GLRA 2I3YA 1A2MA 2LQOA 3ZVJA 2WJUA 4N0VA 4NXIA 1ABAA 1YZXA 3APQA 4IS0A 5H5RA 4KW6A 2FLSA 5G5EA 4X4JA 5G1KA 4GSNA 3A5IA 3Q74A 3SBCA 2PN8A 1Z6MA 3H79A 3HCZA 4WR5A 3CRUA 4HDEA 4J56E 3ISOA 3DRNA 3DIEA 3MSZA 4Z2TA 4YKFA 4GCIA 1EOGA 4Q5NA 2VCTA 2C0DA 4TR4A 3V1WA 3RDWA 2H66A 3HJMA 1M99A 1RK4A 5G1LA 2ALBA 1R4WA 1HNAA 1DSBA 2IWTA 1TP9A 1H75A 4HOJA 3EVIA 4MA9A 1TTZA 3LXTA 5HR0A 2FA8A 2H6YA 3CRTA 2XC2A 2HZFA 1QGVA 4IJIA 2XPEA 4BWQA 3IV4A 1OKTA 22GSA 4O92A 5EVOA 3EU4A 3GV1A 4ACSA 2MYGA 1B4PA 2E2GA 3UBKA 5ECLB 2PGTA 4EKZA 5IM9A 4MJEA 3HXSA 3VK9A 4X1UA 4DSSB 3D4TA 4XRDA 3ZFLA 4DVCA 1GSDA 2VM1A 5A5KA 2P5QA 5F07A 4DSSA 1KNGA 1QUWA 3GRXA 2WS2A 1TDIA 5D9TA 4TKYA 1HD2A 1QK8A 1S3RA 3NOFA 4YKGA 3ERWA 1XOAA 3UOMA 1F2EA 1B9XC 2DBCA 4HZ2A 3C73A 3D0ZA 3IR4A 4KAEA 5E59A 5ENUA 3W8JA 5ELGA 4XS6A 2YWOA 2YP6A 2DJ0A 4JRRA 3HZ8A 5EPFA 1V57A 1LJRA 5ID2B 1TU7A 2EIQA 2YNXA 5CYYA 5JCGA 1YKCA 3UAPA 5ID2A 3I43A 1I9DA 1Z5YE 1YJ6A 1GULA 2N5BA 4F03A 1JZWA 2IMFA 3A5WA 4YAPA 3F9UA 5JWOB 4X0XA 4AGSA 4MPFA 2H74A 4MMMA 4GXZA 1V98A 2O85A 4OD7A 3GTUB 3C1SA 4FYCA 2YJ7A 5IO2A 3HJOA 3DVWA 1Y6EA 4BA7A 1J0FA 4FIWA 4KH7A 2BMXA 4MLYA 3KZQA 2JU5A 3MDKA 2CVDA 5A4WA 4TOPA 5LD0A 4IKHA 5DCGA 4MPGA 1KEBA 1V58A 1ST9A 4KDYA 1JFUA 1ZCPA 5AISA 4YQMA 1QQ2A 5GZZB 2VCXA 2VL2A 2R3XA 1SYXA 3G7IA 1GUMA 5C04A 1T3BA 1UA5A 4HZ4A 2GDRA 2RUFA 4K2DA 1T7PB 3TJKA 5COHA 2AUVA 3F6DA 4RQRA 3DGQA 5J5NA 4Z2UA 3ZLPA 4KF9A 1M2AA 2MMNA 4WF5A 5INYA 1JLWA 4MZBA 2DC5A 1KTEA 1TI1A 1XW5A 4K5SA 5A4VA 2N5AA 5FT3A 2DMLA 4V2MA 3GNJA 5DQYA 1UN2A 2DLXA 2ZUPA 4EUYA 5F06A 1XOBA 3DMLA 1AQVA 4TW5A 2PUKC 2PU9C 3P90A 1ZYQB 2YWMA 3CSIA 6GSUA 2LJAA 5ECNB 2WFCA 5IQYA 3TRQA 1O8WA 2E0QA 2LNTA 3IBHA 4OMVA 2H0GA 1URMA 3VI5A 3F0IA 5KEJA 3L9VA 4IBPA 1EGOA 3K8NA 3IOSA 1XWKA 4F0BA 2YJHA 4HUAA 5D9WA 2C3TA 3ERGA 5IPGA 1T1VA 3TKSA 2H01A 4I5QA 1C72A 4ISDA 1WMJA 1EWXA 2CT6A 3BBYA 1O85A 1WE0A 4I8BA 3KIJA 1GUHA 4HU9A 1DE1A 4IN0A 5IMFA 1PN9A 3LEFA 1SK1A 5IMVA 4ZXGA 3GA4A 1A2LA 4TXVA 1OE8A 10GSA 2HLSA 2CV4A 5BMUA 4N0ZA 3L9SA 4I2TA 2LJRA 5JCUA 1YY7A 2VL2C 2GZYA 1FHEA 3KTBA 3ZZXA 4D73B 2M46A 3FYGA 4TR1B 2J9HA 2PVQA 2PMTA 3GH9A 3MNGA 2FA4A 2QC7A 3QOUA 4TR1A 2JADA 3QCPA 3VURA 1A8YA 5IMDA 3LYPA 3KMOA 2F8FA 1SJZA 1SKRB 3TJGA 3RPNA 2LSTA 4YQVA 3QPMA 3WGDA 2XPDA 3F4RA 3ZRDA 2VCWA 4IELA 2JZSA 3KP9A 1ZOFA 4HSCX 3ZVJD 4NWYA 2NTOA 3O3TA 4MJBA 2HYXA 2FWHA 1XPVA 5ABRA 3OR5A 1TK5B 3LJRA 1GNEA 1N8JA 3M3MA 2LKUA 2X8HA 2UZ8A 4KE3A 3FZ5A 3BCIA 7GSSA 2KUCA 2GQLA 4KX4A 4XS4B 3S9FA 2R2JA 2OA7A 1M2BA 4IVFA 6GSSA 1JHBA 2HE3A 4XS4A 1QMVA 4QL9A 1EV4A 3ZL5A 4WKWA 1XCCA 5IPHA 2YOIA 3LXZA 1GNWA 3TKSC 3C1RA 2P5RA 1GP1A 2ZNMA 3GUSA 2FWFA 2WGRA 3NZNA 2K8VA 1A2JA 2LNSA 3I6AA 2KOKA 2CVBA 4MF5A 4JU5A 2HRKA 3VPTA 1Z3EA 1Z9HA 4G0KA 3M8NA 3EMPA 1THOA 2L5LA 1XBSA 2X8CA 2MBSA 3QDNA 5IMZA 4Z7XA 4PUFC 1X9SB 5FWGA 2FCHA 2IFQB 3TJBA 1WP0A 2RIIA 3F3RA 5LNKe 3Q6OA 2OE0A 1QXHA 2R37A 3TRPA 1U3IA 3RHBA 2ES7A 1PN0A 4USSA 5HFGA 3VWWA 1ERTA 1BX9A 4EXJA 6GSTA 4WXTA 2O8VB 2DJ1A 4O32A 4AJ6A 1RW1A 2YPMA 2WDUA 2A4HA 3DYRA 1S3AA 2LRTA 3GKNA 1GSEA 2PERA 4JEDA 2JZRA 2ZCTA 5IMAA 5HR1A 3Q19A 1M9BA 3CSJA 3HVNA 3H93A 1B4QA 1TRUA 1ERUA 4L0WA 4MH2A 1K0BA 4EIQA 1Z6NA 3FR6A 3KD0A 2OKAA 4O5QA 4TR0A 2DKIA 2D2ZA 5D9VA 1V2AA 2L6CA 3CTGA 3O6TA 2H1BA 5DQSA 5L71A 4G10A 3TKSE 1FOHA 3ZREA 4EDZA 2L4CA 1ON4A 5AIXA 2CZ2A 12GSA 2GT5A 4BPYA 4POKA 4QQ7A 1GWCA 3TUEA 1UC7A 4LA1A 5EL8A 1SKWB 4Z2RA 1AQXA 4OO4A 3HA9A 5KN3A 3IPZA 3ZITA 4IGJA 4WBRD 4L5OA 4ZILA 4ZBDA 4ECJA 3GL3A 5KOWA 4CY8A 3H4KA 2C8UA 4GSTA 5JCWA 3TGZA 1NHOA 3F4SA 4KGIA 1WOUA 1PSQA 1AUCA 2IMDA 4BVYB 4K0NA 5G2ZA 4H86A 4BVYA 3GH6A 3IC8A 3GYKA 1O73A 3TJJA 4IP6A 3UVHA 1FAAA 6GSWA 3UL3A 4RI7A 1MD3A 3UMAA 2FGXA 1A24A 2B1KA 3VLNA 3UIWA 4K7NA 3VI7A 3BJ5A 2QA1A 2ON7A 1OC8A 1FO5A 1SJ6A 4DSQA 4PUAA 3W8SA 1A8LA 3L9UA 5G31A 1M7TA 4GQFA 2L5OA 4RUVA 2VUPA 1M2DA 4HQSA 5CRGA 3SWLA 1PX6A 5ECKB 3IAM2 4MH3A 4MZWA 1EP8A 1TRSA 1PMTA 4PNFA 4IJ3A 2IMKA 2DJJA 3G7YA 4CHSA 4MF7A 1SL0B 5BRTA 1ZMAA 2DSAA 3LYKA 4K8MA 4Q5FA 3VWXA 4MP4A 2TRCP 4MZCA 2OBIA 4PXOA 3KCMA 3MAKA 2X4AA 3EINA 3HD5A 5ECMB 4FYBA 5ECRB 4K7OA 5B6NA 4TR3A 1XZOA 4K9ZA 1B8XA 2HRAA 5D8IA 4RQXA 14GSA 3VWVA 3PINA 1TXXA 1O6JA 2IJYA 2LRCA 4WEYA 4I97A 3HYPA 4HU7A 3ZTLA 3LFLA 1ZYNA 4JR4A 1V40A 4AJ7A 4OCEA 4PQ1A 2XBQA 5E4WA 3GSTA 1BYEA 1XFLA 4ML6A 3KGKA 6GSYA 1VGLA 1GTUA 2G0FA 1R5AA 2H75A 2XBIA 4PQIA 1BEDA 3R3EA 1AQWA 3UVTA 1A23A 1E2YA 1T4YA 2OJLA 3E9JB 13GSA 1MTCA 3GTUA 3TKPA 1TI3A 5IOXA 5J41A 4QL7A 1CQGA 5D93A 3QFBC 3D22A 3IK9A 4K5RA 4JE1A 2B3SA 2GS3A 3BD2A 1TW9A 3HDCA 1DE2A 3CMIA 3D4MA 3WD6A 1S3CA 1Q98A 2IN3A 1Y25A 1X0RA 1B48A 4KDXA 2JL4A 2DJKA 2LEGA 2IPAA 1TK0B 2K8SA 3BCKA 2VL9A 3A3TA 5JWQB 2GQMA 1H4OA 4HQZA 2IMEA 4ICYA 4PQHA 3C8EA 2H71A 2GTUA 3ZIVA 4ECBA 3DVXA 4OFMA 4GF0A 2O87A 2OACA 3FW2A 4HI7A 1SD8A 2OADA 2VAFA 4XCSA 4G2EA 3TB2A 5GSSA 4ZBAA 2EIOA 5JWRB 2VLUA 2VCZA 4HS1A 2YCDA 4J57E 2GSSA 1SENA 3IK7A 1ERVA 2I4AA 3JCML 2CAIA 1XVQA 1WWJA 4CY6A 3ZIJA 3NIVA 1THXA 1SJIA 1R7HA 4L8EA 3WT2A 1PA3A 2YZUA 1A0FA 2AB6A 1O7UA 3G7JA 4ECIA 1SL1B 1EZKA 1Z7PA 19GSA 1EGRA 2A2SA 2M80A 2VM2A 1X5CA 4F2IA 1W4VA 2CX4A 5F05A 4XS1A 1GRXA 1NM3A 3LG6A 4N30A 1ML6A 2PWJA 1F3BA 3D21A 2QA2A 1YEXA 4ZB6A 4X43A 4MJAA 1HQOA 4MK3A 4IQ1A 2DJ2A 5HFIA 4K7IA 4IW9A 3LWAA 1Q4JA 3FK8A 1OC9B 2LUSA 4D73A 2PPTA 2WCIA 4GSSA 3VFIA 2P31A 3ZMLA 1OAZA 1OC9A 5IIZA 1LU4A 5G5FA 3I69A 4ZB8A 2HZEB 3ED3A 1B9YC 2V6KA 1WJKA 3P7XA 5J9CA 3DD3A 5EY6A 2F3MA 2HNLA 3E3EA 4POMA 4BVXB 4K2XA 2FY6A 2JSZA 4FH8A 1DUGA 4BVXA 5HFKA 1I5GA 4AF2A 5ECHB 1OE7A 4LL1B 3F6FA 1GSFA 1K3YA 2H6ZA 3EMXA 1G6YA 5CRWA 3Q18A 4EC0A 2V2GA 4EE0A 3MYDA 3M1GA 3I9V2 4ZB9A 3WT1A 5G30A 5CRDA 1X5DA 2I1UA 1K0NA 4Q5RA 2HSMA 2H76A 3UARA 4LMWA 1ZGNA 3FR9A 3KTLA 3GL5A 3HY2A 2DIZA 1AAZA 1OKDA 2CA8A 1ZYPA 3P2AA 5DALB 5F0GA 2A4VA 4PGTA 2RM5A 4IQAA 2H1AA 3W6GA 2V32A 3A2VA 2AYTA 1TRWA 17GSA 3GMFA 5ECOB 2GSQA 4V2NA 2GSRA 4KCEA 4WBJA 2IFQA 1GSYA 1YQ1A 2HSHA 2LQQA 1SK0A 3ZYWA 3FKFA 2NDOA 1F9MA 2VD1A 1AW9A 1PL1A 2BJXA 4GWRA 4ML1A 2E2MA 4EDYA 2JACA 2KHPA 4IP1A 3N5OA 1GSSA 2GT6A 2OE1A 3FRCA 5GSTA 2HT9A 3KH9A 2B5XA 1J08A 1T4ZA 3IDVA 2QSIA 2VIMA 2XHFA 4JR6A 2TIRA 4ZL9A 2QGVA 1TKDB 2TRXA 5DJMA 2PVOC 1X9WB 2CVKA 1EEMA 4LMVA 4YQUA 4XRAA 4G9HA 1JZRA 2BTOT 2H70A 2V6OA 3F4TA 2DMMA 2FUG2 4MDCA 2DJ3A 3PH9A 4XTSA 1GL8A 4V1Ap 5B7CA 2X49A 1PD21 4PNGA 4KSMA 2VLVA 3TRXA 16GSA 1GUKA 2C0EA 3PPUA 3CQFA 3D6IA 3GKKA 2B6MA 2HRNA 3U6VA 4KDUA 3F8UA 1FW1A 2M72A 2C0GA 1N2AA 3ME8A 5DAKB 3CTFA 3VPQA 5DAKA 1S3DA 2X99A 3UJ1A 2DKHA 3KXOA 3GFKA 5IO0A 1AC1A 2WB9A 1KBNA 3D5JA 3AY8A 2HI7A 3IHGA 3LGCA 1PX7A 2N5FA 4MABA 4CDOA 4NV5A 1SD9A 2X8GA 3P8WA 3GKMA 1R5PA 3EC3A 1G0TA 4NAXA 1GTIA 3GX8A 1XWGA 3FY7A 3QMXA 4NPBA 2LJKA 2JZTA 1GTAA 3IRAA 2L4QA 2KLXA 6GSXA 2VD0A 3KMNA 4I6XA 4HJMA 1NSWA 3ZMKA 1WPIA 1SL2B 4OCFA 3LQ7A 2WRTA 2LS5A 3HVVA
chains in the Genus database with same CATH topology
