3IPZA

Crystal structure of arabidopsis monothiol glutaredoxin atgrxcp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
SALTPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKAMCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, oxidoreductase
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structure of Arabidopsis chloroplastic monothiol glutaredoxin AtGRXcp.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 35
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ipzA01
2B5EA 5IMVA 2ZNMA 1PQNA 3K8NA 5IM9A 1E2YA 1ZGNA 4HOJA 3VK9A 1BEDA 4RQRA 5KN1A 1T4ZA 5ECRB 5GAND 4HS1A 3LORA 4POKA 3A2XA 1JZRA 4O92A 1XVQA 4DEJA 1PSQA 4EUYA 4EL1A 1GNEA 5IO2A 1GTIA 2H0GA 4HQZA 2CVKA 1ERVA 1V9WA 4EE0A 3TKSC 2F8AA 3O3TA 1OVNA 2WDUA 3CYNA 5DCHA 3C7MA 1MD3A 3O76A 2A2SA 5HQPA 3EE2A 4L5LA 1B8XA 1TU8A 5AIXA 1NHYA 3WT2A 3EMXA 5IPGA 2CZ2A 2VCQA 6GSWA 3FKFA 3EC3A 2J23A 13GSA 4TR0A 4CDOA 3DEXA 2ON5A 4HI7A 3GIXA 3I6AA 1A2JA 12GSA 2E7PA 3VLNA 2LS5A 4MK3A 4IVFA 2B7KA 3DKSA 4BL7A 1PKZA 5ECKB 3P90A 1H4OA 2H70A 4OMVA 3G7YA 4OWYA 2LV3A 1SKSB 4K7IA 2VL2C 4WF4A 5D9XA 1SL0B 1PGTA 4CHSA 1EV9A 3W8SA 1GH2A 4RQXA 1WWJA 1VF3A 2NBSA 3EURA 4ULXA 9GSSA 2L5LA 3FRCA 1TRUA 4TR4A 4TRXA 3UBLA 5G5FA 3C73A 4BVXA 3DXBA 3MNGA 2B6MA 3FHKA 5E4WA 3US3A 3KTLA 4FIWA 4ECBA 4HZ2A 2C0FA 3TJKA 4WETA 4HUAA 4K8MA 2L57A 2PU9C 3W6GA 1OKDA 2HFDA 3M0FA 3VWVA 5B6MA 1E6BA 1TRVA 2LKUA 3WGXA 1S3AA 3TJFA 2YJ7A 1Q98A 4ZB9A 1BJXA 3BCKA 1O7UA 4YQMA 1XCCA 4NAXA 2NVLA 4IQ1A 4OCFA 4JBBA 3G7JA 2O8VB 4EVMA 2LTKA 2YZHA 4ZL7A 2JZRA 2YJHA 3GMFA 1GTBA 1MEKA 2DSAA 1FVJA 2E2GA 3U5RE 5C00A 3APQA 1EP8A 1T00A 2RM6A 2L4CA 4I2UA 4DSQA 3C8EA 1Z6NA 1X9SB 3D6IA 3M1GA 5F07A 3TKRA 2XBIA 2H76A 5J41A 4N0VA 5CP1A 3HY2A 5HFGA 3IR4A 11GSA 1G6YA 2YWOA 1ABAA 2CX3A 1MDKA 3VFIA 2PUKC 3ZFLA 4F0BA 4WBRD 4GTUA 4MZWA 2R3XA 1Y6EA 3F0IA 1UVZA 4JZQA 1OKTA 4FYUA 5IPHA 1O6JA 2HSYA 2AJQB 4F03A 2VD0A 4X0XA 2H71A 5ELAA 2RUFA 5CO3A 1YEXA 3SWLA 2I81A 3TJGA 1YF0A 1J08A 2H30A 2CT6A 2WULA 4KW6A 3TUEA 3EVIA 2I1UA 4XS6A 2AB6A 2WFCA 4LA1A 6GSXA 4XS1A 1XFLA 3QPMA 2IPAA 3C1RA 1NM3A 1XW6A 3GHAA 5H5RA 3RDWA 3L78A 4L8EA 2MBSA 1K3OA 4AJ8A 5ELGA 2RIIA 1A0RP 3EWLA 5JWRB 3VI7A 4PXOA 5J9CA 4GSSA 2J9HA 5CRDA 2R2JA 3ZFBA 3M9JA 2PPTA 2GZYA 3DWVA 5IMAA 1K3YA 1M2AA 1TDIA 4PX1A 1LU4A 3CXGA 4N11A 2FWHA 4BPYA 4MMMA 2V1MA 4IW9A 2GQMA 3QFAC 3H79A 5DCGA 1QFNA 3F8UA 2G2QA 1ZMAA 1XWKA 3QAWA 1JZDA 2HYXA 5IIZA 3I43A 3FZ4A 3GYKA 1K0CA 4MH3A 2IMIA 4L0UA 3HVXA 5CRWA 1GUHA 2C3QA 4LMWA 5KN3A 2IMDA 3HCZA 3D22A 2C80A 17GSA 5IQYA 4PQIA 4POBA 1TRWA 4NMUA 1HNAA 5DBQA 1MDJA 1ZL9A 5ECIB 3GN3A 3LSZA 1AAZA 3ZZXA 2MMZA 2VM2A 2GQKA 3GH9A 3G9BA 3RHBA 1AIUA 3ZIVA 4ACSA 2RLIA 20GSA 1EP7A 4GCIA 3HXSA 2O7KA 2VLVA 2PMTA 1SK0A 1K0OA 1KNGA 3KIJA 1M2DA 1XIYA 3D5JA 1GSYA 2PBJA 2PGTA 1VF2A 1Y25A 2GZPA 1FAAA 2DJ1A 4MH2A 3ZRDA 5DAKA 4Q5NA 1SYRA 4YAVA 4Q5QA 4X1UA 3Q18A 1TK0B 2E0QA 2HI7A 3WGEA 1MDIA 5G1LA 3LWAA 3C71A 1TRSA 2LJRA 2DJ0A 2M46A 2XBQA 5ECNB 1QXHA 3ZIJA 5DQSA 2EIQA 2H1AA 3FY7A 4TOPA 5ECPB 4MLYA 3QDNA 2BTOT 4MJAA 1K3LA 1FW1A 4WBJA 4F9ZA 2C0EA 4EO3A 4F2IA 1XOAA 1T7PB 1CQGA 4HJMA 3I69A 3LXZA 5DAKB 1MTCA 3IBHA 3QD9A 2LUSA 2DC5A 3I9V2 5D9VA 2GT5A 2NDOA 2MBTA 2E2MA 3IK9A 5D9TA 3UVHA 4XS4A 1GWCA 3TRQA 3VPQA 5JWQB 5EPFA 4O5RA 1W89A 1O8WA 1R26A 4HZ4A 2OKAA 3GX8A 1ILOA 1AQVA 3ZMKA 3TJJA 2CX4A 4KNDA 5IOXA 1YQ1A 4JU5A 3TGZA 4J56E 3F6DA 4AGSA 4Z7XA 2OADA 1QMVA 4EKZA 1AQWA 1G7OA 2NTOA 4BVYA 6GSTA 2GTUA 5EVOA 1A24A 1M9BA 4QL9A 5JCGA 3ME8A 1F3AA 5EL8A 1Q4JA 1BAYA 5B8AA 3UJ1A 2C3NA 4GXZA 4P3YB 4KCAA 4NPBA 4XS4B 1NW2A 5G5EA 2HZEA 4LL1B 5D93A 1JZOA 1S3CA 2FWGA 5ECSA 2OE1A 3KCMA 16GSA 5HFIA 2O87A 4PURA 1SL1B 2RUEA 3PGTA 1FB0A 1ERTA 2CV4A 4K7OA 2KHPA 4D73B 4ML6A 3ERFA 4L5OA 5ECOB 1O85A 3HDCA 3LGCA 4N30A 4KUNA 1TKDB 3FZAA 5B8BA 2YP6A 3A3TA 1B4QA 4ZIJA 1VF4A 2H74A 2AAWA 1FO5A 3M8NA 4GQFA 2BMXA 1ZYQB 3MAKA 3RAZA 2ES7A 1T8EB 3FZ9A 5B7CA 1SK1A 5CYYA 2VUPA 2AV4A 2HZEB 4IN0A 3KJYA 3WT1A 1TXXA 4K6XA 2L59A 4TR1A 4K0GA 4IHUA 2FY6A 3UBKA 2F8FA 5A4WA 3CTFA 3IAM2 5D73A 4NXIA 1F2EA 3GX0A 1F37A 3BBYA 4ZBBA 2MMNA 2KP1A 4KE3A 3L0HA 5IMFA 4WR5A 3FW2A 1T1VA 2REMA 4IJIA 1R4WA 3TCOA 3EMPA 3R2QA 1AUCA 2GLRA 1RK4A 4KCEA 1J9BA 4WR4A 2H6ZA 4KSOA 1GUKA 3GKXA 19GSA 5HR1A 2CVBA 2G0FA 3KGKA 4TR1B 1F6MC 5D8IA 4WKWA 2WJUA 1ERWA 4XTSA 3APSA 1TJDA 2V6KA 2XPEA 1AC1A 1FOVA 2H1BA 1U88A 4IBPA 1V57A 4TXOA 1VRSD 4V2MA 1GTUA 1X5EA 3IPZA 4NHWA 4QQ7A 5F8BA 1XXUA 3TDGA 2K8VA 1Z9HA 1OC8A 1GTAA 3GFKA 2EIOA 1GNWA 4MPFA 3CRUA 4HDEA 4H86A 3QR6A 2VO4A 1YZXA 2O85A 1PN9A 2K8SA 4V2NA 1O8XA 1ZCPA 3HYPA 4IELA 4ZB6A 2H8LA 3DYRA 3KH7A 3TKSE 5A4UA 1U3AA 1V40A 4OO5A 3HVSA 4DVCA 1A0FA 2IFQA 2XC2A 1XPVA 3Q6OA 1Z3EA 3ISOA 4KH7A 3F4RA 3LYPA 1RQMA 1YJ6A 5ECHB 1XWAA 2CA8A 1BQ7A 2OJLA 4TXOB 1I5GA 1SD8A 1ZOFA 2B1LA 5IMZA 2DMLA 2R5GA 4HEA2 4FYBA 1WJKA 3GUSA 3TJBA 1ML6A 4ZB8A 1THXA 1U3IA 4E8HA 3LG6A 3FYGA 1EGOA 2FWEA 2MYGA 3ERWA 2N5AA 2IFQB 2LJAA 3Q19A 2MZCA 2R4VA 3RPPA 1PMTA 1OE8A 3C1SA 3ZITA 1GSFA 3VWUA 3S9FA 2KLXA 3ZVJD 4PNGA 1A23A 2YPMA 2AHEA 2YV7A 5B6NA 1HNBA 2C0GA 3F9UA 4NV2A 1ON4A 2GSRA 3V1WA 2GSSA 2NPBA 4K7NA 1K0BA 2C3TA 2YV9A 4MF7A 1SKRB 4K0NA 4LL4B 4GSNA 3HJPA 2H0HA 1J0FA 5F05A 3ZLPA 2FGXA 2VL9A 3FR6A 3PH9A 3QFBC 2IL3A 5FWGA 5HR3A 3KZQA 5IO0A 4V1Ag 2IMKA 2L6CA 4EDYA 2LRTA 3GL5A 4BA7A 3PINA 4JE1A 4PQHA 3LYKA 2OBIA 1I9DA 2X8HA 1WRYA 2P5QA 1R5AA 3EINA 5F0GA 1PKWA 2A4VA 3ZMLA 5J3RA 4EC0A 4PQ1A 2HXKA 3D4TA 4KAEA 1PD21 3J7Yk 1LBKA 1M99A 4OFMA 3ZVJA 4ZL8A 2OE3A 4KX4A 4PNFA 1G7EA 1XWGA 3E9JB 3TKQA 1TW9A 1U6TA 3E3EA 2JSYA 4I8BA 2A2RA 2VOCA 4POMA 5LD0A 2XPDA 2IWTA 3N9JA 2WCIA 1SU9A 3P2AA 3KP9A 2M80A 5DALA 3ED3A 2X64A 2H66A 2EIRA 1Z5YE 3BOAA 