3JCML

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
SVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDIDEVSDFDEMYELTDPMTVMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDYNHKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 28
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF02966 DIM1 Mitosis protein DIM1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3jcmL00
1MDIA 3TKSE 2QSIA 1PKZA 1B48A 2IFQA 1TDIA 3UARA 4X0XA 1LBKA 3A2WA 5A4UA 1VF1A 20GSA 5G30A 2YN1A 1K0DA 2VM1A 4GWRA 1GTAA 3CXGA 3ERWA 2J9HA 2C4JA 3HJPA 3LYKA 3FYGA 2L5OA 1G6YA 1SJZA 4ULXA 3WYWA 1C72A 3TJBA 4KB3A 2IN3A 4WR4A 3MDKA 2H19A 1UC7A 4XRAA 1JZWA 5G1KA 1ZL9A 2K6VA 3DMLA 4Z7XA 1KEBA 2LV3A 2H6ZA 6GSSA 4J57E 3GUSA 2B1LA 3FZ5A 1TRSA 4ZB8A 3UVHA 1BG5A 3HY2A 1EP7A 2YWOA 7GSSA 3VPQA 2YANA 2O89A 4K0NA 2CT6A 3VWUA 4KDXA 2JZRA 1R5PA 1GP1A 3KXOA 3VK9A 1EOHA 1FVJA 3HVXA 1W4VA 3HYPA 3PR8A 4NWYA 5HR0A 5F07A 1I9DA 3CTGA 3R2QA 2ZCTA 3UBKA 5GSSA 2DLXA 5HR3A 1M7TA 1AUCA 1ZOFA 2B1KA 3APOA 2VLVA 1ABAA 2ES7A 4P3YB 2X64A 3RHCA 3MWHA 2NPBA 2XBQA 1M2BA 3UOMA 5J41A 5E4WA 4HEA2 1YQ1A 1V57A 1ACVA 1YF0A 4DSSA 4PXOA 3IK9A 4TR4A 3TCOA 2HE3A 2FCHA 3DWVA 4YQVA 1MDKA 2C1YA 3V1WA 1Q98A 2IJYA 2X8CA 1A8LA 1IYHA 1PL2A 1XWBA 2H76A 1VF4A 5GAPD 1YF1A 4O32A 2B3SA 3PGTA 4TXOB 2LUSA 4HOJA 5IO2A 2FWHA 4F9ZA 1X0RA 4ML6A 3A2VA 2X99A 5DALB 3BCKA 1AXDA 3GV1A 3HVVA 5AIVA 3GH6A 3QPMA 2V6OA 3UVTA 3QFAC 2CVBA 2KLXA 5A4VA 1LJRA 2E2MA 1U88A 1A23A 3LJRA 5B7CA 3CSHA 3TKPA 1MD4A 1BX9A 2VCTA 3NZNA 1LU4A 1QQ2A 3HCZA 4FYCA 4MJEA 3P90A 5D9VA 4TR1B 1F2EA 2IWTA 1USBA 5HFGA 3VWWA 5CYYA 5IMCA 5IOWA 5ID2B 4XS4B 4J56E 5IMDA 1M9BA 1OYJA 4K9ZA 1SKRB 4XS6A 2G2QA 1XFLA 3UMAA 3FZ4A 4WEYA 4OD7A 2BJXA 4F0BA 4ZILA 4ISDA 1MD3A 1O7UA 2YWMA 2R5GA 1R5AA 14GSA 3TRQA 3ZITA 3BOAA 2PWJA 3H4KA 1SL1B 4TKYA 2ZNMA 3DRNA 4EUYA 3GA4A 3FW2A 1RQMA 5F0GA 5EL8A 5HFKA 3ZRDA 2KP1A 4ZB9A 2ON7A 5ECPB 4YQMA 1O81A 4AJ8A 4BWSA 2G0FA 5DBQA 3J7Yb 13GSA 4KCEA 1A0RP 3ERFA 1BAYA 3ISOA 4ZB6A 3EURA 4K0GA 4E8EA 3RBTA 5D9TA 3GX8A 5AN1A 2H1BA 1UVZA 5F06A 2CAQA 2LJKA 4GXZA 1F9MA 4KNDA 3KMOA 1TK8B 3F9UA 1NHOA 2AUVA 2IIYA 3I9V2 2P31A 3CSIA 3VLNA 5F8BA 1T4ZA 3QFBC 4TXOA 4ML1A 1ZYQB 2FHEA 4ILFA 4CW9A 6GSXA 2B5EA 3DXBA 2H72A 3IR4A 2DBCA 2H6XA 5ELGA 4HQSA 2VD1A 5IPHA 5H5SA 3GURA 1HNBA 2HLSA 2HNLA 1XW6A 1S3DA 2RM5A 3D5JA 3GKXA 5AGYA 2OADA 5H5QA 4MPGA 1G0TA 5F05A 1W89A 2HI7A 5JWRB 1YEXA 3O6TA 2GDRA 2MMNA 1U3IA 2FLSA 2VIMA 4V2LA 2LEGA 4JR6A 5ID2A 4MZBA 1WJKA 4XS4A 5JCUA 1FW1A 3D6IA 3FKFA 3C7MA 5ELAA 4BPYA 3QCPA 3GL3A 4TN8A 1PMTA 2YNXA 1GLPA 1TXXA 5IQYA 4XCSA 4JR4A 1AQXA 3N5OA 5DAKB 5GSTA 4GLTA 3EMXA 3CTFA 2H1AA 2HZFA 2E7PA 2GZYA 2VL2C 3DD3A 4HZ4A 5CO3A 3LWAA 1N2AA 5LD0A 4JE1A 2HFDA 3MNGA 3IK7A 3VI7A 3U5RE 4TVEA 2VCWA 5IMFA 3UIWA 5J5NA 2MMOA 2VCXA 3TOUA 2IFQB 4TR3A 3L78A 4ACSA 1GTUA 1HD2A 4ZL7A 5KEJA 1GSQA 2WJUA 4I8BA 3G7JA 2FGXA 1GULA 5COHA 4NV5A 4RQXA 4AGSA 4EDYA 3WGEA 2XHFA 3F0IA 5ECOB 3F63A 3MSZA 4MP4A 5ECRB 2VL3A 2F51A 2C3QA 5ECNB 1S3CA 2F8AA 2YJ7A 4JU5A 2B7KA 2IMIA 3VPTA 4DSRA 2WS2A 4AF2A 3E0UA 3KZQA 4YQUA 2I1UA 16GSA 5J9CA 4MDCA 1Z7RA 2C0DA 3ZLPA 1EEJA 1PSQA 4N10A 2V1MA 2F3MA 1Q4JA 3F8UA 4F03A 4J2FA 3FY7A 4F82A 3HZ8A 2CZ2A 5ECKB 4PX1A 5IMVA 3PH9A 3HXSA 4EDZA 5GAND 3GRXA 2AV4A 3BBYA 2R4VA 4POBA 3DIEA 3GTUB 3Q18A 3GH9A 1FB6A 2YWIA 3L4NA 2MYGA 3EU3A 2M80A 2KP2A 4HJMA 4EE0A 3KP8A 4MH3A 1Z3EA 1XIYA 1CQGA 4GRFA 1XPVA 3IAS2 2JZTA 1THXA 4KGIA 2OA7A 4KSOA 1G7OA 3BJ5A 5E59A 4HI7A 3Q19A 1A2MA 1KBNA 1ZZYA 1GSSA 4K1FA 4DSSB 1Z9HA 4ZIJA 1B9YC 4E8HA 2A2RA 4I6XA 4G10A 5B8AA 4WBJA 2NBSA 2YOIA 4GF0A 3QAWA 4FYUA 1RW1A 4X1UA 1VF2A 4ZBBA 2JU5A 5DQYA 5ECQB 5G1LA 3FHKA 2C80A 1QFNA 2LRTA 4NXIA 1EP8A 5ECIB 5CNWA 1TW9A 2YV9A 3EU4A 3GYKA 4JEDA 2LSTA 2VL2A 5L71A 4K7NA 2WB9A 1G6WA 5FT3A 3IE3A 4N0ZA 5AIXA 3GSTA 4POKA 1VF3A 4L0UA 22GSA 3KM6A 3EYTA 1EOGA 2YZUA 2H66A 2OBIA 3UBLA 1V9WA 4IQ1A 4ECBA 3HKRA 1GSEA 1K0MA 2OACA 3GFKA 4Q5NA 1ZYEA 2LQOA 3D22A 4BVXA 2H8LA 1ZGNA 1XW9A 2JADA 3C71A 2N5AA 5IO0A 4BWQA 2H74A 4Q5RA 2O8VB 4QL7A 2E0QA 1SJIA 3GKNA 2C8UA 1XOAA 4N0VA 2NTOA 1PL1A 3ZIJA 4OO4A 1R26A 3C1RA 3GTUA 4D73A 1ERTA 1TK0B 1XWCA 2FWFA 1FAAA 2B6MA 3EE2A 1GTBA 4MH2A 1TK5B 3U6VA 2JSYA 2L6CA 4LMWA 4MF5A 5D96A 4MMMA 3F4RA 4MF6A 2CV4A 2R3XA 3IXRA 2CVKA 4HQZA 3H93A 3GL5A 1DSBA 5ENUA 4EXJA 4H86A 2WGRA 4IW9A 1TOFA 3LORA 4KH7A 3E3EA 2YV7A 1THOA 3A5WA 3LEFA 2GTUA 3PINA 2EIRA 1PD21 1OKDA 5CRDA 3M1GA 2IMFA 4NHWA 1GWCA 12GSA 3GKMA 3ZFLA 5INYA 2OE3A 2DJ0A 2NVLA 3VFIA 1YKAA 5DQSA 3UL3A 1FO5A 3O3TA 2YZHA 4MPFA 3IDVA 4PQ1A 2F9SA 3KIJA 3P2AA 4MA9A 3WGXA 3CSJA 5ABRA 2WRTA 5ECHB 4OO5A 5JWQB 3DGQA 4PUFC 2P0GA 2TRCP 4TXVA 2FWEA 4PNGA 4O5RA 1B9XC 1E6BA 3LXZA 2FWGA 2V41A 2PMTA 4IVFA 4I97A 4KCAA 2HRNA 3F3QA 1TRWA 3P7XA 4LLRA 2H0GA 1U3AA 1WE0A 4GSTA 4BVYA 5CAXA 5DJMA 5DDLA 1H75A 1PRXA 1O73A 1XWGA 2L6DA 1OC3A 3FRCA 1XVWA 1EZKA 3A2XA 2K18A 3BCIA 2VUPA 1GUMA 4L0WA 1NW2A 4X43A 1SL2B 1YKCA 2DC5A 2VCVA 4Q5QA 1XCCA 1SKWB 3FK8A 2H73A 1BYEA 3L0HA 3TKRA 1X9WB 4NV2A 1WMJA 1AQVA 2C0EA 2D2ZA 1SK2A 3LYPA 4IHUA 2MMZA 2IL3A 5DCHA 4MJAA 4GTUA 2RUEA 1MEKA 1NM3A 2FUG2 2YJHA 2VD0A 1O6JA 3IHQA 1XOBA 2H01A 3E9JB 2O7KA 4EVMA 4G19A 4KW6A 2DJ2A 3QMXA 1R4WA 1EV9A 1ON4A 1DBYA 2PBJA 2O87A 3ZFBA 2M46A 3RPNA 2H1DA 5HR2A 2CQ9A 2OE1A 3W8JA 2PVQA 4V1Ag 2HXKA 2LQQA 2LRCA 4KA0A 1PA3A 2AYTA 3JCML 2FA8A 1V98A 1JZOA 2GSQA 1J9BA 2I9HA 3QOUA 4MZWA 3WT1A 3ME8A 2I81A 2LTKA 1JLWA 3TB2A 11GSA 3F6DA 3I43A 3ZZXA 6GSWA 1MTCA 4ZXGA 5G2ZA 1K0CA 3ZMLA 1T1VA 18GSA 2IMKA 3GSSA 4HU7A 3VWVA 4YAVA 1XVQA 5J9BA 2R6KA 4TW5A 1XBSA 4PQIA 3KTBA 5IOXA 5B6NA 2C0FA 3ZVJA 1K3OA 3D21A 2WDUA 4JZQA 4I5QA 5AISA 4LL1B 2YPMA 1GSFA 4LL4B 3A3TA 4RI6A 5A4WA 3GMFA 3CYNA 10GSA 2GZPA 3IRAA 4BA7A 6GSYA 1T3BA 1T4YA 2KUCA 4FH8A 1KNGA 2QKEA 1XXUA 3HHVA 3TRPA 1MDJA 4MZCA 2IPAA 1X5EA 4RI7A 2V6KA 3HVSA 2XC2A 4AJ7A 4WKWA 4ZBDA 1ML6A 1SKSB 2K8VA 1WOUA 5J3RA 1EEMA 4FIWA 2DJKA 1X5DA 5G31A 2XPDA 1YEPA 2JL4A 4ZBAA 2QGVA 4ECCA 4WF5A 2AHEA 3H8QA 3FR3A 1T8EB 4XS1A 1ERWA 1SENA 2GQKA 1K0OA 4F0CA 4CHSA 3DVXA 2N5BA 2O85A 3WT2A 5KN3A 3O76A 4IS0A 1B4PA 3QR6A 3Q6OA 5FWGA 2KOKA 2CAIA 2PN8A 2WCIA 1TP9A 3GX0A 1UN2A 3GHAA 2P5RA 1M99A 3IOSA 3F6FA 4I2TA 1A8YA 4WBRD 1SYRA 6GSUA 1HQOA 2GT5A 2LNSA 4MF7A 3GNJA 4EL1A 3KMNA 1DE1A 5B8BA 5EVOA 1TI1A 3RAZA 2OKAA 4D73B 2X8HA 3K8NA 2AJQB 4TR0A 2I4AA 4CDOA 3GIXA 2PERA 4TOPA 2OJLA 3ERGA 3FEUA 3DEXA 5DCGA 1K0AA 3F4TA 5IMAA 1EGOA 1GTIA 3KCMA 2H1GA 4ECIA 4HJ2A 2RM6A 3ZL5A 1M9AA 2H71A 1A2LA 6GSTA 3OR5A 3ZTLA 4LA1A 5JCWA 3IA1A 3KTLA 2VM2A 2GZZA 5LCZA 3N9JA 2X8GA 1NSWA 1ST9A 2VLTA 2N5FA 1V40A 2DIYA 3TOTA 5IIZA 1YDKA 3EINA 3ZIVA 3LQ7A 5KN0A 3TJKA 4KUNA 4JRRA 2CA8A 3KD0A 2HT9A 2H0HA 4Q5FA 1X5CA 3VURA 1WRYA 4V2NA 4IP1A 5C00A 4PUAA 5IMZA 1T7PB 2VO4A 4HZ2A 1R7HA 4XRDA 2EIQA 4MLYA 2CVDA 1S3AA 2HRFA 1HNAA 3LXTA 4YH2A 4V1Ap 4IQAA 3TKQA 1X9SB 4O7HA 3J7Yk 2LJRA 2DIZA 2XPEA 4NAXA 3M8NA 3SWLA 2M72A 3HD5A 5J4UA 4FO5A 17GSA 5B6MA 2CZ3A 3WD6A 1F37A 4ZL9A 4RQRA 5KN2A 2PU9C 4OCFA 2LJAA 5D73A 1Y25A 3CRUA 5IPGA 1OE7A 5GZZB 3DKSA 4FYBA 3ZREA 1BEDA 1JZRA 4HDEA 5FHIA 2NDOA 2DJJA 5H5RA 4MCUA 1WWJA 3TKSA 1BJXA 3FR6A 1BQ7A 2IMDA 5CRGA 2H0IA 3QAVA 5ECMB 3HJOA 1A24A 3C8EA 1HYUA 1EV4A 3M9KA 4L5LA 4HU9A 4IBPA 2ON5A 1H4OA 2PGTA 1A2JA 3LSZA 2VAFA 1TTZA 1XWAA 3EVIA 1X9MB 4OWYA 1PX7A 3NIVA 1B8XA 5CP1A 5DVBA 1M2DA 1PX6A 2H30A 4OMVA 4EO3A 2Z9SA 1DE2A 1SK1A 4GCIA 2JZSA 4MJBA 2EC4A 2HZEA 3G7YA 1OC8A 3EWLA 4K8MA 4GQCA 2C3NA 3ZMKA 3KJYA 4ID0A 5EY6A 6GSVA 1CQHA 2MBTA 3UEMA 3M0FA 3RPPA 1T00A 3WGDA 1DUGA 4POLA 1GSUA 4HUAA 3CMIA 2MBSA 2E2GA 2DMLA 5EPFA 5JCGA 2EIOA 1SYXA 2ZUPA 3KEBA 3TJFA 2AAWA 2XBIA 3H79A 2OE0A 3IBHA 1SD8A 1GUKA 5ECSA 2PUKC 1SJ6A 2GVPA 2PPTA 2R2JA 2MZCA 3G9BA 1K3LA 4GSSA 1GLQA 2FA4A 1QXHA 2ALBA 2B5XA 3F3RA 3DVWA 1JLVA 4POMA 2AB6A 4KSMA 1SU9A 3IC4A 3NOFA 4L8EA 1ILOA 4K2DA 3Q74A 1EGRA 2YCDA 3TDGA 5HFIA 4HS1A 1FVKA 1AW9A 1AIUA 4IJIA 2PVOC 4XTSA 1Z6MA 1XWKA 2RUFA 4OFMA 1NHYA 1M2AA 3SBCA 1U6TA 4KX4A 3FZ9A 3M3MA 1URMA 2I3YA 2K9FA 1JZDA 3D0ZA 1EWXA 1SD9A 4OFNA 1TU8A 4KAEA 2HSYA 1TJDA 1TU7A 19GSA 3D4MA 4OCEA 3QD9A 2GGTA 1A0FA 3UAPA 2GS3A 3APSA 1J0FA 3KP9A 5HQPA 2LKUA 3G7IA 2RIIA 1FHEA 1Z6NA 2DMMA 4BL7A 4IKHA 4KDUA 3VI5A 3RHBA 1GSDA 2H6YA 1JHBA 1GSYA 4L5OA 1PKWA 5CRWA 1U87A 1K0NA 4PNFA 4EF0A 2DSAA 2GSRA 5G5FA 5LNKe 5ECLB 1ERVA 5D8IA 2LNTA 2L4CA 5IM9A 3APQA 2FNOA 1HNCA 2L57A 1PN9A 1I5GA 1VGLA 2YWNA 2J23A 4TRXA 2L5LA 3KGKA 3L9SA 3TJJA 3I6AA 5DALA 4N30A 4MABA 3FZAA 3S9FA 2BMXA 1FOVA 3BD2A 2OBKA 4XHMA 2FD3A 2TRXA 2K8SA 3KH7A 4WXTA 2GLRA 4NMUA 3ZYWA 1TI3A 5C04A 4NHZA 2WFCA 4O92A 2GSTA 2H75A 1SK0A 4RUVA 1O85A 2HSHA 2L59A 3HA9A 4TR1A 2F8FA 4WETA 4WR5A 2JACA 4OFTA 2GQMA 1ERUA 5A5KA 1Z7PA 2VOCA 1KTEA 3DYRA 2B5YA 1YY7A 3IV4A 3H1NA 4V2MA 2WULA 4IN0A 2C0GA 1WPIA 2L4QA 4QL9A 2R37A 4G2EA 2H70A 3HJMA 5CREA 2A4VA 3IAM2 4DEJA 1PQNA 3HDCA 4AJ6A 1OE8A 1OC9B 4PQHA 3TGZA 2CX4A 2CX3A 3EMPA 2V2GA 1J08A 3C73A 4KDYA 4K7OA 2B7JA 4DVCA 1IYIA 4ECJA 3LG6A 1GH2A 1F6MC 4IJ3A 2GT6A 4KE3A 2IMEA 3HZ4A 1E2YA 1QMVA 3KH9A 3I69A 1Y6EA 3W8SA 4K6XA 1V2AA 4I2UA 1JFUA 1M0UA 2MMAA 2DJ1A 1OKTA 2GSSA 3LGCA 4JBBA 2REMA 1GNWA 1OVNA 1TRVA 1AAZA 2P5QA 5KN1A 4IP6A 1F3BA 1YJ6A 9GSSA 1AC1A 2VLUA 3ME7A 1QK8A 2GQLA 3US3A 1WP0A 3MAKA 3IPZA 2FY6A 3TRXA 5G5EA 3TKSC 1ZMAA 2RLIA 3CRTA 4QQ7A 4N11A 4WF4A 3UJ1A 3L9UA 2YP6A 3W6GA 4ZL8A 1QUWA 2VCQA 1QGVA 4G9HA 3EC3A 3C1SA 5CRHA 3L9VA 3RDWA 4LMVA 4NPBA 1PGTA 1FG4A 1TKDB 4PGTA 4GSNA 1XW5A 4IGJA 3VWXA 4F2IA 1V58A 1XZOA 1GRXA 1N8JA 4XIHA 3ZVJD 1Z5YE 2BTOT 2KHPA 2WZ9A 3P8WA 5D93A 4DSQA 1RK4A 1F3AA 2VCZA 4YAPA 4IELA 4PURA 1AQWA 1OAZA 3QDNA 1G7EA 2VL9A 4MJCA 3D4TA 3F4SA 5D9XA 3AY8A 3TUEA 2LS5A 1OC9A 4K7IA 1SL0B 3GN3A 5DJLA 2C3TA 1TRUA 5HR1A 2A2SA 5DAKA 2HYXA 2LRNA 1VRSD 4EKZA 2V32A 1O8WA 2HZEB 1UA5A 1K0BA 3CBUA 5D9WA 2DJ3A 5JWOB 2TIRA 1O8XA 3TJGA 3QAGA 3M9JA 1WIKA 8GSSA 1GUHA 1ZCPA 3GKKA 1GNEA 3LFLA 3FR9A 4GQFA 1B4QA 1YZXA 2JSZA 3ED3A 4EC0A 1GL8A 1K3YA 4MK3A 2QC7A 1FB0A