2VCQA 5F8BA 1IYHA 1ERWA 3PGTA 2HFDA 5B8BA 3GIXA 1T00A 4I2UA 4GLTA 5J9BA 1GH2A 1XW6A 3HJPA 4TN8A 1U87A 3UEMA 1PKWA 1TRVA 1VRSD 2WULA 4BL7B 4N11A 2R0PA 2H73A 3TOTA 5IOWA 1EEJA 1FVJA 3R2QA 4BL7A 1FG4A 4GRFA 2J23A 1YDKA 1M0UA 1FOVA 4G0LA 1Z7RA 1ZZYA 4L5LA 2B5YA 2B1LA 2VO4A 2P0GA 5B8AA 1EOHA 2NPBA 5C00A 1PGTA 4V1Ag 3FZ9A 2K18A 2VOCA 3US3A 2V41A 4FO5A 4HEA2 4OFNA 2Z9SA 5CREA 2MMZA 1BAYA 1PQNA 1ILOA 4BWSA 3LORA 1K0CA 2H0IA 1FVKA 5A4UA 1OC3A 2X64A 4O7HA 3N9JA 2KP1A 3FMWA 1SYRA 4MF6A 4MCUA 3TOUA 3RPPA 1GSQA 1F37A 1VF2A 3TCOA 3KP8A 2CQ9A 4AJ8A 3GSSA 1OVNA 3F3QA 2F9SA 1HYUA 3CSHA 1BG5A 3HZ4A 1XIYA 3ME7A 3M9KA 5DBQA 4E8HA 3FZ4A 4FYUA 4N10A 3GKXA 3HHVA 1DBYA 3FEUA 5CNWA 5D9XA 2LTKA 5J3RA 1K0DA 2KP2A 1MDKA 4TRXA 3FR3A 1OYJA 2GVPA 3EWLA 4TVEA 2FNOA 3IC4A 4NV2A 5H5SA 5IMCA 1G7OA 2MMAA 4EO3A 3DXBA 4NHZA 1JLVA 4WETA 4POBA 3TKRA 2REMA 5DDLA 4EIPA 2A2RA 3EYTA 3E0UA 3QFAC 4PURA 3QR6A 3APSA 3J7Yb 20GSA 1TOFA 2C4JA 4ID0A 3TJFA 3QAWA 2QKEA 3TDGA 2GGTA 2H1GA 2V1MA 2K9FA 1XWCA 1O8XA 5CRHA 3UBLA 2F8AA 1XVWA 3LSZA 3DWVA 3QAVA 1WIKA 4EVMA 2H6XA 4ZL8A 4Q5QA 3A2WA 4OFTA 3IHQA 1ACVA 1BQ7A 5CAXA 3RAZA 2PBJA 5GAND 11GSA 3WGEA 3APOA 3DKSA 4A5PA 1G6WA 3L78A 1TK8B 2GSTA 18GSA 4O5RA 1EP7A 4EF0A 2HXKA 4KUNA 1VF3A 3EURA 4E8EA 1X9MB 9GSSA 2LRNA 3IE3A 3ERFA 2VLTA 3MIXA 3C7MA 2FD3A 4GTUA 3RBTA 1PKZA 3J7Yk 1J9BA 4YH2A 3MWHA 5CO3A 3BOAA 2CX3A 5H5QA 4V2LA 2JSYA 4LLRA 3CYNA 3QAGA 4J2FA 3IA1A 3WYWA 3KEBA 5LCZA 5AN1A 4ZIJA 1GLQA 2L57A 1V9WA 4EL1A 3GHAA 2YN1A 2AV4A 2YV7A 4OWYA 1GLPA 3M0FA 4ILFA 1K3LA 1BJXA 2B7KA 5ECQB 2H30A 1MD4A 1VF4A 4XHMA 1UVZA 2NVLA 4ZL7A 4G19A 2GZPA 2L59A 1VF1A 3CBUA 1TU8A 1R26A 1U88A 4KB3A 6GSVA 3KM6A 4JZQA 1USBA 2RLIA 2MMOA 4GQCA 3C71A 2NBSA 5GAPD 4K0GA 4DSRA 5DCHA 2O89A 2ON5A 4NHWA 1SK2A 2F51A 2R5GA 5AGYA 4L0UA 2H72A 3HVXA 4WR4A 2E7PA 2AHEA 5CP1A 2AJQB 4POLA 2C80A 2VL3A 3CXGA 4KNDA 5DJLA 4PTSA 4DEJA 4HJ2A 2FWGA 2H19A 4YAVA 2IL3A 3KH7A 1M9AA 4WF4A 1EV9A 2HZEA 2H1DA 2R0GA 1K0AA 5ECSA 1W89A 3VWUA 2MZCA 4F9ZA 5HR3A 2C0FA 3EU3A 3LW9A 2YWIA 3RHCA 2L6DA 5HQPA 3IAS2 1NHYA 1ZL9A 3U5RE 2C3NA 3QD9A 5ECPB 4ULXA 1FB6A 3O76A 4RI6A 3PR8A 2OBKA 3M9JA 4F82A 1CQHA 2R0CA 4PX1A 2EIRA 1YF1A 4G0IA 5KN1A 2RM6A 2R4VA 2IMIA 2C1YA 3GX0A 1YEPA 4MJCA 1GSUA 5ECIB 3FZAA 1MDIA 4OO5A 1U3AA 2H8LA 3G9BA 1YKAA 3HKRA 4IHUA 2YZHA 2IIYA 4KA0A 1G7EA 4K6XA 2FWEA 2G2QA 4MNNA 1IYIA 2HSYA 5D73A 1XWBA 4XIHA 3IXRA 4CW9A 2CZ3A 1QFNA 5DALA 4K1FA 3H1NA 4ZBBA 2DIYA 1JZOA 1A0RP 2A2PA 5DVBA 4FQUA 3A2XA 1E6BA 2EC4A 8GSSA 3GURA 4ECCA 5KN2A 3ZFBA 1O81A 2R6KA 1PL2A 1K3OA 1WRYA 5D96A 3L4NA 1HNCA 5KN0A 3EE2A 1ZYEA 1AIUA 2OE3A 3FHKA 3TKQA 2FHEA 2GZZA 3L0HA 5KOXA 2VCVA 2O7KA 1F6MC 5ELAA 4KCAA 2I9HA 5J4UA 1FB0A 2C3QA 2H0HA 1XW9A 4P3YB 2AAWA 4LL4B 4JBBA 5AIVA 4O5UA 1NW2A 4NMUA 3F63A 2MBTA 2K6VA 3GN3A 1PRXA 4TXOB 3H8QA 1RQMA 1GTBA 2HRFA 2CAQA 4TXOA 1HNBA 2B7JA 3KJYA 1K0OA 1SU9A 1F3AA 4F0CA 2YANA 1YF0A 2WZ9A 2LV3A 1MDJA 3DEXA 2I81A 1T8EB 5HR2A 1LBKA 1AXDA 1XWAA 2YWNA 1TJDA 3WGXA 1MEKA 2GQKA 2B5EA 2RUEA 3EPTA 5FHIA 2YV9A 1K0MA 1U6TA 1X5EA 1JZDA 5B6MA 4KSOA 1SKSB 1XXUA 3HVSA 2GLRA 2I3YA 1A2MA 2LQOA 3ZVJA 2WJUA 4N0VA 4NXIA 1ABAA 1YZXA 3APQA 4IS0A 5H5RA 4KW6A 2FLSA 5G5EA 4X4JA 5G1KA 4GSNA 3A5IA 3Q74A 3SBCA 2PN8A 1Z6MA 3H79A 3HCZA 4WR5A 3CRUA 4HDEA 4J56E 3ISOA 3DRNA 3DIEA 3MSZA 4Z2TA 4YKFA 4GCIA 1EOGA 4Q5NA 2VCTA 2C0DA 4TR4A 3V1WA 3RDWA 2H66A 3HJMA 1M99A 1RK4A 5G1LA 2ALBA 1R4WA 1HNAA 1DSBA 2IWTA 1TP9A 1H75A 4HOJA 3EVIA 4MA9A 1TTZA 3LXTA 5HR0A 2FA8A 2H6YA 3CRTA 2XC2A 2HZFA 1QGVA 4IJIA 2XPEA 4BWQA 3IV4A 1OKTA 22GSA 4O92A 5EVOA 3EU4A 3GV1A 4ACSA 2MYGA 1B4PA 2E2GA 3UBKA 5ECLB 2PGTA 4EKZA 5IM9A 4MJEA 3HXSA 3VK9A 4X1UA 4DSSB 3D4TA 4XRDA 3ZFLA 4DVCA 1GSDA 2VM1A 5A5KA 2P5QA 5F07A 4DSSA 1KNGA 1QUWA 3GRXA 2WS2A 1TDIA 5D9TA 4TKYA 1HD2A 1QK8A 3NOFA 4YKGA 3ERWA 1XOAA 3UOMA 1F2EA 1B9XC 2DBCA 4HZ2A 3C73A 3D0ZA 3IR4A 4KAEA 5E59A 5ENUA 3W8JA 5ELGA 4XS6A 2YWOA 2YP6A 2DJ0A 4JRRA 3HZ8A 5EPFA 1V57A 1LJRA 5ID2B 1TU7A 2EIQA 2YNXA 5CYYA 5JCGA 1YKCA 3UAPA 5ID2A 3I43A 1I9DA 1Z5YE 1YJ6A 1GULA 2N5BA 4F03A 1JZWA 2IMFA 3A5WA 4YAPA 3F9UA 5JWOB 4X0XA 4AGSA 4MPFA 2H74A 4MMMA 4GXZA 1V98A 2O85A 4OD7A 3GTUB 3C1SA 4FYCA 2YJ7A 5IO2A 3HJOA 3DVWA 1Y6EA 4BA7A 1J0FA 4FIWA 4KH7A 2BMXA 4MLYA 3KZQA 2JU5A 3MDKA 2CVDA 5A4WA 4TOPA 5LD0A 4IKHA 5DCGA 4MPGA 1KEBA 1V58A 1ST9A 4KDYA 1JFUA 1ZCPA 5AISA 4YQMA 1QQ2A 5GZZB 2VCXA 2VL2A 2R3XA 1SYXA 3G7IA 1GUMA 5C04A 1T3BA 1UA5A 4HZ4A 2GDRA 2RUFA 4K2DA 1T7PB 3TJKA 5COHA 2AUVA 3F6DA 4RQRA 3DGQA 5J5NA 4Z2UA 3ZLPA 4KF9A 1M2AA 2MMNA 4WF5A 5INYA 1JLWA 4MZBA 2DC5A 1KTEA 1TI1A 1XW5A 4K5SA 5A4VA 2N5AA 5FT3A 2DMLA 4V2MA 3GNJA 5DQYA 1UN2A 2DLXA 2ZUPA 4EUYA 5F06A 1XOBA 3DMLA 1AQVA 4TW5A 2PUKC 2PU9C 3P90A 1ZYQB 2YWMA 3CSIA 6GSUA 2LJAA 5ECNB 2WFCA 5IQYA 3TRQA 1O8WA 2E0QA 2LNTA 3IBHA 4OMVA 2H0GA 1URMA 3VI5A 3F0IA 5KEJA 3L9VA 4IBPA 1EGOA 3K8NA 3IOSA 1XWKA 4F0BA 2YJHA 4HUAA 5D9WA 2C3TA 3ERGA 5IPGA 1T1VA 3TKSA 2H01A 4I5QA 1C72A 4ISDA 1WMJA 1EWXA 2CT6A 3BBYA 1O85A 1WE0A 4I8BA 3KIJA 1GUHA 4HU9A 1DE1A 4IN0A 5IMFA 1PN9A 3LEFA 1SK1A 5IMVA 4ZXGA 3GA4A 1A2LA 4TXVA 1OE8A 10GSA 2HLSA 2CV4A 5BMUA 4N0ZA 3L9SA 4I2TA 2LJRA 5JCUA 1YY7A 2VL2C 2GZYA 1FHEA 3KTBA 3ZZXA 4D73B 2M46A 3FYGA 4TR1B 2J9HA 2PVQA 2PMTA 3GH9A 3MNGA 2FA4A 2QC7A 3QOUA 4TR1A 2JADA 3QCPA 3VURA 1A8YA 5IMDA 3LYPA 3KMOA 2F8FA 1SJZA 1SKRB 3TJGA 3RPNA 2LSTA 4YQVA 3QPMA 3WGDA 2XPDA 3F4RA 3ZRDA 2VCWA 4IELA 2JZSA 3KP9A 1ZOFA 3ZVJD 4NWYA 2NTOA 3O3TA 4MJBA 2HYXA 2FWHA 1XPVA 5ABRA 3OR5A 1TK5B 3LJRA 1GNEA 1N8JA 3M3MA 2LKUA 2X8HA 2UZ8A 4KE3A 3FZ5A 3BCIA 7GSSA 2KUCA 2GQLA 4KX4A 4XS4B 3S9FA 2R2JA 2OA7A 1M2BA 4IVFA 6GSSA 1JHBA 2HE3A 4XS4A 1QMVA 4QL9A 1EV4A 3ZL5A 4WKWA 1XCCA 5IPHA 2YOIA 3LXZA 1GNWA 3TKSC 3C1RA 2P5RA 1GP1A 2ZNMA 3GUSA 2FWFA 2WGRA 3NZNA 2K8VA 1A2JA 2LNSA 3I6AA 2KOKA 2CVBA 4MF5A 4JU5A 2HRKA 3VPTA 1Z3EA 1Z9HA 4G0KA 3M8NA 3EMPA 1THOA 2L5LA 1XBSA 2X8CA 2MBSA 3QDNA 5IMZA 4Z7XA 4PUFC 1X9SB 5FWGA 2FCHA 2IFQB 3TJBA 1WP0A 2RIIA 3F3RA 5LNKe 3Q6OA 2OE0A 1QXHA 2R37A 3TRPA 1U3IA 3RHBA 2ES7A 1PN0A 4USSA 5HFGA 3VWWA 1ERTA 1BX9A 4EXJA 6GSTA 4WXTA 2O8VB 2DJ1A 4O32A 4AJ6A 1RW1A 2YPMA 2WDUA 2A4HA 3DYRA 1S3AA 2LRTA 3GKNA 1GSEA 2PERA 4JEDA 2JZRA 2ZCTA 5IMAA 5HR1A 3Q19A 1M9BA 3CSJA 3H93A 1B4QA 1TRUA 1ERUA 4L0WA 4MH2A 1K0BA 4EIQA 1Z6NA 3FR6A 3KD0A 2OKAA 4O5QA 4TR0A 2DKIA 2D2ZA 5D9VA 1V2AA 2L6CA 3CTGA 3O6TA 2H1BA 5DQSA 5L71A 4G10A 3TKSE 1FOHA 3ZREA 4EDZA 2L4CA 1ON4A 5AIXA 2CZ2A 12GSA 2GT5A 4BPYA 4POKA 4QQ7A 1GWCA 3TUEA 1UC7A 4LA1A 5EL8A 1SKWB 4Z2RA 1AQXA 4OO4A 3HA9A 5KN3A 3IPZA 3ZITA 4IGJA 4WBRD 4L5OA 4ZILA 4ZBDA 4ECJA 3GL3A 5KOWA 4CY8A 3H4KA 2C8UA 4GSTA 5JCWA 3TGZA 1NHOA 3F4SA 4KGIA 1WOUA 1PSQA 1AUCA 2IMDA 4BVYB 4K0NA 5G2ZA 4H86A 4BVYA 3GH6A 3IC8A 3GYKA 1O73A 3TJJA 4IP6A 3UVHA 1FAAA 6GSWA 3UL3A 4RI7A 1MD3A 3UMAA 2FGXA 1A24A 2B1KA 3VLNA 3UIWA 4K7NA 3VI7A 3BJ5A 2QA1A 2ON7A 1OC8A 1FO5A 1SJ6A 4DSQA 4PUAA 3W8SA 1A8LA 3L9UA 5G31A 1M7TA 4GQFA 2L5OA 4RUVA 2VUPA 1M2DA 4HQSA 5CRGA 3SWLA 1PX6A 5ECKB 3IAM2 4MH3A 4MZWA 1EP8A 1TRSA 1PMTA 4PNFA 4IJ3A 2IMKA 2DJJA 3G7YA 4CHSA 4MF7A 1SL0B 5BRTA 1ZMAA 2DSAA 3LYKA 4K8MA 4Q5FA 3VWXA 4MP4A 2TRCP 4MZCA 2OBIA 4PXOA 3KCMA 3MAKA 2X4AA 3EINA 3HD5A 5ECMB 4FYBA 5ECRB 4K7OA 5B6NA 4TR3A 1XZOA 4K9ZA 1B8XA 2HRAA 5D8IA 4RQXA 14GSA 3VWVA 3PINA 1TXXA 1O6JA 2IJYA 2LRCA 4WEYA 4I97A 3HYPA 4HU7A 3ZTLA 3LFLA 1ZYNA 4JR4A 1V40A 4AJ7A 4OCEA 4PQ1A 2XBQA 5E4WA 3GSTA 1BYEA 1XFLA 4ML6A 3KGKA 6GSYA 1VGLA 1GTUA 2G0FA 1R5AA 2H75A 2XBIA 4PQIA 1BEDA 3R3EA 1AQWA 3UVTA 1A23A 1E2YA 1T4YA 2OJLA 3E9JB 13GSA 1MTCA 3GTUA 3TKPA 1TI3A 5IOXA 5J41A 4QL7A 1CQGA 5D93A 3QFBC 3D22A 3IK9A 4K5RA 4JE1A 2B3SA 2GS3A 3BD2A 1TW9A 3HDCA 1DE2A 3CMIA 3D4MA 3WD6A 1S3CA 1Q98A 2IN3A 1Y25A 1X0RA 1B48A 4KDXA 2JL4A 2DJKA 2LEGA 2IPAA 1TK0B 2K8SA 3BCKA 2VL9A 3A3TA 5JWQB 2GQMA 1H4OA 4HQZA 2IMEA 4ICYA 4PQHA 3C8EA 2H71A 2GTUA 3ZIVA 4ECBA 3DVXA 4OFMA 4GF0A 2O87A 2OACA 3FW2A 4HI7A 1SD8A 2OADA 2VAFA 4XCSA 4G2EA 3TB2A 5GSSA 4ZBAA 2EIOA 5JWRB 2VLUA 2VCZA 4HS1A 2YCDA 4J57E 2GSSA 1SENA 3IK7A 1ERVA 2I4AA 3JCML 2CAIA 1XVQA 1WWJA 4CY6A 3ZIJA 3NIVA 1THXA 1SJIA 1R7HA 4L8EA 3WT2A 1PA3A 2YZUA 1A0FA 2AB6A 1O7UA 3G7JA 4ECIA 1SL1B 1EZKA 1Z7PA 19GSA 1EGRA 2A2SA 2M80A 2VM2A 1X5CA 4F2IA 1W4VA 2CX4A 5F05A 4XS1A 1GRXA 1NM3A 3LG6A 4N30A 1ML6A 2PWJA 1F3BA 3D21A 2QA2A 1YEXA 4ZB6A 4X43A 4MJAA 1HQOA 4MK3A 4IQ1A 2DJ2A 5HFIA 4K7IA 4IW9A 3LWAA 1Q4JA 3FK8A 1OC9B 2LUSA 4D73A 