1A8YA 3IXRA 3IC4A 2HLSA 4DSSA 5CRGA 1TI1A 4ZILA 4MF5A 4Q5FA 1F3BA 1YEPA 4G19A 1YKCA 2JZSA 3GKNA 1XBSA 2V41A 1X5DA 2H1GA 5FT3A 2R6KA 1LJRA 1B48A 4N0ZA 2YZUA 1W4VA 2VLUA 2VD1A 2AYTA 5KN2A 4XCSA 1SJIA 3UIWA 1EOGA 4OO4A 3BCIA 3H8QA 4NHZA 1BYEA 3LEFA 3D21A 1R5PA 2TRXA 4RUVA 2FUG2 3L9UA 2HE3A 5DALB 2WS2A 4G10A 2FWFA 3KMNA 4ISDA 2ALBA 1OE7A 4ZXGA 3F63A 4DSSB 3GL3A 1X0RA 2QGVA 3FEUA 3IK7A 5DVBA 2V32A 22GSA 3W8JA 1PL1A 2VL3A 1HD2A 1X9MB 3PR8A 4HJ2A 2DBCA 1N8JA 4OFNA 2K9FA 1PX7A 1NHOA 2F51A 3UARA 2C4JA 3WGDA 3BJ5A 1XWCA 1XW9A 1DBYA 3FZ5A 5HR2A 1QK8A 3ME7A 1SK2A 2V2GA 4I2TA 1OC9A 2VCVA 2P31A 2P0GA 1GUMA 3GNJA 2LRNA 4G2EA 5GSTA 3D0ZA 1GLQA 1JLVA 2CAQA 1RW1A 2HT9A 5KEJA 2GZZA 1PX6A 5EY6A 3E0UA 2GS3A 1K0MA 4RI6A 5F06A 2B5XA 5AGYA 5CRHA 2X8GA 4AJ6A 4V1Ap 5ID2A 2OE0A 3QOUA 2HNLA 5J9BA 4D73A 2ON7A 4O7HA 3A5WA 4IP1A 2C8UA 2LRCA 1B4PA 2H19A 3GH6A 1TOFA 3F4TA 1JHBA 1GL8A 1YDKA 4BWSA 2LQOA 3D4MA 2X99A 1WIKA 1GP1A 2PVQA 1MD4A 2VCTA 1OC9B 2HZFA 1TU7A 3HVVA 3L9VA 1OC3A 5ENUA 2YN1A 2KUCA 2HRFA 4GRFA 1K0AA 2PN8A 3GKMA 1Z7PA 5DJMA 2WZ9A 6GSYA 2B3SA 2MMAA 1DSBA 1UC7A 3GV1A 4TN8A 5ID2B 3TRPA 2DJ3A 3CSJA 4KDXA 4TXVA 4YAPA 4I97A 5H5SA 5GAPD 2H75A 1WMJA 2WB9A 3DIEA 2DJKA 4ML1A 2O89A 1V98A 1SJ6A 2X8CA 4F82A 3IOSA 2GDRA 2LJKA 3RPNA 3DD3A 3TB2A 4KGIA 1FVKA 1DUGA 2GGTA 1A2MA 2VLTA 3KM6A 5IMDA 7GSSA 2N5FA 2B5YA 2VCZA 4JEDA 4IS0A 3HJMA 4IJ3A 4AF2A 4MA9A 3IRAA 2KOKA 3QAGA 2GT6A 2ZCTA 2JADA 3DVXA 2JACA 1PRXA 2L6DA 2V6OA 1YY7A 1THOA 2K6VA 5D96A 4O32A 4NV5A 3QAVA 5G31A 1TK5B 2TIRA 2FD3A 2FLSA 2C0DA 5ABRA 2L4QA 1U87A 1A2LA 3N5OA 3G7IA 2YWMA 18GSA 3O6TA 1USBA 2Z9SA 1GLPA 4MJBA 4HU7A 4IQAA 1AXDA 4FO5A 3UAPA 1GSUA 3QCPA 3TOUA 4PUAA 3UOMA 2QSIA 3HHVA 3ZREA 3EYTA 1GSDA 4ZL9A 1FHEA 2DIZA 1SKWB 4F0CA 1ERUA 3P8WA 3SBCA 2YCDA 6GSUA 3FR9A 4Q5RA 2EC4A 2DMMA 3F3QA 3M3MA 5ECLB 3VPTA 1AQXA 1C72A 4JRRA 2N5BA 1NSWA 1N2AA 4ZBDA 2HRNA 3TKSA 3H1NA 3AY8A 3GSSA 5IOWA 2P5RA 1HNCA 1XZOA 5DDLA 3ZL5A 1M2BA 8GSSA 3TKPA 2H6YA 5JCWA 2TRCP 2XHFA 4GSTA 1PA3A 1JFUA 4GF0A 1JLWA 3GRXA 1KTEA 2VIMA 4L0WA 4X43A 2GQLA 2I9HA 2VAFA 4MDCA 5AISA 1T3BA 1SENA 2IMEA 2JZTA 5ECMB 2L5OA 3DGQA 2C1YA 2WGRA 2QC7A 4I5QA 3VI5A 3DVWA 1M7TA 3GKKA 1M9AA 2IMFA 4J2FA 4YQUA 1WE0A 2LNSA 2H6XA 1PL2A 2CVDA 3OR5A 4ECCA 1YKAA 3GURA 3IHQA 4TR3A 5A5KA 4MP4A 1EOHA 4ECJA 3A2WA 1BX9A 2LEGA 2VL2A 2RM5A 1UN2A 2GSTA 3UL3A 4K2DA 3KD0A 3J7Yb 4OFTA 2VM1A 1T4YA 4EDZA 2LSTA 5AIVA 2PVOC 3F3RA 3GTUA 2YANA 3HZ8A 1IYHA 2JSZA 5FHIA 1BG5A 1EV4A 3GA4A 3NZNA 4OCEA 3MDKA 4KB3A 4LMVA 3VURA 4EXJA 3L4NA 4JR6A 1TTZA 4WF5A 1EEJA 3P7XA 4WXTA 1V58A 2H73A 2JU5A 2IJYA 2PWJA 2YOIA 3IA1A 5COHA 4WEYA 1S3DA 1DE1A 3L9SA 1B9YC 4MZCA 5KN0A 4TVEA 2ZUPA 1AW9A 4FYCA 2K18A 4ILFA 1QGVA 4MJCA 2MMOA 3ZTLA 3KTBA 3LXTA 1TK8B 1GRXA 3GTUB 3VWXA 3HJOA 1XW5A 3U6VA 5AN1A 1URMA 2FA8A 5JCUA 4LLRA 4HU9A 4JR4A 4YQVA 5A4VA 3VWWA 3NOFA 5INYA 1Z6MA 3FK8A 4ZBAA 4N10A 4XHMA 5DQYA 3ERGA 4K1FA 4PGTA 4KDUA 3IDVA 4NWYA 3CSHA 3HD5A 2VCWA 4ID0A 1TP9A 3A2VA 1DE2A 1WOUA 3KXOA 4DSRA 4XRAA 2OBKA 2VCXA 3WYWA 2WRTA 2YNXA 4HQSA 1WP0A 1TI3A 1FB6A 4J57E 4MF6A 2LQQA 2FCHA 1GSSA 5G30A 2B7JA 1OAZA 2OACA 1X9WB 5D9WA 1HYUA 2M72A 2B1KA 3H4KA 2AUVA 3CBUA 3UEMA 4MPGA 1ACVA 3DRNA 3Q74A 4MJEA 3TRXA 3RHCA 1GSQA 3FR3A 1VGLA 2H1DA 1ST9A 5GSSA 4TW5A 1EWXA 3MSZA 5L71A 1K0NA 1XVWA 2F9SA 4YH2A 1ZZYA 4MCUA 5J5NA 1H75A 4POLA 6GSVA 1A8LA 1O73A 5DJLA 1O81A 3UMAA 2H0IA 4KA0A 2QKEA 2GVPA 3CTGA 2KP2A 2I3YA 3NIVA 5IMCA 4ECIA 2IIYA 1SD9A 5G2ZA 4GLTA 3EU3A 1CQHA 2DJ2A 5CNWA 2DLXA 5G1KA 1EEMA 1YF1A 4EF0A 5HR0A 1UA5A 1XOBA 4AJ7A 1F9MA 4MABA 3KP8A 1G6WA 2FHEA 3LJRA 1SYXA 5CREA 3LFLA 5HFKA 4G9HA 2OA7A 2CQ9A 4I6XA 4FH8A 4PUFC 1B9XC 3CRTA 4KSMA 1EZKA 3DMLA 5J4UA 3F4SA 3ZYWA 1R7HA 1Z7RA 2PERA 1VF1A 3MWHA 2FNOA 6GSSA 3BD2A 4XRDA 1QQ2A 3JCML 4K9ZA 5C04A 1M0UA 2FA4A 1JZWA 1X5CA 4MZBA 2YWNA 4IP6A 2BJXA 2H72A 4XIHA 2HSHA 2YWIA 3QMXA 1GULA 5H5QA 14GSA 4CW9A 2R37A 1WPIA 5LNKe 4OD7A 4IGJA 5JWOB 2I4AA 1GSEA 4QL7A 5LCZA 5E59A 3M9KA 3LQ7A 4IKHA 3GSTA 3KMOA 2CAIA 3TOTA 1QUWA 3CSIA 3KH9A 4GQCA 4V2LA 2H01A 4BWQA 1V2AA 2F3MA 3CMIA 1SL2B 3HZ4A 1HQOA 1OYJA 3HKRA 3F6FA 5CAXA 3EU4A 5GZZB 1SJZA 3IE3A 1IYIA 2CZ3A 1G0TA 4TKYA 1ZYEA 2DIYA 3WD6A 3UVTA 2JL4A 3IV4A 1EGRA 2DJJA 3KEBA 4RI7A 3RBTA 1KEBA 2D2ZA 10GSA 3IAS2 2LNTA 1K0DA 4GWRA 3H93A 4E8EA 5ECQB 2GSQA 3HA9A 1FG4A 2IN3A 3APOA 4KDYA 1XWBA 1KBNA
chains in the Genus database with same CATH superfamily
2B5EA 5IMVA 2ZNMA 1PQNA 3K8NA 5IM9A 1E2YA 1ZGNA 4HOJA 4G0LA 3VK9A 1BEDA 4RQRA 5KN1A 1T4ZA 5ECRB 5GAND 4HS1A 3LORA 4POKA 3A2XA 1JZRA 4O92A 1XVQA 4DEJA 1PSQA 4EUYA 4EL1A 1GNEA 5IO2A 1GTIA 2UZ8A 2H0GA 4HQZA 2CVKA 1ERVA 1V9WA 4EE0A 3TKSC 2F8AA 3O3TA 1OVNA 2WDUA 3CYNA 4EIPA 5DCHA 3C7MA 1MD3A 3O76A 2A2SA 5HQPA 3EE2A 4L5LA 1B8XA 1TU8A 5AIXA 1NHYA 3WT2A 3EMXA 5IPGA 2CZ2A 2VCQA 6GSWA 3FKFA 3EC3A 4ICYA 4EIQA 2J23A 13GSA 4TR0A 4CDOA 3DEXA 2ON5A 4HI7A 3GIXA 3I6AA 1A2JA 12GSA 2E7PA 3VLNA 2LS5A 2R0GA 4MK3A 4IVFA 2B7KA 3DKSA 4BL7A 1PKZA 5ECKB 3P90A 1H4OA 2H70A 4OMVA 5BMUA 3G7YA 2DKHA 4OWYA 2LV3A 1SKSB 4K7IA 2VL2C 4WF4A 5D9XA 1SL0B 1PGTA 4CHSA 1EV9A 3W8SA 1GH2A 4RQXA 1WWJA 4G0IA 1VF3A 2NBSA 3EURA 4ULXA 9GSSA 2L5LA 3FRCA 1TRUA 4TR4A 1XG8A 4K5SA 4TRXA 3UBLA 5G5FA 3C73A 4BVXA 3DXBA 3MNGA 2B6MA 3FHKA 5E4WA 3US3A 3KTLA 4FIWA 4ECBA 4HZ2A 4BL7B 2C0FA 3TJKA 4WETA 4HUAA 4K8MA 2L57A 2PU9C 3W6GA 3LW9A 1OKDA 2HFDA 3M0FA 3VWVA 5B6MA 1E6BA 1TRVA 2LKUA 3WGXA 1S3AA 3TJFA 2YJ7A 1Q98A 4ZB9A 1BJXA 3BCKA 1O7UA 4YQMA 1XCCA 4NAXA 2NVLA 4IQ1A 4OCFA 4JBBA 4BVXB 3G7JA 2O8VB 4EVMA 2LTKA 2YZHA 4ZL7A 2JZRA 2YJHA 3GMFA 1GTBA 1MEKA 2DSAA 1FVJA 2E2GA 3U5RE 5C00A 3APQA 1EP8A 1T00A 2RM6A 2L4CA 4I2UA 4DSQA 3C8EA 1Z6NA 1X9SB 1PN0A 