chains in the Genus database with same CATH superfamily
1MDIA 3TKSE 2QSIA 1PKZA 1B48A 2IFQA 1TDIA 3UARA 4X0XA 1LBKA 3A2WA 3EPTA 5A4UA 1VF1A 20GSA 5G30A 2YN1A 1K0DA 2VM1A 4GWRA 1GTAA 3CXGA 3ERWA 2J9HA 2C4JA 3HJPA 3LYKA 3FYGA 2L5OA 1G6YA 1SJZA 4ULXA 3WYWA 1C72A 3TJBA 4KB3A 2IN3A 3IHGA 4WR4A 3MDKA 2H19A 1UC7A 4XRAA 1JZWA 5G1KA 1ZL9A 2K6VA 4YKFA 3DMLA 4Z7XA 1KEBA 2LV3A 2H6ZA 6GSSA 4J57E 3GUSA 2B1LA 3FZ5A 1TRSA 4ZB8A 3UVHA 1BG5A 3HY2A 1EP7A 2YWOA 7GSSA 3VPQA 2YANA 2O89A 4K0NA 2CT6A 3VWUA 4KDXA 2JZRA 1R5PA 1GP1A 4G0IA 3KXOA 3VK9A 1EOHA 2HRAA 1FVJA 3HVXA 1W4VA 3HYPA 3PR8A 4NWYA 5HR0A 5F07A 1I9DA 3CTGA 3R2QA 2ZCTA 3UBKA 5GSSA 2DLXA 3FMWA 5HR3A 1M7TA 4A5PA 1AUCA 1ZOFA 2B1KA 3APOA 2VLVA 1ABAA 2ES7A 4P3YB 2X64A 3RHCA 3MWHA 2NPBA 2XBQA 1M2BA 3UOMA 5J41A 5E4WA 4HEA2 1YQ1A 1V57A 1ACVA 2HRKA 1YF0A 4DSSA 4EIQA 4PXOA 3IK9A 4TR4A 3TCOA 2HE3A 2FCHA 3DWVA 4YQVA 1PN0A 1MDKA 2C1YA 3V1WA 1Q98A 2IJYA 2X8CA 1A8LA 1IYHA 1PL2A 1XWBA 2H76A 1VF4A 5GAPD 1YF1A 4O32A 2B3SA 3PGTA 4TXOB 2LUSA 4HOJA 5IO2A 2FWHA 4F9ZA 1X0RA 4ML6A 3A2VA 2X99A 5DALB 3BCKA 1AXDA 3GV1A 3HVVA 5AIVA 3GH6A 3QPMA 2V6OA 3UVTA 3QFAC 2CVBA 2KLXA 5A4VA 1LJRA 2E2MA 1U88A 1A23A 3LJRA 5B7CA 2X49A 3CSHA 3TKPA 1MD4A 1BX9A 2VCTA 3NZNA 1LU4A 1QQ2A 3HCZA 4FYCA 4MJEA 3P90A 5D9VA 4TR1B 1F2EA 2IWTA 1USBA 5HFGA 3VWWA 2QA1A 5CYYA 5IMCA 5IOWA 5ID2B 4XS4B 4J56E 5IMDA 1M9BA 1OYJA 4K9ZA 1SKRB 4XS6A 2G2QA 1XFLA 3UMAA 3FZ4A 4WEYA 4OD7A 2BJXA 4F0BA 4ZILA 4ISDA 1MD3A 1O7UA 2YWMA 3HVNA 2R5GA 1R5AA 14GSA 3TRQA 3ZITA 3BOAA 1ZYNA 2PWJA 3H4KA 1SL1B 4TKYA 2ZNMA 3DRNA 4EUYA 3GA4A 3FW2A 1RQMA 5F0GA 5EL8A 5HFKA 2R0GA 3ZRDA 4ICYA 2KP1A 4ZB9A 2ON7A 5ECPB 4YQMA 1O81A 4AJ8A 4BWSA 2G0FA 5DBQA 3J7Yb 13GSA 4KCEA 1A0RP 3ERFA 1BAYA 3ISOA 4ZB6A 3EURA 4K0GA 4E8EA 3RBTA 5D9TA 3GX8A 5AN1A 2H1BA 1UVZA 5F06A 2CAQA 2LJKA 4GXZA 1F9MA 4KNDA 3KMOA 1TK8B 3F9UA 1NHOA 2AUVA 2IIYA 3I9V2 2P31A 3CSIA 3VLNA 5F8BA 1T4ZA 3QFBC 4TXOA 4ML1A 1ZYQB 2FHEA 4ILFA 4CW9A 6GSXA 2B5EA 3DXBA 2H72A 3IR4A 3IC8A 2DBCA 2H6XA 5ELGA 4HQSA 2VD1A 5IPHA 5H5SA 3GURA 1HNBA 2HLSA 2HNLA 1XW6A 1S3DA 4Z2UA 2RM5A 3D5JA 3GKXA 5AGYA 2OADA 5H5QA 4MPGA 1G0TA 5F05A 1W89A 2HI7A 5JWRB 1YEXA 3O6TA 2GDRA 2MMNA 1U3IA 2FLSA 2VIMA 4V2LA 2LEGA 4JR6A 5ID2A 4MZBA 1WJKA 4XS4A 5JCUA 1FW1A 3D6IA 3FKFA 3C7MA 5ELAA 4BPYA 3QCPA 3GL3A 4TN8A 1PMTA 2YNXA 1GLPA 1TXXA 5IQYA 4XCSA 4JR4A 1AQXA 3N5OA 5DAKB 5GSTA 4GLTA 3EMXA 3CTFA 2H1AA 2HZFA 2E7PA 2GZYA 2VL2C 3DD3A 4HZ4A 5CO3A 3LWAA 1N2AA 5LD0A 4JE1A 2HFDA 3MNGA 3IK7A 4CY8A 3VI7A 3U5RE 4TVEA 2VCWA 5IMFA 3UIWA 5J5NA 2MMOA 2VCXA 3TOUA 2IFQB 4TR3A 4USSA 3L78A 4ACSA 1GTUA 1HD2A 4ZL7A 5KEJA 1GSQA 2WJUA 4I8BA 3G7JA 2FGXA 1GULA 5COHA 4NV5A 4RQXA 4AGSA 4EDYA 3WGEA 2XHFA 3F0IA 5ECOB 4Z2RA 3F63A 3MSZA 4MP4A 5ECRB 2VL3A 2F51A 2C3QA 5ECNB 1S3CA 2F8AA 2YJ7A 4JU5A 2B7KA 2IMIA 3VPTA 4DSRA 2WS2A 4AF2A 3E0UA 3KZQA 4YQUA 2I1UA 16GSA 5J9CA 4MDCA 1Z7RA 2C0DA 3ZLPA 1EEJA 1PSQA 4N10A 2V1MA 2F3MA 1Q4JA 3F8UA 4F03A 4J2FA 3FY7A 4F82A 3HZ8A 1ZYPA 2CZ2A 5ECKB 4PX1A 5IMVA 3PH9A 3HXSA 4EDZA 5GAND 3GRXA 2AV4A 3BBYA 2R4VA 4POBA 3DIEA 3GTUB 3Q18A 3GH9A 1FB6A 2YWIA 3L4NA 2MYGA 3EU3A 2M80A 2KP2A 4HJMA 4EE0A 3KP8A 4MH3A 1Z3EA 1XIYA 1CQGA 4GRFA 1XPVA 3IAS2 2JZTA 1THXA 4KGIA 2OA7A 4KSOA 1G7OA 3BJ5A 5E59A 5KOWA 4HI7A 3Q19A 1A2MA 1KBNA 1ZZYA 1GSSA 4K1FA 4DSSB 1Z9HA 4ZIJA 1B9YC 4E8HA 2A2RA 4I6XA 4G10A 5B8AA 4WBJA 2NBSA 2YOIA 4GF0A 3QAWA 4FYUA 1RW1A 4X1UA 1VF2A 4ZBBA 2JU5A 5DQYA 5ECQB 5G1LA 3FHKA 2C80A 1QFNA 2LRTA 4NXIA 1EP8A 5ECIB 5CNWA 1TW9A 2YV9A 3EU4A 3GYKA 4JEDA 2LSTA 2VL2A 5L71A 4K7NA 2WB9A 1G6WA 5FT3A 3IE3A 4N0ZA 5AIXA 3GSTA 4POKA 1VF3A 4L0UA 22GSA 3KM6A 3EYTA 1EOGA 2YZUA 2H66A 2OBIA 3UBLA 1V9WA 4IQ1A 4K5RA 4ECBA 3HKRA 1GSEA 1K0MA 2OACA 3GFKA 4Q5NA 1ZYEA 2LQOA 3D22A 4BVXA 2H8LA 1ZGNA 1XW9A 2JADA 3C71A 2N5AA 5IO0A 1S3RA 4BWQA 2H74A 4Q5RA 2O8VB 4QL7A 2E0QA 1SJIA 3GKNA 2C8UA 1XOAA 4N0VA 2NTOA 1PL1A 4KF9A 3ZIJA 4OO4A 1R26A 3C1RA 3GTUA 4D73A 1ERTA 1TK0B 2R0CA 1XWCA 2FWFA 1FAAA 2B6MA 3EE2A 1GTBA 4K2XA 4MH2A 1TK5B 3U6VA 4O5QA 2JSYA 2L6CA 4LMWA 4MF5A 5D96A 4MMMA 3F4RA 4MF6A 2CV4A 2R3XA 3IXRA 2CVKA 4HQZA 3H93A 3GL5A 1DSBA 2HSMA 5ENUA 4EXJA 4H86A 2WGRA 4IW9A 1TOFA 3LORA 4KH7A 3E3EA 2YV7A 1THOA 3A5WA 3LEFA 2GTUA 3PINA 2EIRA 1PD21 1OKDA 5CRDA 3M1GA 2IMFA 4NHWA 1GWCA 12GSA 3GKMA 3ZFLA 5INYA 2OE3A 2DJ0A 2NVLA 3VFIA 1YKAA 5DQSA 3UL3A 1FO5A 3O3TA 2YZHA 4MPFA 3IDVA 4PQ1A 2F9SA 3KIJA 3P2AA 4MA9A 3WGXA 3CSJA 5ABRA 2WRTA 5ECHB 4OO5A 5JWQB 3DGQA 4PUFC 2P0GA 2TRCP 4TXVA 2FWEA 4PNGA 1FOHA 4X4JA 4O5RA 1B9XC 1E6BA 3LXZA 2FWGA 2V41A 2PMTA 4IVFA 4I97A 4KCAA 2HRNA 3F3QA 1TRWA 3P7XA 4LLRA 1M3JA 2H0GA 1U3AA 1WE0A 4GSTA 4BVYA 5CAXA 5DJMA 5DDLA 1H75A 1PRXA 1O73A 4EIPA 1XWGA 2L6DA 1OC3A 3FRCA 1XVWA 3LW9A 1EZKA 3A2XA 2K18A 3BCIA 2VUPA 1GUMA 4L0WA 1NW2A 4X43A 1SL2B 1YKCA 2DC5A 2VCVA 4Q5QA 1XCCA 1SKWB 3FK8A 2H73A 1BYEA 3L0HA 3TKRA 1X9WB 4NV2A 1WMJA 1AQVA 2C0EA 2D2ZA 1SK2A 3LYPA 4IHUA 2MMZA 2IL3A 5DCHA 4MJAA 3MIXA 4GTUA 2RUEA 1MEKA 1NM3A 2FUG2 2YJHA 2VD0A 1O6JA 3IHQA 1XOBA 2H01A 3E9JB 2O7KA 4EVMA 4G19A 4KW6A 2DJ2A 4PTSA 3QMXA 1R4WA 1EV9A 1ON4A 1DBYA 2PBJA 2O87A 3ZFBA 2M46A 3RPNA 2H1DA 5HR2A 2CQ9A 3CQFA 2OE1A 3W8JA 2PVQA 4V1Ag 2HXKA 2LQQA 2LRCA 4KA0A 1PA3A 2AYTA 3JCML 2FA8A 1V98A 1JZOA 2GSQA 1J9BA 2I9HA 3QOUA 4MZWA 3WT1A 3ME8A 2I81A 2LTKA 1JLWA 3TB2A 11GSA 3F6DA 3I43A 3ZZXA 6GSWA 1MTCA 4ZXGA 5G2ZA 1K0CA 3ZMLA 1T1VA 18GSA 2IMKA 3GSSA 4HU7A 3VWVA 4YAVA 1XVQA 5J9BA 2R6KA 4TW5A 1XBSA 4PQIA 3KTBA 5IOXA 5B6NA 2C0FA 3ZVJA 1K3OA 3D21A 2WDUA 4JZQA 4I5QA 5AISA 4LL1B 2YPMA 1GSFA 4LL4B 3A3TA 4RI6A 5A4WA 3GMFA 3CYNA 10GSA 2GZPA 3IRAA 4BA7A 6GSYA 1T3BA 1T4YA 2KUCA 4FH8A 1KNGA 2QKEA 1XXUA 3HHVA 3TRPA 2A4HA 1MDJA 4MZCA 2IPAA 1X5EA 4RI7A 2V6KA 3HVSA 2XC2A 4AJ7A 4WKWA 4ZBDA 1ML6A 1SKSB 2K8VA 1WOUA 5J3RA 1EEMA 3A5IA 4FIWA 2DJKA 1X5DA 5G31A 2XPDA 1YEPA 2JL4A 4ZBAA 2QGVA 4ECCA 4WF5A 2AHEA 3H8QA 3FR3A 1T8EB 4XS1A 1ERWA 1SENA 2GQKA 1K0OA 4F0CA 4CHSA 3DVXA 2N5BA 2O85A 4G0LA 3WT2A 5KN3A 3O76A 4IS0A 1B4PA 3QR6A 3Q6OA 5FWGA 2KOKA 2CAIA 2PN8A 2WCIA 1TP9A 3GX0A 1UN2A 3GHAA 2P5RA 1M99A 4BVXB 3IOSA 3F6FA 4I2TA 1A8YA 4WBRD 1SYRA 6GSUA 1HQOA 2GT5A 4O5UA 2LNSA 4MF7A 3GNJA 4EL1A 3KMNA 1DE1A 5B8BA 5EVOA 1TI1A 3RAZA 2OKAA 4D73B 2X8HA 3K8NA 2AJQB 4TR0A 2I4AA 4CDOA 3GIXA 2PERA 4TOPA 2OJLA 3ERGA 3FEUA 3DEXA 5DCGA 1K0AA 3F4TA 5IMAA 1EGOA 1GTIA 3KCMA 2H1GA 4ECIA 4HJ2A 2RM6A 3ZL5A 1M9AA 2H71A 1A2LA 6GSTA 3OR5A 3ZTLA 4LA1A 5JCWA 3IA1A 3KTLA 2VM2A 2GZZA 5LCZA 3N9JA 2QA2A 2X8GA 1NSWA 1ST9A 2VLTA 2N5FA 1V40A 2DIYA 3TOTA 5IIZA 1YDKA 3EINA 3ZIVA 3LQ7A 5KN0A 3TJKA 4KUNA 4JRRA 2CA8A 3KD0A 2HT9A 2H0HA 4Q5FA 1X5CA 3VURA 1WRYA 4V2NA 4IP1A 5C00A 4PUAA 5IMZA 1T7PB 2VO4A 4HZ2A 1R7HA 4XRDA 2EIQA 4MLYA 2CVDA 1S3AA 2HRFA 1HNAA 3LXTA 4YH2A 4V1Ap 4IQAA 3TKQA 1X9SB 4O7HA 3J7Yk 2LJRA 2DIZA 2XPEA 4NAXA 3M8NA 4FQUA 3SWLA 2M72A 3HD5A 5J4UA 4BVYB 4FO5A 17GSA 5B6MA 2CZ3A 3WD6A 1F37A 4ZL9A 4RQRA 5KN2A 2PU9C 4OCFA 2LJAA 5D73A 1Y25A 3CRUA 5IPGA 1OE7A 5GZZB 3DKSA 4FYBA 3ZREA 1BEDA 1JZRA 4HDEA 5FHIA 2NDOA 2DJJA 5H5RA 4MCUA 1WWJA 3TKSA 1BJXA 3FR6A 1BQ7A 2IMDA 5CRGA 2H0IA 3QAVA 5ECMB 3HJOA 1A24A 3C8EA 1HYUA 1EV4A 3M9KA 4L5LA 4HU9A 4IBPA 2ON5A 1H4OA 2PGTA 1A2JA 3LSZA 4YKGA 2VAFA 1TTZA 1XWAA 3EVIA 4BIKA 1X9MB 4BL7B 4OWYA 1PX7A 3NIVA 1B8XA 5CP1A 5DVBA 1M2DA 1PX6A 2H30A 4OMVA 4EO3A 2Z9SA 1DE2A 1SK1A 4GCIA 2JZSA 4MJBA 2EC4A 2HZEA 3G7YA 1OC8A 3EWLA 4K8MA 2X4AA 4GQCA 2C3NA 3ZMKA 3KJYA 4ID0A 5EY6A 6GSVA 1CQHA 2MBTA 3UEMA 3M0FA 3RPPA 1T00A 3WGDA 1DUGA 4POLA 1GSUA 4HUAA 3CMIA 3R3EA 2MBSA 2E2GA 2DMLA 5EPFA 5JCGA 2EIOA 5KOXA 1SYXA 2ZUPA 3KEBA 3TJFA 2AAWA 2XBIA 3H79A 2OE0A 4CY6A 3IBHA 4MNNA 1SD8A 1GUKA 5ECSA 2PUKC 1SJ6A 2GVPA 2PPTA 2R2JA 2MZCA 3G9BA 1K3LA 4GSSA 1GLQA 1PFOA 2FA4A 1QXHA 2ALBA 3PPUA 2B5XA 3F3RA 3DVWA 1JLVA 4POMA 2AB6A 4KSMA 1SU9A 2UZ8A 3IC4A 3NOFA 4L8EA 1ILOA 4K2DA 3Q74A 1EGRA 2YCDA 3TDGA 5HFIA 4HS1A 1FVKA 1AW9A 1AIUA 4IJIA 2PVOC 4XTSA 1Z6MA 1XWKA 2RUFA 4OFMA 1NHYA 1M2AA 3SBCA 1U6TA 4KX4A 3FZ9A 3M3MA 1URMA 2I3YA 2K9FA 1JZDA 3D0ZA 1EWXA 1SD9A 4OFNA 1TU8A 4KAEA 2HSYA 1TJDA 1TU7A 19GSA 3D4MA 4OCEA 3QD9A 2GGTA 1A0FA 3UAPA 2GS3A 3APSA 1J0FA 3KP9A 5HQPA 2LKUA 3G7IA 2RIIA 1FHEA 1Z6NA 2DMMA 4BL7A 4HSCX 4IKHA 4KDUA 3VI5A 3RHBA 1GSDA 2H6YA 1JHBA 1GSYA 4L5OA 1PKWA 5CRWA 1U87A 1K0NA 4PNFA 4EF0A 3MYDA 2DSAA 2GSRA 5G5FA 5LNKe 5ECLB 1ERVA 5D8IA 2LNTA 2L4CA 5IM9A 3APQA 2FNOA 1HNCA 2L57A 1PN9A 1I5GA 1VGLA 2YWNA 2J23A 4TRXA 2L5LA 3KGKA 3L9SA 3TJJA 3I6AA 5DALA 4N30A 4MABA 3FZAA 3S9FA 5BMUA 2BMXA 1FOVA 3BD2A 2OBKA 4XHMA 2FD3A 4K5SA 2TRXA 2K8SA 3KH7A 4WXTA 2GLRA 4NMUA 3ZYWA 1TI3A 5C04A 4NHZA 2WFCA 4O92A 2GSTA 2H75A 1SK0A 