2PPTA 2WCIA 4GSSA 3VFIA 2P31A 3ZMLA 1OAZA 1OC9A 5IIZA 1LU4A 5G5FA 3I69A 4ZB8A 2HZEB 3ED3A 1B9YC 2V6KA 1WJKA 3P7XA 5J9CA 3DD3A 5EY6A 2F3MA 2HNLA 3E3EA 4POMA 4BVXB 4K2XA 2FY6A 2JSZA 4FH8A 1DUGA 4BVXA 5HFKA 1I5GA 4AF2A 5ECHB 1OE7A 4LL1B 3F6FA 1GSFA 1K3YA 2H6ZA 3EMXA 1G6YA 5CRWA 3Q18A 4EC0A 2V2GA 4EE0A 3MYDA 3M1GA 3I9V2 4ZB9A 3WT1A 5G30A 5CRDA 1X5DA 2I1UA 1K0NA 4Q5RA 2HSMA 2H76A 3UARA 4LMWA 1ZGNA 3FR9A 3KTLA 3GL5A 3HY2A 2DIZA 1AAZA 1OKDA 2CA8A 1ZYPA 3P2AA 5DALB 5F0GA 2A4VA 4PGTA 2RM5A 4IQAA 2H1AA 3W6GA 2V32A 3A2VA 2AYTA 1TRWA 17GSA 3GMFA 5ECOB 2GSQA 4V2NA 2GSRA 4KCEA 4WBJA 2IFQA 1GSYA 1YQ1A 2HSHA 2LQQA 1SK0A 3ZYWA 3FKFA 2NDOA 1F9MA 2VD1A 1AW9A 1PL1A 2BJXA 4GWRA 4ML1A 2E2MA 4EDYA 2JACA 2KHPA 4IP1A 3N5OA 1GSSA 2GT6A 2OE1A 3FRCA 5GSTA 2HT9A 3KH9A 2B5XA 1J08A 1T4ZA 3IDVA 2QSIA 2VIMA 2XHFA 4JR6A 2TIRA 4ZL9A 2QGVA 1TKDB 2TRXA 5DJMA 2PVOC 1X9WB 2CVKA 1EEMA 4LMVA 4YQUA 4XRAA 4G9HA 1JZRA 2BTOT 2H70A 2V6OA 3F4TA 2DMMA 2FUG2 4MDCA 2DJ3A 3PH9A 4XTSA 1GL8A 4V1Ap 5B7CA 2X49A 1PD21 4PNGA 4KSMA 2VLVA 3TRXA 16GSA 1GUKA 2C0EA 3PPUA 3D6IA 3GKKA 2B6MA 2HRNA 3U6VA 4KDUA 3F8UA 1FW1A 2M72A 2C0GA 1N2AA 3ME8A 5DAKB 3CTFA 3VPQA 5DAKA 1S3DA 2X99A 3UJ1A 2DKHA 3KXOA 3GFKA 5IO0A 1AC1A 2WB9A 1KBNA 3D5JA 3AY8A 2HI7A 3IHGA 3LGCA 1PX7A 2N5FA 4MABA 4CDOA 4NV5A 1SD9A 2X8GA 3P8WA 3GKMA 1R5PA 3EC3A 1G0TA 4NAXA 1GTIA 3GX8A 1XWGA 3FY7A 3QMXA 4NPBA 2LJKA 2JZTA 1GTAA 3IRAA 2L4QA 2KLXA 6GSXA 2VD0A 3KMNA 4I6XA 4HJMA 1NSWA 3ZMKA 1WPIA 1SL2B 4OCFA 3LQ7A 2WRTA 2LS5A 3HVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCQ A;  5F8B A;  1IYH A;  1ERW A;  3PGT A;  2HFD A;  5B8B A;  3GIX A;  1T00 A;  4I2U A;  4GLT A;  5J9B A;  1GH2 A;  1XW6 A;  3HJP A;  4TN8 A;  1U87 A;  3UEM A;  1PKW A;  1TRV A;  1VRS D;  2WUL A;  4N11 A;  2H73 A;  3TOT A;  5IOW A;  1EEJ A;  1FVJ A;  3R2Q A;  4BL7 A;  1FG4 A;  4GRF A;  2J23 A;  1YDK A;  1M0U A;  1FOV A;  1Z7R A;  1ZZY A;  4L5L A;  2B5Y A;  2B1L A;  2VO4 A;  2P0G A;  5B8A A;  1EOH A;  2NPB A;  5C00 A;  1PGT A;  4V1A g;  3FZ9 A;  2K18 A;  2VOC A;  3US3 A;  2V41 A;  4FO5 A;  4HEA 2;  4OFN A;  2Z9S A;  5CRE A;  2MMZ A;  1BAY A;  1PQN A;  1ILO A;  4BWS A;  3LOR A;  1K0C A;  2H0I A;  1FVK A;  5A4U A;  1OC3 A;  2X64 A;  4O7H A;  3N9J A;  2KP1 A;  1SYR A;  4MF6 A;  4MCU A;  3TOU A;  3RPP A;  1GSQ A;  1F37 A;  1VF2 A;  3TCO A;  3KP8 A;  2CQ9 A;  4AJ8 A;  3GSS A;  1OVN A;  3F3Q A;  2F9S A;  1HYU A;  3CSH A;  1BG5 A;  3HZ4 A;  1XIY A;  3ME7 A;  3M9K A;  5DBQ A;  4E8H A;  3FZ4 A;  4FYU A;  4N10 A;  3GKX A;  3HHV A;  1DBY A;  3FEU A;  5CNW A;  5D9X A;  2LTK A;  5J3R A;  1K0D A;  2KP2 A;  1MDK A;  4TRX A;  3FR3 A;  1OYJ A;  2GVP A;  3EWL A;  4TVE A;  2FNO A;  3IC4 A;  4NV2 A;  5H5S A;  5IMC A;  1G7O A;  2MMA A;  4EO3 A;  3DXB A;  4NHZ A;  1JLV A;  4WET A;  4POB A;  3TKR A;  2REM A;  5DDL A;  2A2R A;  3EYT A;  3E0U A;  3QFA C;  4PUR A;  3QR6 A;  3APS A;  3J7Y b;  20GS A;  1TOF A;  2C4J A;  4ID0 A;  3TJF A;  3QAW A;  2QKE A;  3TDG A;  2GGT A;  2H1G A;  2V1M A;  2K9F A;  1XWC A;  1O8X A;  5CRH A;  3UBL A;  2F8A A;  1XVW A;  3LSZ A;  3DWV A;  3QAV A;  1WIK A;  4EVM A;  2H6X A;  4ZL8 A;  4Q5Q A;  3A2W A;  4OFT A;  3IHQ A;  1ACV A;  1BQ7 A;  5CAX A;  3RAZ A;  2PBJ A;  5GAN D;  11GS A;  3WGE A;  3APO A;  3DKS A;  1G6W A;  3L78 A;  1TK8 B;  2GST A;  18GS A;  4O5R A;  1EP7 A;  4EF0 A;  2HXK A;  4KUN A;  1VF3 A;  3EUR A;  4E8E A;  1X9M B;  9GSS A;  2LRN A;  3IE3 A;  3ERF A;  2VLT A;  3C7M A;  2FD3 A;  4GTU A;  3RBT A;  1PKZ A;  3J7Y k;  1J9B A;  4YH2 A;  3MWH A;  5CO3 A;  3BOA A;  2CX3 A;  5H5Q A;  4V2L A;  2JSY A;  4LLR A;  3CYN A;  3QAG A;  4J2F A;  3IA1 A;  3WYW A;  3KEB A;  5LCZ A;  5AN1 A;  4ZIJ A;  1GLQ A;  2L57 A;  1V9W A;  4EL1 A;  3GHA A;  2YN1 A;  2AV4 A;  2YV7 A;  4OWY A;  1GLP A;  3M0F A;  4ILF A;  1K3L A;  1BJX A;  2B7K A;  5ECQ B;  2H30 A;  1MD4 A;  1VF4 A;  4XHM A;  1UVZ A;  2NVL A;  4ZL7 A;  4G19 A;  2GZP A;  2L59 A;  1VF1 A;  3CBU A;  1TU8 A;  1R26 A;  1U88 A;  4KB3 A;  6GSV A;  3KM6 A;  4JZQ A;  1USB A;  2RLI A;  2MMO A;  4GQC A;  3C71 A;  2NBS A;  5GAP D;  4K0G A;  4DSR A;  5DCH A;  2O89 A;  2ON5 A;  4NHW A;  1SK2 A;  2F51 A;  2R5G A;  5AGY A;  4L0U A;  2H72 A;  3HVX A;  4WR4 A;  2E7P A;  2AHE A;  5CP1 A;  2AJQ B;  4POL A;  2C80 A;  2VL3 A;  3CXG A;  4KND A;  5DJL A;  4DEJ A;  4HJ2 A;  2FWG A;  2H19 A;  4YAV A;  2IL3 A;  3KH7 A;  1M9A A;  4WF4 A;  1EV9 A;  2HZE A;  2H1D A;  1K0A A;  5ECS A;  1W89 A;  3VWU A;  2MZC A;  4F9Z A;  5HR3 A;  2C0F A;  3EU3 A;  2YWI A;  3RHC A;  2L6D A;  5HQP A;  3IAS 2;  1NHY A;  1ZL9 A;  3U5R E;  2C3N A;  3QD9 A;  5ECP B;  4ULX A;  1FB6 A;  3O76 A;  4RI6 A;  3PR8 A;  2OBK A;  3M9J A;  4F82 A;  1CQH A;  4PX1 A;  2EIR A;  1YF1 A;  5KN1 A;  2RM6 A;  2R4V A;  2IMI A;  2C1Y A;  3GX0 A;  1YEP A;  4MJC A;  1GSU A;  5ECI B;  3FZA A;  1MDI A;  4OO5 A;  1U3A A;  2H8L A;  3G9B A;  1YKA A;  3HKR A;  4IHU A;  2YZH A;  2IIY A;  4KA0 A;  1G7E A;  4K6X A;  2FWE A;  2G2Q A;  1IYI A;  2HSY A;  5D73 A;  1XWB A;  4XIH A;  3IXR A;  4CW9 A;  2CZ3 A;  1QFN A;  5DAL A;  4K1F A;  3H1N A;  4ZBB A;  2DIY A;  1JZO A;  1A0R P;  5DVB A;  3A2X A;  1E6B A;  2EC4 A;  8GSS A;  3GUR A;  4ECC A;  5KN2 A;  3ZFB A;  1O81 A;  2R6K A;  1PL2 A;  1K3O A;  1WRY A;  5D96 A;  3L4N A;  1HNC A;  5KN0 A;  3EE2 A;  1ZYE A;  1AIU A;  2OE3 A;  3FHK A;  3TKQ A;  2FHE A;  2GZZ A;  3L0H A;  2VCV A;  2O7K A;  1F6M C;  5ELA A;  4KCA A;  2I9H A;  5J4U A;  1FB0 A;  2C3Q A;  2H0H A;  1XW9 A;  4P3Y B;  2AAW A;  4LL4 B;  4JBB A;  5AIV A;  1NW2 A;  4NMU A;  3F63 A;  2MBT A;  2K6V A;  3GN3 A;  1PRX A;  4TXO B;  3H8Q A;  1RQM A;  1GTB A;  2HRF A;  2CAQ A;  4TXO A;  1HNB A;  2B7J A;  3KJY A;  1K0O A;  1SU9 A;  1F3A A;  4F0C A;  2YAN A;  1YF0 A;  2WZ9 A;  2LV3 A;  1MDJ A;  3DEX A;  2I81 A;  1T8E B;  5HR2 A;  1LBK A;  1AXD A;  1XWA A;  2YWN A;  1TJD A;  3WGX A;  1MEK A;  2GQK A;  2B5E A;  2RUE A;  5FHI A;  2YV9 A;  1K0M A;  1U6T A;  1X5E A;  1JZD A;  5B6M A;  4KSO A;  1SKS B;  1XXU A;  3HVS A;  2GLR A;  2I3Y A;  1A2M A;  2LQO A;  3ZVJ A;  2WJU A;  4N0V A;  4NXI A;  1ABA A;  1YZX A;  3APQ A;  4IS0 A;  5H5R A;  4KW6 A;  2FLS A;  5G5E A;  5G1K A;  4GSN A;  3Q74 A;  3SBC A;  2PN8 A;  1Z6M A;  3H79 A;  3HCZ A;  4WR5 A;  3CRU A;  4HDE A;  4J56 E;  3ISO A;  3DRN A;  3DIE A;  3MSZ A;  4GCI A;  1EOG A;  4Q5N A;  2VCT A;  2C0D A;  4TR4 A;  3V1W A;  3RDW A;  2H66 A;  3HJM A;  1M99 A;  1RK4 A;  5G1L A;  2ALB A;  1R4W A;  1HNA A;  1DSB A;  2IWT A;  1TP9 A;  1H75 A;  4HOJ A;  3EVI A;  4MA9 A;  1TTZ A;  3LXT A;  5HR0 A;  2FA8 A;  2H6Y A;  3CRT A;  2XC2 A;  2HZF A;  1QGV A;  4IJI A;  2XPE A;  4BWQ A;  3IV4 A;  1OKT A;  22GS A;  4O92 A;  5EVO A;  3EU4 A;  3GV1 A;  4ACS A;  2MYG A;  1B4P A;  2E2G A;  3UBK A;  5ECL B;  2PGT A;  4EKZ A;  5IM9 A;  4MJE A;  3HXS A;  3VK9 A;  4X1U A;  4DSS B;  3D4T A;  4XRD A;  3ZFL A;  4DVC A;  1GSD A;  2VM1 A;  5A5K A;  2P5Q A;  5F07 A;  4DSS A;  1KNG A;  1QUW A;  3GRX A;  2WS2 A;  1TDI A;  5D9T A;  4TKY A;  1HD2 A;  1QK8 A;  3NOF A;  3ERW A;  1XOA A;  3UOM A;  1F2E A;  1B9X C;  2DBC A;  4HZ2 A;  3C73 A;  3D0Z A;  3IR4 A;  4KAE A;  5E59 A;  5ENU A;  3W8J A;  5ELG A;  4XS6 A;  2YWO A;  2YP6 A;  2DJ0 A;  4JRR A;  3HZ8 A;  5EPF A;  1V57 A;  1LJR A;  5ID2 B;  1TU7 A;  2EIQ A;  2YNX A;  5CYY A;  5JCG A;  1YKC A;  3UAP A;  5ID2 A;  3I43 A;  1I9D A;  1Z5Y E;  1YJ6 A;  1GUL A;  2N5B A;  4F03 A;  1JZW A;  2IMF A;  3A5W A;  4YAP A;  3F9U A;  5JWO B;  4X0X A;  4AGS A;  4MPF A;  2H74 A;  4MMM A;  4GXZ A;  1V98 A;  2O85 A;  4OD7 A;  3GTU B;  3C1S A;  4FYC A;  2YJ7 A;  5IO2 A;  3HJO