3D6IA 3M1GA 5F07A 3TKRA 4A5PA 2XBIA 2H76A 5J41A 4N0VA 5CP1A 3HY2A 5HFGA 3IR4A 11GSA 1G6YA 2YWOA 1ABAA 2CX3A 1MDKA 3VFIA 2PUKC 3ZFLA 4F0BA 4WBRD 4GTUA 4MZWA 2R3XA 1Y6EA 3F0IA 1UVZA 4JZQA 1OKTA 4FYUA 5IPHA 1O6JA 2HSYA 2AJQB 4F03A 2VD0A 4X0XA 2H71A 5ELAA 2RUFA 5CO3A 1YEXA 3SWLA 2I81A 3TJGA 1YF0A 1J08A 2H30A 2CT6A 2WULA 2HRAA 4KW6A 3TUEA 3EVIA 2I1UA 4XS6A 2AB6A 2WFCA 4LA1A 6GSXA 4XS1A 1XFLA 3QPMA 2IPAA 3C1RA 1NM3A 1XW6A 3GHAA 5H5RA 3RDWA 3L78A 4L8EA 2MBSA 1K3OA 5BRTA 4AJ8A 5ELGA 2RIIA 1A0RP 3EWLA 5JWRB 4Z2RA 3VI7A 4PXOA 5J9CA 4GSSA 2J9HA 5CRDA 2R2JA 3ZFBA 3M9JA 2PPTA 2GZYA 3DWVA 5IMAA 1K3YA 1M2AA 1TDIA 4PX1A 1LU4A 3CXGA 4N11A 2FWHA 4BPYA 4MMMA 2V1MA 4IW9A 2GQMA 3QFAC 3H79A 5DCGA 1QFNA 3F8UA 2G2QA 1ZMAA 1XWKA 3QAWA 1JZDA 2HYXA 5IIZA 3I43A 3FZ4A 3GYKA 1K0CA 4MH3A 2IMIA 4L0UA 3HVXA 5CRWA 1GUHA 2C3QA 4LMWA 5KN3A 2IMDA 3HCZA 3D22A 2C80A 17GSA 5IQYA 4PQIA 4POBA 1TRWA 4NMUA 1HNAA 1MDJA 5DBQA 1ZL9A 5ECIB 3GN3A 3LSZA 1AAZA 3ZZXA 2MMZA 2VM2A 2GQKA 3GH9A 3G9BA 3RHBA 1AIUA 4USSA 3ZIVA 4ACSA 2RLIA 20GSA 1EP7A 4GCIA 3HXSA 2O7KA 2VLVA 1M3JA 2PMTA 1S3RA 1SK0A 1K0OA 1KNGA 3HVNA 3KIJA 1M2DA 1XIYA 3D5JA 1GSYA 2PBJA 2PGTA 1VF2A 1Y25A 2GZPA 1FAAA 2DJ1A 4MH2A 3ZRDA 5DAKA 4Q5NA 1SYRA 4YAVA 4Q5QA 4X1UA 4Z2UA 3Q18A 1TK0B 2E0QA 2HI7A 3WGEA 1MDIA 5G1LA 3LWAA 3C71A 1TRSA 2LJRA 2DJ0A 2M46A 2XBQA 5ECNB 1QXHA 3ZIJA 5DQSA 2EIQA 2H1AA 3FY7A 4TOPA 5ECPB 4MLYA 3QDNA 2BTOT 2R0PA 4MJAA 1K3LA 1FW1A 4WBJA 4F9ZA 2C0EA 4EO3A 4F2IA 1XOAA 1T7PB 1CQGA 4HJMA 3I69A 3LXZA 5DAKB 1MTCA 3IBHA 3QD9A 2LUSA 2DC5A 3I9V2 5D9VA 2GT5A 2NDOA 2MBTA 2E2MA 3IK9A 5D9TA 3UVHA 4XS4A 1GWCA 3TRQA 3VPQA 5JWQB 5EPFA 4O5RA 1W89A 1O8WA 1R26A 4HZ4A 3A5IA 2OKAA 3GX8A 1ILOA 1AQVA 3ZMKA 3TJJA 2CX4A 4KNDA 5IOXA 4Z2TA 1YQ1A 4JU5A 1PFOA 3TGZA 4KF9A 4J56E 3F6DA 4AGSA 4Z7XA 2OADA 1QMVA 4EKZA 1AQWA 1G7OA 2NTOA 4BVYA 6GSTA 2GTUA 5EVOA 1A24A 1M9BA 4QL9A 4O5UA 5JCGA 3ME8A 1F3AA 5EL8A 1Q4JA 1BAYA 5B8AA 3UJ1A 2C3NA 4GXZA 4P3YB 4KCAA 4NPBA 4XS4B 1NW2A 5G5EA 2HZEA 4LL1B 5D93A 2DKIA 1JZOA 1S3CA 2FWGA 5ECSA 2OE1A 3KCMA 16GSA 5HFIA 2O87A 4PURA 1SL1B 2RUEA 3PGTA 1FB0A 1ERTA 4K5RA 2CV4A 4K7OA 2KHPA 4D73B 4ML6A 3ERFA 1M3IA 4L5OA 5ECOB 1O85A 3HDCA 3LGCA 4N30A 4KUNA 1TKDB 3FZAA 5B8BA 4BVYB 2YP6A 3A3TA 1B4QA 4ZIJA 1VF4A 2H74A 2AAWA 1FO5A 3M8NA 4GQFA 4K2XA 2BMXA 1ZYQB 3MAKA 3RAZA 2ES7A 1T8EB 3FZ9A 5B7CA 1SK1A 5CYYA 2VUPA 2AV4A 1ZYNA 2HZEB 4IN0A 3KJYA 3WT1A 1TXXA 4K6XA 2L59A 4TR1A 4K0GA 4IHUA 3R3EA 2FY6A 3UBKA 2F8FA 5A4WA 3CTFA 3IAM2 5D73A 4NXIA 1F2EA 3GX0A 1F37A 3BBYA 4ZBBA 2MMNA 2KP1A 4KE3A 3L0HA 5IMFA 4WR5A 3FW2A 1T1VA 2REMA 4IJIA 1R4WA 3TCOA 1FOHA 3EMPA 3R2QA 1AUCA 2GLRA 1RK4A 4KCEA 1J9BA 4WR4A 2H6ZA 4KSOA 1GUKA 3GKXA 19GSA 5HR1A 2CVBA 2G0FA 3KGKA 4TR1B 1F6MC 5D8IA 4WKWA 2WJUA 1ERWA 4XTSA 3APSA 1TJDA 2V6KA 2XPEA 1AC1A 1FOVA 2H1BA 1U88A 4IBPA 1V57A 4TXOA 1VRSD 4V2MA 1GTUA 1X5EA 3IPZA 4NHWA 4QQ7A 5F8BA 1XXUA 3TDGA 2K8VA 1Z9HA 1OC8A 1GTAA 3GFKA 2EIOA 1GNWA 4MPFA 3CRUA 2QA2A 4HDEA 4H86A 3QR6A 2VO4A 1YZXA 2O85A 1PN9A 2K8SA 4V2NA 1O8XA 1ZCPA 3HYPA 4IELA 4ZB6A 2H8LA 3DYRA 3KH7A 3TKSE 5A4UA 1U3AA 1V40A 4OO5A 3HVSA 4DVCA 1A0FA 2IFQA 2XC2A 1XPVA 3Q6OA 1Z3EA 3ISOA 4KH7A 3F4RA 3LYPA 1RQMA 1YJ6A 5ECHB 1XWAA 2CA8A 1BQ7A 2OJLA 4TXOB 1I5GA 3IC8A 1SD8A 1ZOFA 2B1LA 5IMZA 2DMLA 2R5GA 4HEA2 4FYBA 1WJKA 3GUSA 3TJBA 1ML6A 4ZB8A 1THXA 1U3IA 4E8HA 3LG6A 3FYGA 1EGOA 2FWEA 2MYGA 3ERWA 2N5AA 2IFQB 2LJAA 3Q19A 2MZCA 2R4VA 3RPPA 1PMTA 1OE8A 3C1SA 3ZITA 1GSFA 3VWUA 3S9FA 2KLXA 3ZVJD 4PNGA 1A23A 2YPMA 2AHEA 2YV7A 5B6NA 1HNBA 2C0GA 3F9UA 1ZYPA 4NV2A 1ON4A 2GSRA 3V1WA 2GSSA 2NPBA 2A2PA 4K7NA 1K0BA 2C3TA 2YV9A 4MF7A 1SKRB 4K0NA 4LL4B 4GSNA 3HJPA 2H0HA 1J0FA 5F05A 3ZLPA 2FGXA 2VL9A 3FR6A 3PH9A 3QFBC 2IL3A 5FWGA 5HR3A 3KZQA 5IO0A 4V1Ag 2IMKA 2L6CA 4EDYA 2LRTA 3GL5A 4BA7A 3PINA 4JE1A 4PQHA 3LYKA 2OBIA 1I9DA 2X8HA 1WRYA 2P5QA 1R5AA 3EINA 5KOXA 5F0GA 1PKWA 2A4VA 3ZMLA 5J3RA 4BIKA 4EC0A 4PQ1A 2HXKA 3D4TA 3FMWA 4KAEA 1PD21 3J7Yk 1LBKA 1M99A 4OFMA 3ZVJA 4ZL8A 2OE3A 4KX4A 4PNFA 1G7EA 1XWGA 3E9JB 3TKQA 1TW9A 1U6TA 3E3EA 2JSYA 4I8BA 2A2RA 2A4HA 2VOCA 4POMA 5LD0A 2XPDA 2IWTA 3N9JA 2WCIA 1SU9A 2X4AA 3P2AA 3KP9A 2M80A 5DALA 3ED3A 2X64A 2H66A 2EIRA 1Z5YE 3BOAA 1A8YA 3IXRA 3IC4A 2HLSA 4DSSA 5CRGA 1TI1A 4ZILA 4MF5A 4Q5FA 1F3BA 1YEPA 4G19A 1YKCA 2JZSA 3GKNA 1XBSA 2V41A 1X5DA 2H1GA 5FT3A 2R6KA 1LJRA 1B48A 4N0ZA 2YZUA 1W4VA 2VLUA 3IHGA 2VD1A 2AYTA 5KN2A 4XCSA 1SJIA 3UIWA 1EOGA 4OO4A 3BCIA 3H8QA 4NHZA 1BYEA 3LEFA 3D21A 1R5PA 2TRXA 4RUVA 2FUG2 3L9UA 2HE3A 5DALB 2WS2A 4G10A 2FWFA 3KMNA 4ISDA 2ALBA 4FQUA 1OE7A 4ZXGA 3F63A 4DSSB 3GL3A 1X0RA 2QGVA 3FEUA 3IK7A 5DVBA 2V32A 22GSA 3W8JA 1PL1A 2VL3A 1HD2A 1X9MB 3PR8A 4HJ2A 2DBCA 1N8JA 4OFNA 2K9FA 1PX7A 1NHOA 2F51A 3UARA 2C4JA 3WGDA 3BJ5A 1XWCA 1XW9A 1DBYA 3FZ5A 5HR2A 1QK8A 3ME7A 1SK2A 2V2GA 4I2TA 4YKFA 1OC9A 2VCVA 2P31A 2P0GA 1GUMA 3GNJA 2LRNA 4G2EA 5GSTA 3D0ZA 1GLQA 1JLVA 2CAQA 1RW1A 2HT9A 5KEJA 2GZZA 1PX6A 5EY6A 3E0UA 2GS3A 1K0MA 4RI6A 5F06A 2B5XA 5AGYA 5CRHA 2X8GA 4AJ6A 4V1Ap 5ID2A 2OE0A 3QOUA 2HNLA 5J9BA 4D73A 2ON7A 4O7HA 3A5WA 4IP1A 2C8UA 2LRCA 1B4PA 2H19A 3GH6A 1TOFA 3F4TA 1JHBA 1GL8A 1YDKA 4BWSA 2LQOA 3D4MA 2X99A 1WIKA 1GP1A 2HSMA 2PVQA 1MD4A 2VCTA 1OC9B 2HZFA 1TU7A 3HVVA 3L9VA 1OC3A 5ENUA 2YN1A 2KUCA 3MIXA 2HRFA 4GRFA 1K0AA 2PN8A 3GKMA 1Z7PA 5DJMA 2WZ9A 6GSYA 2B3SA 2MMAA 1DSBA 1UC7A 3GV1A 4TN8A 5ID2B 3TRPA 2DJ3A 3CSJA 4KDXA 4TXVA 4YAPA 4I97A 5H5SA 5GAPD 2H75A 1WMJA 2WB9A 3DIEA 2DJKA 4ML1A 2O89A 1V98A 1SJ6A 2X8CA 4F82A 3IOSA 2GDRA 2LJKA 3RPNA 3DD3A 3TB2A 4KGIA 1FVKA 1DUGA 2GGTA 1A2MA 2VLTA 3KM6A 5IMDA 7GSSA 2N5FA 2B5YA 2VCZA 4JEDA 4IS0A 3HJMA 4IJ3A 4AF2A 4MA9A 3IRAA 2KOKA 3QAGA 2GT6A 2ZCTA 2JADA 3DVXA 2JACA 