4RUVA 1O85A 2HSHA 2L59A 3HA9A 4TR1A 2F8FA 4WETA 4WR5A 2JACA 4OFTA 2GQMA 1ERUA 5A5KA 1Z7PA 2VOCA 1KTEA 3DYRA 2B5YA 1YY7A 3IV4A 3H1NA 4V2MA 2WULA 4IN0A 2C0GA 1WPIA 2L4QA 4QL9A 2R37A 4G2EA 2H70A 3HJMA 5CREA 2A4VA 3IAM2 4DEJA 1PQNA 3HDCA 4AJ6A 1OE8A 1OC9B 4PQHA 3TGZA 2CX4A 2CX3A 3EMPA 2V2GA 1J08A 3C73A 4KDYA 4K7OA 2B7JA 4DVCA 1IYIA 4ECJA 3LG6A 1GH2A 1F6MC 4IJ3A 2GT6A 4KE3A 2IMEA 3HZ4A 1E2YA 2A2PA 1QMVA 3KH9A 3I69A 1Y6EA 3W8SA 4K6XA 2R0PA 4G0KA 1V2AA 4I2UA 1JFUA 1M0UA 2MMAA 2DJ1A 1OKTA 2GSSA 3LGCA 4JBBA 2REMA 1GNWA 1OVNA 1TRVA 1AAZA 2P5QA 5KN1A 4IP6A 1F3BA 1YJ6A 9GSSA 1AC1A 2VLUA 3ME7A 1QK8A 2GQLA 3US3A 1WP0A 3MAKA 3IPZA 2FY6A 3TRXA 5G5EA 3TKSC 1ZMAA 2RLIA 3CRTA 4QQ7A 4N11A 4WF4A 3UJ1A 3L9UA 2YP6A 3W6GA 4ZL8A 1QUWA 2VCQA 1QGVA 1M3IA 4G9HA 2DKHA 3EC3A 3C1SA 5CRHA 3L9VA 3RDWA 4LMVA 4NPBA 1PGTA 1FG4A 1TKDB 4PGTA 4GSNA 1XW5A 4IGJA 3VWXA 4F2IA 1V58A 1XZOA 1GRXA 1N8JA 4XIHA 3ZVJD 1Z5YE 2BTOT 2KHPA 2WZ9A 3P8WA 5D93A 4DSQA 1RK4A 1F3AA 2VCZA 4YAPA 4IELA 4PURA 1AQWA 1OAZA 3QDNA 1G7EA 2VL9A 4MJCA 3D4TA 3F4SA 5D9XA 3AY8A 3TUEA 2LS5A 1OC9A 4K7IA 1SL0B 3GN3A 5DJLA 2C3TA 1TRUA 5HR1A 2A2SA 5DAKA 2HYXA 2LRNA 1VRSD 4EKZA 2V32A 1O8WA 2HZEB 1UA5A 1K0BA 3CBUA 5D9WA 5BRTA 2DJ3A 5JWOB 2TIRA 1O8XA 4Z2TA 3TJGA 3QAGA 3M9JA 1WIKA 8GSSA 1GUHA 1ZCPA 3GKKA 1GNEA 1XG8A 3LFLA 3FR9A 4GQFA 1B4QA 1YZXA 2JSZA 3ED3A 4EC0A 1GL8A 1K3YA 2DKIA 4MK3A 2QC7A 1FB0A
chains in the Genus database with same CATH topology
1MDIA 3TKSE 2QSIA 1PKZA 1B48A 2IFQA 1TDIA 3UARA 4X0XA 1LBKA 3A2WA 3EPTA 5A4UA 1VF1A 20GSA 5G30A 2YN1A 1K0DA 2VM1A 4GWRA 1GTAA 3CXGA 3ERWA 2J9HA 2C4JA 3HJPA 3LYKA 3FYGA 2L5OA 1G6YA 1SJZA 4ULXA 3WYWA 1C72A 3TJBA 4KB3A 2IN3A 3IHGA 4WR4A 3MDKA 2H19A 1UC7A 4XRAA 1JZWA 5G1KA 1ZL9A 2K6VA 4YKFA 3DMLA 4Z7XA 1KEBA 2LV3A 2H6ZA 6GSSA 4J57E 3GUSA 2B1LA 3FZ5A 1TRSA 4ZB8A 3UVHA 1BG5A 3HY2A 1EP7A 2YWOA 7GSSA 3VPQA 2YANA 2O89A 4K0NA 2CT6A 3VWUA 4KDXA 2JZRA 1R5PA 1GP1A 4G0IA 3KXOA 3VK9A 1EOHA 2HRAA 1FVJA 3HVXA 1W4VA 3HYPA 3PR8A 4NWYA 5HR0A 5F07A 1I9DA 3CTGA 3R2QA 2ZCTA 3UBKA 5GSSA 2DLXA 3FMWA 5HR3A 1M7TA 4A5PA 1AUCA 1ZOFA 2B1KA 3APOA 2VLVA 1ABAA 2ES7A 4P3YB 2X64A 3RHCA 3MWHA 2NPBA 2XBQA 1M2BA 3UOMA 5J41A 5E4WA 4HEA2 1YQ1A 1V57A 1ACVA 2HRKA 1YF0A 4DSSA 4EIQA 4PXOA 3IK9A 4TR4A 3TCOA 2HE3A 2FCHA 3DWVA 4YQVA 1PN0A 1MDKA 2C1YA 3V1WA 1Q98A 2IJYA 2X8CA 1A8LA 1IYHA 1PL2A 1XWBA 2H76A 1VF4A 5GAPD 1YF1A 4O32A 2B3SA 3PGTA 4TXOB 2LUSA 4HOJA 5IO2A 2FWHA 4F9ZA 1X0RA 4ML6A 3A2VA 2X99A 5DALB 3BCKA 1AXDA 3GV1A 3HVVA 5AIVA 3GH6A 3QPMA 2V6OA 3UVTA 3QFAC 2CVBA 2KLXA 5A4VA 1LJRA 2E2MA 1U88A 1A23A 3LJRA 5B7CA 2X49A 3CSHA 3TKPA 1MD4A 1BX9A 2VCTA 3NZNA 1LU4A 1QQ2A 3HCZA 4FYCA 4MJEA 3P90A 5D9VA 4TR1B 1F2EA 2IWTA 1USBA 5HFGA 3VWWA 2QA1A 5CYYA 5IMCA 5IOWA 5ID2B 4XS4B 4J56E 5IMDA 1M9BA 1OYJA 4K9ZA 1SKRB 4XS6A 2G2QA 1XFLA 3UMAA 3FZ4A 4WEYA 4OD7A 2BJXA 4F0BA 4ZILA 4ISDA 1MD3A 1O7UA 2YWMA 2R5GA 1R5AA 14GSA 3TRQA 3ZITA 3BOAA 1ZYNA 2PWJA 3H4KA 1SL1B 4TKYA 2ZNMA 3DRNA 4EUYA 3GA4A 3FW2A 1RQMA 5F0GA 5EL8A 5HFKA 2R0GA 3ZRDA 4ICYA 2KP1A 4ZB9A 2ON7A 5ECPB 4YQMA 1O81A 4AJ8A 4BWSA 2G0FA 5DBQA 3J7Yb 13GSA 4KCEA 1A0RP 3ERFA 1BAYA 3ISOA 4ZB6A 3EURA 4K0GA 4E8EA 3RBTA 5D9TA 3GX8A 5AN1A 2H1BA 1UVZA 5F06A 2CAQA 2LJKA 4GXZA 1F9MA 4KNDA 3KMOA 1TK8B 3F9UA 1NHOA 2AUVA 2IIYA 3I9V2 2P31A 3CSIA 3VLNA 5F8BA 1T4ZA 3QFBC 4TXOA 4ML1A 1ZYQB 2FHEA 4ILFA 4CW9A 6GSXA 2B5EA 3DXBA 2H72A 3IR4A 3IC8A 2DBCA 2H6XA 5ELGA 4HQSA 2VD1A 5IPHA 5H5SA 3GURA 1HNBA 2HLSA 2HNLA 1XW6A 1S3DA 4Z2UA 2RM5A 3D5JA 3GKXA 5AGYA 2OADA 5H5QA 4MPGA 1G0TA 5F05A 1W89A 2HI7A 5JWRB 1YEXA 3O6TA 2GDRA 2MMNA 1U3IA 2FLSA 2VIMA 4V2LA 2LEGA 4JR6A 5ID2A 4MZBA 1WJKA 4XS4A 5JCUA 1FW1A 3D6IA 3FKFA 3C7MA 5ELAA 4BPYA 3QCPA 3GL3A 4TN8A 1PMTA 2YNXA 1GLPA 1TXXA 5IQYA 4XCSA 4JR4A 1AQXA 3N5OA 5DAKB 5GSTA 4GLTA 3EMXA 3CTFA 2H1AA 2HZFA 2E7PA 2GZYA 2VL2C 3DD3A 4HZ4A 5CO3A 3LWAA 1N2AA 5LD0A 4JE1A 2HFDA 3MNGA 3IK7A 4CY8A 3VI7A 3U5RE 4TVEA 2VCWA 5IMFA 3UIWA 5J5NA 2MMOA 2VCXA 3TOUA 2IFQB 4TR3A 4USSA 3L78A 4ACSA 1GTUA 1HD2A 4ZL7A 5KEJA 1GSQA 2WJUA 4I8BA 3G7JA 2FGXA 1GULA 5COHA 4NV5A 4RQXA 4AGSA 4EDYA 3WGEA 2XHFA 3F0IA 5ECOB 4Z2RA 3F63A 3MSZA 4MP4A 5ECRB 2VL3A 2F51A 2C3QA 5ECNB 1S3CA 2F8AA 2YJ7A 4JU5A 2B7KA 2IMIA 3VPTA 4DSRA 2WS2A 4AF2A 3E0UA 3KZQA 4YQUA 2I1UA 16GSA 5J9CA 4MDCA 1Z7RA 2C0DA 3ZLPA 1EEJA 1PSQA 4N10A 2V1MA 2F3MA 1Q4JA 3F8UA 4F03A 4J2FA 3FY7A 4F82A 3HZ8A 1ZYPA 2CZ2A 5ECKB 4PX1A 5IMVA 3PH9A 3HXSA 4EDZA 5GAND 3GRXA 2AV4A 3BBYA 2R4VA 4POBA 3DIEA 3GTUB 3Q18A 3GH9A 1FB6A 2YWIA 3L4NA 2MYGA 3EU3A 2M80A 2KP2A 4HJMA 4EE0A 3KP8A 4MH3A 1Z3EA 1XIYA 1CQGA 4GRFA 1XPVA 3IAS2 2JZTA 1THXA 4KGIA 2OA7A 4KSOA 1G7OA 3BJ5A 5E59A 5KOWA 4HI7A 3Q19A 1A2MA 1KBNA 1ZZYA 1GSSA 4K1FA 4DSSB 1Z9HA 4ZIJA 1B9YC 4E8HA 2A2RA 4I6XA 4G10A 5B8AA 4WBJA 2NBSA 2YOIA 4GF0A 3QAWA 4FYUA 1RW1A 4X1UA 1VF2A 4ZBBA 2JU5A 5DQYA 5ECQB 5G1LA 3FHKA 2C80A 1QFNA 2LRTA 4NXIA 1EP8A 5ECIB 5CNWA 1TW9A 2YV9A 3EU4A 3GYKA 4JEDA 2LSTA 2VL2A 5L71A 4K7NA 2WB9A 1G6WA 5FT3A 3IE3A 4N0ZA 5AIXA 3GSTA 4POKA 1VF3A 4L0UA 22GSA 3KM6A 3EYTA 1EOGA 2YZUA 2H66A 2OBIA 3UBLA 1V9WA 4IQ1A 4K5RA 4ECBA 3HKRA 1GSEA 1K0MA 2OACA 3GFKA 4Q5NA 1ZYEA 2LQOA 3D22A 4BVXA 2H8LA 1ZGNA 1XW9A 2JADA 3C71A 2N5AA 5IO0A 4BWQA 2H74A 4Q5RA 2O8VB 4QL7A 2E0QA 1SJIA 3GKNA 2C8UA 1XOAA 4N0VA 2NTOA 1PL1A 4KF9A 3ZIJA 4OO4A 1R26A 3C1RA 3GTUA 4D73A 1ERTA 1TK0B 2R0CA 1XWCA 2FWFA 1FAAA 2B6MA 3EE2A 1GTBA 4K2XA 4MH2A 1TK5B 3U6VA 4O5QA 2JSYA 2L6CA 4LMWA 4MF5A 5D96A 4MMMA 3F4RA 4MF6A 2CV4A 2R3XA 3IXRA 2CVKA 4HQZA 3H93A 3GL5A 1DSBA 2HSMA 5ENUA 4EXJA 4H86A 2WGRA 4IW9A 1TOFA 3LORA 4KH7A 3E3EA 2YV7A 1THOA 3A5WA 3LEFA 2GTUA 3PINA 2EIRA 1PD21 1OKDA 5CRDA 3M1GA 2IMFA 4NHWA 1GWCA 12GSA 3GKMA 3ZFLA 5INYA 2OE3A 2DJ0A 2NVLA 3VFIA 1YKAA 5DQSA 3UL3A 1FO5A 3O3TA 2YZHA 4MPFA 3IDVA 4PQ1A 2F9SA 3KIJA 3P2AA 4MA9A 3WGXA 3CSJA 5ABRA 2WRTA 5ECHB 4OO5A 5JWQB 3DGQA 4PUFC 2P0GA 2TRCP 4TXVA 2FWEA 4PNGA 1FOHA 4X4JA 4O5RA 1B9XC 1E6BA 3LXZA 2FWGA 2V41A 2PMTA 4IVFA 4I97A 4KCAA 2HRNA 3F3QA 1TRWA 3P7XA 4LLRA 2H0GA 1U3AA 1WE0A 4GSTA 4BVYA 5CAXA 5DJMA 5DDLA 1H75A 1PRXA 1O73A 4EIPA 1XWGA 2L6DA 1OC3A 3FRCA 1XVWA 3LW9A 1EZKA 3A2XA 2K18A 3BCIA 2VUPA 1GUMA 4L0WA 1NW2A 4X43A 1SL2B 1YKCA 2DC5A 2VCVA 4Q5QA 1XCCA 1SKWB 3FK8A 2H73A 1BYEA 3L0HA 3TKRA 1X9WB 4NV2A 1WMJA 1AQVA 2C0EA 2D2ZA 1SK2A 3LYPA 4IHUA 2MMZA 2IL3A 5DCHA 4MJAA 3MIXA 4GTUA 2RUEA 1MEKA 1NM3A 2FUG2 2YJHA 2VD0A 1O6JA 3IHQA 1XOBA 2H01A 3E9JB 2O7KA 4EVMA 4G19A 4KW6A 2DJ2A 4PTSA 3QMXA 1R4WA 1EV9A 1ON4A 1DBYA 2PBJA 2O87A 3ZFBA 2M46A 3RPNA 2H1DA 5HR2A 2CQ9A 2OE1A 3W8JA 2PVQA 4V1Ag 2HXKA 2LQQA 2LRCA 4KA0A 1PA3A 2AYTA 3JCML 2FA8A 1V98A 1JZOA 2GSQA 1J9BA 2I9HA 3QOUA 4MZWA 3WT1A 3ME8A 2I81A 2LTKA 1JLWA 3TB2A 11GSA 3F6DA 3I43A 3ZZXA 6GSWA 1MTCA 4ZXGA 5G2ZA 1K0CA 3ZMLA 1T1VA 18GSA 2IMKA 3GSSA 4HU7A 3VWVA 4YAVA 1XVQA 5J9BA 2R6KA 4TW5A 1XBSA 4PQIA 3KTBA 5IOXA 5B6NA 2C0FA 3ZVJA 1K3OA 3D21A 2WDUA 4JZQA 4I5QA 5AISA 4LL1B 2YPMA 1GSFA 4LL4B 3A3TA 4RI6A 5A4WA 3GMFA 3CYNA 10GSA 2GZPA 3IRAA 4BA7A 6GSYA 1T3BA 1T4YA 2KUCA 4FH8A 1KNGA 2QKEA 1XXUA 3HHVA 3TRPA 2A4HA 1MDJA 4MZCA 2IPAA 1X5EA 4RI7A 2V6KA 3HVSA 2XC2A 4AJ7A 4WKWA 4ZBDA 1ML6A 1SKSB 2K8VA 1WOUA 5J3RA 1EEMA 3A5IA 4FIWA 2DJKA 1X5DA 5G31A 2XPDA 1YEPA 2JL4A 4ZBAA 2QGVA 4ECCA 4WF5A 2AHEA 3H8QA 3FR3A 1T8EB 4XS1A 1ERWA 1SENA 2GQKA 1K0OA 4F0CA 4CHSA 3DVXA 2N5BA 2O85A 4G0LA 3WT2A 5KN3A 3O76A 4IS0A 1B4PA 3QR6A 3Q6OA 5FWGA 2KOKA 2CAIA 2PN8A 2WCIA 1TP9A 3GX0A 1UN2A 3GHAA 2P5RA 1M99A 4BVXB 3IOSA 3F6FA 4I2TA 1A8YA 4WBRD 1SYRA 6GSUA 1HQOA 2GT5A 4O5UA 2LNSA 4MF7A 3GNJA 4EL1A 3KMNA 1DE1A 5B8BA 5EVOA 1TI1A 3RAZA 2OKAA 4D73B 2X8HA 3K8NA 2AJQB 4TR0A 2I4AA 4CDOA 3GIXA 2PERA 4TOPA 2OJLA 3ERGA 3FEUA 3DEXA 5DCGA 1K0AA 3F4TA 5IMAA 1EGOA 1GTIA 3KCMA 2H1GA 4ECIA 4HJ2A 2RM6A 3ZL5A 1M9AA 2H71A 1A2LA 6GSTA 3OR5A 3ZTLA 4LA1A 5JCWA 3IA1A 3KTLA 2VM2A 2GZZA 5LCZA 3N9JA 2QA2A 2X8GA 1NSWA 1ST9A 2VLTA 2N5FA 1V40A 2DIYA 3TOTA 5IIZA 1YDKA 3EINA 3ZIVA 3LQ7A 5KN0A 3TJKA 4KUNA 4JRRA 2CA8A 3KD0A 2HT9A 2H0HA 4Q5FA 1X5CA 3VURA 1WRYA 4V2NA 4IP1A 5C00A 4PUAA 5IMZA 1T7PB 2VO4A 4HZ2A 1R7HA 4XRDA 2EIQA 4MLYA 2CVDA 1S3AA 2HRFA 1HNAA 3LXTA 4YH2A 4V1Ap 4IQAA 3TKQA 1X9SB 4O7HA 3J7Yk 2LJRA 2DIZA 2XPEA 4NAXA 3M8NA 4FQUA 3SWLA 2M72A 3HD5A 5J4UA 4BVYB 4FO5A 17GSA 5B6MA 2CZ3A 3WD6A 1F37A 4ZL9A 4RQRA 5KN2A 2PU9C 4OCFA 2LJAA 5D73A 1Y25A 3CRUA 5IPGA 1OE7A 5GZZB 3DKSA 4FYBA 3ZREA 1BEDA 1JZRA 4HDEA 5FHIA 2NDOA 2DJJA 5H5RA 4MCUA 1WWJA 3TKSA 1BJXA 3FR6A 1BQ7A 2IMDA 5CRGA 2H0IA 3QAVA 5ECMB 3HJOA 1A24A 3C8EA 1HYUA 1EV4A 3M9KA 4L5LA 4HU9A 4IBPA 2ON5A 1H4OA 2PGTA 1A2JA 3LSZA 4YKGA 2VAFA 1TTZA 1XWAA 3EVIA 1X9MB 4BL7B 4OWYA 1PX7A 3NIVA 1B8XA 5CP1A 5DVBA 1M2DA 1PX6A 2H30A 4OMVA 4EO3A 2Z9SA 1DE2A 1SK1A 4GCIA 2JZSA 4MJBA 2EC4A 2HZEA 3G7YA 1OC8A 3EWLA 4K8MA 2X4AA 4GQCA 2C3NA 3ZMKA 3KJYA 4ID0A 5EY6A 6GSVA 1CQHA 2MBTA 3UEMA 3M0FA 3RPPA 1T00A 3WGDA 1DUGA 4POLA 1GSUA 4HUAA 3CMIA 3R3EA 2MBSA 2E2GA 2DMLA 5EPFA 5JCGA 2EIOA 5KOXA 1SYXA 2ZUPA 3KEBA 3TJFA 2AAWA 2XBIA 3H79A 2OE0A 4CY6A 3IBHA 4MNNA 1SD8A 1GUKA 5ECSA 2PUKC 1SJ6A 2GVPA 2PPTA 2R2JA 2MZCA 3G9BA 1K3LA 4GSSA 1GLQA 2FA4A 1QXHA 2ALBA 3PPUA 2B5XA 3F3RA 3DVWA 1JLVA 4POMA 2AB6A 4KSMA 1SU9A 2UZ8A 3IC4A 3NOFA 4L8EA 1ILOA 4K2DA 3Q74A 1EGRA 2YCDA 3TDGA 5HFIA 4HS1A 1FVKA 1AW9A 1AIUA 4IJIA 2PVOC 4XTSA 1Z6MA 1XWKA 