A;  3DVW A;  1Y6E A;  4BA7 A;  1J0F A;  4FIW A;  4KH7 A;  2BMX A;  4MLY A;  3KZQ A;  2JU5 A;  3MDK A;  2CVD A;  5A4W A;  4TOP A;  5LD0 A;  4IKH A;  5DCG A;  4MPG A;  1KEB A;  1V58 A;  1ST9 A;  4KDY A;  1JFU A;  1ZCP A;  5AIS A;  4YQM A;  1QQ2 A;  5GZZ B;  2VCX A;  2VL2 A;  2R3X A;  1SYX A;  3G7I A;  1GUM A;  5C04 A;  1T3B A;  1UA5 A;  4HZ4 A;  2GDR A;  2RUF A;  4K2D A;  1T7P B;  3TJK A;  5COH A;  2AUV A;  3F6D A;  4RQR A;  3DGQ A;  5J5N A;  3ZLP A;  1M2A A;  2MMN A;  4WF5 A;  5INY A;  1JLW A;  4MZB A;  2DC5 A;  1KTE A;  1TI1 A;  1XW5 A;  5A4V A;  2N5A A;  5FT3 A;  2DML A;  4V2M A;  3GNJ A;  5DQY A;  1UN2 A;  2DLX A;  2ZUP A;  4EUY A;  5F06 A;  1XOB A;  3DML A;  1AQV A;  4TW5 A;  2PUK C;  2PU9 C;  3P90 A;  1ZYQ B;  2YWM A;  3CSI A;  6GSU A;  2LJA A;  5ECN B;  2WFC A;  5IQY A;  3TRQ A;  1O8W A;  2E0Q A;  2LNT A;  3IBH A;  4OMV A;  2H0G A;  1URM A;  3VI5 A;  3F0I A;  5KEJ A;  3L9V A;  4IBP A;  1EGO A;  3K8N A;  3IOS A;  1XWK A;  4F0B A;  2YJH A;  4HUA A;  5D9W A;  2C3T A;  3ERG A;  5IPG A;  1T1V A;  3TKS A;  2H01 A;  4I5Q A;  1C72 A;  4ISD A;  1WMJ A;  1EWX A;  2CT6 A;  3BBY A;  1O85 A;  1WE0 A;  4I8B A;  3KIJ A;  1GUH A;  4HU9 A;  1DE1 A;  4IN0 A;  5IMF A;  1PN9 A;  3LEF A;  1SK1 A;  5IMV A;  4ZXG A;  3GA4 A;  1A2L A;  4TXV A;  1OE8 A;  10GS A;  2HLS A;  2CV4 A;  4N0Z A;  3L9S A;  4I2T A;  2LJR A;  5JCU A;  1YY7 A;  2VL2 C;  2GZY A;  1FHE A;  3KTB A;  3ZZX A;  4D73 B;  2M46 A;  3FYG A;  4TR1 B;  2J9H A;  2PVQ A;  2PMT A;  3GH9 A;  3MNG A;  2FA4 A;  2QC7 A;  3QOU A;  4TR1 A;  2JAD A;  3QCP A;  3VUR A;  1A8Y A;  5IMD A;  3LYP A;  3KMO A;  2F8F A;  1SJZ A;  1SKR B;  3TJG A;  3RPN A;  2LST A;  4YQV A;  3QPM A;  3WGD A;  2XPD A;  3F4R A;  3ZRD A;  2VCW A;  4IEL A;  2JZS A;  3KP9 A;  1ZOF A;  3ZVJ D;  4NWY A;  2NTO A;  3O3T A;  4MJB A;  2HYX A;  2FWH A;  1XPV A;  5ABR A;  3OR5 A;  1TK5 B;  3LJR A;  1GNE A;  1N8J A;  3M3M A;  2LKU A;  2X8H A;  4KE3 A;  3FZ5 A;  3BCI A;  7GSS A;  2KUC A;  2GQL A;  4KX4 A;  4XS4 B;  3S9F A;  2R2J A;  2OA7 A;  1M2B A;  4IVF A;  6GSS A;  1JHB A;  2HE3 A;  4XS4 A;  1QMV A;  4QL9 A;  1EV4 A;  3ZL5 A;  4WKW A;  1XCC A;  5IPH A;  2YOI A;  3LXZ A;  1GNW A;  3TKS C;  3C1R A;  2P5R A;  1GP1 A;  2ZNM A;  3GUS A;  2FWF A;  2WGR A;  3NZN A;  2K8V A;  1A2J A;  2LNS A;  3I6A A;  2KOK A;  2CVB A;  4MF5 A;  4JU5 A;  3VPT A;  1Z3E A;  1Z9H A;  3M8N A;  3EMP A;  1THO A;  2L5L A;  1XBS A;  2X8C A;  2MBS A;  3QDN A;  5IMZ A;  4Z7X A;  4PUF C;  1X9S B;  5FWG A;  2FCH A;  2IFQ B;  3TJB A;  1WP0 A;  2RII A;  3F3R A;  5LNK e;  3Q6O A;  2OE0 A;  1QXH A;  2R37 A;  3TRP A;  1U3I A;  3RHB A;  2ES7 A;  5HFG A;  3VWW A;  1ERT A;  1BX9 A;  4EXJ A;  6GST A;  4WXT A;  2O8V B;  2DJ1 A;  4O32 A;  4AJ6 A;  1RW1 A;  2YPM A;  2WDU A;  3DYR A;  1S3A A;  2LRT A;  3GKN A;  1GSE A;  2PER A;  4JED A;  2JZR A;  2ZCT A;  5IMA A;  5HR1 A;  3Q19 A;  1M9B A;  3CSJ A;  3H93 A;  1B4Q A;  1TRU A;  1ERU A;  4L0W A;  4MH2 A;  1K0B A;  1Z6N A;  3FR6 A;  3KD0 A;  2OKA A;  4TR0 A;  2D2Z A;  5D9V A;  1V2A A;  2L6C A;  3CTG A;  3O6T A;  2H1B A;  5DQS A;  5L71 A;  4G10 A;  3TKS E;  3ZRE A;  4EDZ A;  2L4C A;  1ON4 A;  5AIX A;  2CZ2 A;  12GS A;  2GT5 A;  4BPY A;  4POK A;  4QQ7 A;  1GWC A;  3TUE A;  1UC7 A;  4LA1 A;  5EL8 A;  1SKW B;  1AQX A;  4OO4 A;  3HA9 A;  5KN3 A;  3IPZ A;  3ZIT A;  4IGJ A;  4WBR D;  4L5O A;  4ZIL A;  4ZBD A;  4ECJ A;  3GL3 A;  3H4K A;  2C8U A;  4GST A;  5JCW A;  3TGZ A;  1NHO A;  3F4S A;  4KGI A;  1WOU A;  1PSQ A;  1AUC A;  2IMD A;  4K0N A;  5G2Z A;  4H86 A;  4BVY A;  3GH6 A;  3GYK A;  1O73 A;  3TJJ A;  4IP6 A;  3UVH A;  1FAA A;  6GSW A;  3UL3 A;  4RI7 A;  1MD3 A;  3UMA A;  2FGX A;  1A24 A;  2B1K A;  3VLN A;  3UIW A;  4K7N A;  3VI7 A;  3BJ5 A;  2ON7 A;  1OC8 A;  1FO5 A;  1SJ6 A;  4DSQ A;  4PUA A;  3W8S A;  1A8L A;  3L9U A;  5G31 A;  1M7T A;  4GQF A;  2L5O A;  4RUV A;  2VUP A;  1M2D A;  4HQS A;  5CRG A;  3SWL A;  1PX6 A;  5ECK B;  3IAM 2;  4MH3 A;  4MZW A;  1EP8 A;  1TRS A;  1PMT A;  4PNF A;  4IJ3 A;  2IMK A;  2DJJ A;  3G7Y A;  4CHS A;  4MF7 A;  1SL0 B;  1ZMA A;  2DSA A;  3LYK A;  4K8M A;  4Q5F A;  3VWX A;  4MP4 A;  2TRC P;  4MZC A;  2OBI A;  4PXO A;  3KCM A;  3MAK A;  3EIN A;  3HD5 A;  5ECM B;  4FYB A;  5ECR B;  4K7O A;  5B6N A;  4TR3 A;  1XZO A;  4K9Z A;  1B8X A;  5D8I A;  14GS A;  4RQX A;  3VWV A;  3PIN A;  1TXX A;  1O6J A;  2IJY A;  2LRC A;  4WEY A;  4I97 A;  3HYP A;  4HU7 A;  3ZTL A;  3LFL A;  4JR4 A;  1V40 A;  4AJ7 A;  4OCE A;  4PQ1 A;  2XBQ A;  5E4W A;  3GST A;  1BYE A;  1XFL A;  4ML6 A;  3KGK A;  6GSY A;  1VGL A;  1GTU A;  2G0F A;  1R5A A;  2H75 A;  2XBI A;  4PQI A;  1BED A;  1AQW A;  3UVT A;  1A23 A;  1E2Y A;  1T4Y A;  2OJL A;  3E9J B;  13GS A;  1MTC A;  3GTU A;  3TKP A;  1TI3 A;  5IOX A;  5J41 A;  4QL7 A;  1CQG A;  5D93 A;  3QFB C;  3D22 A;  3IK9 A;  4JE1 A;  2B3S A;  2GS3 A;  3BD2 A;  1TW9 A;  3HDC A;  1DE2 A;  3CMI A;  3D4M A;  3WD6 A;  1S3C A;  1Q98 A;  2IN3 A;  1Y25 A;  1X0R A;  1B48 A;  4KDX A;  2JL4 A;  2DJK A;  2LEG A;  2IPA A;  1TK0 B;  2K8S A;  3BCK A;  2VL9 A;  3A3T A;  5JWQ B;  2GQM A;  1H4O A;  4HQZ A;  2IME A;  4PQH A;  3C8E A;  2H71 A;  2GTU A;  3ZIV A;  4ECB A;  3DVX A;  4OFM A;  4GF0 A;  2O87 A;  2OAC A;  3FW2 A;  4HI7 A;  1SD8 A;  2OAD A;  2VAF A;  4XCS A;  4G2E A;  3TB2 A;  5GSS A;  4ZBA A;  2EIO A;  5JWR B;  2VLU A;  2VCZ A;  4HS1 A;  2YCD A;  4J57 E;  2GSS A;  1SEN A;  3IK7 A;  1ERV A;  2I4A A;  3JCM L;  2CAI A;  1XVQ A;  1WWJ A;  3ZIJ A;  3NIV A;  1THX A;  1SJI A;  1R7H A;  4L8E A;  3WT2 A;  1PA3 A;  2YZU A;  1A0F A;  2AB6 A;  1O7U A;  3G7J A;  4ECI A;  1SL1 B;  1EZK A;  1Z7P A;  19GS A;  1EGR A;  2A2S A;  2M80 A;  2VM2 A;  1X5C A;  4F2I A;  1W4V A;  2CX4 A;  5F05 A;  4XS1 A;  1GRX A;  1NM3 A;  3LG6 A;  4N30 A;  1ML6 A;  2PWJ A;  1F3B A;  3D21 A;  1YEX A;  4ZB6 A;  4X43 A;  4MJA A;  1HQO A;  4MK3 A;  4IQ1 A;  2DJ2 A;  5HFI A;  4K7I A;  4IW9 A;  3LWA A;  1Q4J A;  3FK8 A;  1OC9 B;  2LUS A;  4D73 A;  2PPT A;  2WCI A;  4GSS A;  3VFI A;  2P31 A;  3ZML A;  1OAZ A;  1OC9 A;  5IIZ A;  1LU4 A;  5G5F A;  3I69 A;  4ZB8 A;  2HZE B;  3ED3 A;  1B9Y C;  2V6K A;  1WJK A;  3P7X A;  5J9C A;  3DD3 A;  5EY6 A;  2F3M A;  2HNL A;  3E3E A;  4POM A;  2FY6 A;  2JSZ A;  4FH8 A;  1DUG A;  4BVX A;  5HFK A;  1I5G A;  4AF2 A;  5ECH B;  1OE7 A;  4LL1 B;  3F6F A;  1GSF A;  1K3Y A;  2H6Z A;  3EMX A;  1G6Y A;  5CRW A;  3Q18 A;  4EC0 A;  2V2G A;  4EE0 A;  3M1G A;  3I9V 2;  4ZB9 A;  3WT1 A;  5G30 A;  5CRD A;  1X5D A;  2I1U A;  1K0N A;  4Q5R A;  2H76 A;  3UAR A;  4LMW A;  1ZGN A;  3FR9 A;  3KTL A;  3GL5 A;  3HY2 A;  2DIZ A;  1AAZ A;  1OKD A;  2CA8 A;  3P2A A;  5DAL B;  5F0G A;  2A4V A;  4PGT A;  2RM5 A;  4IQA A;  2H1A A;  3W6G A;  2V32 A;  3A2V A;  2AYT A;  1TRW A;  17GS A;  3GMF A;  5ECO B;  2GSQ A;  4V2N A;  2GSR A;  4KCE A;  4WBJ A;  2IFQ A;  1GSY A;  1YQ1 A;  2HSH A;  2LQQ A;  1SK0 A;  3ZYW A;  3FKF A;  2NDO A;  1F9M A;  2VD1 A;  1AW9 A;  1PL1 A;  2BJX A;  4GWR A;  4ML1 A;  2E2M A;  4EDY A;  2JAC A;  2KHP A;  4IP1 A;  3N5O A;  1GSS A;  2GT6 A;  2OE1 A;  3FRC A;  5GST A;  2HT9 A;  3KH9 A;  2B5X A;  1J08 A;  1T4Z A;  3IDV A;  2QSI A;  2VIM A;  2XHF A;  4JR6 A;  2TIR A;  4ZL9 A;  2QGV A;  1TKD B;  2TRX A;  5DJM A;  2PVO C;  1X9W B;  2CVK A;  1EEM A;  4LMV A;  4YQU A;  4XRA A;  4G9H A;  1JZR A;  2BTO T;  2H70 A;  2V6O A;  3F4T A;  2DMM A;  2FUG 2;  4MDC A;  2DJ3 A;  3PH9 A;  4XTS A;  1GL8 A;  4V1A p;  5B7C A;  1PD2 1;  4PNG A;  4KSM A;  2VLV A;  3TRX A;  16GS A;  1GUK A;  2C0E A;  3D6I A;  3GKK A;  2B6M A;  2HRN A;  3U6V A;  4KDU A;  3F8U A;  1FW1 A;  2M72 A;  2C0G A;  1N2A A;  3ME8 A;  5DAK B;  3CTF A;  3VPQ A;  5DAK A;  1S3D A;  2X99 A;  3UJ1 A;  3KXO A;  3GFK A;  5IO0 A;  1AC1 A;  2WB9 A;  1KBN A;  3D5J A;  3AY8 A;  2HI7 A;  3LGC A;  1PX7 A;  2N5F A;  4MAB A;  4CDO A;  4NV5 A;  1SD9 A;  2X8G A;  3P8W A;  3GKM A;  1R5P A;  3EC3 A;  1G0T A;  4NAX A;  1GTI A;  3GX8 A;  1XWG A;  3FY7 A;  3QMX A;  4NPB A;  2LJK A;  2JZT A;  1GTA A;  3IRA A;  2L4Q A;  2KLX A;  6GSX A;  2VD0 A;  3KMN A;  4I6X A;  4HJM A;  1NSW A;  3ZMK A;  1WPI A;  1SL2 B;  4OCF A;  3LQ7 A;  2WRT A;  2LS5 A;  3HVV A; 