1PRXA 2L6DA 2V6OA 1YY7A 1THOA 2K6VA 5D96A 4O32A 4NV5A 3QAVA 5G31A 4X4JA 1TK5B 2TIRA 2FD3A 2FLSA 4O5QA 2C0DA 5ABRA 2L4QA 1U87A 1A2LA 3N5OA 3G7IA 2YWMA 18GSA 3O6TA 1USBA 2Z9SA 1GLPA 4MJBA 4HU7A 4IQAA 1AXDA 4FO5A 2X49A 3UAPA 1GSUA 3EPTA 3QCPA 3TOUA 4PUAA 3UOMA 2QSIA 3HHVA 3ZREA 3EYTA 1GSDA 4ZL9A 1FHEA 2DIZA 1SKWB 4F0CA 1ERUA 3P8WA 3SBCA 2YCDA 6GSUA 3FR9A 4Q5RA 2EC4A 2DMMA 3F3QA 3M3MA 5ECLB 3VPTA 1AQXA 1C72A 4JRRA 2N5BA 1NSWA 1N2AA 4ZBDA 2HRNA 3TKSA 3H1NA 3AY8A 3GSSA 5IOWA 2P5RA 1HNCA 1XZOA 5DDLA 3ZL5A 1M2BA 8GSSA 3TKPA 2H6YA 5JCWA 2TRCP 2XHFA 4GSTA 1PA3A 1JFUA 4GF0A 1JLWA 3GRXA 1KTEA 2VIMA 4L0WA 4X43A 2GQLA 2I9HA 2VAFA 5KOWA 4MDCA 5AISA 1T3BA 1SENA 2IMEA 2JZTA 5ECMB 2L5OA 3DGQA 2C1YA 2WGRA 2QC7A 2QA1A 4I5QA 3VI5A 3DVWA 1M7TA 3GKKA 1M9AA 2IMFA 4J2FA 4YQUA 1WE0A 2LNSA 2H6XA 1PL2A 2CVDA 3OR5A 4ECCA 1YKAA 3GURA 3IHQA 4TR3A 5A5KA 4MP4A 1EOHA 4ECJA 3A2WA 3CQFA 1BX9A 2LEGA 2VL2A 2RM5A 1UN2A 2GSTA 3UL3A 4HSCX 4K2DA 3KD0A 3J7Yb 4OFTA 2VM1A 1T4YA 4EDZA 2LSTA 5AIVA 2PVOC 3F3RA 3GTUA 2YANA 3HZ8A 1IYHA 2JSZA 5FHIA 4G0KA 1BG5A 1EV4A 3GA4A 3NZNA 3PPUA 4OCEA 4CY8A 3MDKA 4KB3A 4LMVA 3VURA 4EXJA 3L4NA 4JR6A 1TTZA 4WF5A 1EEJA 3P7XA 4WXTA 1V58A 2H73A 2JU5A 2IJYA 2PWJA 2YOIA 3IA1A 5COHA 4WEYA 1S3DA 1DE1A 3L9SA 1B9YC 4MZCA 5KN0A 4TVEA 2ZUPA 1AW9A 4FYCA 2K18A 4ILFA 1QGVA 4MJCA 2MMOA 3ZTLA 3KTBA 3LXTA 1TK8B 1GRXA 3GTUB 3VWXA 3MYDA 3HJOA 1XW5A 2R0CA 4PTSA 3U6VA 5AN1A 1URMA 2FA8A 5JCUA 4LLRA 4HU9A 4JR4A 4YQVA 5A4VA 3VWWA 3NOFA 5INYA 1Z6MA 3FK8A 4ZBAA 4N10A 4XHMA 5DQYA 3ERGA 4K1FA 4PGTA 4KDUA 3IDVA 4NWYA 3CSHA 3HD5A 2VCWA 4ID0A 1TP9A 3A2VA 1DE2A 1WOUA 3KXOA 4DSRA 4XRAA 2OBKA 2VCXA 3WYWA 2WRTA 2YNXA 4HQSA 1WP0A 1TI3A 1FB6A 4J57E 4MF6A 2LQQA 2HRKA 2FCHA 1GSSA 5G30A 2B7JA 1OAZA 2OACA 1X9WB 5D9WA 1HYUA 2M72A 2B1KA 3H4KA 2AUVA 3CBUA 3UEMA 4MPGA 1ACVA 3DRNA 3Q74A 4MJEA 3TRXA 3RHCA 1GSQA 3FR3A 1VGLA 2H1DA 1ST9A 5GSSA 4TW5A 1EWXA 3MSZA 5L71A 1K0NA 1XVWA 2F9SA 4YH2A 1ZZYA 4MCUA 5J5NA 1H75A 4POLA 6GSVA 1A8LA 1O73A 5DJLA 1O81A 3UMAA 2H0IA 4KA0A 2QKEA 2GVPA 3CTGA 2KP2A 4MNNA 2I3YA 3NIVA 5IMCA 4ECIA 2IIYA 1SD9A 5G2ZA 4GLTA 3EU3A 1CQHA 2DJ2A 5CNWA 2DLXA 5G1KA 1EEMA 1YF1A 4EF0A 5HR0A 1UA5A 1XOBA 4AJ7A 1F9MA 4MABA 3KP8A 1G6WA 2FHEA 3LJRA 1SYXA 5CREA 3LFLA 5HFKA 4G9HA 2OA7A 2CQ9A 4I6XA 4FH8A 4PUFC 1B9XC 3CRTA 4KSMA 1EZKA 3DMLA 5J4UA 3F4SA 3ZYWA 1R7HA 1Z7RA 2PERA 1VF1A 3MWHA 2FNOA 6GSSA 3BD2A 4XRDA 1QQ2A 3JCML 4K9ZA 5C04A 1M0UA 2FA4A 1JZWA 1X5CA 4MZBA 2YWNA 4IP6A 2BJXA 2H72A 4XIHA 2HSHA 2YWIA 4YKGA 3QMXA 1GULA 5H5QA 14GSA 4CW9A 2R37A 1WPIA 5LNKe 4OD7A 4IGJA 5JWOB 2I4AA 1GSEA 4QL7A 5LCZA 5E59A 3M9KA 3LQ7A 4IKHA 3GSTA 3KMOA 2CAIA 3TOTA 1QUWA 3CSIA 3KH9A 4GQCA 4V2LA 2H01A 4BWQA 1V2AA 2F3MA 3CMIA 1SL2B 3HZ4A 1HQOA 1OYJA 3HKRA 3F6FA 5CAXA 4CY6A 3EU4A 5GZZB 1SJZA 3IE3A 1IYIA 2CZ3A 1G0TA 4TKYA 1ZYEA 2DIYA 3WD6A 3UVTA 2JL4A 3IV4A 1EGRA 2DJJA 3KEBA 4RI7A 3RBTA 1KEBA 2D2ZA 10GSA 3IAS2 2LNTA 1K0DA 4GWRA 3H93A 4E8EA 5ECQB 2GSQA 3HA9A 1FG4A 2IN3A 3APOA 4KDYA 1XWBA 1KBNA
chains in the Genus database with same CATH topology
2B5EA 5IMVA 2ZNMA 1PQNA 3K8NA 5IM9A 1E2YA 1ZGNA 4HOJA 4G0LA 3VK9A 1BEDA 4RQRA 5KN1A 1T4ZA 5ECRB 5GAND 4HS1A 3LORA 4POKA 3A2XA 1JZRA 4O92A 1XVQA 4DEJA 1PSQA 4EUYA 4EL1A 1GNEA 5IO2A 1GTIA 2UZ8A 2H0GA 4HQZA 2CVKA 1ERVA 1V9WA 4EE0A 3TKSC 2F8AA 3O3TA 1OVNA 2WDUA 3CYNA 4EIPA 5DCHA 3C7MA 1MD3A 3O76A 2A2SA 5HQPA 3EE2A 4L5LA 1B8XA 1TU8A 5AIXA 1NHYA 3WT2A 3EMXA 5IPGA 2CZ2A 2VCQA 6GSWA 3FKFA 3EC3A 4ICYA 4EIQA 2J23A 13GSA 4TR0A 4CDOA 3DEXA 2ON5A 4HI7A 3GIXA 3I6AA 1A2JA 12GSA 2E7PA 3VLNA 2LS5A 2R0GA 4MK3A 4IVFA 2B7KA 3DKSA 4BL7A 1PKZA 5ECKB 3P90A 1H4OA 2H70A 4OMVA 5BMUA 3G7YA 2DKHA 4OWYA 2LV3A 1SKSB 4K7IA 2VL2C 4WF4A 5D9XA 1SL0B 1PGTA 4CHSA 1EV9A 3W8SA 1GH2A 4RQXA 1WWJA 4G0IA 1VF3A 2NBSA 3EURA 4ULXA 9GSSA 2L5LA 3FRCA 1TRUA 4TR4A 4K5SA 4TRXA 3UBLA 5G5FA 3C73A 4BVXA 3DXBA 3MNGA 2B6MA 3FHKA 5E4WA 3US3A 3KTLA 4FIWA 4ECBA 4HZ2A 4BL7B 2C0FA 3TJKA 4WETA 4HUAA 4K8MA 2L57A 2PU9C 3W6GA 3LW9A 1OKDA 2HFDA 3M0FA 3VWVA 5B6MA 1E6BA 1TRVA 2LKUA 3WGXA 1S3AA 3TJFA 2YJ7A 1Q98A 4ZB9A 1BJXA 3BCKA 1O7UA 4YQMA 1XCCA 4NAXA 2NVLA 4IQ1A 4OCFA 4JBBA 4BVXB 3G7JA 2O8VB 4EVMA 2LTKA 2YZHA 4ZL7A 2JZRA 2YJHA 3GMFA 1GTBA 1MEKA 2DSAA 1FVJA 2E2GA 3U5RE 5C00A 3APQA 1EP8A 1T00A 2RM6A 2L4CA 4I2UA 4DSQA 3C8EA 1Z6NA 1X9SB 1PN0A 3D6IA 3M1GA 5F07A 3TKRA 4A5PA 2XBIA 2H76A 5J41A 4N0VA 5CP1A 3HY2A 5HFGA 3IR4A 11GSA 1G6YA 2YWOA 1ABAA 2CX3A 1MDKA 3VFIA 2PUKC 3ZFLA 4F0BA 4WBRD 4GTUA 4MZWA 2R3XA 1Y6EA 3F0IA 1UVZA 4JZQA 1OKTA 4FYUA 5IPHA 1O6JA 2HSYA 2AJQB 4F03A 2VD0A 4X0XA 2H71A 5ELAA 2RUFA 5CO3A 1YEXA 3SWLA 2I81A 3TJGA 1YF0A 1J08A 2H30A 2CT6A 2WULA 2HRAA 4KW6A 3TUEA 3EVIA 2I1UA 4XS6A 2AB6A 2WFCA 4LA1A 6GSXA 4XS1A 1XFLA 3QPMA 2IPAA 3C1RA 1NM3A 1XW6A 3GHAA 5H5RA 3RDWA 3L78A 4L8EA 2MBSA 1K3OA 5BRTA 4AJ8A 5ELGA 2RIIA 1A0RP 3EWLA 5JWRB 4Z2RA 3VI7A 4PXOA 5J9CA 4GSSA 2J9HA 5CRDA 2R2JA 3ZFBA 3M9JA 2PPTA 2GZYA 3DWVA 5IMAA 1K3YA 1M2AA 1TDIA 4PX1A 1LU4A 3CXGA 4N11A 2FWHA 4BPYA 4MMMA 2V1MA 4IW9A 2GQMA 3QFAC 3H79A 5DCGA 1QFNA 3F8UA 2G2QA 1ZMAA 1XWKA 3QAWA 1JZDA 2HYXA 5IIZA 3I43A 3FZ4A 3GYKA 1K0CA 4MH3A 2IMIA 4L0UA 3HVXA 5CRWA 1GUHA 2C3QA 4LMWA 5KN3A 2IMDA 3HCZA 3D22A 2C80A 17GSA 5IQYA 4PQIA 4POBA 1TRWA 4NMUA 1HNAA 1MDJA 5DBQA 1ZL9A 5ECIB 3GN3A 3LSZA 1AAZA 3ZZXA 2MMZA 2VM2A 2GQKA 3GH9A 3G9BA 3RHBA 1AIUA 4USSA 3ZIVA 4ACSA 2RLIA 20GSA 1EP7A 4GCIA 3HXSA 2O7KA 2VLVA 2PMTA 1SK0A 1K0OA 1KNGA 3KIJA 1M2DA 1XIYA 3D5JA 1GSYA 2PBJA 2PGTA 1VF2A 1Y25A 2GZPA 1FAAA 2DJ1A 4MH2A 3ZRDA 5DAKA 4Q5NA 1SYRA 4YAVA 4Q5QA 4X1UA 4Z2UA 3Q18A 1TK0B 2E0QA 2HI7A 3WGEA 1MDIA 5G1LA 3LWAA 3C71A 1TRSA 2LJRA 2DJ0A 2M46A 2XBQA 5ECNB 1QXHA 3ZIJA 5DQSA 