2RUFA 4OFMA 1NHYA 1M2AA 3SBCA 1U6TA 4KX4A 3FZ9A 3M3MA 1URMA 2I3YA 2K9FA 1JZDA 3D0ZA 1EWXA 1SD9A 4OFNA 1TU8A 4KAEA 2HSYA 1TJDA 1TU7A 19GSA 3D4MA 4OCEA 3QD9A 2GGTA 1A0FA 3UAPA 2GS3A 3APSA 1J0FA 3KP9A 5HQPA 2LKUA 3G7IA 2RIIA 1FHEA 1Z6NA 2DMMA 4BL7A 4IKHA 4KDUA 3VI5A 3RHBA 1GSDA 2H6YA 1JHBA 1GSYA 4L5OA 1PKWA 5CRWA 1U87A 1K0NA 4PNFA 4EF0A 3MYDA 2DSAA 2GSRA 5G5FA 5LNKe 5ECLB 1ERVA 5D8IA 2LNTA 2L4CA 5IM9A 3APQA 2FNOA 1HNCA 2L57A 1PN9A 1I5GA 1VGLA 2YWNA 2J23A 4TRXA 2L5LA 3KGKA 3L9SA 3TJJA 3I6AA 5DALA 4N30A 4MABA 3FZAA 3S9FA 5BMUA 2BMXA 1FOVA 3BD2A 2OBKA 4XHMA 2FD3A 4K5SA 2TRXA 2K8SA 3KH7A 4WXTA 2GLRA 4NMUA 3ZYWA 1TI3A 5C04A 4NHZA 2WFCA 4O92A 2GSTA 2H75A 1SK0A 4RUVA 1O85A 2HSHA 2L59A 3HA9A 4TR1A 2F8FA 4WETA 4WR5A 2JACA 4OFTA 2GQMA 1ERUA 5A5KA 1Z7PA 2VOCA 1KTEA 3DYRA 2B5YA 1YY7A 3IV4A 3H1NA 4V2MA 2WULA 4IN0A 2C0GA 1WPIA 2L4QA 4QL9A 2R37A 4G2EA 2H70A 3HJMA 5CREA 2A4VA 3IAM2 4DEJA 1PQNA 3HDCA 4AJ6A 1OE8A 1OC9B 4PQHA 3TGZA 2CX4A 2CX3A 3EMPA 2V2GA 1J08A 3C73A 4KDYA 4K7OA 2B7JA 4DVCA 1IYIA 4ECJA 3LG6A 1GH2A 1F6MC 4IJ3A 2GT6A 4KE3A 2IMEA 3HZ4A 1E2YA 2A2PA 1QMVA 3KH9A 3I69A 1Y6EA 3W8SA 4K6XA 2R0PA 4G0KA 1V2AA 4I2UA 1JFUA 1M0UA 2MMAA 2DJ1A 1OKTA 2GSSA 3LGCA 4JBBA 2REMA 1GNWA 1OVNA 1TRVA 1AAZA 2P5QA 5KN1A 4IP6A 1F3BA 1YJ6A 9GSSA 1AC1A 2VLUA 3ME7A 1QK8A 2GQLA 3US3A 1WP0A 3MAKA 3IPZA 2FY6A 3TRXA 5G5EA 3TKSC 1ZMAA 2RLIA 3CRTA 4QQ7A 4N11A 4WF4A 3UJ1A 3L9UA 2YP6A 3W6GA 4ZL8A 1QUWA 2VCQA 1QGVA 4G9HA 2DKHA 3EC3A 3C1SA 5CRHA 3L9VA 3RDWA 4LMVA 4NPBA 1PGTA 1FG4A 1TKDB 4PGTA 4GSNA 1XW5A 4IGJA 3VWXA 4F2IA 1V58A 1XZOA 1GRXA 1N8JA 4XIHA 3ZVJD 1Z5YE 2BTOT 2KHPA 2WZ9A 3P8WA 5D93A 4DSQA 1RK4A 1F3AA 2VCZA 4YAPA 4IELA 4PURA 1AQWA 1OAZA 3QDNA 1G7EA 2VL9A 4MJCA 3D4TA 3F4SA 5D9XA 3AY8A 3TUEA 2LS5A 1OC9A 4K7IA 1SL0B 3GN3A 5DJLA 2C3TA 1TRUA 5HR1A 2A2SA 5DAKA 2HYXA 2LRNA 1VRSD 4EKZA 2V32A 1O8WA 2HZEB 1UA5A 1K0BA 3CBUA 5D9WA 5BRTA 2DJ3A 5JWOB 2TIRA 1O8XA 4Z2TA 3TJGA 3QAGA 3M9JA 1WIKA 8GSSA 1GUHA 1ZCPA 3GKKA 1GNEA 3LFLA 3FR9A 4GQFA 1B4QA 1YZXA 2JSZA 3ED3A 4EC0A 1GL8A 1K3YA 2DKIA 4MK3A 2QC7A 1FB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDI A;  3TKS E;  2QSI A;  1PKZ A;  1B48 A;  2IFQ A;  1TDI A;  3UAR A;  4X0X A;  1LBK A;  3A2W A;  5A4U A;  1VF1 A;  20GS A;  5G30 A;  2YN1 A;  1K0D A;  2VM1 A;  4GWR A;  1GTA A;  3CXG A;  3ERW A;  2J9H A;  2C4J A;  3HJP A;  3LYK A;  3FYG A;  2L5O A;  1G6Y A;  1SJZ A;  4ULX A;  3WYW A;  1C72 A;  3TJB A;  4KB3 A;  2IN3 A;  4WR4 A;  3MDK A;  2H19 A;  1UC7 A;  4XRA A;  1JZW A;  5G1K A;  1ZL9 A;  2K6V A;  3DML A;  4Z7X A;  1KEB A;  2LV3 A;  2H6Z A;  6GSS A;  4J57 E;  3GUS A;  2B1L A;  3FZ5 A;  1TRS A;  4ZB8 A;  3UVH A;  1BG5 A;  3HY2 A;  1EP7 A;  2YWO A;  7GSS A;  3VPQ A;  2YAN A;  2O89 A;  4K0N A;  2CT6 A;  3VWU A;  4KDX A;  2JZR A;  1R5P A;  1GP1 A;  3KXO A;  3VK9 A;  1EOH A;  1FVJ A;  3HVX A;  1W4V A;  3HYP A;  3PR8 A;  4NWY A;  5HR0 A;  5F07 A;  1I9D A;  3CTG A;  3R2Q A;  2ZCT A;  3UBK A;  5GSS A;  2DLX A;  5HR3 A;  1M7T A;  1AUC A;  1ZOF A;  2B1K A;  3APO A;  2VLV A;  1ABA A;  2ES7 A;  4P3Y B;  2X64 A;  3RHC A;  3MWH A;  2NPB A;  2XBQ A;  1M2B A;  3UOM A;  5J41 A;  5E4W A;  4HEA 2;  1YQ1 A;  1V57 A;  1ACV A;  1YF0 A;  4DSS A;  4PXO A;  3IK9 A;  4TR4 A;  3TCO A;  2HE3 A;  2FCH A;  3DWV A;  4YQV A;  1MDK A;  2C1Y A;  3V1W A;  1Q98 A;  2IJY A;  2X8C A;  1A8L A;  1IYH A;  1PL2 A;  1XWB A;  2H76 A;  1VF4 A;  5GAP D;  1YF1 A;  4O32 A;  2B3S A;  3PGT A;  4TXO B;  2LUS A;  4HOJ A;  5IO2 A;  2FWH A;  4F9Z A;  1X0R A;  4ML6 A;  3A2V A;  2X99 A;  5DAL B;  3BCK A;  1AXD A;  3GV1 A;  3HVV A;  5AIV A;  3GH6 A;  3QPM A;  2V6O A;  3UVT A;  3QFA C;  2CVB A;  2KLX A;  5A4V A;  1LJR A;  2E2M A;  1U88 A;  1A23 A;  3LJR A;  5B7C A;  3CSH A;  3TKP A;  1MD4 A;  1BX9 A;  2VCT A;  3NZN A;  1LU4 A;  1QQ2 A;  3HCZ A;  4FYC A;  4MJE A;  3P90 A;  5D9V A;  4TR1 B;  1F2E A;  2IWT A;  1USB A;  5HFG A;  3VWW A;  5CYY A;  5IMC A;  5IOW A;  5ID2 B;  4XS4 B;  4J56 E;  5IMD A;  1M9B A;  1OYJ A;  4K9Z A;  1SKR B;  4XS6 A;  2G2Q A;  1XFL A;  3UMA A;  3FZ4 A;  4WEY A;  4OD7 A;  2BJX A;  4F0B A;  4ZIL A;  4ISD A;  1MD3 A;  1O7U A;  2YWM A;  2R5G A;  1R5A A;  14GS A;  3TRQ A;  3ZIT A;  3BOA A;  2PWJ A;  3H4K A;  1SL1 B;  4TKY A;  2ZNM A;  3DRN A;  4EUY A;  3GA4 A;  3FW2 A;  1RQM A;  5F0G A;  5EL8 A;  5HFK A;  3ZRD A;  2KP1 A;  4ZB9 A;  2ON7 A;  5ECP B;  4YQM A;  1O81 A;  4AJ8 A;  4BWS A;  2G0F A;  5DBQ A;  3J7Y b;  13GS A;  4KCE A;  1A0R P;  3ERF A;  1BAY A;  3ISO A;  4ZB6 A;  3EUR A;  4K0G A;  4E8E A;  3RBT A;  5D9T A;  3GX8 A;  5AN1 A;  2H1B A;  1UVZ A;  5F06 A;  2CAQ A;  2LJK A;  4GXZ A;  1F9M A;  4KND A;  3KMO A;  1TK8 B;  3F9U A;  1NHO A;  2AUV A;  2IIY A;  3I9V 2;  2P31 A;  3CSI A;  3VLN A;  5F8B A;  1T4Z A;  3QFB C;  4TXO A;  4ML1 A;  1ZYQ B;  2FHE A;  4ILF A;  4CW9 A;  6GSX A;  2B5E A;  3DXB A;  2H72 A;  3IR4 A;  2DBC A;  2H6X A;  5ELG A;  4HQS A;  2VD1 A;  5IPH A;  5H5S A;  3GUR A;  1HNB A;  2HLS A;  2HNL A;  1XW6 A;  1S3D A;  2RM5 A;  3D5J A;  3GKX A;  5AGY A;  2OAD A;  5H5Q A;  4MPG A;  1G0T A;  5F05 A;  1W89 A;  2HI7 A;  5JWR B;  1YEX A;  3O6T A;  2GDR A;  2MMN A;  1U3I A;  2FLS A;  2VIM A;  4V2L A;  2LEG A;  4JR6 A;  5ID2 A;  4MZB A;  1WJK A;  4XS4 A;  5JCU A;  1FW1 A;  3D6I A;  3FKF A;  3C7M A;  5ELA A;  4BPY A;  3QCP A;  3GL3 A;  4TN8 A;  1PMT A;  2YNX A;  1GLP A;  1TXX A;  5IQY A;  4XCS A;  4JR4 A;  1AQX A;  3N5O A;  5DAK B;  5GST A;  4GLT A;  3EMX A;  3CTF A;  2H1A A;  2HZF A;  2E7P A;  2GZY A;  2VL2 C;  3DD3 A;  4HZ4 A;  5CO3 A;  3LWA A;  1N2A A;  5LD0 A;  4JE1 A;  2HFD A;  3MNG A;  3IK7 A;  3VI7 A;  3U5R E;  4TVE A;  2VCW A;  5IMF A;  3UIW A;  5J5N A;  2MMO A;  2VCX A;  3TOU A;  2IFQ B;  4TR3 A;  3L78 A;  4ACS A;  1GTU A;  1HD2 A;  4ZL7 A;  5KEJ A;  1GSQ A;  2WJU A;  4I8B A;  3G7J A;  2FGX A;  1GUL A;  5COH A;  4NV5 A;  4RQX A;  4AGS A;  4EDY A;  3WGE A;  2XHF A;  3F0I A;  5ECO B;  3F63 A;  3MSZ A;  4MP4 A;  5ECR B;  2VL3 A;  2F51 A;  2C3Q A;  5ECN B;  1S3C A;  2F8A A;  2YJ7 A;  4JU5 A;  2B7K A;  2IMI A;  3VPT A;  4DSR A;  2WS2 A;  4AF2 A;  3E0U A;  3KZQ A;  4YQU A;  2I1U A;  16GS A;  5J9C A;  4MDC A;  1Z7R A;  2C0D A;  3ZLP A;  1EEJ A;  1PSQ A;  4N10 A;  2V1M A;  2F3M A;  1Q4J A;  3F8U A;  4F03 A;  4J2F A;  3FY7 A;  4F82 A;  3HZ8 A;  2CZ2 A;  5ECK B;  4PX1 A;  5IMV A;  3PH9 A;  3HXS A;  4EDZ A;  5GAN D;  3GRX A;  2AV4 A;  3BBY A;  2R4V A;  4POB A;  3DIE A;  3GTU B;  3Q18 A;  3GH9 A;  1FB6 A;  2YWI A;  3L4N A;  2MYG A;  3EU3 A;  2M80 A;  2KP2 A;  4HJM A;  4EE0 A;  3KP8 A;  4MH3 A;  1Z3E A;  1XIY A;  1CQG A;  4GRF A;  1XPV A;  3IAS 2;  2JZT A;  1THX A;  4KGI A;  2OA7 A;  4KSO A;  1G7O A;  3BJ5 A;  5E59 A;  4HI7 A;  3Q19 A;  1A2M A;  1KBN A;  1ZZY A;  1GSS A;  4K1F A;  4DSS B;  1Z9H A;  4ZIJ A;  1B9Y C;  4E8H A;  2A2R A;  4I6X A;  4G10 A;  5B8A A;  4WBJ A;  2NBS A;  2YOI A;  4GF0 A;  3QAW A;  4FYU A;  1RW1 A;  4X1U A;  1VF2 A;  4ZBB A;  2JU5 A;  5DQY A;  5ECQ B;  5G1L A;  3FHK A;  2C80 A;  1QFN A;  2LRT A;  4NXI A;  1EP8 A;  5ECI B;  5CNW A;  1TW9 A;  2YV9 A;  3EU4 A;  3GYK A;  4JED A;  2LST A;  2VL2 A;  5L71 A;  4K7N A;  2WB9 A;  1G6W A;  5FT3 A;  3IE3 A;  4N0Z A;  5AIX A;  3GST A;  4POK A;  1VF3 A;  4L0U A;  22GS A;  3KM6 A;  3EYT A;  1EOG A;  2YZU A;  2H66 A;  2OBI A;  3UBL A;  1V9W A;  4IQ1 A;  4ECB A;  3HKR A;  1GSE A;  1K0M A;  2OAC A;  3GFK A;  4Q5N A;  1ZYE A;  2LQO A;  3D22 A;  4BVX A;  2H8L A;  1ZGN A;  1XW9 A;  2JAD A;  3C71 A;  2N5A A;  5IO0 A;  4BWQ A;  2H74 A;  4Q5R A;  2O8V B;  4QL7 A;  2E0Q A;  1SJI A;  3GKN A;  2C8U A;  1XOA A;  4N0V A;  2NTO A;  1PL1 A;  3ZIJ A;  4OO4 A;  1R26 A;  3C1R A;  3GTU A;  4D73 A;  1ERT A;  1TK0 B;  1XWC A;  2FWF A;  1FAA A;  2B6M A;  3EE2 A;  1GTB A;  4MH2 A;  1TK5 B;  3U6V A;  2JSY A;  2L6C A;  4LMW A;  4MF5 A;  5D96 A;  4MMM A;  3F4R A;  4MF6 A;  2CV4 A;  2R3X A;  3IXR A;  2CVK A;  4HQZ A;  3H93 A;  3GL5 A;  1DSB A;  5ENU A;  4EXJ A;  4H86 A;  2WGR A;  4IW9 A;  1TOF A;  3LOR A;  4KH7 A;  3E3E A;  2YV7 A;  1THO A;  3A5W A;  3LEF A;  2GTU A;  3PIN A;  2EIR A;  1PD2 1;  1OKD A;  5CRD A;  3M1G A;  2IMF A;  4NHW A;  1GWC A;  12GS A;  3GKM A;  3ZFL A;  5INY A;  2OE3 A;  2DJ0 A;  2NVL A;  3VFI A;  1YKA A;  5DQS A;  3UL3 A;  1FO5 A;  3O3T A;  2YZH A;  4MPF A;  3IDV A;  4PQ1 A;  2F9S A;  3KIJ A;  3P2A A;  4MA9 A;  3WGX A;  3CSJ A;  5ABR A;  2WRT A;  5ECH B;  4OO5 A;  5JWQ B;  3DGQ A;  4PUF C;  2P0G A;  2TRC P;  4TXV A;  2FWE A;  4PNG A;  4O5R A;  1B9X C;  1E6B A;  3LXZ A;  2FWG A;  2V41 A;  2PMT A;  4IVF A;  4I97 A;  4KCA A;  2HRN A;  3F3Q A;  1TRW A;  3P7X A;  4LLR A;  2H0G A;  1U3A A;  1WE0 A;  4GST A;  4BVY A;  5CAX A;  5DJM A;  5DDL A;  1H75 A;  1PRX A;  1O73 A;  1XWG A;  2L6D A;  1OC3 A;  3FRC A;  1XVW A;  1EZK A;  3A2X A;  2K18 A;  3BCI A;  2VUP A;  1GUM A;  4L0W A;  1NW2 A;  4X43 A;  1SL2 B;  1YKC A;  2DC5 A;  2VCV A;  4Q5Q A;  1XCC A;  1SKW B;  3FK8 A;  2H73 A;  1BYE A;  3L0H A;  3TKR A;  1X9W B;  4NV2 A;  1WMJ A;  1AQV A;  2C0E A;  2D2Z A;  1SK2 A;  3LYP A;  4IHU A;  2MMZ A;  2IL3 A;  5DCH A;  4MJA A;  4GTU A;  2RUE A;  1MEK A;  1NM3 A;  2FUG 2;  2YJH A;  2VD0 A;  1O6J A;  3IHQ A;  1XOB A;  2H01 A;  3E9J B;  2O7K A;  4EVM A;  4G19 A;  