#chains in the Genus database with same CATH topology
 2VCQ A;  5F8B A;  1IYH A;  1ERW A;  3PGT A;  2HFD A;  5B8B A;  3GIX A;  1T00 A;  4I2U A;  4GLT A;  5J9B A;  1GH2 A;  1XW6 A;  3HJP A;  4TN8 A;  1U87 A;  3UEM A;  1PKW A;  1TRV A;  1VRS D;  2WUL A;  4BL7 B;  1PFO A;  4N11 A;  2R0P A;  2H73 A;  3TOT A;  5IOW A;  1EEJ A;  1FVJ A;  3R2Q A;  4BL7 A;  1FG4 A;  4GRF A;  2J23 A;  1YDK A;  1M0U A;  1FOV A;  4G0L A;  1Z7R A;  1ZZY A;  4L5L A;  2B5Y A;  2B1L A;  2VO4 A;  2P0G A;  5B8A A;  1EOH A;  2NPB A;  5C00 A;  1PGT A;  4V1A g;  3FZ9 A;  2K18 A;  2VOC A;  3US3 A;  2V41 A;  4FO5 A;  4HEA 2;  4OFN A;  2Z9S A;  5CRE A;  2MMZ A;  1BAY A;  1PQN A;  1ILO A;  4BWS A;  3LOR A;  1K0C A;  2H0I A;  1FVK A;  5A4U A;  1OC3 A;  2X64 A;  4O7H A;  3N9J A;  2KP1 A;  3FMW A;  1SYR A;  4MF6 A;  4MCU A;  3TOU A;  3RPP A;  1GSQ A;  1F37 A;  1VF2 A;  3TCO A;  3KP8 A;  2CQ9 A;  4AJ8 A;  3GSS A;  1OVN A;  3F3Q A;  2F9S A;  1HYU A;  3CSH A;  1BG5 A;  3HZ4 A;  1XIY A;  3ME7 A;  3M9K A;  5DBQ A;  4E8H A;  3FZ4 A;  4FYU A;  4N10 A;  3GKX A;  3HHV A;  1DBY A;  3FEU A;  5CNW A;  5D9X A;  2LTK A;  5J3R A;  1K0D A;  2KP2 A;  1MDK A;  4TRX A;  3FR3 A;  1OYJ A;  2GVP A;  3EWL A;  4TVE A;  2FNO A;  3IC4 A;  4NV2 A;  5H5S A;  5IMC A;  1G7O A;  2MMA A;  4EO3 A;  3DXB A;  4NHZ A;  1JLV A;  4WET A;  4POB A;  3TKR A;  2REM A;  5DDL A;  4EIP A;  2A2R A;  3EYT A;  3E0U A;  3QFA C;  4PUR A;  3QR6 A;  3APS A;  3J7Y b;  20GS A;  1TOF A;  2C4J A;  4ID0 A;  3TJF A;  3QAW A;  2QKE A;  3TDG A;  2GGT A;  2H1G A;  2V1M A;  2K9F A;  1XWC A;  1O8X A;  5CRH A;  3UBL A;  2F8A A;  1XVW A;  3LSZ A;  3DWV A;  3QAV A;  1WIK A;  4EVM A;  2H6X A;  4ZL8 A;  4Q5Q A;  3A2W A;  4OFT A;  3IHQ A;  1ACV A;  1BQ7 A;  5CAX A;  3RAZ A;  2PBJ A;  5GAN D;  11GS A;  3WGE A;  3APO A;  3DKS A;  4A5P A;  1G6W A;  3L78 A;  1TK8 B;  2GST A;  18GS A;  4O5R A;  1EP7 A;  4EF0 A;  2HXK A;  4KUN A;  1VF3 A;  3EUR A;  4E8E A;  1X9M B;  9GSS A;  2LRN A;  3IE3 A;  3ERF A;  2VLT A;  3MIX A;  3C7M A;  2FD3 A;  4GTU A;  3RBT A;  1PKZ A;  3J7Y k;  1J9B A;  4YH2 A;  3MWH A;  5CO3 A;  3BOA A;  2CX3 A;  5H5Q A;  4V2L A;  2JSY A;  4LLR A;  3CYN A;  3QAG A;  4J2F A;  3IA1 A;  3WYW A;  3KEB A;  5LCZ A;  5AN1 A;  4ZIJ A;  1GLQ A;  2L57 A;  1V9W A;  4EL1 A;  3GHA A;  2YN1 A;  2AV4 A;  2YV7 A;  1M3I A;  4OWY A;  1GLP A;  3M0F A;  4ILF A;  1K3L A;  1BJX A;  2B7K A;  5ECQ B;  2H30 A;  1MD4 A;  1VF4 A;  4XHM A;  1UVZ A;  2NVL A;  4ZL7 A;  4G19 A;  2GZP A;  2L59 A;  1VF1 A;  3CBU A;  1TU8 A;  1R26 A;  1U88 A;  4KB3 A;  6GSV A;  3KM6 A;  4JZQ A;  1USB A;  2RLI A;  2MMO A;  4GQC A;  3C71 A;  2NBS A;  5GAP D;  4K0G A;  4DSR A;  5DCH A;  2O89 A;  2ON5 A;  4NHW A;  1SK2 A;  2F51 A;  2R5G A;  5AGY A;  4L0U A;  2H72 A;  3HVX A;  4WR4 A;  2E7P A;  2AHE A;  5CP1 A;  2AJQ B;  4POL A;  2C80 A;  2VL3 A;  3CXG A;  4KND A;  5DJL A;  4PTS A;  4DEJ A;  4HJ2 A;  2FWG A;  2H19 A;  4YAV A;  2IL3 A;  3KH7 A;  1M9A A;  4WF4 A;  1EV9 A;  1M3J A;  2HZE A;  2H1D A;  2R0G A;  1K0A A;  5ECS A;  1W89 A;  3VWU A;  2MZC A;  4F9Z A;  5HR3 A;  2C0F A;  3EU3 A;  3LW9 A;  2YWI A;  3RHC A;  2L6D A;  5HQP A;  3IAS 2;  1NHY A;  1ZL9 A;  3U5R E;  2C3N A;  3QD9 A;  5ECP B;  4ULX A;  1FB6 A;  3O76 A;  4RI6 A;  3PR8 A;  2OBK A;  3M9J A;  4F82 A;  1CQH A;  2R0C A;  4PX1 A;  2EIR A;  1YF1 A;  4G0I A;  5KN1 A;  2RM6 A;  2R4V A;  2IMI A;  2C1Y A;  3GX0 A;  1YEP A;  4MJC A;  1GSU A;  5ECI B;  3FZA A;  1MDI A;  4OO5 A;  1U3A A;  2H8L A;  3G9B A;  1YKA A;  3HKR A;  4IHU A;  2YZH A;  2IIY A;  4KA0 A;  1G7E A;  4K6X A;  2FWE A;  2G2Q A;  4MNN A;  1IYI A;  2HSY A;  5D73 A;  1XWB A;  4XIH A;  3IXR A;  4CW9 A;  2CZ3 A;  1QFN A;  5DAL A;  4K1F A;  3H1N A;  4ZBB A;  2DIY A;  1JZO A;  1A0R P;  2A2P A;  5DVB A;  4FQU A;  3A2X A;  1E6B A;  2EC4 A;  8GSS A;  3GUR A;  4ECC A;  5KN2 A;  3ZFB A;  1O81 A;  2R6K A;  1PL2 A;  1K3O A;  1WRY A;  5D96 A;  3L4N A;  1HNC A;  5KN0 A;  3EE2 A;  1ZYE A;  1AIU A;  2OE3 A;  3FHK A;  3TKQ A;  2FHE A;  2GZZ A;  3L0H A;  5KOX A;  2VCV A;  2O7K A;  1F6M C;  5ELA A;  4KCA A;  2I9H A;  5J4U A;  1FB0 A;  2C3Q A;  2H0H A;  1XW9 A;  4P3Y B;  2AAW A;  4LL4 B;  4JBB A;  5AIV A;  4O5U A;  1NW2 A;  4NMU A;  3F63 A;  2MBT A;  2K6V A;  3GN3 A;  1PRX A;  4TXO B;  3H8Q A;  1RQM A;  1GTB A;  2HRF A;  2CAQ A;  4TXO A;  1HNB A;  2B7J A;  3KJY A;  1K0O A;  1SU9 A;  1F3A A;  4F0C A;  2YAN A;  1YF0 A;  2WZ9 A;  2LV3 A;  1MDJ A;  3DEX A;  2I81 A;  1T8E B;  5HR2 A;  1LBK A;  1AXD A;  1XWA A;  2YWN A;  1TJD A;  3WGX A;  1MEK A;  2GQK A;  2B5E A;  4BIK A;  2RUE A;  3EPT A;  5FHI A;  2YV9 A;  1K0M A;  1U6T A;  1X5E A;  1JZD A;  5B6M A;  4KSO A;  1SKS B;  1XG8 A;  1XXU A;  3HVS A;  2GLR A;  2I3Y A;  1A2M A;  2LQO A;  3ZVJ A;  2WJU A;  4N0V A;  4NXI A;  1ABA A;  1YZX A;  3APQ A;  4IS0 A;  5H5R A;  4KW6 A;  2FLS A;  5G5E A;  4X4J A;  5G1K A;  4GSN A;  3A5I A;  3Q74 A;  3SBC A;  2PN8 A;  1Z6M A;  3H79 A;  3HCZ A;  4WR5 A;  3CRU A;  4HDE A;  4J56 E;  3ISO A;  3DRN A;  3DIE A;  3MSZ A;  4Z2T A;  4YKF A;  4GCI A;  1EOG A;  4Q5N A;  2VCT A;  2C0D A;  4TR4 A;  3V1W A;  3RDW A;  2H66 A;  3HJM A;  1M99 A;  1RK4 A;  5G1L A;  2ALB A;  1R4W A;  1HNA A;  1DSB A;  2IWT A;  1TP9 A;  1H75 A;  4HOJ A;  3EVI A;  4MA9 A;  1TTZ A;  3LXT A;  5HR0 A;  2FA8 A;  2H6Y A;  3CRT A;  2XC2 A;  2HZF A;  1QGV A;  4IJI A;  2XPE A;  4BWQ A;  3IV4 A;  1OKT A;  22GS A;  4O92 A;  5EVO A;  3EU4 A;  3GV1 A;  4ACS A;  2MYG A;  1B4P A;  2E2G A;  3UBK A;  5ECL B;  2PGT A;  4EKZ A;  5IM9 A;  4MJE A;  3HXS A;  3VK9 A;  4X1U A;  4DSS B;  3D4T A;  4XRD A;  3ZFL A;  4DVC A;  1GSD A;  2VM1 A;  5A5K A;  2P5Q A;  5F07 A;  4DSS A;  1KNG A;  1QUW A;  3GRX A;  2WS2 A;  1TDI A;  5D9T A;  4TKY A;  1HD2 A;  1QK8 A;  1S3R A;  3NOF A;  4YKG A;  3ERW A;  1XOA A;  3UOM A;  1F2E A;  1B9X C;  2DBC A;  4HZ2 A;  3C73 A;  3D0Z A;  3IR4 A;  4KAE A;  5E59 A;  5ENU A;  3W8J A;  5ELG A;  4XS6 A;  2YWO A;  2YP6 A;  2DJ0 A;  4JRR A;  3HZ8 A;  5EPF A;  1V57 A;  1LJR A;  5ID2 B;  1TU7 A;  2EIQ A;  2YNX A;  5CYY A;  5JCG A;  1YKC A;  3UAP A;  5ID2 A;  3I43 A;  1I9D A;  1Z5Y E;  1YJ6 A;  1GUL A;  2N5B A;  4F03 A;  1JZW A;  2IMF A;  3A5W A;  4YAP A;  3F9U A;  5JWO B;  4X0X A;  4AGS A;  4MPF A;  2H74 A;  4MMM A;  4GXZ A;  1V98 A;  2O85 A;  4OD7 A;  3GTU B;  3C1S A;  4FYC A;  2YJ7 A;  5IO2 A;  3HJO A;  3DVW A;  1Y6E A;  4BA7 A;  1J0F A;  4FIW A;  4KH7 A;  2BMX A;  4MLY A;  3KZQ A;  2JU5 A;  3MDK A;  2CVD A;  5A4W A;  4TOP A;  5LD0 A;  4IKH A;  5DCG A;  4MPG A;  1KEB A;  1V58 A;  1ST9 A;  4KDY A;  1JFU A;  1ZCP A;  5AIS A;  4YQM A;  1QQ2 A;  5GZZ B;  2VCX A;  2VL2 A;  2R3X A;  1SYX A;  3G7I A;  1GUM A;  5C04 A;  1T3B A;  1UA5 A;  4HZ4 A;  2GDR A;  2RUF A;  4K2D A;  1T7P B;  3TJK A;  5COH A;  2AUV A;  3F6D A;  4RQR A;  3DGQ A;  5J5N A;  4Z2U A;  3ZLP A;  4KF9 A;  1M2A A;  2MMN A;  4WF5 A;  5INY A;  1JLW A;  4MZB A;  2DC5 A;  1KTE A;  1TI1 A;  1XW5 A;  4K5S A;  5A4V A;  2N5A A;  5FT3 A;  2DML A;  4V2M A;  3GNJ A;  