2EIQA 2H1AA 3FY7A 4TOPA 5ECPB 4MLYA 3QDNA 2BTOT 2R0PA 4MJAA 1K3LA 1FW1A 4WBJA 4F9ZA 2C0EA 4EO3A 4F2IA 1XOAA 1T7PB 1CQGA 4HJMA 3I69A 3LXZA 5DAKB 1MTCA 3IBHA 3QD9A 2LUSA 2DC5A 3I9V2 5D9VA 2GT5A 2NDOA 2MBTA 2E2MA 3IK9A 5D9TA 3UVHA 4XS4A 1GWCA 3TRQA 3VPQA 5JWQB 5EPFA 4O5RA 1W89A 1O8WA 1R26A 4HZ4A 3A5IA 2OKAA 3GX8A 1ILOA 1AQVA 3ZMKA 3TJJA 2CX4A 4KNDA 5IOXA 4Z2TA 1YQ1A 4JU5A 3TGZA 4KF9A 4J56E 3F6DA 4AGSA 4Z7XA 2OADA 1QMVA 4EKZA 1AQWA 1G7OA 2NTOA 4BVYA 6GSTA 2GTUA 5EVOA 1A24A 1M9BA 4QL9A 4O5UA 5JCGA 3ME8A 1F3AA 5EL8A 1Q4JA 1BAYA 5B8AA 3UJ1A 2C3NA 4GXZA 4P3YB 4KCAA 4NPBA 4XS4B 1NW2A 5G5EA 2HZEA 4LL1B 5D93A 2DKIA 1JZOA 1S3CA 2FWGA 5ECSA 2OE1A 3KCMA 16GSA 5HFIA 2O87A 4PURA 1SL1B 2RUEA 3PGTA 1FB0A 1ERTA 4K5RA 2CV4A 4K7OA 2KHPA 4D73B 4ML6A 3ERFA 4L5OA 5ECOB 1O85A 3HDCA 3LGCA 4N30A 4KUNA 1TKDB 3FZAA 5B8BA 4BVYB 2YP6A 3A3TA 1B4QA 4ZIJA 1VF4A 2H74A 2AAWA 1FO5A 3M8NA 4GQFA 4K2XA 2BMXA 1ZYQB 3MAKA 3RAZA 2ES7A 1T8EB 3FZ9A 5B7CA 1SK1A 5CYYA 2VUPA 2AV4A 1ZYNA 2HZEB 4IN0A 3KJYA 3WT1A 1TXXA 4K6XA 2L59A 4TR1A 4K0GA 4IHUA 3R3EA 2FY6A 3UBKA 2F8FA 5A4WA 3CTFA 3IAM2 5D73A 4NXIA 1F2EA 3GX0A 1F37A 3BBYA 4ZBBA 2MMNA 2KP1A 4KE3A 3L0HA 5IMFA 4WR5A 3FW2A 1T1VA 2REMA 4IJIA 1R4WA 3TCOA 1FOHA 3EMPA 3R2QA 1AUCA 2GLRA 1RK4A 4KCEA 1J9BA 4WR4A 2H6ZA 4KSOA 1GUKA 3GKXA 19GSA 5HR1A 2CVBA 2G0FA 3KGKA 4TR1B 1F6MC 5D8IA 4WKWA 2WJUA 1ERWA 4XTSA 3APSA 1TJDA 2V6KA 2XPEA 1AC1A 1FOVA 2H1BA 1U88A 4IBPA 1V57A 4TXOA 1VRSD 4V2MA 1GTUA 1X5EA 3IPZA 4NHWA 4QQ7A 5F8BA 1XXUA 3TDGA 2K8VA 1Z9HA 1OC8A 1GTAA 3GFKA 2EIOA 1GNWA 4MPFA 3CRUA 2QA2A 4HDEA 4H86A 3QR6A 2VO4A 1YZXA 2O85A 1PN9A 2K8SA 4V2NA 1O8XA 1ZCPA 3HYPA 4IELA 4ZB6A 2H8LA 3DYRA 3KH7A 3TKSE 5A4UA 1U3AA 1V40A 4OO5A 3HVSA 4DVCA 1A0FA 2IFQA 2XC2A 1XPVA 3Q6OA 1Z3EA 3ISOA 4KH7A 3F4RA 3LYPA 1RQMA 1YJ6A 5ECHB 1XWAA 2CA8A 1BQ7A 2OJLA 4TXOB 1I5GA 3IC8A 1SD8A 1ZOFA 2B1LA 5IMZA 2DMLA 2R5GA 4HEA2 4FYBA 1WJKA 3GUSA 3TJBA 1ML6A 4ZB8A 1THXA 1U3IA 4E8HA 3LG6A 3FYGA 1EGOA 2FWEA 2MYGA 3ERWA 2N5AA 2IFQB 2LJAA 3Q19A 2MZCA 2R4VA 3RPPA 1PMTA 1OE8A 3C1SA 3ZITA 1GSFA 3VWUA 3S9FA 2KLXA 3ZVJD 4PNGA 1A23A 2YPMA 2AHEA 2YV7A 5B6NA 1HNBA 2C0GA 3F9UA 1ZYPA 4NV2A 1ON4A 2GSRA 3V1WA 2GSSA 2NPBA 2A2PA 4K7NA 1K0BA 2C3TA 2YV9A 4MF7A 1SKRB 4K0NA 4LL4B 4GSNA 3HJPA 2H0HA 1J0FA 5F05A 3ZLPA 2FGXA 2VL9A 3FR6A 3PH9A 3QFBC 2IL3A 5FWGA 5HR3A 3KZQA 5IO0A 4V1Ag 2IMKA 2L6CA 4EDYA 2LRTA 3GL5A 4BA7A 3PINA 4JE1A 4PQHA 3LYKA 2OBIA 1I9DA 2X8HA 1WRYA 2P5QA 1R5AA 3EINA 5KOXA 5F0GA 1PKWA 2A4VA 3ZMLA 5J3RA 4EC0A 4PQ1A 2HXKA 3D4TA 3FMWA 4KAEA 1PD21 3J7Yk 1LBKA 1M99A 4OFMA 3ZVJA 4ZL8A 2OE3A 4KX4A 4PNFA 1G7EA 1XWGA 3E9JB 3TKQA 1TW9A 1U6TA 3E3EA 2JSYA 4I8BA 2A2RA 2A4HA 2VOCA 4POMA 5LD0A 2XPDA 2IWTA 3N9JA 2WCIA 1SU9A 2X4AA 3P2AA 3KP9A 2M80A 5DALA 3ED3A 2X64A 2H66A 2EIRA 1Z5YE 3BOAA 1A8YA 3IXRA 3IC4A 2HLSA 4DSSA 5CRGA 1TI1A 4ZILA 4MF5A 4Q5FA 1F3BA 1YEPA 4G19A 1YKCA 2JZSA 3GKNA 1XBSA 2V41A 1X5DA 2H1GA 5FT3A 2R6KA 1LJRA 1B48A 4N0ZA 2YZUA 1W4VA 2VLUA 3IHGA 2VD1A 2AYTA 5KN2A 4XCSA 1SJIA 3UIWA 1EOGA 4OO4A 3BCIA 3H8QA 4NHZA 1BYEA 3LEFA 3D21A 1R5PA 2TRXA 4RUVA 2FUG2 3L9UA 2HE3A 5DALB 2WS2A 4G10A 2FWFA 3KMNA 4ISDA 2ALBA 4FQUA 1OE7A 4ZXGA 3F63A 4DSSB 3GL3A 1X0RA 2QGVA 3FEUA 3IK7A 5DVBA 2V32A 22GSA 3W8JA 1PL1A 2VL3A 1HD2A 1X9MB 3PR8A 4HJ2A 2DBCA 1N8JA 4OFNA 2K9FA 1PX7A 1NHOA 2F51A 3UARA 2C4JA 3WGDA 3BJ5A 1XWCA 1XW9A 1DBYA 3FZ5A 5HR2A 1QK8A 3ME7A 1SK2A 2V2GA 4I2TA 4YKFA 1OC9A 2VCVA 2P31A 2P0GA 1GUMA 3GNJA 2LRNA 4G2EA 5GSTA 3D0ZA 1GLQA 1JLVA 2CAQA 1RW1A 2HT9A 5KEJA 2GZZA 1PX6A 5EY6A 3E0UA 2GS3A 1K0MA 4RI6A 5F06A 2B5XA 5AGYA 5CRHA 2X8GA 4AJ6A 4V1Ap 5ID2A 2OE0A 3QOUA 2HNLA 5J9BA 4D73A 2ON7A 4O7HA 3A5WA 4IP1A 2C8UA 2LRCA 1B4PA 2H19A 3GH6A 1TOFA 3F4TA 1JHBA 1GL8A 1YDKA 4BWSA 2LQOA 3D4MA 2X99A 1WIKA 1GP1A 2HSMA 2PVQA 1MD4A 2VCTA 1OC9B 2HZFA 1TU7A 3HVVA 3L9VA 1OC3A 5ENUA 2YN1A 2KUCA 3MIXA 2HRFA 4GRFA 1K0AA 2PN8A 3GKMA 1Z7PA 5DJMA 2WZ9A 6GSYA 2B3SA 2MMAA 1DSBA 1UC7A 3GV1A 4TN8A 5ID2B 3TRPA 2DJ3A 3CSJA 4KDXA 4TXVA 4YAPA 4I97A 5H5SA 5GAPD 2H75A 1WMJA 2WB9A 3DIEA 2DJKA 4ML1A 2O89A 1V98A 1SJ6A 2X8CA 4F82A 3IOSA 2GDRA 2LJKA 3RPNA 3DD3A 3TB2A 4KGIA 1FVKA 1DUGA 2GGTA 1A2MA 2VLTA 3KM6A 5IMDA 7GSSA 2N5FA 2B5YA 2VCZA 4JEDA 4IS0A 3HJMA 4IJ3A 4AF2A 4MA9A 3IRAA 2KOKA 3QAGA 2GT6A 2ZCTA 2JADA 3DVXA 2JACA 1PRXA 2L6DA 2V6OA 1YY7A 1THOA 2K6VA 5D96A 4O32A 4NV5A 3QAVA 5G31A 4X4JA 1TK5B 2TIRA 2FD3A 2FLSA 4O5QA 2C0DA 5ABRA 2L4QA 1U87A 1A2LA 3N5OA 3G7IA 2YWMA 18GSA 3O6TA 1USBA 2Z9SA 1GLPA 4MJBA 4HU7A 4IQAA 1AXDA 4FO5A 2X49A 3UAPA 1GSUA 3EPTA 3QCPA 3TOUA 4PUAA 3UOMA 2QSIA 3HHVA 3ZREA 3EYTA 1GSDA 4ZL9A 1FHEA 2DIZA 1SKWB 4F0CA 1ERUA 3P8WA 3SBCA 2YCDA 6GSUA 3FR9A 4Q5RA 2EC4A 2DMMA 3F3QA 3M3MA 5ECLB 3VPTA 1AQXA 1C72A 4JRRA 2N5BA 1NSWA 1N2AA 4ZBDA 2HRNA 3TKSA 3H1NA 3AY8A 3GSSA 5IOWA 2P5RA 1HNCA 1XZOA 5DDLA 3ZL5A 1M2BA 8GSSA 3TKPA 2H6YA 5JCWA 2TRCP 2XHFA 4GSTA 1PA3A 1JFUA 4GF0A 1JLWA 3GRXA 1KTEA 2VIMA 4L0WA 4X43A 2GQLA 2I9HA 2VAFA 5KOWA 4MDCA 5AISA 1T3BA 1SENA 2IMEA 2JZTA 5ECMB 2L5OA 3DGQA 2C1YA 2WGRA 2QC7A 2QA1A 4I5QA 3VI5A 3DVWA 1M7TA 3GKKA 1M9AA 2IMFA 4J2FA 4YQUA 1WE0A 2LNSA 2H6XA 1PL2A 2CVDA 3OR5A 4ECCA 1YKAA 3GURA 3IHQA 4TR3A 5A5KA 4MP4A 1EOHA 4ECJA 3A2WA 1BX9A 2LEGA 2VL2A 2RM5A 1UN2A 2GSTA 3UL3A 4K2DA 3KD0A 3J7Yb 4OFTA 2VM1A 1T4YA 4EDZA 2LSTA 5AIVA 2PVOC 3F3RA 3GTUA 2YANA 3HZ8A 1IYHA 2JSZA 5FHIA 4G0KA 1BG5A 1EV4A 3GA4A 3NZNA 3PPUA 4OCEA 4CY8A 3MDKA 4KB3A 4LMVA 3VURA 4EXJA 3L4NA 4JR6A 1TTZA 4WF5A 1EEJA 3P7XA 4WXTA 1V58A 2H73A 2JU5A 2IJYA 2PWJA 2YOIA 3IA1A 5COHA 4WEYA 1S3DA 1DE1A 3L9SA 1B9YC 4MZCA 5KN0A 4TVEA 2ZUPA 1AW9A 4FYCA 2K18A 4ILFA 1QGVA 4MJCA 2MMOA 3ZTLA 3KTBA 3LXTA 1TK8B 1GRXA 3GTUB 3VWXA 3MYDA 3HJOA 