4KW6 A;  2DJ2 A;  3QMX A;  1R4W A;  1EV9 A;  1ON4 A;  1DBY A;  2PBJ A;  2O87 A;  3ZFB A;  2M46 A;  3RPN A;  2H1D A;  5HR2 A;  2CQ9 A;  2OE1 A;  3W8J A;  2PVQ A;  4V1A g;  2HXK A;  2LQQ A;  2LRC A;  4KA0 A;  1PA3 A;  2AYT A;  3JCM L;  2FA8 A;  1V98 A;  1JZO A;  2GSQ A;  1J9B A;  2I9H A;  3QOU A;  4MZW A;  3WT1 A;  3ME8 A;  2I81 A;  2LTK A;  1JLW A;  3TB2 A;  11GS A;  3F6D A;  3I43 A;  3ZZX A;  6GSW A;  1MTC A;  4ZXG A;  5G2Z A;  1K0C A;  3ZML A;  1T1V A;  18GS A;  2IMK A;  3GSS A;  4HU7 A;  3VWV A;  4YAV A;  1XVQ A;  5J9B A;  2R6K A;  4TW5 A;  1XBS A;  4PQI A;  3KTB A;  5IOX A;  5B6N A;  2C0F A;  3ZVJ A;  1K3O A;  3D21 A;  2WDU A;  4JZQ A;  4I5Q A;  5AIS A;  4LL1 B;  2YPM A;  1GSF A;  4LL4 B;  3A3T A;  4RI6 A;  5A4W A;  3GMF A;  3CYN A;  10GS A;  2GZP A;  3IRA A;  4BA7 A;  6GSY A;  1T3B A;  1T4Y A;  2KUC A;  4FH8 A;  1KNG A;  2QKE A;  1XXU A;  3HHV A;  3TRP A;  1MDJ A;  4MZC A;  2IPA A;  1X5E A;  4RI7 A;  2V6K A;  3HVS A;  2XC2 A;  4AJ7 A;  4WKW A;  4ZBD A;  1ML6 A;  1SKS B;  2K8V A;  1WOU A;  5J3R A;  1EEM A;  4FIW A;  2DJK A;  1X5D A;  5G31 A;  2XPD A;  1YEP A;  2JL4 A;  4ZBA A;  2QGV A;  4ECC A;  4WF5 A;  2AHE A;  3H8Q A;  3FR3 A;  1T8E B;  4XS1 A;  1ERW A;  1SEN A;  2GQK A;  1K0O A;  4F0C A;  4CHS A;  3DVX A;  2N5B A;  2O85 A;  3WT2 A;  5KN3 A;  3O76 A;  4IS0 A;  1B4P A;  3QR6 A;  3Q6O A;  5FWG A;  2KOK A;  2CAI A;  2PN8 A;  2WCI A;  1TP9 A;  3GX0 A;  1UN2 A;  3GHA A;  2P5R A;  1M99 A;  3IOS A;  3F6F A;  4I2T A;  1A8Y A;  4WBR D;  1SYR A;  6GSU A;  1HQO A;  2GT5 A;  2LNS A;  4MF7 A;  3GNJ A;  4EL1 A;  3KMN A;  1DE1 A;  5B8B A;  5EVO A;  1TI1 A;  3RAZ A;  2OKA A;  4D73 B;  2X8H A;  3K8N A;  2AJQ B;  4TR0 A;  2I4A A;  4CDO A;  3GIX A;  2PER A;  4TOP A;  2OJL A;  3ERG A;  3FEU A;  3DEX A;  5DCG A;  1K0A A;  3F4T A;  5IMA A;  1EGO A;  1GTI A;  3KCM A;  2H1G A;  4ECI A;  4HJ2 A;  2RM6 A;  3ZL5 A;  1M9A A;  2H71 A;  1A2L A;  6GST A;  3OR5 A;  3ZTL A;  4LA1 A;  5JCW A;  3IA1 A;  3KTL A;  2VM2 A;  2GZZ A;  5LCZ A;  3N9J A;  2X8G A;  1NSW A;  1ST9 A;  2VLT A;  2N5F A;  1V40 A;  2DIY A;  3TOT A;  5IIZ A;  1YDK A;  3EIN A;  3ZIV A;  3LQ7 A;  5KN0 A;  3TJK A;  4KUN A;  4JRR A;  2CA8 A;  3KD0 A;  2HT9 A;  2H0H A;  4Q5F A;  1X5C A;  3VUR A;  1WRY A;  4V2N A;  4IP1 A;  5C00 A;  4PUA A;  5IMZ A;  1T7P B;  2VO4 A;  4HZ2 A;  1R7H A;  4XRD A;  2EIQ A;  4MLY A;  2CVD A;  1S3A A;  2HRF A;  1HNA A;  3LXT A;  4YH2 A;  4V1A p;  4IQA A;  3TKQ A;  1X9S B;  4O7H A;  3J7Y k;  2LJR A;  2DIZ A;  2XPE A;  4NAX A;  3M8N A;  3SWL A;  2M72 A;  3HD5 A;  5J4U A;  4FO5 A;  17GS A;  5B6M A;  2CZ3 A;  3WD6 A;  1F37 A;  4ZL9 A;  4RQR A;  5KN2 A;  2PU9 C;  4OCF A;  2LJA A;  5D73 A;  1Y25 A;  3CRU A;  5IPG A;  1OE7 A;  5GZZ B;  3DKS A;  4FYB A;  3ZRE A;  1BED A;  1JZR A;  4HDE A;  5FHI A;  2NDO A;  2DJJ A;  5H5R A;  4MCU A;  1WWJ A;  3TKS A;  1BJX A;  3FR6 A;  1BQ7 A;  2IMD A;  5CRG A;  2H0I A;  3QAV A;  5ECM B;  3HJO A;  1A24 A;  3C8E A;  1HYU A;  1EV4 A;  3M9K A;  4L5L A;  4HU9 A;  4IBP A;  2ON5 A;  1H4O A;  2PGT A;  1A2J A;  3LSZ A;  2VAF A;  1TTZ A;  1XWA A;  3EVI A;  1X9M B;  4OWY A;  1PX7 A;  3NIV A;  1B8X A;  5CP1 A;  5DVB A;  1M2D A;  1PX6 A;  2H30 A;  4OMV A;  4EO3 A;  2Z9S A;  1DE2 A;  1SK1 A;  4GCI A;  2JZS A;  4MJB A;  2EC4 A;  2HZE A;  3G7Y A;  1OC8 A;  3EWL A;  4K8M A;  4GQC A;  2C3N A;  3ZMK A;  3KJY A;  4ID0 A;  5EY6 A;  6GSV A;  1CQH A;  2MBT A;  3UEM A;  3M0F A;  3RPP A;  1T00 A;  3WGD A;  1DUG A;  4POL A;  1GSU A;  4HUA A;  3CMI A;  2MBS A;  2E2G A;  2DML A;  5EPF A;  5JCG A;  2EIO A;  1SYX A;  2ZUP A;  3KEB A;  3TJF A;  2AAW A;  2XBI A;  3H79 A;  2OE0 A;  3IBH A;  1SD8 A;  1GUK A;  5ECS A;  2PUK C;  1SJ6 A;  2GVP A;  2PPT A;  2R2J A;  2MZC A;  3G9B A;  1K3L A;  4GSS A;  1GLQ A;  2FA4 A;  1QXH A;  2ALB A;  2B5X A;  3F3R A;  3DVW A;  1JLV A;  4POM A;  2AB6 A;  4KSM A;  1SU9 A;  3IC4 A;  3NOF A;  4L8E A;  1ILO A;  4K2D A;  3Q74 A;  1EGR A;  2YCD A;  3TDG A;  5HFI A;  4HS1 A;  1FVK A;  1AW9 A;  1AIU A;  4IJI A;  2PVO C;  4XTS A;  1Z6M A;  1XWK A;  2RUF A;  4OFM A;  1NHY A;  1M2A A;  3SBC A;  1U6T A;  4KX4 A;  3FZ9 A;  3M3M A;  1URM A;  2I3Y A;  2K9F A;  1JZD A;  3D0Z A;  1EWX A;  1SD9 A;  4OFN A;  1TU8 A;  4KAE A;  2HSY A;  1TJD A;  1TU7 A;  19GS A;  3D4M A;  4OCE A;  3QD9 A;  2GGT A;  1A0F A;  3UAP A;  2GS3 A;  3APS A;  1J0F A;  3KP9 A;  5HQP A;  2LKU A;  3G7I A;  2RII A;  1FHE A;  1Z6N A;  2DMM A;  4BL7 A;  4IKH A;  4KDU A;  3VI5 A;  3RHB A;  1GSD A;  2H6Y A;  1JHB A;  1GSY A;  4L5O A;  1PKW A;  5CRW A;  1U87 A;  1K0N A;  4PNF A;  4EF0 A;  2DSA A;  2GSR A;  5G5F A;  5LNK e;  5ECL B;  1ERV A;  5D8I A;  2LNT A;  2L4C A;  5IM9 A;  3APQ A;  2FNO A;  1HNC A;  2L57 A;  1PN9 A;  1I5G A;  1VGL A;  2YWN A;  2J23 A;  4TRX A;  2L5L A;  3KGK A;  3L9S A;  3TJJ A;  3I6A A;  5DAL A;  4N30 A;  4MAB A;  3FZA A;  3S9F A;  2BMX A;  1FOV A;  3BD2 A;  2OBK A;  4XHM A;  2FD3 A;  2TRX A;  2K8S A;  3KH7 A;  4WXT A;  2GLR A;  4NMU A;  3ZYW A;  1TI3 A;  5C04 A;  4NHZ A;  2WFC A;  4O92 A;  2GST A;  2H75 A;  1SK0 A;  4RUV A;  1O85 A;  2HSH A;  2L59 A;  3HA9 A;  4TR1 A;  2F8F A;  4WET A;  4WR5 A;  2JAC A;  4OFT A;  2GQM A;  1ERU A;  5A5K A;  1Z7P A;  2VOC A;  1KTE A;  3DYR A;  2B5Y A;  1YY7 A;  3IV4 A;  3H1N A;  4V2M A;  2WUL A;  4IN0 A;  2C0G A;  1WPI A;  2L4Q A;  4QL9 A;  2R37 A;  4G2E A;  2H70 A;  3HJM A;  5CRE A;  2A4V A;  3IAM 2;  4DEJ A;  1PQN A;  3HDC A;  4AJ6 A;  1OE8 A;  1OC9 B;  4PQH A;  3TGZ A;  2CX4 A;  2CX3 A;  3EMP A;  2V2G A;  1J08 A;  3C73 A;  4KDY A;  4K7O A;  2B7J A;  4DVC A;  1IYI A;  4ECJ A;  3LG6 A;  1GH2 A;  1F6M C;  4IJ3 A;  2GT6 A;  4KE3 A;  2IME A;  3HZ4 A;  1E2Y A;  1QMV A;  3KH9 A;  3I69 A;  1Y6E A;  3W8S A;  4K6X A;  1V2A A;  4I2U A;  1JFU A;  1M0U A;  2MMA A;  2DJ1 A;  1OKT A;  2GSS A;  3LGC A;  4JBB A;  2REM A;  1GNW A;  1OVN A;  1TRV A;  1AAZ A;  2P5Q A;  5KN1 A;  4IP6 A;  1F3B A;  1YJ6 A;  9GSS A;  1AC1 A;  2VLU A;  3ME7 A;  1QK8 A;  2GQL A;  3US3 A;  1WP0 A;  3MAK A;  3IPZ A;  2FY6 A;  3TRX A;  5G5E A;  3TKS C;  1ZMA A;  2RLI A;  3CRT A;  4QQ7 A;  4N11 A;  4WF4 A;  3UJ1 A;  3L9U A;  2YP6 A;  3W6G A;  4ZL8 A;  1QUW A;  2VCQ A;  1QGV A;  4G9H A;  3EC3 A;  3C1S A;  5CRH A;  3L9V A;  3RDW A;  4LMV A;  4NPB A;  1PGT A;  1FG4 A;  1TKD B;  4PGT A;  4GSN A;  1XW5 A;  4IGJ A;  3VWX A;  4F2I A;  1V58 A;  1XZO A;  1GRX A;  1N8J A;  4XIH A;  3ZVJ D;  1Z5Y E;  2BTO T;  2KHP A;  2WZ9 A;  3P8W A;  5D93 A;  4DSQ A;  1RK4 A;  1F3A A;  2VCZ A;  4YAP A;  4IEL A;  4PUR A;  1AQW A;  1OAZ A;  3QDN A;  1G7E A;  2VL9 A;  4MJC A;  3D4T A;  3F4S A;  5D9X A;  3AY8 A;  3TUE A;  2LS5 A;  1OC9 A;  4K7I A;  1SL0 B;  3GN3 A;  5DJL A;  2C3T A;  1TRU A;  5HR1 A;  2A2S A;  5DAK A;  2HYX A;  2LRN A;  1VRS D;  4EKZ A;  2V32 A;  1O8W A;  2HZE B;  1UA5 A;  1K0B A;  3CBU A;  5D9W A;  2DJ3 A;  5JWO B;  2TIR A;  1O8X A;  3TJG A;  3QAG A;  3M9J A;  1WIK A;  8GSS A;  1GUH A;  1ZCP A;  3GKK A;  1GNE A;  3LFL A;  3FR9 A;  4GQF A;  1B4Q A;  1YZX A;  2JSZ A;  3ED3 A;  4EC0 A;  1GL8 A;  1K3Y A;  4MK3 A;  2QC7 A;  1FB0 A; 
#chains in the Genus database with same CATH topology
 1MDI A;  3TKS E;  2QSI A;  1PKZ A;  1B48 A;  2IFQ A;  1TDI A;  3UAR A;  4X0X A;  1LBK A;  3A2W A;  3EPT A;  5A4U A;  1VF1 A;  20GS A;  5G30 A;  2YN1 A;  1K0D A;  2VM1 A;  4GWR A;  1GTA A;  3CXG A;  3ERW A;  2J9H A;  2C4J A;  3HJP A;  3LYK A;  3FYG A;  2L5O A;  1G6Y A;  1SJZ A;  4ULX A;  3WYW A;  1C72 A;  3TJB A;  4KB3 A;  2IN3 A;  3IHG A;  4WR4 A;  3MDK A;  2H19 A;  1UC7 A;  4XRA A;  1JZW A;  5G1K A;  1ZL9 A;  2K6V A;  4YKF A;  3DML A;  4Z7X A;  1KEB A;  2LV3 A;  2H6Z A;  6GSS A;  4J57 E;  3GUS A;  2B1L A;  3FZ5 A;  1TRS A;  4ZB8 A;  3UVH A;  1BG5 A;  3HY2 A;  1EP7 A;  2YWO A;  7GSS A;  3VPQ A;  2YAN A;  2O89 A;  4K0N A;  2CT6 A;  3VWU A;  4KDX A;  2JZR A;  1R5P A;  1GP1 A;  4G0I A;  3KXO A;  3VK9 A;  1EOH A;  2HRA A;  1FVJ A;  3HVX A;  1W4V A;  3HYP A;  3PR8 A;  4NWY A;  5HR0 A;  5F07 A;  1I9D A;  3CTG A;  3R2Q A;  2ZCT A;  3UBK A;  5GSS A;  2DLX A;  3FMW A;  5HR3 A;  1M7T A;  4A5P A;  1AUC A;  1ZOF A;  2B1K A;  3APO A;  2VLV A;  1ABA A;  2ES7 A;  4P3Y B;  2X64 A;  3RHC A;  3MWH A;  2NPB A;  2XBQ A;  1M2B A;  3UOM A;  5J41 A;  5E4W A;  4HEA 2;  1YQ1 A;  1V57 A;  1ACV A;  2HRK A;  1YF0 A;  4DSS A;  4EIQ A;  4PXO A;  3IK9 A;  4TR4 A;  3TCO A;  2HE3 A;  2FCH A;  3DWV A;  4YQV A;  1PN0 A;  1MDK A;  2C1Y A;  3V1W A;  1Q98 A;  2IJY A;  2X8C A;  1A8L A;  1IYH A;  1PL2 A;  1XWB A;  2H76 A;  1VF4 A;  5GAP D;  1YF1 A;  4O32 A;  2B3S A;  3PGT A;  4TXO B;  2LUS A;  4HOJ A;  5IO2 A;  2FWH A;  4F9Z A;  1X0R A;  4ML6 A;  3A2V A;  2X99 A;  5DAL B;  3BCK A;  1AXD A;  3GV1 A;  3HVV A;  5AIV A;  3GH6 A;  3QPM A;  2V6O A;  3UVT A;  3QFA C;  2CVB A;  2KLX A;  5A4V A;  1LJR A;  2E2M A;  1U88 A;  1A23 A;  3LJR A;  5B7C A;  2X49 A;  3CSH A;  3TKP A;  1MD4 A;  1BX9 A;  2VCT A;  3NZN A;  1LU4 A;  1QQ2 A;  3HCZ A;  4FYC A;  4MJE A;  3P90 A;  5D9V A;  4TR1 B;  1F2E A;  2IWT A;  1USB A;  5HFG A;  3VWW A;  2QA1 A;  5CYY A;  5IMC A;  5IOW A;  5ID2 B;  4XS4 B;  4J56 E;  5IMD A;  1M9B A;  1OYJ A;  4K9Z A;  1SKR B;  4XS6 A;  2G2Q A;  1XFL A;  3UMA A;  3FZ4 A;  4WEY A;  4OD7 