5DQY A;  1UN2 A;  2DLX A;  2ZUP A;  4EUY A;  5F06 A;  1XOB A;  3DML A;  1AQV A;  4TW5 A;  2PUK C;  2PU9 C;  3P90 A;  1ZYQ B;  2YWM A;  3CSI A;  6GSU A;  2LJA A;  5ECN B;  2WFC A;  5IQY A;  3TRQ A;  1O8W A;  2E0Q A;  2LNT A;  3IBH A;  4OMV A;  2H0G A;  1URM A;  3VI5 A;  3F0I A;  5KEJ A;  3L9V A;  4IBP A;  1EGO A;  3K8N A;  3IOS A;  1XWK A;  4F0B A;  2YJH A;  4HUA A;  5D9W A;  2C3T A;  3ERG A;  5IPG A;  1T1V A;  3TKS A;  2H01 A;  4I5Q A;  1C72 A;  4ISD A;  1WMJ A;  1EWX A;  2CT6 A;  3BBY A;  1O85 A;  1WE0 A;  4I8B A;  3KIJ A;  1GUH A;  4HU9 A;  1DE1 A;  4IN0 A;  5IMF A;  1PN9 A;  3LEF A;  1SK1 A;  5IMV A;  4ZXG A;  3GA4 A;  1A2L A;  4TXV A;  1OE8 A;  10GS A;  2HLS A;  2CV4 A;  5BMU A;  4N0Z A;  3L9S A;  4I2T A;  2LJR A;  5JCU A;  1YY7 A;  2VL2 C;  2GZY A;  1FHE A;  3KTB A;  3ZZX A;  4D73 B;  2M46 A;  3FYG A;  4TR1 B;  2J9H A;  2PVQ A;  2PMT A;  3GH9 A;  3MNG A;  2FA4 A;  2QC7 A;  3QOU A;  4TR1 A;  2JAD A;  3QCP A;  3VUR A;  1A8Y A;  5IMD A;  3LYP A;  3KMO A;  2F8F A;  1SJZ A;  1SKR B;  3TJG A;  3RPN A;  2LST A;  4YQV A;  3QPM A;  3WGD A;  2XPD A;  3F4R A;  3ZRD A;  2VCW A;  4IEL A;  2JZS A;  3KP9 A;  1ZOF A;  4HSC X;  3ZVJ D;  4NWY A;  2NTO A;  3O3T A;  4MJB A;  2HYX A;  2FWH A;  1XPV A;  5ABR A;  3OR5 A;  1TK5 B;  3LJR A;  1GNE A;  1N8J A;  3M3M A;  2LKU A;  2X8H A;  2UZ8 A;  4KE3 A;  3FZ5 A;  3BCI A;  7GSS A;  2KUC A;  2GQL A;  4KX4 A;  4XS4 B;  3S9F A;  2R2J A;  2OA7 A;  1M2B A;  4IVF A;  6GSS A;  1JHB A;  2HE3 A;  4XS4 A;  1QMV A;  4QL9 A;  1EV4 A;  3ZL5 A;  4WKW A;  1XCC A;  5IPH A;  2YOI A;  3LXZ A;  1GNW A;  3TKS C;  3C1R A;  2P5R A;  1GP1 A;  2ZNM A;  3GUS A;  2FWF A;  2WGR A;  3NZN A;  2K8V A;  1A2J A;  2LNS A;  3I6A A;  2KOK A;  2CVB A;  4MF5 A;  4JU5 A;  2HRK A;  3VPT A;  1Z3E A;  1Z9H A;  4G0K A;  3M8N A;  3EMP A;  1THO A;  2L5L A;  1XBS A;  2X8C A;  2MBS A;  3QDN A;  5IMZ A;  4Z7X A;  4PUF C;  1X9S B;  5FWG A;  2FCH A;  2IFQ B;  3TJB A;  1WP0 A;  2RII A;  3F3R A;  5LNK e;  3Q6O A;  2OE0 A;  1QXH A;  2R37 A;  3TRP A;  1U3I A;  3RHB A;  2ES7 A;  1PN0 A;  4USS A;  5HFG A;  3VWW A;  1ERT A;  1BX9 A;  4EXJ A;  6GST A;  4WXT A;  2O8V B;  2DJ1 A;  4O32 A;  4AJ6 A;  1RW1 A;  2YPM A;  2WDU A;  2A4H A;  3DYR A;  1S3A A;  2LRT A;  3GKN A;  1GSE A;  2PER A;  4JED A;  2JZR A;  2ZCT A;  5IMA A;  5HR1 A;  3Q19 A;  1M9B A;  3CSJ A;  3HVN A;  3H93 A;  1B4Q A;  1TRU A;  1ERU A;  4L0W A;  4MH2 A;  1K0B A;  4EIQ A;  1Z6N A;  3FR6 A;  3KD0 A;  2OKA A;  4O5Q A;  4TR0 A;  2DKI A;  2D2Z A;  5D9V A;  1V2A A;  2L6C A;  3CTG A;  3O6T A;  2H1B A;  5DQS A;  5L71 A;  4G10 A;  3TKS E;  1FOH A;  3ZRE A;  4EDZ A;  2L4C A;  1ON4 A;  5AIX A;  2CZ2 A;  12GS A;  2GT5 A;  4BPY A;  4POK A;  4QQ7 A;  1GWC A;  3TUE A;  1UC7 A;  4LA1 A;  5EL8 A;  1SKW B;  4Z2R A;  1AQX A;  4OO4 A;  3HA9 A;  5KN3 A;  3IPZ A;  3ZIT A;  4IGJ A;  4WBR D;  4L5O A;  4ZIL A;  4ZBD A;  4ECJ A;  3GL3 A;  5KOW A;  4CY8 A;  3H4K A;  2C8U A;  4GST A;  5JCW A;  3TGZ A;  1NHO A;  3F4S A;  4KGI A;  1WOU A;  1PSQ A;  1AUC A;  2IMD A;  4BVY B;  4K0N A;  5G2Z A;  4H86 A;  4BVY A;  3GH6 A;  3IC8 A;  3GYK A;  1O73 A;  3TJJ A;  4IP6 A;  3UVH A;  1FAA A;  6GSW A;  3UL3 A;  4RI7 A;  1MD3 A;  3UMA A;  2FGX A;  1A24 A;  2B1K A;  3VLN A;  3UIW A;  4K7N A;  3VI7 A;  3BJ5 A;  2QA1 A;  2ON7 A;  1OC8 A;  1FO5 A;  1SJ6 A;  4DSQ A;  4PUA A;  3W8S A;  1A8L A;  3L9U A;  5G31 A;  1M7T A;  4GQF A;  2L5O A;  4RUV A;  2VUP A;  1M2D A;  4HQS A;  5CRG A;  3SWL A;  1PX6 A;  5ECK B;  3IAM 2;  4MH3 A;  4MZW A;  1EP8 A;  1TRS A;  1PMT A;  4PNF A;  4IJ3 A;  2IMK A;  2DJJ A;  3G7Y A;  4CHS A;  4MF7 A;  1SL0 B;  5BRT A;  1ZMA A;  2DSA A;  3LYK A;  4K8M A;  4Q5F A;  3VWX A;  4MP4 A;  2TRC P;  4MZC A;  2OBI A;  4PXO A;  3KCM A;  3MAK A;  2X4A A;  3EIN A;  3HD5 A;  5ECM B;  4FYB A;  5ECR B;  4K7O A;  5B6N A;  4TR3 A;  1XZO A;  4K9Z A;  1B8X A;  2HRA A;  5D8I A;  4RQX A;  14GS A;  3VWV A;  3PIN A;  1TXX A;  1O6J A;  2IJY A;  2LRC A;  4WEY A;  4I97 A;  3HYP A;  4HU7 A;  3ZTL A;  3LFL A;  1ZYN A;  4JR4 A;  1V40 A;  4AJ7 A;  4OCE A;  4PQ1 A;  2XBQ A;  5E4W A;  3GST A;  1BYE A;  1XFL A;  4ML6 A;  3KGK A;  6GSY A;  1VGL A;  1GTU A;  2G0F A;  1R5A A;  2H75 A;  2XBI A;  4PQI A;  1BED A;  3R3E A;  1AQW A;  3UVT A;  1A23 A;  1E2Y A;  1T4Y A;  2OJL A;  3E9J B;  13GS A;  1MTC A;  3GTU A;  3TKP A;  1TI3 A;  5IOX A;  5J41 A;  4QL7 A;  1CQG A;  5D93 A;  3QFB C;  3D22 A;  3IK9 A;  4K5R A;  4JE1 A;  2B3S A;  2GS3 A;  3BD2 A;  1TW9 A;  3HDC A;  1DE2 A;  3CMI A;  3D4M A;  3WD6 A;  1S3C A;  1Q98 A;  2IN3 A;  1Y25 A;  1X0R A;  1B48 A;  4KDX A;  2JL4 A;  2DJK A;  2LEG A;  2IPA A;  1TK0 B;  2K8S A;  3BCK A;  2VL9 A;  3A3T A;  5JWQ B;  2GQM A;  1H4O A;  4HQZ A;  2IME A;  4ICY A;  4PQH A;  3C8E A;  2H71 A;  2GTU A;  3ZIV A;  4ECB A;  3DVX A;  4OFM A;  4GF0 A;  2O87 A;  2OAC A;  3FW2 A;  4HI7 A;  1SD8 A;  2OAD A;  2VAF A;  4XCS A;  4G2E A;  3TB2 A;  5GSS A;  4ZBA A;  2EIO A;  5JWR B;  2VLU A;  2VCZ A;  4HS1 A;  2YCD A;  4J57 E;  2GSS A;  1SEN A;  3IK7 A;  1ERV A;  2I4A A;  3JCM L;  2CAI A;  1XVQ A;  1WWJ A;  4CY6 A;  3ZIJ A;  3NIV A;  1THX A;  1SJI A;  1R7H A;  4L8E A;  3WT2 A;  1PA3 A;  2YZU A;  1A0F A;  2AB6 A;  1O7U A;  3G7J A;  4ECI A;  1SL1 B;  1EZK A;  1Z7P A;  19GS A;  1EGR A;  2A2S A;  2M80 A;  2VM2 A;  1X5C A;  4F2I A;  1W4V A;  2CX4 A;  5F05 A;  4XS1 A;  1GRX A;  1NM3 A;  3LG6 A;  4N30 A;  1ML6 A;  2PWJ A;  1F3B A;  3D21 A;  2QA2 A;  1YEX A;  4ZB6 A;  4X43 A;  4MJA A;  1HQO A;  4MK3 A;  4IQ1 A;  2DJ2 A;  5HFI A;  4K7I A;  4IW9 A;  3LWA A;  1Q4J A;  3FK8 A;  1OC9 B;  2LUS A;  4D73 A;  2PPT A;  2WCI A;  4GSS A;  3VFI A;  2P31 A;  3ZML A;  1OAZ A;  1OC9 A;  5IIZ A;  1LU4 A;  5G5F A;  3I69 A;  4ZB8 A;  2HZE B;  3ED3 A;  1B9Y C;  2V6K A;  1WJK A;  3P7X A;  5J9C A;  3DD3 A;  5EY6 A;  2F3M A;  2HNL A;  3E3E A;  4POM A;  4BVX B;  4K2X A;  2FY6 A;  2JSZ A;  4FH8 A;  1DUG A;  4BVX A;  5HFK A;  1I5G A;  4AF2 A;  5ECH B;  1OE7 A;  4LL1 B;  3F6F A;  1GSF A;  1K3Y A;  2H6Z A;  3EMX A;  1G6Y A;  5CRW A;  3Q18 A;  4EC0 A;  2V2G A;  4EE0 A;  3MYD A;  3M1G A;  3I9V 2;  4ZB9 A;  3WT1 A;  5G30 A;  5CRD A;  1X5D A;  2I1U A;  1K0N A;  4Q5R A;  2HSM A;  2H76 A;  3UAR A;  4LMW A;  1ZGN A;  3FR9 A;  3KTL A;  3GL5 A;  3HY2 A;  2DIZ A;  1AAZ A;  1OKD A;  2CA8 A;  1ZYP A;  3P2A A;  5DAL B;  5F0G A;  2A4V A;  4PGT A;  2RM5 A;  4IQA A;  2H1A A;  3W6G A;  2V32 A;  3A2V A;  2AYT A;  1TRW A;  17GS A;  3GMF A;  5ECO B;  2GSQ A;  4V2N A;  2GSR A;  4KCE A;  4WBJ A;  2IFQ A;  1GSY A;  1YQ1 A;  2HSH A;  2LQQ A;  1SK0 A;  3ZYW A;  3FKF A;  2NDO A;  1F9M A;  2VD1 A;  1AW9 A;  1PL1 A;  2BJX A;  4GWR A;  4ML1 A;  2E2M A;  4EDY A;  2JAC A;  2KHP A;  4IP1 A;  3N5O A;  1GSS A;  2GT6 A;  2OE1 A;  3FRC A;  5GST A;  2HT9 A;  3KH9 A;  2B5X A;  1J08 A;  1T4Z A;  3IDV A;  2QSI A;  2VIM A;  2XHF A;  4JR6 A;  2TIR A;  4ZL9 A;  2QGV A;  1TKD B;  2TRX A;  5DJM A;  2PVO C;  1X9W B;  2CVK A;  1EEM A;  4LMV A;  4YQU A;  4XRA A;  4G9H A;  1JZR A;  2BTO T;  2H70 A;  2V6O A;  3F4T A;  2DMM A;  2FUG 2;  4MDC A;  2DJ3 A;  3PH9 A;  4XTS A;  1GL8 A;  4V1A p;  5B7C A;  2X49 A;  1PD2 1;  4PNG A;  4KSM A;  2VLV A;  3TRX A;  16GS A;  1GUK A;  2C0E A;  3PPU A;  3CQF A;  3D6I A;  3GKK A;  2B6M A;  2HRN A;  3U6V A;  4KDU A;  3F8U A;  1FW1 A;  2M72 A;  2C0G A;  1N2A A;  3ME8 A;  5DAK B;  3CTF A;  3VPQ A;  5DAK A;  1S3D A;  2X99 A;  3UJ1 A;  2DKH A;  3KXO A;  3GFK A;  5IO0 A;  1AC1 A;  2WB9 A;  1KBN A;  3D5J A;  3AY8 A;  2HI7 A;  3IHG A;  3LGC A;  1PX7 A;  2N5F A;  4MAB A;  4CDO A;  4NV5 A;  1SD9 A;  2X8G A;  3P8W A;  3GKM A;  1R5P A;  3EC3 A;  1G0T A;  4NAX A;  1GTI A;  3GX8 A;  1XWG A;  3FY7 A;  3QMX A;  4NPB A;  2LJK A;  2JZT A;  1GTA A;  3IRA A;  2L4Q A;  2KLX A;  6GSX A;  2VD0 A;  3KMN A;  4I6X A;  4HJM A;  1NSW A;  3ZMK A;  1WPI A;  1SL2 B;  4OCF A;  3LQ7 A;  2WRT A;  2LS5 A;  3HVV A; 