1XW5A 2R0CA 4PTSA 3U6VA 5AN1A 1URMA 2FA8A 5JCUA 4LLRA 4HU9A 4JR4A 4YQVA 5A4VA 3VWWA 3NOFA 5INYA 1Z6MA 3FK8A 4ZBAA 4N10A 4XHMA 5DQYA 3ERGA 4K1FA 4PGTA 4KDUA 3IDVA 4NWYA 3CSHA 3HD5A 2VCWA 4ID0A 1TP9A 3A2VA 1DE2A 1WOUA 3KXOA 4DSRA 4XRAA 2OBKA 2VCXA 3WYWA 2WRTA 2YNXA 4HQSA 1WP0A 1TI3A 1FB6A 4J57E 4MF6A 2LQQA 2HRKA 2FCHA 1GSSA 5G30A 2B7JA 1OAZA 2OACA 1X9WB 5D9WA 1HYUA 2M72A 2B1KA 3H4KA 2AUVA 3CBUA 3UEMA 4MPGA 1ACVA 3DRNA 3Q74A 4MJEA 3TRXA 3RHCA 1GSQA 3FR3A 1VGLA 2H1DA 1ST9A 5GSSA 4TW5A 1EWXA 3MSZA 5L71A 1K0NA 1XVWA 2F9SA 4YH2A 1ZZYA 4MCUA 5J5NA 1H75A 4POLA 6GSVA 1A8LA 1O73A 5DJLA 1O81A 3UMAA 2H0IA 4KA0A 2QKEA 2GVPA 3CTGA 2KP2A 4MNNA 2I3YA 3NIVA 5IMCA 4ECIA 2IIYA 1SD9A 5G2ZA 4GLTA 3EU3A 1CQHA 2DJ2A 5CNWA 2DLXA 5G1KA 1EEMA 1YF1A 4EF0A 5HR0A 1UA5A 1XOBA 4AJ7A 1F9MA 4MABA 3KP8A 1G6WA 2FHEA 3LJRA 1SYXA 5CREA 3LFLA 5HFKA 4G9HA 2OA7A 2CQ9A 4I6XA 4FH8A 4PUFC 1B9XC 3CRTA 4KSMA 1EZKA 3DMLA 5J4UA 3F4SA 3ZYWA 1R7HA 1Z7RA 2PERA 1VF1A 3MWHA 2FNOA 6GSSA 3BD2A 4XRDA 1QQ2A 3JCML 4K9ZA 5C04A 1M0UA 2FA4A 1JZWA 1X5CA 4MZBA 2YWNA 4IP6A 2BJXA 2H72A 4XIHA 2HSHA 2YWIA 4YKGA 3QMXA 1GULA 5H5QA 14GSA 4CW9A 2R37A 1WPIA 5LNKe 4OD7A 4IGJA 5JWOB 2I4AA 1GSEA 4QL7A 5LCZA 5E59A 3M9KA 3LQ7A 4IKHA 3GSTA 3KMOA 2CAIA 3TOTA 1QUWA 3CSIA 3KH9A 4GQCA 4V2LA 2H01A 4BWQA 1V2AA 2F3MA 3CMIA 1SL2B 3HZ4A 1HQOA 1OYJA 3HKRA 3F6FA 5CAXA 4CY6A 3EU4A 5GZZB 1SJZA 3IE3A 1IYIA 2CZ3A 1G0TA 4TKYA 1ZYEA 2DIYA 3WD6A 3UVTA 2JL4A 3IV4A 1EGRA 2DJJA 3KEBA 4RI7A 3RBTA 1KEBA 2D2ZA 10GSA 3IAS2 2LNTA 1K0DA 4GWRA 3H93A 4E8EA 5ECQB 2GSQA 3HA9A 1FG4A 2IN3A 3APOA 4KDYA 1XWBA 1KBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5E A;  5IMV A;  2ZNM A;  1PQN A;  3K8N A;  5IM9 A;  1E2Y A;  1ZGN A;  4HOJ A;  3VK9 A;  1BED A;  4RQR A;  5KN1 A;  1T4Z A;  5ECR B;  5GAN D;  4HS1 A;  3LOR A;  4POK A;  3A2X A;  1JZR A;  4O92 A;  1XVQ A;  4DEJ A;  1PSQ A;  4EUY A;  4EL1 A;  1GNE A;  5IO2 A;  1GTI A;  2H0G A;  4HQZ A;  2CVK A;  1ERV A;  1V9W A;  4EE0 A;  3TKS C;  2F8A A;  3O3T A;  1OVN A;  2WDU A;  3CYN A;  5DCH A;  3C7M A;  1MD3 A;  3O76 A;  2A2S A;  5HQP A;  3EE2 A;  4L5L A;  1B8X A;  1TU8 A;  5AIX A;  1NHY A;  3WT2 A;  3EMX A;  5IPG A;  2CZ2 A;  2VCQ A;  6GSW A;  3FKF A;  3EC3 A;  2J23 A;  13GS A;  4TR0 A;  4CDO A;  3DEX A;  2ON5 A;  4HI7 A;  3GIX A;  3I6A A;  1A2J A;  12GS A;  2E7P A;  3VLN A;  2LS5 A;  4MK3 A;  4IVF A;  2B7K A;  3DKS A;  4BL7 A;  1PKZ A;  5ECK B;  3P90 A;  1H4O A;  2H70 A;  4OMV A;  3G7Y A;  4OWY A;  2LV3 A;  1SKS B;  4K7I A;  2VL2 C;  4WF4 A;  5D9X A;  1SL0 B;  1PGT A;  4CHS A;  1EV9 A;  3W8S A;  1GH2 A;  4RQX A;  1WWJ A;  1VF3 A;  2NBS A;  3EUR A;  4ULX A;  9GSS A;  2L5L A;  3FRC A;  1TRU A;  4TR4 A;  4TRX A;  3UBL A;  5G5F A;  3C73 A;  4BVX A;  3DXB A;  3MNG A;  2B6M A;  3FHK A;  5E4W A;  3US3 A;  3KTL A;  4FIW A;  4ECB A;  4HZ2 A;  2C0F A;  3TJK A;  4WET A;  4HUA A;  4K8M A;  2L57 A;  2PU9 C;  3W6G A;  1OKD A;  2HFD A;  3M0F A;  3VWV A;  5B6M A;  1E6B A;  1TRV A;  2LKU A;  3WGX A;  1S3A A;  3TJF A;  2YJ7 A;  1Q98 A;  4ZB9 A;  1BJX A;  3BCK A;  1O7U A;  4YQM A;  1XCC A;  4NAX A;  2NVL A;  4IQ1 A;  4OCF A;  4JBB A;  3G7J A;  2O8V B;  4EVM A;  2LTK A;  2YZH A;  4ZL7 A;  2JZR A;  2YJH A;  3GMF A;  1GTB A;  1MEK A;  2DSA A;  1FVJ A;  2E2G A;  3U5R E;  5C00 A;  3APQ A;  1EP8 A;  1T00 A;  2RM6 A;  2L4C A;  4I2U A;  4DSQ A;  3C8E A;  1Z6N A;  1X9S B;  3D6I A;  3M1G A;  5F07 A;  3TKR A;  2XBI A;  2H76 A;  5J41 A;  4N0V A;  5CP1 A;  3HY2 A;  5HFG A;  3IR4 A;  11GS A;  1G6Y A;  2YWO A;  1ABA A;  2CX3 A;  1MDK A;  3VFI A;  2PUK C;  3ZFL A;  4F0B A;  4WBR D;  4GTU A;  4MZW A;  2R3X A;  1Y6E A;  3F0I A;  1UVZ A;  4JZQ A;  1OKT A;  4FYU A;  5IPH A;  1O6J A;  2HSY A;  2AJQ B;  4F03 A;  2VD0 A;  4X0X A;  2H71 A;  5ELA A;  2RUF A;  5CO3 A;  1YEX A;  3SWL A;  2I81 A;  3TJG A;  1YF0 A;  1J08 A;  2H30 A;  2CT6 A;  2WUL A;  4KW6 A;  3TUE A;  3EVI A;  2I1U A;  4XS6 A;  2AB6 A;  2WFC A;  4LA1 A;  6GSX A;  4XS1 A;  1XFL A;  3QPM A;  2IPA A;  3C1R A;  1NM3 A;  1XW6 A;  3GHA A;  5H5R A;  3RDW A;  3L78 A;  4L8E A;  2MBS A;  1K3O A;  4AJ8 A;  5ELG A;  2RII A;  1A0R P;  3EWL A;  5JWR B;  3VI7 A;  4PXO A;  5J9C A;  4GSS A;  2J9H A;  5CRD A;  2R2J A;  3ZFB A;  3M9J A;  2PPT A;  2GZY A;  3DWV A;  5IMA A;  1K3Y A;  1M2A A;  1TDI A;  4PX1 A;  1LU4 A;  3CXG A;  4N11 A;  2FWH A;  4BPY A;  4MMM A;  2V1M A;  4IW9 A;  2GQM A;  3QFA C;  3H79 A;  5DCG A;  1QFN A;  3F8U A;  2G2Q A;  1ZMA A;  1XWK A;  3QAW A;  1JZD A;  2HYX A;  5IIZ A;  3I43 A;  3FZ4 A;  3GYK A;  1K0C A;  4MH3 A;  2IMI A;  4L0U A;  3HVX A;  5CRW A;  1GUH A;  2C3Q A;  4LMW A;  5KN3 A;  2IMD A;  3HCZ A;  3D22 A;  2C80 A;  17GS A;  5IQY A;  4PQI A;  4POB A;  1TRW A;  4NMU A;  1HNA A;  5DBQ A;  1MDJ A;  1ZL9 A;  5ECI B;  3GN3 A;  3LSZ A;  1AAZ A;  3ZZX A;  2MMZ A;  2VM2 A;  2GQK A;  3GH9 A;  3G9B A;  3RHB A;  1AIU A;  3ZIV A;  4ACS A;  2RLI A;  20GS A;  1EP7 A;  4GCI A;  3HXS A;  2O7K A;  2VLV A;  2PMT A;  1SK0 A;  1K0O A;  1KNG A;  3KIJ A;  1M2D A;  1XIY A;  3D5J A;  1GSY A;  2PBJ A;  2PGT A;  1VF2 A;  1Y25 A;  2GZP A;  1FAA A;  2DJ1 A;  4MH2 A;  3ZRD A;  5DAK A;  4Q5N A;  1SYR A;  4YAV A;  4Q5Q A;  4X1U A;  3Q18 A;  1TK0 B;  2E0Q A;  2HI7 A;  3WGE A;  1MDI A;  5G1L A;  3LWA A;  3C71 A;  1TRS A;  2LJR A;  2DJ0 A;  2M46 A;  2XBQ A;  5ECN B;  1QXH A;  3ZIJ A;  5DQS A;  2EIQ A;  2H1A A;  3FY7 A;  4TOP A;  5ECP B;  4MLY A;  3QDN A;  2BTO T;  4MJA A;  1K3L A;  1FW1 A;  4WBJ A;  4F9Z A;  2C0E A;  4EO3 A;  4F2I A;  1XOA A;  1T7P B;  1CQG A;  4HJM A;  3I69 A;  3LXZ A;  5DAK B;  1MTC A;  3IBH A;  3QD9 A;  2LUS A;  2DC5 A;  3I9V 2;  5D9V A;  2GT5 A;  