A;  2BJX A;  4F0B A;  4ZIL A;  4ISD A;  1MD3 A;  1O7U A;  2YWM A;  3HVN A;  2R5G A;  1R5A A;  14GS A;  3TRQ A;  3ZIT A;  3BOA A;  1ZYN A;  2PWJ A;  3H4K A;  1SL1 B;  4TKY A;  2ZNM A;  3DRN A;  4EUY A;  3GA4 A;  3FW2 A;  1RQM A;  5F0G A;  5EL8 A;  5HFK A;  2R0G A;  3ZRD A;  4ICY A;  2KP1 A;  4ZB9 A;  2ON7 A;  5ECP B;  4YQM A;  1O81 A;  4AJ8 A;  4BWS A;  2G0F A;  5DBQ A;  3J7Y b;  13GS A;  4KCE A;  1A0R P;  3ERF A;  1BAY A;  3ISO A;  4ZB6 A;  3EUR A;  4K0G A;  4E8E A;  3RBT A;  5D9T A;  3GX8 A;  5AN1 A;  2H1B A;  1UVZ A;  5F06 A;  2CAQ A;  2LJK A;  4GXZ A;  1F9M A;  4KND A;  3KMO A;  1TK8 B;  3F9U A;  1NHO A;  2AUV A;  2IIY A;  3I9V 2;  2P31 A;  3CSI A;  3VLN A;  5F8B A;  1T4Z A;  3QFB C;  4TXO A;  4ML1 A;  1ZYQ B;  2FHE A;  4ILF A;  4CW9 A;  6GSX A;  2B5E A;  3DXB A;  2H72 A;  3IR4 A;  3IC8 A;  2DBC A;  2H6X A;  5ELG A;  4HQS A;  2VD1 A;  5IPH A;  5H5S A;  3GUR A;  1HNB A;  2HLS A;  2HNL A;  1XW6 A;  1S3D A;  4Z2U A;  2RM5 A;  3D5J A;  3GKX A;  5AGY A;  2OAD A;  5H5Q A;  4MPG A;  1G0T A;  5F05 A;  1W89 A;  2HI7 A;  5JWR B;  1YEX A;  3O6T A;  2GDR A;  2MMN A;  1U3I A;  2FLS A;  2VIM A;  4V2L A;  2LEG A;  4JR6 A;  5ID2 A;  4MZB A;  1WJK A;  4XS4 A;  5JCU A;  1FW1 A;  3D6I A;  3FKF A;  3C7M A;  5ELA A;  4BPY A;  3QCP A;  3GL3 A;  4TN8 A;  1PMT A;  2YNX A;  1GLP A;  1TXX A;  5IQY A;  4XCS A;  4JR4 A;  1AQX A;  3N5O A;  5DAK B;  5GST A;  4GLT A;  3EMX A;  3CTF A;  2H1A A;  2HZF A;  2E7P A;  2GZY A;  2VL2 C;  3DD3 A;  4HZ4 A;  5CO3 A;  3LWA A;  1N2A A;  5LD0 A;  4JE1 A;  2HFD A;  3MNG A;  3IK7 A;  4CY8 A;  3VI7 A;  3U5R E;  4TVE A;  2VCW A;  5IMF A;  3UIW A;  5J5N A;  2MMO A;  2VCX A;  3TOU A;  2IFQ B;  4TR3 A;  4USS A;  3L78 A;  4ACS A;  1GTU A;  1HD2 A;  4ZL7 A;  5KEJ A;  1GSQ A;  2WJU A;  4I8B A;  3G7J A;  2FGX A;  1GUL A;  5COH A;  4NV5 A;  4RQX A;  4AGS A;  4EDY A;  3WGE A;  2XHF A;  3F0I A;  5ECO B;  4Z2R A;  3F63 A;  3MSZ A;  4MP4 A;  5ECR B;  2VL3 A;  2F51 A;  2C3Q A;  5ECN B;  1S3C A;  2F8A A;  2YJ7 A;  4JU5 A;  2B7K A;  2IMI A;  3VPT A;  4DSR A;  2WS2 A;  4AF2 A;  3E0U A;  3KZQ A;  4YQU A;  2I1U A;  16GS A;  5J9C A;  4MDC A;  1Z7R A;  2C0D A;  3ZLP A;  1EEJ A;  1PSQ A;  4N10 A;  2V1M A;  2F3M A;  1Q4J A;  3F8U A;  4F03 A;  4J2F A;  3FY7 A;  4F82 A;  3HZ8 A;  1ZYP A;  2CZ2 A;  5ECK B;  4PX1 A;  5IMV A;  3PH9 A;  3HXS A;  4EDZ A;  5GAN D;  3GRX A;  2AV4 A;  3BBY A;  2R4V A;  4POB A;  3DIE A;  3GTU B;  3Q18 A;  3GH9 A;  1FB6 A;  2YWI A;  3L4N A;  2MYG A;  3EU3 A;  2M80 A;  2KP2 A;  4HJM A;  4EE0 A;  3KP8 A;  4MH3 A;  1Z3E A;  1XIY A;  1CQG A;  4GRF A;  1XPV A;  3IAS 2;  2JZT A;  1THX A;  4KGI A;  2OA7 A;  4KSO A;  1G7O A;  3BJ5 A;  5E59 A;  5KOW A;  4HI7 A;  3Q19 A;  1A2M A;  1KBN A;  1ZZY A;  1GSS A;  4K1F A;  4DSS B;  1Z9H A;  4ZIJ A;  1B9Y C;  4E8H A;  2A2R A;  4I6X A;  4G10 A;  5B8A A;  4WBJ A;  2NBS A;  2YOI A;  4GF0 A;  3QAW A;  4FYU A;  1RW1 A;  4X1U A;  1VF2 A;  4ZBB A;  2JU5 A;  5DQY A;  5ECQ B;  5G1L A;  3FHK A;  2C80 A;  1QFN A;  2LRT A;  4NXI A;  1EP8 A;  5ECI B;  5CNW A;  1TW9 A;  2YV9 A;  3EU4 A;  3GYK A;  4JED A;  2LST A;  2VL2 A;  5L71 A;  4K7N A;  2WB9 A;  1G6W A;  5FT3 A;  3IE3 A;  4N0Z A;  5AIX A;  3GST A;  4POK A;  1VF3 A;  4L0U A;  22GS A;  3KM6 A;  3EYT A;  1EOG A;  2YZU A;  2H66 A;  2OBI A;  3UBL A;  1V9W A;  4IQ1 A;  4K5R A;  4ECB A;  3HKR A;  1GSE A;  1K0M A;  2OAC A;  3GFK A;  4Q5N A;  1ZYE A;  2LQO A;  3D22 A;  4BVX A;  2H8L A;  1ZGN A;  1XW9 A;  2JAD A;  3C71 A;  2N5A A;  5IO0 A;  1S3R A;  4BWQ A;  2H74 A;  4Q5R A;  2O8V B;  4QL7 A;  2E0Q A;  1SJI A;  3GKN A;  2C8U A;  1XOA A;  4N0V A;  2NTO A;  1PL1 A;  4KF9 A;  3ZIJ A;  4OO4 A;  1R26 A;  3C1R A;  3GTU A;  4D73 A;  1ERT A;  1TK0 B;  2R0C A;  1XWC A;  2FWF A;  1FAA A;  2B6M A;  3EE2 A;  1GTB A;  4K2X A;  4MH2 A;  1TK5 B;  3U6V A;  4O5Q A;  2JSY A;  2L6C A;  4LMW A;  4MF5 A;  5D96 A;  4MMM A;  3F4R A;  4MF6 A;  2CV4 A;  2R3X A;  3IXR A;  2CVK A;  4HQZ A;  3H93 A;  3GL5 A;  1DSB A;  2HSM A;  5ENU A;  4EXJ A;  4H86 A;  2WGR A;  4IW9 A;  1TOF A;  3LOR A;  4KH7 A;  3E3E A;  2YV7 A;  1THO A;  3A5W A;  3LEF A;  2GTU A;  3PIN A;  2EIR A;  1PD2 1;  1OKD A;  5CRD A;  3M1G A;  2IMF A;  4NHW A;  1GWC A;  12GS A;  3GKM A;  3ZFL A;  5INY A;  2OE3 A;  2DJ0 A;  2NVL A;  3VFI A;  1YKA A;  5DQS A;  3UL3 A;  1FO5 A;  3O3T A;  2YZH A;  4MPF A;  3IDV A;  4PQ1 A;  2F9S A;  3KIJ A;  3P2A A;  4MA9 A;  3WGX A;  3CSJ A;  5ABR A;  2WRT A;  5ECH B;  4OO5 A;  5JWQ B;  3DGQ A;  4PUF C;  2P0G A;  2TRC P;  4TXV A;  2FWE A;  4PNG A;  1FOH A;  4X4J A;  4O5R A;  1B9X C;  1E6B A;  3LXZ A;  2FWG A;  2V41 A;  2PMT A;  4IVF A;  4I97 A;  4KCA A;  2HRN A;  3F3Q A;  1TRW A;  3P7X A;  4LLR A;  1M3J A;  2H0G A;  1U3A A;  1WE0 A;  4GST A;  4BVY A;  5CAX A;  5DJM A;  5DDL A;  1H75 A;  1PRX A;  1O73 A;  4EIP A;  1XWG A;  2L6D A;  1OC3 A;  3FRC A;  1XVW A;  3LW9 A;  1EZK A;  3A2X A;  2K18 A;  3BCI A;  2VUP A;  1GUM A;  4L0W A;  1NW2 A;  4X43 A;  1SL2 B;  1YKC A;  2DC5 A;  2VCV A;  4Q5Q A;  1XCC A;  1SKW B;  3FK8 A;  2H73 A;  1BYE A;  3L0H A;  3TKR A;  1X9W B;  4NV2 A;  1WMJ A;  1AQV A;  2C0E A;  2D2Z A;  1SK2 A;  3LYP A;  4IHU A;  2MMZ A;  2IL3 A;  5DCH A;  4MJA A;  3MIX A;  4GTU A;  2RUE A;  1MEK A;  1NM3 A;  2FUG 2;  2YJH A;  2VD0 A;  1O6J A;  3IHQ A;  1XOB A;  2H01 A;  3E9J B;  2O7K A;  4EVM A;  4G19 A;  4KW6 A;  2DJ2 A;  4PTS A;  3QMX A;  1R4W A;  1EV9 A;  1ON4 A;  1DBY A;  2PBJ A;  2O87 A;  3ZFB A;  2M46 A;  3RPN A;  2H1D A;  5HR2 A;  2CQ9 A;  3CQF A;  2OE1 A;  3W8J A;  2PVQ A;  4V1A g;  2HXK A;  2LQQ A;  2LRC A;  4KA0 A;  1PA3 A;  2AYT A;  3JCM L;  2FA8 A;  1V98 A;  1JZO A;  2GSQ A;  1J9B A;  2I9H A;  3QOU A;  4MZW A;  3WT1 A;  3ME8 A;  2I81 A;  2LTK A;  1JLW A;  3TB2 A;  11GS A;  3F6D A;  3I43 A;  3ZZX A;  6GSW A;  1MTC A;  4ZXG A;  5G2Z A;  1K0C A;  3ZML A;  1T1V A;  18GS A;  2IMK A;  3GSS A;  4HU7 A;  3VWV A;  4YAV A;  1XVQ A;  5J9B A;  2R6K A;  4TW5 A;  1XBS A;  4PQI A;  3KTB A;  5IOX A;  5B6N A;  2C0F A;  3ZVJ A;  1K3O A;  3D21 A;  2WDU A;  4JZQ A;  4I5Q A;  5AIS A;  4LL1 B;  2YPM A;  1GSF A;  4LL4 B;  3A3T A;  4RI6 A;  5A4W A;  3GMF A;  3CYN A;  10GS A;  2GZP A;  3IRA A;  4BA7 A;  6GSY A;  1T3B A;  1T4Y A;  2KUC A;  4FH8 A;  1KNG A;  2QKE A;  1XXU A;  3HHV A;  3TRP A;  2A4H A;  1MDJ A;  4MZC A;  2IPA A;  1X5E A;  4RI7 A;  2V6K A;  3HVS A;  2XC2 A;  4AJ7 A;  4WKW A;  4ZBD A;  1ML6 A;  1SKS B;  2K8V A;  1WOU A;  5J3R A;  1EEM A;  3A5I A;  4FIW A;  2DJK A;  1X5D A;  5G31 A;  2XPD A;  1YEP A;  2JL4 A;  4ZBA A;  2QGV A;  4ECC A;  4WF5 A;  2AHE A;  3H8Q A;  3FR3 A;  1T8E B;  4XS1 A;  1ERW A;  1SEN A;  2GQK A;  1K0O A;  4F0C A;  4CHS A;  3DVX A;  2N5B A;  2O85 A;  4G0L A;  3WT2 A;  5KN3 A;  3O76 A;  4IS0 A;  1B4P A;  3QR6 A;  3Q6O A;  5FWG A;  2KOK A;  2CAI A;  2PN8 A;  2WCI A;  1TP9 A;  3GX0 A;  1UN2 A;  3GHA A;  2P5R A;  1M99 A;  4BVX B;  3IOS A;  3F6F A;  4I2T A;  1A8Y A;  4WBR D;  1SYR A;  6GSU A;  1HQO A;  2GT5 A;  4O5U A;  2LNS A;  4MF7 A;  3GNJ A;  4EL1 A;  3KMN A;  1DE1 A;  5B8B A;  5EVO A;  1TI1 A;  3RAZ A;  2OKA A;  4D73 B;  2X8H A;  3K8N A;  2AJQ B;  4TR0 A;  2I4A A;  4CDO A;  3GIX A;  2PER A;  4TOP A;  2OJL A;  3ERG A;  3FEU A;  3DEX A;  5DCG A;  1K0A A;  3F4T A;  5IMA A;  1EGO A;  1GTI A;  3KCM A;  2H1G A;  4ECI A;  4HJ2 A;  2RM6 A;  3ZL5 A;  1M9A A;  2H71 A;  1A2L A;  6GST A;  3OR5 A;  3ZTL A;  4LA1 A;  5JCW A;  3IA1 A;  3KTL A;  2VM2 A;  2GZZ A;  5LCZ A;  3N9J A;  2QA2 A;  2X8G A;  1NSW A;  1ST9 A;  2VLT A;  2N5F A;  1V40 A;  2DIY A;  3TOT A;  5IIZ A;  1YDK A;  3EIN A;  3ZIV A;  3LQ7 A;  5KN0 A;  3TJK A;  4KUN A;  4JRR A;  2CA8 A;  3KD0 A;  2HT9 A;  2H0H A;  4Q5F A;  1X5C A;  3VUR A;  1WRY A;  4V2N A;  4IP1 A;  5C00 A;  4PUA A;  5IMZ A;  1T7P B;  2VO4 A;  4HZ2 A;  1R7H A;  4XRD A;  2EIQ A;  4MLY A;  2CVD A;  1S3A A;  2HRF A;  1HNA A;  3LXT A;  4YH2 A;  4V1A p;  4IQA A;  3TKQ A;  1X9S B;  4O7H A;  3J7Y k;  2LJR A;  2DIZ A;  2XPE A;  4NAX A;  3M8N A;  4FQU A;  3SWL A;  2M72 A;  3HD5 A;  5J4U A;  4BVY B;  4FO5 A;  17GS A;  5B6M A;  2CZ3 A;  3WD6 A;  1F37 A;  4ZL9 A;  4RQR A;  5KN2 A;  2PU9 C;  4OCF A;  2LJA A;  5D73 A;  1Y25 A;  3CRU A;  5IPG A;  1OE7 A;  5GZZ B;  3DKS A;  4FYB A;  3ZRE A;  1BED A;  1JZR A;  4HDE A;  5FHI A;  2NDO A;  2DJJ A;  5H5R A;  4MCU A;  1WWJ A;  3TKS A;  1BJX A;  3FR6 A;  1BQ7 A;  2IMD A;  5CRG A;  2H0I A;  3QAV A;  5ECM B;  3HJO A;  1A24 A;  3C8E A;  1HYU A;  1EV4 A;  3M9K A;  4L5L A;  4HU9 A;  4IBP A;  2ON5 A;  1H4O A;  2PGT A;  1A2J A;  3LSZ A;  4YKG A;  2VAF A;  1TTZ A;  1XWA A;  3EVI A;  4BIK A;  1X9M B;  4BL7 B;  4OWY A;  1PX7 A;  3NIV A;  1B8X A;  5CP1 A;  5DVB A;  1M2D A;  1PX6 A;  2H30 A;  4OMV A;  4EO3 A;  2Z9S A;  1DE2 A;  1SK1 A;  4GCI A;  2JZS A;  4MJB A;  2EC4 A;  2HZE A;  3G7Y A;  1OC8 A;  3EWL A;  4K8M A;  2X4A A;  4GQC A;  2C3N A;  3ZMK A;  3KJY A;  4ID0 A;  5EY6 A;  6GSV A;  1CQH A;  2MBT A;  3UEM A;  3M0F A;  3RPP A;  1T00 A;  3WGD A;  1DUG A;  4POL A;  1GSU A;  4HUA A;  3CMI A;  3R3E A;  2MBS A;  2E2G A;  2DML A;  5EPF A;  5JCG A;  2EIO A;  5KOX A;  1SYX A;  2ZUP A;  3KEB A;  3TJF A;  2AAW A;  2XBI A;  3H79 A;  2OE0 A;  4CY6 A;  3IBH A;  4MNN A;  1SD8 A;  