#chains in the Genus database with same CATH homology
 2VCQ A;  5F8B A;  1IYH A;  1ERW A;  3PGT A;  2HFD A;  5B8B A;  3GIX A;  1T00 A;  4I2U A;  4GLT A;  5J9B A;  1GH2 A;  1XW6 A;  3HJP A;  4TN8 A;  1U87 A;  3UEM A;  1PKW A;  1TRV A;  1VRS D;  2WUL A;  4BL7 B;  4N11 A;  2R0P A;  2H73 A;  3TOT A;  5IOW A;  1EEJ A;  1FVJ A;  3R2Q A;  4BL7 A;  1FG4 A;  4GRF A;  2J23 A;  1YDK A;  1M0U A;  1FOV A;  4G0L A;  1Z7R A;  1ZZY A;  4L5L A;  2B5Y A;  2B1L A;  2VO4 A;  2P0G A;  5B8A A;  1EOH A;  2NPB A;  5C00 A;  1PGT A;  4V1A g;  3FZ9 A;  2K18 A;  2VOC A;  3US3 A;  2V41 A;  4FO5 A;  4HEA 2;  4OFN A;  2Z9S A;  5CRE A;  2MMZ A;  1BAY A;  1PQN A;  1ILO A;  4BWS A;  3LOR A;  1K0C A;  2H0I A;  1FVK A;  5A4U A;  1OC3 A;  2X64 A;  4O7H A;  3N9J A;  2KP1 A;  3FMW A;  1SYR A;  4MF6 A;  4MCU A;  3TOU A;  3RPP A;  1GSQ A;  1F37 A;  1VF2 A;  3TCO A;  3KP8 A;  2CQ9 A;  4AJ8 A;  3GSS A;  1OVN A;  3F3Q A;  2F9S A;  1HYU A;  3CSH A;  1BG5 A;  3HZ4 A;  1XIY A;  3ME7 A;  3M9K A;  5DBQ A;  4E8H A;  3FZ4 A;  4FYU A;  4N10 A;  3GKX A;  3HHV A;  1DBY A;  3FEU A;  5CNW A;  5D9X A;  2LTK A;  5J3R A;  1K0D A;  2KP2 A;  1MDK A;  4TRX A;  3FR3 A;  1OYJ A;  2GVP A;  3EWL A;  4TVE A;  2FNO A;  3IC4 A;  4NV2 A;  5H5S A;  5IMC A;  1G7O A;  2MMA A;  4EO3 A;  3DXB A;  4NHZ A;  1JLV A;  4WET A;  4POB A;  3TKR A;  2REM A;  5DDL A;  4EIP A;  2A2R A;  3EYT A;  3E0U A;  3QFA C;  4PUR A;  3QR6 A;  3APS A;  3J7Y b;  20GS A;  1TOF A;  2C4J A;  4ID0 A;  3TJF A;  3QAW A;  2QKE A;  3TDG A;  2GGT A;  2H1G A;  2V1M A;  2K9F A;  1XWC A;  1O8X A;  5CRH A;  3UBL A;  2F8A A;  1XVW A;  3LSZ A;  3DWV A;  3QAV A;  1WIK A;  4EVM A;  2H6X A;  4ZL8 A;  4Q5Q A;  3A2W A;  4OFT A;  3IHQ A;  1ACV A;  1BQ7 A;  5CAX A;  3RAZ A;  2PBJ A;  5GAN D;  11GS A;  3WGE A;  3APO A;  3DKS A;  4A5P A;  1G6W A;  3L78 A;  1TK8 B;  2GST A;  18GS A;  4O5R A;  1EP7 A;  4EF0 A;  2HXK A;  4KUN A;  1VF3 A;  3EUR A;  4E8E A;  1X9M B;  9GSS A;  2LRN A;  3IE3 A;  3ERF A;  2VLT A;  3MIX A;  3C7M A;  2FD3 A;  4GTU A;  3RBT A;  1PKZ A;  3J7Y k;  1J9B A;  4YH2 A;  3MWH A;  5CO3 A;  3BOA A;  2CX3 A;  5H5Q A;  4V2L A;  2JSY A;  4LLR A;  3CYN A;  3QAG A;  4J2F A;  3IA1 A;  3WYW A;  3KEB A;  5LCZ A;  5AN1 A;  4ZIJ A;  1GLQ A;  2L57 A;  1V9W A;  4EL1 A;  3GHA A;  2YN1 A;  2AV4 A;  2YV7 A;  4OWY A;  1GLP A;  3M0F A;  4ILF A;  1K3L A;  1BJX A;  2B7K A;  5ECQ B;  2H30 A;  1MD4 A;  1VF4 A;  4XHM A;  1UVZ A;  2NVL A;  4ZL7 A;  4G19 A;  2GZP A;  2L59 A;  1VF1 A;  3CBU A;  1TU8 A;  1R26 A;  1U88 A;  4KB3 A;  6GSV A;  3KM6 A;  4JZQ A;  1USB A;  2RLI A;  2MMO A;  4GQC A;  3C71 A;  2NBS A;  5GAP D;  4K0G A;  4DSR A;  5DCH A;  2O89 A;  2ON5 A;  4NHW A;  1SK2 A;  2F51 A;  2R5G A;  5AGY A;  4L0U A;  2H72 A;  3HVX A;  4WR4 A;  2E7P A;  2AHE A;  5CP1 A;  2AJQ B;  4POL A;  2C80 A;  2VL3 A;  3CXG A;  4KND A;  5DJL A;  4PTS A;  4DEJ A;  4HJ2 A;  2FWG A;  2H19 A;  4YAV A;  2IL3 A;  3KH7 A;  1M9A A;  4WF4 A;  1EV9 A;  2HZE A;  2H1D A;  2R0G A;  1K0A A;  5ECS A;  1W89 A;  3VWU A;  2MZC A;  4F9Z A;  5HR3 A;  2C0F A;  3EU3 A;  3LW9 A;  2YWI A;  3RHC A;  2L6D A;  5HQP A;  3IAS 2;  1NHY A;  1ZL9 A;  3U5R E;  2C3N A;  3QD9 A;  5ECP B;  4ULX A;  1FB6 A;  3O76 A;  4RI6 A;  3PR8 A;  2OBK A;  3M9J A;  4F82 A;  1CQH A;  2R0C A;  4PX1 A;  2EIR A;  1YF1 A;  4G0I A;  5KN1 A;  2RM6 A;  2R4V A;  2IMI A;  2C1Y A;  3GX0 A;  1YEP A;  4MJC A;  1GSU A;  5ECI B;  3FZA A;  1MDI A;  4OO5 A;  1U3A A;  2H8L A;  3G9B A;  1YKA A;  3HKR A;  4IHU A;  2YZH A;  2IIY A;  4KA0 A;  1G7E A;  4K6X A;  2FWE A;  2G2Q A;  4MNN A;  1IYI A;  2HSY A;  5D73 A;  1XWB A;  4XIH A;  3IXR A;  4CW9 A;  2CZ3 A;  1QFN A;  5DAL A;  4K1F A;  3H1N A;  4ZBB A;  2DIY A;  1JZO A;  1A0R P;  2A2P A;  5DVB A;  4FQU A;  3A2X A;  1E6B A;  2EC4 A;  8GSS A;  3GUR A;  4ECC A;  5KN2 A;  3ZFB A;  1O81 A;  2R6K A;  1PL2 A;  1K3O A;  1WRY A;  5D96 A;  3L4N A;  1HNC A;  5KN0 A;  3EE2 A;  1ZYE A;  1AIU A;  2OE3 A;  3FHK A;  3TKQ A;  2FHE A;  2GZZ A;  3L0H A;  5KOX A;  2VCV A;  2O7K A;  1F6M C;  5ELA A;  4KCA A;  2I9H A;  5J4U A;  1FB0 A;  2C3Q A;  2H0H A;  1XW9 A;  4P3Y B;  2AAW A;  4LL4 B;  4JBB A;  5AIV A;  4O5U A;  1NW2 A;  4NMU A;  3F63 A;  2MBT A;  2K6V A;  3GN3 A;  1PRX A;  4TXO B;  3H8Q A;  1RQM A;  1GTB A;  2HRF A;  2CAQ A;  4TXO A;  1HNB A;  2B7J A;  3KJY A;  1K0O A;  1SU9 A;  1F3A A;  4F0C A;  2YAN A;  1YF0 A;  2WZ9 A;  2LV3 A;  1MDJ A;  3DEX A;  2I81 A;  1T8E B;  5HR2 A;  1LBK A;  1AXD A;  1XWA A;  2YWN A;  1TJD A;  3WGX A;  1MEK A;  2GQK A;  2B5E A;  2RUE A;  3EPT A;  5FHI A;  2YV9 A;  1K0M A;  1U6T A;  1X5E A;  1JZD A;  5B6M A;  4KSO A;  1SKS B;  1XXU A;  3HVS A;  2GLR A;  2I3Y A;  1A2M A;  2LQO A;  3ZVJ A;  2WJU A;  4N0V A;  4NXI A;  1ABA A;  1YZX A;  3APQ A;  4IS0 A;  5H5R A;  4KW6 A;  2FLS A;  5G5E A;  4X4J A;  5G1K A;  4GSN A;  3A5I A;  3Q74 A;  3SBC A;  2PN8 A;  1Z6M A;  3H79 A;  3HCZ A;  4WR5 A;  3CRU A;  4HDE A;  4J56 E;  3ISO A;  3DRN A;  3DIE A;  3MSZ A;  4Z2T A;  4YKF A;  4GCI A;  1EOG A;  4Q5N A;  2VCT A;  2C0D A;  4TR4 A;  3V1W A;  3RDW A;  2H66 A;  3HJM A;  1M99 A;  1RK4 A;  5G1L A;  2ALB A;  1R4W A;  1HNA A;  1DSB A;  2IWT A;  1TP9 A;  1H75 A;  4HOJ A;  3EVI A;  4MA9 A;  1TTZ A;  3LXT A;  5HR0 A;  2FA8 A;  2H6Y A;  3CRT A;  2XC2 A;  2HZF A;  1QGV A;  4IJI A;  2XPE A;  4BWQ A;  3IV4 A;  1OKT A;  22GS A;  4O92 A;  5EVO A;  3EU4 A;  3GV1 A;  4ACS A;  2MYG A;  1B4P A;  2E2G A;  3UBK A;  5ECL B;  2PGT A;  4EKZ A;  5IM9 A;  4MJE A;  3HXS A;  3VK9 A;  4X1U A;  4DSS B;  3D4T A;  4XRD A;  3ZFL A;  4DVC A;  1GSD A;  2VM1 A;  5A5K A;  2P5Q A;  5F07 A;  4DSS A;  1KNG A;  1QUW A;  3GRX A;  2WS2 A;  1TDI A;  5D9T A;  4TKY A;  1HD2 A;  1QK8 A;  3NOF A;  4YKG A;  3ERW A;  1XOA A;  3UOM A;  1F2E A;  1B9X C;  2DBC A;  4HZ2 A;  3C73 A;  3D0Z A;  3IR4 A;  4KAE A;  5E59 A;  5ENU A;  3W8J A;  5ELG A;  4XS6 A;  2YWO A;  2YP6 A;  2DJ0 A;  4JRR A;  3HZ8 A;  5EPF A;  1V57 A;  1LJR A;  5ID2 B;  1TU7 A;  2EIQ A;  2YNX A;  5CYY A;  5JCG A;  1YKC A;  3UAP A;  5ID2 A;  3I43 A;  1I9D A;  1Z5Y E;  1YJ6 A;  1GUL A;  2N5B A;  4F03 A;  1JZW A;  2IMF A;  3A5W A;  4YAP A;  3F9U A;  5JWO B;  4X0X A;  4AGS A;  4MPF A;  2H74 A;  4MMM A;  4GXZ A;  1V98 A;  2O85 A;  4OD7 A;  3GTU B;  3C1S A;  4FYC A;  2YJ7 A;  5IO2 A;  3HJO A;  3DVW A;  1Y6E A;  4BA7 A;  1J0F A;  4FIW A;  4KH7 A;  2BMX A;  4MLY A;  3KZQ A;  2JU5 A;  3MDK A;  2CVD A;  5A4W A;  4TOP A;  5LD0 A;  4IKH A;  5DCG A;  4MPG A;  1KEB A;  1V58 A;  1ST9 A;  4KDY A;  1JFU A;  1ZCP A;  5AIS A;  4YQM A;  1QQ2 A;  5GZZ B;  2VCX A;  2VL2 A;  2R3X A;  1SYX A;  3G7I A;  1GUM A;  5C04 A;  1T3B A;  1UA5 A;  4HZ4 A;  2GDR A;  2RUF A;  4K2D A;  1T7P B;  3TJK A;  5COH A;  2AUV A;  3F6D A;  4RQR A;  3DGQ A;  5J5N A;  4Z2U A;  3ZLP A;  4KF9 A;  1M2A A;  2MMN A;  4WF5 A;  5INY A;  1JLW A;  4MZB A;  2DC5 A;  1KTE A;  1TI1 A;  1XW5 A;  4K5S A;  5A4V A;  2N5A A;  5FT3 A;  2DML A;  4V2M A;  3GNJ A;  5DQY A;  1UN2 A;  2DLX A;  2ZUP A;  4EUY A;  5F06 A;  1XOB A;  3DML A;  1AQV A;  4TW5 A;  2PUK C;  2PU9 C;  3P90 A;  1ZYQ B;  2YWM A;  3CSI A;  6GSU A;  2LJA A;  5ECN B;  2WFC A;  5IQY A;  3TRQ A;  1O8W A;  2E0Q A;  2LNT A;  3IBH A;  4OMV A;  2H0G A;  1URM A;  3VI5 A;  3F0I A;  5KEJ A;  3L9V A;  4IBP A;  1EGO A;  