2NDO A;  2MBT A;  2E2M A;  3IK9 A;  5D9T A;  3UVH A;  4XS4 A;  1GWC A;  3TRQ A;  3VPQ A;  5JWQ B;  5EPF A;  4O5R A;  1W89 A;  1O8W A;  1R26 A;  4HZ4 A;  2OKA A;  3GX8 A;  1ILO A;  1AQV A;  3ZMK A;  3TJJ A;  2CX4 A;  4KND A;  5IOX A;  1YQ1 A;  4JU5 A;  3TGZ A;  4J56 E;  3F6D A;  4AGS A;  4Z7X A;  2OAD A;  1QMV A;  4EKZ A;  1AQW A;  1G7O A;  2NTO A;  4BVY A;  6GST A;  2GTU A;  5EVO A;  1A24 A;  1M9B A;  4QL9 A;  5JCG A;  3ME8 A;  1F3A A;  5EL8 A;  1Q4J A;  1BAY A;  5B8A A;  3UJ1 A;  2C3N A;  4GXZ A;  4P3Y B;  4KCA A;  4NPB A;  4XS4 B;  1NW2 A;  5G5E A;  2HZE A;  4LL1 B;  5D93 A;  1JZO A;  1S3C A;  2FWG A;  5ECS A;  2OE1 A;  3KCM A;  16GS A;  5HFI A;  2O87 A;  4PUR A;  1SL1 B;  2RUE A;  3PGT A;  1FB0 A;  1ERT A;  2CV4 A;  4K7O A;  2KHP A;  4D73 B;  4ML6 A;  3ERF A;  4L5O A;  5ECO B;  1O85 A;  3HDC A;  3LGC A;  4N30 A;  4KUN A;  1TKD B;  3FZA A;  5B8B A;  2YP6 A;  3A3T A;  1B4Q A;  4ZIJ A;  1VF4 A;  2H74 A;  2AAW A;  1FO5 A;  3M8N A;  4GQF A;  2BMX A;  1ZYQ B;  3MAK A;  3RAZ A;  2ES7 A;  1T8E B;  3FZ9 A;  5B7C A;  1SK1 A;  5CYY A;  2VUP A;  2AV4 A;  2HZE B;  4IN0 A;  3KJY A;  3WT1 A;  1TXX A;  4K6X A;  2L59 A;  4TR1 A;  4K0G A;  4IHU A;  2FY6 A;  3UBK A;  2F8F A;  5A4W A;  3CTF A;  3IAM 2;  5D73 A;  4NXI A;  1F2E A;  3GX0 A;  1F37 A;  3BBY A;  4ZBB A;  2MMN A;  2KP1 A;  4KE3 A;  3L0H A;  5IMF A;  4WR5 A;  3FW2 A;  1T1V A;  2REM A;  4IJI A;  1R4W A;  3TCO A;  3EMP A;  3R2Q A;  1AUC A;  2GLR A;  1RK4 A;  4KCE A;  1J9B A;  4WR4 A;  2H6Z A;  4KSO A;  1GUK A;  3GKX A;  19GS A;  5HR1 A;  2CVB A;  2G0F A;  3KGK A;  4TR1 B;  1F6M C;  5D8I A;  4WKW A;  2WJU A;  1ERW A;  4XTS A;  3APS A;  1TJD A;  2V6K A;  2XPE A;  1AC1 A;  1FOV A;  2H1B A;  1U88 A;  4IBP A;  1V57 A;  4TXO A;  1VRS D;  4V2M A;  1GTU A;  1X5E A;  3IPZ A;  4NHW A;  4QQ7 A;  5F8B A;  1XXU A;  3TDG A;  2K8V A;  1Z9H A;  1OC8 A;  1GTA A;  3GFK A;  2EIO A;  1GNW A;  4MPF A;  3CRU A;  4HDE A;  4H86 A;  3QR6 A;  2VO4 A;  1YZX A;  2O85 A;  1PN9 A;  2K8S A;  4V2N A;  1O8X A;  1ZCP A;  3HYP A;  4IEL A;  4ZB6 A;  2H8L A;  3DYR A;  3KH7 A;  3TKS E;  5A4U A;  1U3A A;  1V40 A;  4OO5 A;  3HVS A;  4DVC A;  1A0F A;  2IFQ A;  2XC2 A;  1XPV A;  3Q6O A;  1Z3E A;  3ISO A;  4KH7 A;  3F4R A;  3LYP A;  1RQM A;  1YJ6 A;  5ECH B;  1XWA A;  2CA8 A;  1BQ7 A;  2OJL A;  4TXO B;  1I5G A;  1SD8 A;  1ZOF A;  2B1L A;  5IMZ A;  2DML A;  2R5G A;  4HEA 2;  4FYB A;  1WJK A;  3GUS A;  3TJB A;  1ML6 A;  4ZB8 A;  1THX A;  1U3I A;  4E8H A;  3LG6 A;  3FYG A;  1EGO A;  2FWE A;  2MYG A;  3ERW A;  2N5A A;  2IFQ B;  2LJA A;  3Q19 A;  2MZC A;  2R4V A;  3RPP A;  1PMT A;  1OE8 A;  3C1S A;  3ZIT A;  1GSF A;  3VWU A;  3S9F A;  2KLX A;  3ZVJ D;  4PNG A;  1A23 A;  2YPM A;  2AHE A;  2YV7 A;  5B6N A;  1HNB A;  2C0G A;  3F9U A;  4NV2 A;  1ON4 A;  2GSR A;  3V1W A;  2GSS A;  2NPB A;  4K7N A;  1K0B A;  2C3T A;  2YV9 A;  4MF7 A;  1SKR B;  4K0N A;  4LL4 B;  4GSN A;  3HJP A;  2H0H A;  1J0F A;  5F05 A;  3ZLP A;  2FGX A;  2VL9 A;  3FR6 A;  3PH9 A;  3QFB C;  2IL3 A;  5FWG A;  5HR3 A;  3KZQ A;  5IO0 A;  4V1A g;  2IMK A;  2L6C A;  4EDY A;  2LRT A;  3GL5 A;  4BA7 A;  3PIN A;  4JE1 A;  4PQH A;  3LYK A;  2OBI A;  1I9D A;  2X8H A;  1WRY A;  2P5Q A;  1R5A A;  3EIN A;  5F0G A;  1PKW A;  2A4V A;  3ZML A;  5J3R A;  4EC0 A;  4PQ1 A;  2HXK A;  3D4T A;  4KAE A;  1PD2 1;  3J7Y k;  1LBK A;  1M99 A;  4OFM A;  3ZVJ A;  4ZL8 A;  2OE3 A;  4KX4 A;  4PNF A;  1G7E A;  1XWG A;  3E9J B;  3TKQ A;  1TW9 A;  1U6T A;  3E3E A;  2JSY A;  4I8B A;  2A2R A;  2VOC A;  4POM A;  5LD0 A;  2XPD A;  2IWT A;  3N9J A;  2WCI A;  1SU9 A;  3P2A A;  3KP9 A;  2M80 A;  5DAL A;  3ED3 A;  2X64 A;  2H66 A;  2EIR A;  1Z5Y E;  3BOA A;  1A8Y A;  3IXR A;  3IC4 A;  2HLS A;  4DSS A;  5CRG A;  1TI1 A;  4ZIL A;  4MF5 A;  4Q5F A;  1F3B A;  1YEP A;  4G19 A;  1YKC A;  2JZS A;  3GKN A;  1XBS A;  2V41 A;  1X5D A;  2H1G A;  5FT3 A;  2R6K A;  1LJR A;  1B48 A;  4N0Z A;  2YZU A;  1W4V A;  2VLU A;  2VD1 A;  2AYT A;  5KN2 A;  4XCS A;  1SJI A;  3UIW A;  1EOG A;  4OO4 A;  3BCI A;  3H8Q A;  4NHZ A;  1BYE A;  3LEF A;  3D21 A;  1R5P A;  2TRX A;  4RUV A;  2FUG 2;  3L9U A;  2HE3 A;  5DAL B;  2WS2 A;  4G10 A;  2FWF A;  3KMN A;  4ISD A;  2ALB A;  1OE7 A;  4ZXG A;  3F63 A;  4DSS B;  3GL3 A;  1X0R A;  2QGV A;  3FEU A;  3IK7 A;  5DVB A;  2V32 A;  22GS A;  3W8J A;  1PL1 A;  2VL3 A;  1HD2 A;  1X9M B;  3PR8 A;  4HJ2 A;  2DBC A;  1N8J A;  4OFN A;  2K9F A;  1PX7 A;  1NHO A;  2F51 A;  3UAR A;  2C4J A;  3WGD A;  3BJ5 A;  1XWC A;  1XW9 A;  1DBY A;  3FZ5 A;  5HR2 A;  1QK8 A;  3ME7 A;  1SK2 A;  2V2G A;  4I2T A;  1OC9 A;  2VCV A;  2P31 A;  2P0G A;  1GUM A;  3GNJ A;  2LRN A;  4G2E A;  5GST A;  3D0Z A;  1GLQ A;  1JLV A;  2CAQ A;  1RW1 A;  2HT9 A;  5KEJ A;  2GZZ A;  1PX6 A;  5EY6 A;  3E0U A;  2GS3 A;  1K0M A;  4RI6 A;  5F06 A;  2B5X A;  5AGY A;  5CRH A;  2X8G A;  4AJ6 A;  4V1A p;  5ID2 A;  2OE0 A;  3QOU A;  2HNL A;  5J9B A;  4D73 A;  2ON7 A;  4O7H A;  3A5W A;  4IP1 A;  2C8U A;  2LRC A;  1B4P A;  2H19 A;  3GH6 A;  1TOF A;  3F4T A;  1JHB A;  1GL8 A;  1YDK A;  4BWS A;  2LQO A;  3D4M A;  2X99 A;  1WIK A;  1GP1 A;  2PVQ A;  1MD4 A;  2VCT A;  1OC9 B;  2HZF A;  1TU7 A;  3HVV A;  3L9V A;  1OC3 A;  5ENU A;  2YN1 A;  2KUC A;  2HRF A;  4GRF A;  1K0A A;  2PN8 A;  3GKM A;  1Z7P A;  5DJM A;  2WZ9 A;  6GSY A;  2B3S A;  2MMA A;  1DSB A;  1UC7 A;  3GV1 A;  4TN8 A;  5ID2 B;  3TRP A;  2DJ3 A;  3CSJ A;  4KDX A;  4TXV A;  4YAP A;  4I97 A;  5H5S A;  5GAP D;  2H75 A;  1WMJ A;  2WB9 A;  3DIE A;  2DJK A;  4ML1 A;  2O89 A;  1V98 A;  1SJ6 A;  2X8C A;  4F82 A;  3IOS A;  2GDR A;  2LJK A;  3RPN A;  3DD3 A;  3TB2 A;  4KGI A;  1FVK A;  