1GUK A;  5ECS A;  2PUK C;  1SJ6 A;  2GVP A;  2PPT A;  2R2J A;  2MZC A;  3G9B A;  1K3L A;  4GSS A;  1GLQ A;  1PFO A;  2FA4 A;  1QXH A;  2ALB A;  3PPU A;  2B5X A;  3F3R A;  3DVW A;  1JLV A;  4POM A;  2AB6 A;  4KSM A;  1SU9 A;  2UZ8 A;  3IC4 A;  3NOF A;  4L8E A;  1ILO A;  4K2D A;  3Q74 A;  1EGR A;  2YCD A;  3TDG A;  5HFI A;  4HS1 A;  1FVK A;  1AW9 A;  1AIU A;  4IJI A;  2PVO C;  4XTS A;  1Z6M A;  1XWK A;  2RUF A;  4OFM A;  1NHY A;  1M2A A;  3SBC A;  1U6T A;  4KX4 A;  3FZ9 A;  3M3M A;  1URM A;  2I3Y A;  2K9F A;  1JZD A;  3D0Z A;  1EWX A;  1SD9 A;  4OFN A;  1TU8 A;  4KAE A;  2HSY A;  1TJD A;  1TU7 A;  19GS A;  3D4M A;  4OCE A;  3QD9 A;  2GGT A;  1A0F A;  3UAP A;  2GS3 A;  3APS A;  1J0F A;  3KP9 A;  5HQP A;  2LKU A;  3G7I A;  2RII A;  1FHE A;  1Z6N A;  2DMM A;  4BL7 A;  4HSC X;  4IKH A;  4KDU A;  3VI5 A;  3RHB A;  1GSD A;  2H6Y A;  1JHB A;  1GSY A;  4L5O A;  1PKW A;  5CRW A;  1U87 A;  1K0N A;  4PNF A;  4EF0 A;  3MYD A;  2DSA A;  2GSR A;  5G5F A;  5LNK e;  5ECL B;  1ERV A;  5D8I A;  2LNT A;  2L4C A;  5IM9 A;  3APQ A;  2FNO A;  1HNC A;  2L57 A;  1PN9 A;  1I5G A;  1VGL A;  2YWN A;  2J23 A;  4TRX A;  2L5L A;  3KGK A;  3L9S A;  3TJJ A;  3I6A A;  5DAL A;  4N30 A;  4MAB A;  3FZA A;  3S9F A;  5BMU A;  2BMX A;  1FOV A;  3BD2 A;  2OBK A;  4XHM A;  2FD3 A;  4K5S A;  2TRX A;  2K8S A;  3KH7 A;  4WXT A;  2GLR A;  4NMU A;  3ZYW A;  1TI3 A;  5C04 A;  4NHZ A;  2WFC A;  4O92 A;  2GST A;  2H75 A;  1SK0 A;  4RUV A;  1O85 A;  2HSH A;  2L59 A;  3HA9 A;  4TR1 A;  2F8F A;  4WET A;  4WR5 A;  2JAC A;  4OFT A;  2GQM A;  1ERU A;  5A5K A;  1Z7P A;  2VOC A;  1KTE A;  3DYR A;  2B5Y A;  1YY7 A;  3IV4 A;  3H1N A;  4V2M A;  2WUL A;  4IN0 A;  2C0G A;  1WPI A;  2L4Q A;  4QL9 A;  2R37 A;  4G2E A;  2H70 A;  3HJM A;  5CRE A;  2A4V A;  3IAM 2;  4DEJ A;  1PQN A;  3HDC A;  4AJ6 A;  1OE8 A;  1OC9 B;  4PQH A;  3TGZ A;  2CX4 A;  2CX3 A;  3EMP A;  2V2G A;  1J08 A;  3C73 A;  4KDY A;  4K7O A;  2B7J A;  4DVC A;  1IYI A;  4ECJ A;  3LG6 A;  1GH2 A;  1F6M C;  4IJ3 A;  2GT6 A;  4KE3 A;  2IME A;  3HZ4 A;  1E2Y A;  2A2P A;  1QMV A;  3KH9 A;  3I69 A;  1Y6E A;  3W8S A;  4K6X A;  2R0P A;  4G0K A;  1V2A A;  4I2U A;  1JFU A;  1M0U A;  2MMA A;  2DJ1 A;  1OKT A;  2GSS A;  3LGC A;  4JBB A;  2REM A;  1GNW A;  1OVN A;  1TRV A;  1AAZ A;  2P5Q A;  5KN1 A;  4IP6 A;  1F3B A;  1YJ6 A;  9GSS A;  1AC1 A;  2VLU A;  3ME7 A;  1QK8 A;  2GQL A;  3US3 A;  1WP0 A;  3MAK A;  3IPZ A;  2FY6 A;  3TRX A;  5G5E A;  3TKS C;  1ZMA A;  2RLI A;  3CRT A;  4QQ7 A;  4N11 A;  4WF4 A;  3UJ1 A;  3L9U A;  2YP6 A;  3W6G A;  4ZL8 A;  1QUW A;  2VCQ A;  1QGV A;  1M3I A;  4G9H A;  2DKH A;  3EC3 A;  3C1S A;  5CRH A;  3L9V A;  3RDW A;  4LMV A;  4NPB A;  1PGT A;  1FG4 A;  1TKD B;  4PGT A;  4GSN A;  1XW5 A;  4IGJ A;  3VWX A;  4F2I A;  1V58 A;  1XZO A;  1GRX A;  1N8J A;  4XIH A;  3ZVJ D;  1Z5Y E;  2BTO T;  2KHP A;  2WZ9 A;  3P8W A;  5D93 A;  4DSQ A;  1RK4 A;  1F3A A;  2VCZ A;  4YAP A;  4IEL A;  4PUR A;  1AQW A;  1OAZ A;  3QDN A;  1G7E A;  2VL9 A;  4MJC A;  3D4T A;  3F4S A;  5D9X A;  3AY8 A;  3TUE A;  2LS5 A;  1OC9 A;  4K7I A;  1SL0 B;  3GN3 A;  5DJL A;  2C3T A;  1TRU A;  5HR1 A;  2A2S A;  5DAK A;  2HYX A;  2LRN A;  1VRS D;  4EKZ A;  2V32 A;  1O8W A;  2HZE B;  1UA5 A;  1K0B A;  3CBU A;  5D9W A;  5BRT A;  2DJ3 A;  5JWO B;  2TIR A;  1O8X A;  4Z2T A;  3TJG A;  3QAG A;  3M9J A;  1WIK A;  8GSS A;  1GUH A;  1ZCP A;  3GKK A;  1GNE A;  1XG8 A;  3LFL A;  3FR9 A;  4GQF A;  1B4Q A;  1YZX A;  2JSZ A;  3ED3 A;  4EC0 A;  1GL8 A;  1K3Y A;  2DKI A;  4MK3 A;  2QC7 A;  1FB0 A; 
#chains in the Genus database with same CATH homology
 1MDI A;  3TKS E;  2QSI A;  1PKZ A;  1B48 A;  2IFQ A;  1TDI A;  3UAR A;  4X0X A;  1LBK A;  3A2W A;  3EPT A;  5A4U A;  1VF1 A;  20GS A;  5G30 A;  2YN1 A;  1K0D A;  2VM1 A;  4GWR A;  1GTA A;  3CXG A;  3ERW A;  2J9H A;  2C4J A;  3HJP A;  3LYK A;  3FYG A;  2L5O A;  1G6Y A;  1SJZ A;  4ULX A;  3WYW A;  1C72 A;  3TJB A;  4KB3 A;  2IN3 A;  3IHG A;  4WR4 A;  3MDK A;  2H19 A;  1UC7 A;  4XRA A;  1JZW A;  5G1K A;  1ZL9 A;  2K6V A;  4YKF A;  3DML A;  4Z7X A;  1KEB A;  2LV3 A;  2H6Z A;  6GSS A;  4J57 E;  3GUS A;  2B1L A;  3FZ5 A;  1TRS A;  4ZB8 A;  3UVH A;  1BG5 A;  3HY2 A;  1EP7 A;  2YWO A;  7GSS A;  3VPQ A;  2YAN A;  2O89 A;  4K0N A;  2CT6 A;  3VWU A;  4KDX A;  2JZR A;  1R5P A;  1GP1 A;  4G0I A;  3KXO A;  3VK9 A;  1EOH A;  2HRA A;  1FVJ A;  3HVX A;  1W4V A;  3HYP A;  3PR8 A;  4NWY A;  5HR0 A;  5F07 A;  1I9D A;  3CTG A;  3R2Q A;  2ZCT A;  3UBK A;  5GSS A;  2DLX A;  3FMW A;  5HR3 A;  1M7T A;  4A5P A;  1AUC A;  1ZOF A;  2B1K A;  3APO A;  2VLV A;  1ABA A;  2ES7 A;  4P3Y B;  2X64 A;  3RHC A;  3MWH A;  2NPB A;  2XBQ A;  1M2B A;  3UOM A;  5J41 A;  5E4W A;  4HEA 2;  1YQ1 A;  1V57 A;  1ACV A;  2HRK A;  1YF0 A;  4DSS A;  4EIQ A;  4PXO A;  3IK9 A;  4TR4 A;  3TCO A;  2HE3 A;  2FCH A;  3DWV A;  4YQV A;  1PN0 A;  1MDK A;  2C1Y A;  3V1W A;  1Q98 A;  2IJY A;  2X8C A;  1A8L A;  1IYH A;  1PL2 A;  1XWB A;  2H76 A;  1VF4 A;  5GAP D;  1YF1 A;  4O32 A;  2B3S A;  3PGT A;  4TXO B;  2LUS A;  4HOJ A;  5IO2 A;  2FWH A;  4F9Z A;  1X0R A;  4ML6 A;  3A2V A;  2X99 A;  5DAL B;  3BCK A;  1AXD A;  3GV1 A;  3HVV A;  5AIV A;  3GH6 A;  3QPM A;  2V6O A;  3UVT A;  3QFA C;  2CVB A;  2KLX A;  5A4V A;  1LJR A;  2E2M A;  1U88 A;  1A23 A;  3LJR A;  5B7C A;  2X49 A;  3CSH A;  3TKP A;  1MD4 A;  1BX9 A;  2VCT A;  3NZN A;  1LU4 A;  1QQ2 A;  3HCZ A;  4FYC A;  4MJE A;  3P90 A;  5D9V A;  4TR1 B;  1F2E A;  2IWT A;  1USB A;  5HFG A;  3VWW A;  2QA1 A;  5CYY A;  5IMC A;  5IOW A;  5ID2 B;  4XS4 B;  4J56 E;  5IMD A;  1M9B A;  1OYJ A;  4K9Z A;  1SKR B;  4XS6 A;  2G2Q A;  1XFL A;  3UMA A;  3FZ4 A;  4WEY A;  4OD7 A;  2BJX A;  4F0B A;  4ZIL A;  4ISD A;  1MD3 A;  1O7U A;  2YWM A;  2R5G A;  1R5A A;  14GS A;  3TRQ A;  3ZIT A;  3BOA A;  1ZYN A;  2PWJ A;  3H4K A;  1SL1 B;  4TKY A;  2ZNM A;  3DRN A;  4EUY A;  3GA4 A;  3FW2 A;  1RQM A;  5F0G A;  5EL8 A;  5HFK A;  2R0G A;  3ZRD A;  4ICY A;  2KP1 A;  4ZB9 A;  2ON7 A;  5ECP B;  4YQM A;  1O81 A;  4AJ8 A;  4BWS A;  2G0F A;  5DBQ A;  3J7Y b;  13GS A;  4KCE A;  1A0R P;  3ERF A;  1BAY A;  3ISO A;  4ZB6 A;  3EUR A;  4K0G A;  4E8E A;  3RBT A;  5D9T A;  3GX8 A;  5AN1 A;  2H1B A;  1UVZ A;  5F06 A;  2CAQ A;  2LJK A;  4GXZ A;  1F9M A;  4KND A;  3KMO A;  1TK8 B;  3F9U A;  1NHO A;  2AUV A;  2IIY A;  3I9V 2;  2P31 A;  3CSI A;  3VLN A;  5F8B A;  1T4Z A;  3QFB C;  4TXO A;  4ML1 A;  1ZYQ B;  2FHE A;  4ILF A;  4CW9 A;  6GSX A;  2B5E A;  3DXB A;  2H72 A;  3IR4 A;  3IC8 A;  2DBC A;  2H6X A;  5ELG A;  4HQS A;  2VD1 A;  5IPH A;  5H5S A;  3GUR A;  1HNB A;  2HLS A;  2HNL A;  1XW6 A;  1S3D A;  4Z2U A;  2RM5 A;  3D5J A;  3GKX A;  5AGY A;  2OAD A;  5H5Q A;  4MPG A;  1G0T A;  5F05 A;  1W89 A;  2HI7 A;  5JWR B;  1YEX A;  3O6T A;  2GDR A;  2MMN A;  1U3I A;  2FLS A;  2VIM A;  4V2L A;  2LEG A;  4JR6 A;  5ID2 A;  4MZB A;  1WJK A;  4XS4 A;  5JCU A;  1FW1 A;  3D6I A;  3FKF A;  3C7M A;  5ELA A;  4BPY A;  3QCP A;  3GL3 A;  4TN8 A;  1PMT A;  2YNX A;  1GLP A;  1TXX A;  5IQY A;  4XCS A;  4JR4 A;  1AQX A;  3N5O A;  5DAK B;  5GST A;  4GLT A;  3EMX A;  3CTF A;  2H1A A;  2HZF A;  2E7P A;  2GZY A;  2VL2 C;  3DD3 A;  4HZ4 A;  5CO3 A;  3LWA A;  1N2A A;  5LD0 A;  4JE1 A;  2HFD A;  3MNG A;  3IK7 A;  4CY8 A;  3VI7 A;  3U5R E;  4TVE A;  2VCW A;  5IMF A;  3UIW A;  5J5N A;  2MMO A;  2VCX A;  3TOU A;  2IFQ B;  4TR3 A;  4USS A;  3L78 A;  4ACS A;  1GTU A;  1HD2 A;  4ZL7 A;  5KEJ A;  1GSQ A;  2WJU A;  4I8B A;  3G7J A;  2FGX A;  1GUL A;  5COH A;  4NV5 A;  4RQX A;  4AGS A;  4EDY A;  3WGE A;  2XHF A;  3F0I A;  5ECO B;  4Z2R A;  3F63 A;  3MSZ A;  4MP4 A;  5ECR B;  2VL3 A;  2F51 A;  2C3Q A;  5ECN B;  1S3C A;  2F8A A;  2YJ7 A;  4JU5 A;  2B7K A;  2IMI A;  3VPT A;  4DSR A;  2WS2 A;  4AF2 A;  3E0U A;  3KZQ A;  4YQU A;  2I1U A;  16GS A;  5J9C A;  4MDC A;  1Z7R A;  2C0D A;  3ZLP A;  1EEJ A;  1PSQ A;  4N10 A;  2V1M A;  2F3M A;  1Q4J A;  3F8U A;  4F03 A;  4J2F A;  3FY7 A;  4F82 A;  3HZ8 A;  1ZYP A;  2CZ2 A;  5ECK B;  4PX1 A;  5IMV A;  3PH9 A;  3HXS A;  4EDZ A;  5GAN D;  3GRX A;  2AV4 A;  3BBY A;  2R4V A;  4POB A;  3DIE A;  3GTU B;  3Q18 A;  3GH9 A;  1FB6 A;  2YWI A;  3L4N A;  2MYG A;  3EU3 A;  2M80 A;  2KP2 A;  4HJM A;  4EE0 A;  3KP8 A;  4MH3 A;  1Z3E A;  1XIY A;  1CQG A;  4GRF A;  1XPV A;  3IAS 2;  2JZT A;  1THX A;  4KGI A;  2OA7 A;  4KSO A;  1G7O A;  3BJ5 A;  5E59 A;  5KOW A;  4HI7 A;  3Q19 A;  1A2M A;  1KBN A;  1ZZY A;  1GSS A;  4K1F A;  4DSS B;  1Z9H A;  4ZIJ A;  1B9Y C;  4E8H A;  2A2R A;  4I6X A;  4G10 A;  5B8A A;  4WBJ A;  2NBS A;  2YOI A;  4GF0 A;  3QAW A;  4FYU A;  1RW1 A;  4X1U A;  1VF2 A;  4ZBB A;  2JU5 A;  5DQY A;  5ECQ B;  5G1L A;  3FHK A;  2C80 A;  1QFN A;  2LRT A;  4NXI A;  1EP8 A;  5ECI B;  5CNW A;  1TW9 A;  2YV9 A;  3EU4 A;  3GYK A;  4JED A;  2LST A;  2VL2 A;  5L71 A;  4K7N A;  2WB9 A;  1G6W A;  5FT3 A;  3IE3 A;  4N0Z A;  5AIX A;  3GST A;  4POK A;  1VF3 A;  4L0U A;  22GS A;  3KM6 A;  3EYT A;  1EOG A;  2YZU A;  2H66 A;  2OBI A;  3UBL A;  1V9W A;  4IQ1 A;  4K5R A;  4ECB A;  3HKR A;  1GSE A;  1K0M A;  2OAC A;  3GFK A;  4Q5N A;  1ZYE A;  2LQO A;  3D22 A;  4BVX A;  2H8L A;  1ZGN A;  1XW9 A;  2JAD A;  3C71 A;  2N5A A;  5IO0 A;  4BWQ A;  2H74 A;  