3K8N A;  3IOS A;  1XWK A;  4F0B A;  2YJH A;  4HUA A;  5D9W A;  2C3T A;  3ERG A;  5IPG A;  1T1V A;  3TKS A;  2H01 A;  4I5Q A;  1C72 A;  4ISD A;  1WMJ A;  1EWX A;  2CT6 A;  3BBY A;  1O85 A;  1WE0 A;  4I8B A;  3KIJ A;  1GUH A;  4HU9 A;  1DE1 A;  4IN0 A;  5IMF A;  1PN9 A;  3LEF A;  1SK1 A;  5IMV A;  4ZXG A;  3GA4 A;  1A2L A;  4TXV A;  1OE8 A;  10GS A;  2HLS A;  2CV4 A;  5BMU A;  4N0Z A;  3L9S A;  4I2T A;  2LJR A;  5JCU A;  1YY7 A;  2VL2 C;  2GZY A;  1FHE A;  3KTB A;  3ZZX A;  4D73 B;  2M46 A;  3FYG A;  4TR1 B;  2J9H A;  2PVQ A;  2PMT A;  3GH9 A;  3MNG A;  2FA4 A;  2QC7 A;  3QOU A;  4TR1 A;  2JAD A;  3QCP A;  3VUR A;  1A8Y A;  5IMD A;  3LYP A;  3KMO A;  2F8F A;  1SJZ A;  1SKR B;  3TJG A;  3RPN A;  2LST A;  4YQV A;  3QPM A;  3WGD A;  2XPD A;  3F4R A;  3ZRD A;  2VCW A;  4IEL A;  2JZS A;  3KP9 A;  1ZOF A;  3ZVJ D;  4NWY A;  2NTO A;  3O3T A;  4MJB A;  2HYX A;  2FWH A;  1XPV A;  5ABR A;  3OR5 A;  1TK5 B;  3LJR A;  1GNE A;  1N8J A;  3M3M A;  2LKU A;  2X8H A;  2UZ8 A;  4KE3 A;  3FZ5 A;  3BCI A;  7GSS A;  2KUC A;  2GQL A;  4KX4 A;  4XS4 B;  3S9F A;  2R2J A;  2OA7 A;  1M2B A;  4IVF A;  6GSS A;  1JHB A;  2HE3 A;  4XS4 A;  1QMV A;  4QL9 A;  1EV4 A;  3ZL5 A;  4WKW A;  1XCC A;  5IPH A;  2YOI A;  3LXZ A;  1GNW A;  3TKS C;  3C1R A;  2P5R A;  1GP1 A;  2ZNM A;  3GUS A;  2FWF A;  2WGR A;  3NZN A;  2K8V A;  1A2J A;  2LNS A;  3I6A A;  2KOK A;  2CVB A;  4MF5 A;  4JU5 A;  2HRK A;  3VPT A;  1Z3E A;  1Z9H A;  4G0K A;  3M8N A;  3EMP A;  1THO A;  2L5L A;  1XBS A;  2X8C A;  2MBS A;  3QDN A;  5IMZ A;  4Z7X A;  4PUF C;  1X9S B;  5FWG A;  2FCH A;  2IFQ B;  3TJB A;  1WP0 A;  2RII A;  3F3R A;  5LNK e;  3Q6O A;  2OE0 A;  1QXH A;  2R37 A;  3TRP A;  1U3I A;  3RHB A;  2ES7 A;  1PN0 A;  4USS A;  5HFG A;  3VWW A;  1ERT A;  1BX9 A;  4EXJ A;  6GST A;  4WXT A;  2O8V B;  2DJ1 A;  4O32 A;  4AJ6 A;  1RW1 A;  2YPM A;  2WDU A;  2A4H A;  3DYR A;  1S3A A;  2LRT A;  3GKN A;  1GSE A;  2PER A;  4JED A;  2JZR A;  2ZCT A;  5IMA A;  5HR1 A;  3Q19 A;  1M9B A;  3CSJ A;  3H93 A;  1B4Q A;  1TRU A;  1ERU A;  4L0W A;  4MH2 A;  1K0B A;  4EIQ A;  1Z6N A;  3FR6 A;  3KD0 A;  2OKA A;  4O5Q A;  4TR0 A;  2DKI A;  2D2Z A;  5D9V A;  1V2A A;  2L6C A;  3CTG A;  3O6T A;  2H1B A;  5DQS A;  5L71 A;  4G10 A;  3TKS E;  1FOH A;  3ZRE A;  4EDZ A;  2L4C A;  1ON4 A;  5AIX A;  2CZ2 A;  12GS A;  2GT5 A;  4BPY A;  4POK A;  4QQ7 A;  1GWC A;  3TUE A;  1UC7 A;  4LA1 A;  5EL8 A;  1SKW B;  4Z2R A;  1AQX A;  4OO4 A;  3HA9 A;  5KN3 A;  3IPZ A;  3ZIT A;  4IGJ A;  4WBR D;  4L5O A;  4ZIL A;  4ZBD A;  4ECJ A;  3GL3 A;  5KOW A;  4CY8 A;  3H4K A;  2C8U A;  4GST A;  5JCW A;  3TGZ A;  1NHO A;  3F4S A;  4KGI A;  1WOU A;  1PSQ A;  1AUC A;  2IMD A;  4BVY B;  4K0N A;  5G2Z A;  4H86 A;  4BVY A;  3GH6 A;  3IC8 A;  3GYK A;  1O73 A;  3TJJ A;  4IP6 A;  3UVH A;  1FAA A;  6GSW A;  3UL3 A;  4RI7 A;  1MD3 A;  3UMA A;  2FGX A;  1A24 A;  2B1K A;  3VLN A;  3UIW A;  4K7N A;  3VI7 A;  3BJ5 A;  2QA1 A;  2ON7 A;  1OC8 A;  1FO5 A;  1SJ6 A;  4DSQ A;  4PUA A;  3W8S A;  1A8L A;  3L9U A;  5G31 A;  1M7T A;  4GQF A;  2L5O A;  4RUV A;  2VUP A;  1M2D A;  4HQS A;  5CRG A;  3SWL A;  1PX6 A;  5ECK B;  3IAM 2;  4MH3 A;  4MZW A;  1EP8 A;  1TRS A;  1PMT A;  4PNF A;  4IJ3 A;  2IMK A;  2DJJ A;  3G7Y A;  4CHS A;  4MF7 A;  1SL0 B;  5BRT A;  1ZMA A;  2DSA A;  3LYK A;  4K8M A;  4Q5F A;  3VWX A;  4MP4 A;  2TRC P;  4MZC A;  2OBI A;  4PXO A;  3KCM A;  3MAK A;  2X4A A;  3EIN A;  3HD5 A;  5ECM B;  4FYB A;  5ECR B;  4K7O A;  5B6N A;  4TR3 A;  1XZO A;  4K9Z A;  1B8X A;  2HRA A;  5D8I A;  4RQX A;  14GS A;  3VWV A;  3PIN A;  1TXX A;  1O6J A;  2IJY A;  2LRC A;  4WEY A;  4I97 A;  3HYP A;  4HU7 A;  3ZTL A;  3LFL A;  1ZYN A;  4JR4 A;  1V40 A;  4AJ7 A;  4OCE A;  4PQ1 A;  2XBQ A;  5E4W A;  3GST A;  1BYE A;  1XFL A;  4ML6 A;  3KGK A;  6GSY A;  1VGL A;  1GTU A;  2G0F A;  1R5A A;  2H75 A;  2XBI A;  4PQI A;  1BED A;  3R3E A;  1AQW A;  3UVT A;  1A23 A;  1E2Y A;  1T4Y A;  2OJL A;  3E9J B;  13GS A;  1MTC A;  3GTU A;  3TKP A;  1TI3 A;  5IOX A;  5J41 A;  4QL7 A;  1CQG A;  5D93 A;  3QFB C;  3D22 A;  3IK9 A;  4K5R A;  4JE1 A;  2B3S A;  2GS3 A;  3BD2 A;  1TW9 A;  3HDC A;  1DE2 A;  3CMI A;  3D4M A;  3WD6 A;  1S3C A;  1Q98 A;  2IN3 A;  1Y25 A;  1X0R A;  1B48 A;  4KDX A;  2JL4 A;  2DJK A;  2LEG A;  2IPA A;  1TK0 B;  2K8S A;  3BCK A;  2VL9 A;  3A3T A;  5JWQ B;  2GQM A;  1H4O A;  4HQZ A;  2IME A;  4ICY A;  4PQH A;  3C8E A;  2H71 A;  2GTU A;  3ZIV A;  4ECB A;  3DVX A;  4OFM A;  4GF0 A;  2O87 A;  2OAC A;  3FW2 A;  4HI7 A;  1SD8 A;  2OAD A;  2VAF A;  4XCS A;  4G2E A;  3TB2 A;  5GSS A;  4ZBA A;  2EIO A;  5JWR B;  2VLU A;  2VCZ A;  4HS1 A;  2YCD A;  4J57 E;  2GSS A;  1SEN A;  3IK7 A;  1ERV A;  2I4A A;  3JCM L;  2CAI A;  1XVQ A;  1WWJ A;  4CY6 A;  3ZIJ A;  3NIV A;  1THX A;  1SJI A;  1R7H A;  4L8E A;  3WT2 A;  1PA3 A;  2YZU A;  1A0F A;  2AB6 A;  1O7U A;  3G7J A;  4ECI A;  1SL1 B;  1EZK A;  1Z7P A;  19GS A;  1EGR A;  2A2S A;  2M80 A;  2VM2 A;  1X5C A;  4F2I A;  1W4V A;  2CX4 A;  5F05 A;  4XS1 A;  1GRX A;  1NM3 A;  3LG6 A;  4N30 A;  1ML6 A;  2PWJ A;  1F3B A;  3D21 A;  2QA2 A;  1YEX A;  4ZB6 A;  4X43 A;  4MJA A;  1HQO A;  4MK3 A;  4IQ1 A;  2DJ2 A;  5HFI A;  4K7I A;  4IW9 A;  3LWA A;  1Q4J A;  3FK8 A;  1OC9 B;  2LUS A;  4D73 A;  2PPT A;  2WCI A;  4GSS A;  3VFI A;  2P31 A;  3ZML A;  1OAZ A;  1OC9 A;  5IIZ A;  1LU4 A;  5G5F A;  3I69 A;  4ZB8 A;  2HZE B;  3ED3 A;  1B9Y C;  2V6K A;  1WJK A;  3P7X A;  5J9C A;  3DD3 A;  5EY6 A;  2F3M A;  2HNL A;  3E3E A;  4POM A;  4BVX B;  4K2X A;  2FY6 A;  2JSZ A;  4FH8 A;  1DUG A;  4BVX A;  5HFK A;  1I5G A;  4AF2 A;  5ECH B;  1OE7 A;  4LL1 B;  3F6F A;  1GSF A;  1K3Y A;  2H6Z A;  3EMX A;  1G6Y A;  5CRW A;  3Q18 A;  4EC0 A;  2V2G A;  4EE0 A;  3MYD A;  3M1G A;  3I9V 2;  4ZB9 A;  3WT1 A;  5G30 A;  5CRD A;  1X5D A;  2I1U A;  1K0N A;  4Q5R A;  2HSM A;  2H76 A;  3UAR A;  4LMW A;  1ZGN A;  3FR9 A;  3KTL A;  3GL5 A;  3HY2 A;  2DIZ A;  1AAZ A;  1OKD A;  2CA8 A;  1ZYP A;  3P2A A;  5DAL B;  5F0G A;  2A4V A;  4PGT A;  2RM5 A;  4IQA A;  2H1A A;  3W6G A;  2V32 A;  3A2V A;  2AYT A;  1TRW A;  17GS A;  3GMF A;  5ECO B;  2GSQ A;  4V2N A;  2GSR A;  4KCE A;  4WBJ A;  2IFQ A;  1GSY A;  1YQ1 A;  2HSH A;  2LQQ A;  1SK0 A;  3ZYW A;  3FKF A;  2NDO A;  1F9M A;  2VD1 A;  1AW9 A;  1PL1 A;  2BJX A;  4GWR A;  4ML1 A;  2E2M A;  4EDY A;  2JAC A;  2KHP A;  4IP1 A;  3N5O A;  1GSS A;  2GT6 A;  2OE1 A;  3FRC A;  5GST A;  2HT9 A;  3KH9 A;  2B5X A;  1J08 A;  1T4Z A;  3IDV A;  2QSI A;  2VIM A;  2XHF A;  4JR6 A;  2TIR A;  4ZL9 A;  2QGV A;  1TKD B;  2TRX A;  5DJM A;  2PVO C;  1X9W B;  2CVK A;  1EEM A;  4LMV A;  4YQU A;  4XRA A;  4G9H A;  1JZR A;  2BTO T;  2H70 A;  2V6O A;  3F4T A;  2DMM A;  2FUG 2;  4MDC A;  2DJ3 A;  3PH9 A;  4XTS A;  1GL8 A;  4V1A p;  5B7C A;  2X49 A;  1PD2 1;  4PNG A;  4KSM A;  2VLV A;  3TRX A;  16GS A;  1GUK A;  2C0E A;  3PPU A;  3D6I A;  3GKK A;  2B6M A;  2HRN A;  3U6V A;  4KDU A;  3F8U A;  1FW1 A;  2M72 A;  2C0G A;  1N2A A;  3ME8 A;  5DAK B;  3CTF A;  3VPQ A;  5DAK A;  1S3D A;  2X99 A;  3UJ1 A;  2DKH A;  3KXO A;  3GFK A;  5IO0 A;  1AC1 A;  2WB9 A;  1KBN A;  3D5J A;  3AY8 A;  2HI7 A;  3IHG A;  3LGC A;  1PX7 A;  2N5F A;  4MAB A;  4CDO A;  4NV5 A;  1SD9 A;  2X8G A;  3P8W A;  3GKM A;  1R5P A;  3EC3 A;  1G0T A;  4NAX A;  1GTI A;  3GX8 A;  1XWG A;  3FY7 A;  3QMX A;  4NPB A;  2LJK A;  2JZT A;  1GTA A;  3IRA A;  2L4Q A;  2KLX A;  6GSX A;  2VD0 A;  3KMN A;  4I6X A;  4HJM A;  1NSW A;  3ZMK A;  1WPI A;  1SL2 B;  4OCF A;  3LQ7 A;  2WRT A;  2LS5 A;  3HVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...