4Q5R A;  2O8V B;  4QL7 A;  2E0Q A;  1SJI A;  3GKN A;  2C8U A;  1XOA A;  4N0V A;  2NTO A;  1PL1 A;  4KF9 A;  3ZIJ A;  4OO4 A;  1R26 A;  3C1R A;  3GTU A;  4D73 A;  1ERT A;  1TK0 B;  2R0C A;  1XWC A;  2FWF A;  1FAA A;  2B6M A;  3EE2 A;  1GTB A;  4K2X A;  4MH2 A;  1TK5 B;  3U6V A;  4O5Q A;  2JSY A;  2L6C A;  4LMW A;  4MF5 A;  5D96 A;  4MMM A;  3F4R A;  4MF6 A;  2CV4 A;  2R3X A;  3IXR A;  2CVK A;  4HQZ A;  3H93 A;  3GL5 A;  1DSB A;  2HSM A;  5ENU A;  4EXJ A;  4H86 A;  2WGR A;  4IW9 A;  1TOF A;  3LOR A;  4KH7 A;  3E3E A;  2YV7 A;  1THO A;  3A5W A;  3LEF A;  2GTU A;  3PIN A;  2EIR A;  1PD2 1;  1OKD A;  5CRD A;  3M1G A;  2IMF A;  4NHW A;  1GWC A;  12GS A;  3GKM A;  3ZFL A;  5INY A;  2OE3 A;  2DJ0 A;  2NVL A;  3VFI A;  1YKA A;  5DQS A;  3UL3 A;  1FO5 A;  3O3T A;  2YZH A;  4MPF A;  3IDV A;  4PQ1 A;  2F9S A;  3KIJ A;  3P2A A;  4MA9 A;  3WGX A;  3CSJ A;  5ABR A;  2WRT A;  5ECH B;  4OO5 A;  5JWQ B;  3DGQ A;  4PUF C;  2P0G A;  2TRC P;  4TXV A;  2FWE A;  4PNG A;  1FOH A;  4X4J A;  4O5R A;  1B9X C;  1E6B A;  3LXZ A;  2FWG A;  2V41 A;  2PMT A;  4IVF A;  4I97 A;  4KCA A;  2HRN A;  3F3Q A;  1TRW A;  3P7X A;  4LLR A;  2H0G A;  1U3A A;  1WE0 A;  4GST A;  4BVY A;  5CAX A;  5DJM A;  5DDL A;  1H75 A;  1PRX A;  1O73 A;  4EIP A;  1XWG A;  2L6D A;  1OC3 A;  3FRC A;  1XVW A;  3LW9 A;  1EZK A;  3A2X A;  2K18 A;  3BCI A;  2VUP A;  1GUM A;  4L0W A;  1NW2 A;  4X43 A;  1SL2 B;  1YKC A;  2DC5 A;  2VCV A;  4Q5Q A;  1XCC A;  1SKW B;  3FK8 A;  2H73 A;  1BYE A;  3L0H A;  3TKR A;  1X9W B;  4NV2 A;  1WMJ A;  1AQV A;  2C0E A;  2D2Z A;  1SK2 A;  3LYP A;  4IHU A;  2MMZ A;  2IL3 A;  5DCH A;  4MJA A;  3MIX A;  4GTU A;  2RUE A;  1MEK A;  1NM3 A;  2FUG 2;  2YJH A;  2VD0 A;  1O6J A;  3IHQ A;  1XOB A;  2H01 A;  3E9J B;  2O7K A;  4EVM A;  4G19 A;  4KW6 A;  2DJ2 A;  4PTS A;  3QMX A;  1R4W A;  1EV9 A;  1ON4 A;  1DBY A;  2PBJ A;  2O87 A;  3ZFB A;  2M46 A;  3RPN A;  2H1D A;  5HR2 A;  2CQ9 A;  2OE1 A;  3W8J A;  2PVQ A;  4V1A g;  2HXK A;  2LQQ A;  2LRC A;  4KA0 A;  1PA3 A;  2AYT A;  3JCM L;  2FA8 A;  1V98 A;  1JZO A;  2GSQ A;  1J9B A;  2I9H A;  3QOU A;  4MZW A;  3WT1 A;  3ME8 A;  2I81 A;  2LTK A;  1JLW A;  3TB2 A;  11GS A;  3F6D A;  3I43 A;  3ZZX A;  6GSW A;  1MTC A;  4ZXG A;  5G2Z A;  1K0C A;  3ZML A;  1T1V A;  18GS A;  2IMK A;  3GSS A;  4HU7 A;  3VWV A;  4YAV A;  1XVQ A;  5J9B A;  2R6K A;  4TW5 A;  1XBS A;  4PQI A;  3KTB A;  5IOX A;  5B6N A;  2C0F A;  3ZVJ A;  1K3O A;  3D21 A;  2WDU A;  4JZQ A;  4I5Q A;  5AIS A;  4LL1 B;  2YPM A;  1GSF A;  4LL4 B;  3A3T A;  4RI6 A;  5A4W A;  3GMF A;  3CYN A;  10GS A;  2GZP A;  3IRA A;  4BA7 A;  6GSY A;  1T3B A;  1T4Y A;  2KUC A;  4FH8 A;  1KNG A;  2QKE A;  1XXU A;  3HHV A;  3TRP A;  2A4H A;  1MDJ A;  4MZC A;  2IPA A;  1X5E A;  4RI7 A;  2V6K A;  3HVS A;  2XC2 A;  4AJ7 A;  4WKW A;  4ZBD A;  1ML6 A;  1SKS B;  2K8V A;  1WOU A;  5J3R A;  1EEM A;  3A5I A;  4FIW A;  2DJK A;  1X5D A;  5G31 A;  2XPD A;  1YEP A;  2JL4 A;  4ZBA A;  2QGV A;  4ECC A;  4WF5 A;  2AHE A;  3H8Q A;  3FR3 A;  1T8E B;  4XS1 A;  1ERW A;  1SEN A;  2GQK A;  1K0O A;  4F0C A;  4CHS A;  3DVX A;  2N5B A;  2O85 A;  4G0L A;  3WT2 A;  5KN3 A;  3O76 A;  4IS0 A;  1B4P A;  3QR6 A;  3Q6O A;  5FWG A;  2KOK A;  2CAI A;  2PN8 A;  2WCI A;  1TP9 A;  3GX0 A;  1UN2 A;  3GHA A;  2P5R A;  1M99 A;  4BVX B;  3IOS A;  3F6F A;  4I2T A;  1A8Y A;  4WBR D;  1SYR A;  6GSU A;  1HQO A;  2GT5 A;  4O5U A;  2LNS A;  4MF7 A;  3GNJ A;  4EL1 A;  3KMN A;  1DE1 A;  5B8B A;  5EVO A;  1TI1 A;  3RAZ A;  2OKA A;  4D73 B;  2X8H A;  3K8N A;  2AJQ B;  4TR0 A;  2I4A A;  4CDO A;  3GIX A;  2PER A;  4TOP A;  2OJL A;  3ERG A;  3FEU A;  3DEX A;  5DCG A;  1K0A A;  3F4T A;  5IMA A;  1EGO A;  1GTI A;  3KCM A;  2H1G A;  4ECI A;  4HJ2 A;  2RM6 A;  3ZL5 A;  1M9A A;  2H71 A;  1A2L A;  6GST A;  3OR5 A;  3ZTL A;  4LA1 A;  5JCW A;  3IA1 A;  3KTL A;  2VM2 A;  2GZZ A;  5LCZ A;  3N9J A;  2QA2 A;  2X8G A;  1NSW A;  1ST9 A;  2VLT A;  2N5F A;  1V40 A;  2DIY A;  3TOT A;  5IIZ A;  1YDK A;  3EIN A;  3ZIV A;  3LQ7 A;  5KN0 A;  3TJK A;  4KUN A;  4JRR A;  2CA8 A;  3KD0 A;  2HT9 A;  2H0H A;  4Q5F A;  1X5C A;  3VUR A;  1WRY A;  4V2N A;  4IP1 A;  5C00 A;  4PUA A;  5IMZ A;  1T7P B;  2VO4 A;  4HZ2 A;  1R7H A;  4XRD A;  2EIQ A;  4MLY A;  2CVD A;  1S3A A;  2HRF A;  1HNA A;  3LXT A;  4YH2 A;  4V1A p;  4IQA A;  3TKQ A;  1X9S B;  4O7H A;  3J7Y k;  2LJR A;  2DIZ A;  2XPE A;  4NAX A;  3M8N A;  4FQU A;  3SWL A;  2M72 A;  3HD5 A;  5J4U A;  4BVY B;  4FO5 A;  17GS A;  5B6M A;  2CZ3 A;  3WD6 A;  1F37 A;  4ZL9 A;  4RQR A;  5KN2 A;  2PU9 C;  4OCF A;  2LJA A;  5D73 A;  1Y25 A;  3CRU A;  5IPG A;  1OE7 A;  5GZZ B;  3DKS A;  4FYB A;  3ZRE A;  1BED A;  1JZR A;  4HDE A;  5FHI A;  2NDO A;  2DJJ A;  5H5R A;  4MCU A;  1WWJ A;  3TKS A;  1BJX A;  3FR6 A;  1BQ7 A;  2IMD A;  5CRG A;  2H0I A;  3QAV A;  5ECM B;  3HJO A;  1A24 A;  3C8E A;  1HYU A;  1EV4 A;  3M9K A;  4L5L A;  4HU9 A;  4IBP A;  2ON5 A;  1H4O A;  2PGT A;  1A2J A;  3LSZ A;  4YKG A;  2VAF A;  1TTZ A;  1XWA A;  3EVI A;  1X9M B;  4BL7 B;  4OWY A;  1PX7 A;  3NIV A;  1B8X A;  5CP1 A;  5DVB A;  1M2D A;  1PX6 A;  2H30 A;  4OMV A;  4EO3 A;  2Z9S A;  1DE2 A;  1SK1 A;  4GCI A;  2JZS A;  4MJB A;  2EC4 A;  2HZE A;  3G7Y A;  1OC8 A;  3EWL A;  4K8M A;  2X4A A;  4GQC A;  2C3N A;  3ZMK A;  3KJY A;  4ID0 A;  5EY6 A;  6GSV A;  1CQH A;  2MBT A;  3UEM A;  3M0F A;  3RPP A;  1T00 A;  3WGD A;  1DUG A;  4POL A;  1GSU A;  4HUA A;  3CMI A;  3R3E A;  2MBS A;  2E2G A;  2DML A;  5EPF A;  5JCG A;  2EIO A;  5KOX A;  1SYX A;  2ZUP A;  3KEB A;  3TJF A;  2AAW A;  2XBI A;  3H79 A;  2OE0 A;  4CY6 A;  3IBH A;  4MNN A;  1SD8 A;  1GUK A;  5ECS A;  2PUK C;  1SJ6 A;  2GVP A;  2PPT A;  2R2J A;  2MZC A;  3G9B A;  1K3L A;  4GSS A;  1GLQ A;  2FA4 A;  1QXH A;  2ALB A;  3PPU A;  2B5X A;  3F3R A;  3DVW A;  1JLV A;  4POM A;  2AB6 A;  4KSM A;  1SU9 A;  2UZ8 A;  3IC4 A;  3NOF A;  4L8E A;  1ILO A;  4K2D A;  3Q74 A;  1EGR A;  2YCD A;  3TDG A;  5HFI A;  4HS1 A;  1FVK A;  1AW9 A;  1AIU A;  4IJI A;  2PVO C;  4XTS A;  1Z6M A;  1XWK A;  2RUF A;  4OFM A;  1NHY A;  1M2A A;  3SBC A;  1U6T A;  4KX4 A;  3FZ9 A;  3M3M A;  1URM A;  2I3Y A;  2K9F A;  1JZD A;  3D0Z A;  1EWX A;  1SD9 A;  4OFN A;  1TU8 A;  4KAE A;  2HSY A;  1TJD A;  1TU7 A;  19GS A;  3D4M A;  4OCE A;  3QD9 A;  2GGT A;  1A0F A;  3UAP A;  2GS3 A;  3APS A;  1J0F A;  3KP9 A;  5HQP A;  2LKU A;  3G7I A;  2RII A;  1FHE A;  1Z6N A;  2DMM A;  4BL7 A;  4IKH A;  4KDU A;  3VI5 A;  3RHB A;  1GSD A;  2H6Y A;  1JHB A;  1GSY A;  4L5O A;  1PKW A;  5CRW A;  1U87 A;  1K0N A;  4PNF A;  4EF0 A;  3MYD A;  2DSA A;  2GSR A;  5G5F A;  5LNK e;  5ECL B;  1ERV A;  5D8I A;  2LNT A;  2L4C A;  5IM9 A;  3APQ A;  2FNO A;  1HNC A;  2L57 A;  1PN9 A;  1I5G A;  1VGL A;  2YWN A;  2J23 A;  4TRX A;  2L5L A;  3KGK A;  3L9S A;  3TJJ A;  3I6A A;  5DAL A;  4N30 A;  4MAB A;  3FZA A;  3S9F A;  5BMU A;  2BMX A;  1FOV A;  3BD2 A;  2OBK A;  4XHM A;  2FD3 A;  4K5S A;  2TRX A;  2K8S A;  3KH7 A;  4WXT A;  2GLR A;  4NMU A;  3ZYW A;  1TI3 A;  5C04 A;  4NHZ A;  2WFC A;  4O92 A;  2GST A;  2H75 A;  1SK0 A;  4RUV A;  1O85 A;  2HSH A;  2L59 A;  3HA9 A;  4TR1 A;  2F8F A;  4WET A;  4WR5 A;  2JAC A;  4OFT A;  2GQM A;  1ERU A;  5A5K A;  1Z7P A;  2VOC A;  1KTE A;  3DYR A;  2B5Y A;  1YY7 A;  3IV4 A;  3H1N A;  4V2M A;  2WUL A;  4IN0 A;  2C0G A;  1WPI A;  2L4Q A;  4QL9 A;  2R37 A;  4G2E A;  2H70 A;  3HJM A;  5CRE A;  2A4V A;  3IAM 2;  4DEJ A;  1PQN A;  3HDC A;  4AJ6 A;  1OE8 A;  1OC9 B;  4PQH A;  3TGZ A;  2CX4 A;  2CX3 A;  3EMP A;  2V2G A;  1J08 A;  3C73 A;  4KDY A;  4K7O A;  2B7J A;  4DVC A;  1IYI A;  4ECJ A;  3LG6 A;  1GH2 A;  1F6M C;  4IJ3 A;  2GT6 A;  4KE3 A;  2IME A;  3HZ4 A;  1E2Y A;  2A2P A;  1QMV A;  3KH9 A;  3I69 A;  1Y6E A;  3W8S A;  4K6X A;  2R0P A;  4G0K A;  1V2A A;  4I2U A;  1JFU A;  1M0U A;  2MMA A;  2DJ1 A;  1OKT A;  2GSS A;  3LGC A;  4JBB A;  2REM A;  1GNW A;  1OVN A;  1TRV A;  1AAZ A;  2P5Q A;  5KN1 A;  4IP6 A;  1F3B A;  1YJ6 A;  9GSS A;  1AC1 A;  2VLU A;  3ME7 A;  1QK8 A;  2GQL A;  3US3 A;  1WP0 A;  3MAK A;  3IPZ A;  2FY6 A;  3TRX A;  5G5E A;  3TKS C;  1ZMA A;  2RLI A;  3CRT A;  4QQ7 A;  4N11 A;  4WF4 A;  3UJ1 A;  3L9U A;  2YP6 A;  3W6G A;  4ZL8 A;  1QUW A;  2VCQ A;  1QGV A;  4G9H A;  2DKH A;  3EC3 A;  3C1S A;  5CRH A;  3L9V A;  3RDW A;  4LMV A;  4NPB A;  1PGT A;  1FG4 A;  1TKD B;  4PGT A;  4GSN A;  1XW5 A;  4IGJ A;  3VWX A;  4F2I A;  1V58 A;  1XZO A;  1GRX A;  1N8J A;  4XIH A;  3ZVJ D;  1Z5Y E;  2BTO T;  2KHP A;  2WZ9 A;  3P8W A;  5D93 A;  4DSQ A;  1RK4 A;  1F3A A;  2VCZ A;  4YAP A;  4IEL A;  4PUR A;  1AQW A;  1OAZ A;  3QDN A;  1G7E A;  2VL9 A;  4MJC A;  3D4T A;  3F4S A;  5D9X A;  3AY8 A;  3TUE A;  2LS5 A;  1OC9 A;  4K7I A;  1SL0 B;  3GN3 A;  5DJL A;  2C3T A;  1TRU A;  5HR1 A;  2A2S A;  5DAK A;  2HYX A;  2LRN A;  1VRS D;  4EKZ A;  2V32 A;  1O8W A;  2HZE B;  1UA5 A;  1K0B A;  3CBU A;  5D9W A;  5BRT A;  2DJ3 A;  5JWO B;  2TIR A;  1O8X A;  4Z2T A;  3TJG A;  3QAG A;  3M9J A;  1WIK A;  8GSS A;  1GUH A;  1ZCP A;  3GKK A;  1GNE A;  3LFL A;  3FR9 A;  4GQF A;  1B4Q A;  1YZX A;  2JSZ A;  3ED3 A;  4EC0 A;  1GL8 A;  1K3Y A;  2DKI A;  4MK3 A;  2QC7 A;  1FB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...