1DUG A;  2GGT A;  1A2M A;  2VLT A;  3KM6 A;  5IMD A;  7GSS A;  2N5F A;  2B5Y A;  2VCZ A;  4JED A;  4IS0 A;  3HJM A;  4IJ3 A;  4AF2 A;  4MA9 A;  3IRA A;  2KOK A;  3QAG A;  2GT6 A;  2ZCT A;  2JAD A;  3DVX A;  2JAC A;  1PRX A;  2L6D A;  2V6O A;  1YY7 A;  1THO A;  2K6V A;  5D96 A;  4O32 A;  4NV5 A;  3QAV A;  5G31 A;  1TK5 B;  2TIR A;  2FD3 A;  2FLS A;  2C0D A;  5ABR A;  2L4Q A;  1U87 A;  1A2L A;  3N5O A;  3G7I A;  2YWM A;  18GS A;  3O6T A;  1USB A;  2Z9S A;  1GLP A;  4MJB A;  4HU7 A;  4IQA A;  1AXD A;  4FO5 A;  3UAP A;  1GSU A;  3QCP A;  3TOU A;  4PUA A;  3UOM A;  2QSI A;  3HHV A;  3ZRE A;  3EYT A;  1GSD A;  4ZL9 A;  1FHE A;  2DIZ A;  1SKW B;  4F0C A;  1ERU A;  3P8W A;  3SBC A;  2YCD A;  6GSU A;  3FR9 A;  4Q5R A;  2EC4 A;  2DMM A;  3F3Q A;  3M3M A;  5ECL B;  3VPT A;  1AQX A;  1C72 A;  4JRR A;  2N5B A;  1NSW A;  1N2A A;  4ZBD A;  2HRN A;  3TKS A;  3H1N A;  3AY8 A;  3GSS A;  5IOW A;  2P5R A;  1HNC A;  1XZO A;  5DDL A;  3ZL5 A;  1M2B A;  8GSS A;  3TKP A;  2H6Y A;  5JCW A;  2TRC P;  2XHF A;  4GST A;  1PA3 A;  1JFU A;  4GF0 A;  1JLW A;  3GRX A;  1KTE A;  2VIM A;  4L0W A;  4X43 A;  2GQL A;  2I9H A;  2VAF A;  4MDC A;  5AIS A;  1T3B A;  1SEN A;  2IME A;  2JZT A;  5ECM B;  2L5O A;  3DGQ A;  2C1Y A;  2WGR A;  2QC7 A;  4I5Q A;  3VI5 A;  3DVW A;  1M7T A;  3GKK A;  1M9A A;  2IMF A;  4J2F A;  4YQU A;  1WE0 A;  2LNS A;  2H6X A;  1PL2 A;  2CVD A;  3OR5 A;  4ECC A;  1YKA A;  3GUR A;  3IHQ A;  4TR3 A;  5A5K A;  4MP4 A;  1EOH A;  4ECJ A;  3A2W A;  1BX9 A;  2LEG A;  2VL2 A;  2RM5 A;  1UN2 A;  2GST A;  3UL3 A;  4K2D A;  3KD0 A;  3J7Y b;  4OFT A;  2VM1 A;  1T4Y A;  4EDZ A;  2LST A;  5AIV A;  2PVO C;  3F3R A;  3GTU A;  2YAN A;  3HZ8 A;  1IYH A;  2JSZ A;  5FHI A;  1BG5 A;  1EV4 A;  3GA4 A;  3NZN A;  4OCE A;  3MDK A;  4KB3 A;  4LMV A;  3VUR A;  4EXJ A;  3L4N A;  4JR6 A;  1TTZ A;  4WF5 A;  1EEJ A;  3P7X A;  4WXT A;  1V58 A;  2H73 A;  2JU5 A;  2IJY A;  2PWJ A;  2YOI A;  3IA1 A;  5COH A;  4WEY A;  1S3D A;  1DE1 A;  3L9S A;  1B9Y C;  4MZC A;  5KN0 A;  4TVE A;  2ZUP A;  1AW9 A;  4FYC A;  2K18 A;  4ILF A;  1QGV A;  4MJC A;  2MMO A;  3ZTL A;  3KTB A;  3LXT A;  1TK8 B;  1GRX A;  3GTU B;  3VWX A;  3HJO A;  1XW5 A;  3U6V A;  5AN1 A;  1URM A;  2FA8 A;  5JCU A;  4LLR A;  4HU9 A;  4JR4 A;  4YQV A;  5A4V A;  3VWW A;  3NOF A;  5INY A;  1Z6M A;  3FK8 A;  4ZBA A;  4N10 A;  4XHM A;  5DQY A;  3ERG A;  4K1F A;  4PGT A;  4KDU A;  3IDV A;  4NWY A;  3CSH A;  3HD5 A;  2VCW A;  4ID0 A;  1TP9 A;  3A2V A;  1DE2 A;  1WOU A;  3KXO A;  4DSR A;  4XRA A;  2OBK A;  2VCX A;  3WYW A;  2WRT A;  2YNX A;  4HQS A;  1WP0 A;  1TI3 A;  1FB6 A;  4J57 E;  4MF6 A;  2LQQ A;  2FCH A;  1GSS A;  5G30 A;  2B7J A;  1OAZ A;  2OAC A;  1X9W B;  5D9W A;  1HYU A;  2M72 A;  2B1K A;  3H4K A;  2AUV A;  3CBU A;  3UEM A;  4MPG A;  1ACV A;  3DRN A;  3Q74 A;  4MJE A;  3TRX A;  3RHC A;  1GSQ A;  3FR3 A;  1VGL A;  2H1D A;  1ST9 A;  5GSS A;  4TW5 A;  1EWX A;  3MSZ A;  5L71 A;  1K0N A;  1XVW A;  2F9S A;  4YH2 A;  1ZZY A;  4MCU A;  5J5N A;  1H75 A;  4POL A;  6GSV A;  1A8L A;  1O73 A;  5DJL A;  1O81 A;  3UMA A;  2H0I A;  4KA0 A;  2QKE A;  2GVP A;  3CTG A;  2KP2 A;  2I3Y A;  3NIV A;  5IMC A;  4ECI A;  2IIY A;  1SD9 A;  5G2Z A;  4GLT A;  3EU3 A;  1CQH A;  2DJ2 A;  5CNW A;  2DLX A;  5G1K A;  1EEM A;  1YF1 A;  4EF0 A;  5HR0 A;  1UA5 A;  1XOB A;  4AJ7 A;  1F9M A;  4MAB A;  3KP8 A;  1G6W A;  2FHE A;  3LJR A;  1SYX A;  5CRE A;  3LFL A;  5HFK A;  4G9H A;  2OA7 A;  2CQ9 A;  4I6X A;  4FH8 A;  4PUF C;  1B9X C;  3CRT A;  4KSM A;  1EZK A;  3DML A;  5J4U A;  3F4S A;  3ZYW A;  1R7H A;  1Z7R A;  2PER A;  1VF1 A;  3MWH A;  2FNO A;  6GSS A;  3BD2 A;  4XRD A;  1QQ2 A;  3JCM L;  4K9Z A;  5C04 A;  1M0U A;  2FA4 A;  1JZW A;  1X5C A;  4MZB A;  2YWN A;  4IP6 A;  2BJX A;  2H72 A;  4XIH A;  2HSH A;  2YWI A;  3QMX A;  1GUL A;  5H5Q A;  14GS A;  4CW9 A;  2R37 A;  1WPI A;  5LNK e;  4OD7 A;  4IGJ A;  5JWO B;  2I4A A;  1GSE A;  4QL7 A;  5LCZ A;  5E59 A;  3M9K A;  3LQ7 A;  4IKH A;  3GST A;  3KMO A;  2CAI A;  3TOT A;  1QUW A;  3CSI A;  3KH9 A;  4GQC A;  4V2L A;  2H01 A;  4BWQ A;  1V2A A;  2F3M A;  3CMI A;  1SL2 B;  3HZ4 A;  1HQO A;  1OYJ A;  3HKR A;  3F6F A;  5CAX A;  3EU4 A;  5GZZ B;  1SJZ A;  3IE3 A;  1IYI A;  2CZ3 A;  1G0T A;  4TKY A;  1ZYE A;  2DIY A;  3WD6 A;  3UVT A;  2JL4 A;  3IV4 A;  1EGR A;  2DJJ A;  3KEB A;  4RI7 A;  3RBT A;  1KEB A;  2D2Z A;  10GS A;  3IAS 2;  2LNT A;  1K0D A;  4GWR A;  3H93 A;  4E8E A;  5ECQ B;  2GSQ A;  3HA9 A;  1FG4 A;  2IN3 A;  3APO A;  4KDY A;  1XWB A;  1KBN A; 
#chains in the Genus database with same CATH topology
 2B5E A;  5IMV A;  2ZNM A;  1PQN A;  3K8N A;  5IM9 A;  1E2Y A;  1ZGN A;  4HOJ A;  4G0L A;  3VK9 A;  1BED A;  4RQR A;  5KN1 A;  1T4Z A;  5ECR B;  5GAN D;  4HS1 A;  3LOR A;  4POK A;  3A2X A;  1JZR A;  4O92 A;  1XVQ A;  4DEJ A;  1PSQ A;  4EUY A;  4EL1 A;  1GNE A;  5IO2 A;  1GTI A;  2UZ8 A;  2H0G A;  4HQZ A;  2CVK A;  1ERV A;  1V9W A;  4EE0 A;  3TKS C;  2F8A A;  3O3T A;  1OVN A;  2WDU A;  3CYN A;  4EIP A;  5DCH A;  3C7M A;  1MD3 A;  3O76 A;  2A2S A;  5HQP A;  3EE2 A;  4L5L A;  1B8X A;  1TU8 A;  5AIX A;  1NHY A;  3WT2 A;  3EMX A;  5IPG A;  2CZ2 A;  2VCQ A;  6GSW A;  3FKF A;  3EC3 A;  4ICY A;  4EIQ A;  2J23 A;  13GS A;  4TR0 A;  4CDO A;  3DEX A;  2ON5 A;  4HI7 A;  3GIX A;  3I6A A;  1A2J A;  12GS A;  2E7P A;  3VLN A;  2LS5 A;  2R0G A;  4MK3 A;  4IVF A;  2B7K A;  3DKS A;  4BL7 A;  1PKZ A;  5ECK B;  3P90 A;  1H4O A;  2H70 A;  4OMV A;  5BMU A;  3G7Y A;  2DKH A;  4OWY A;  2LV3 A;  1SKS B;  4K7I A;  2VL2 C;  4WF4 A;  5D9X A;  1SL0 B;  1PGT A;  4CHS A;  1EV9 A;  3W8S A;  1GH2 A;  4RQX A;  1WWJ A;  4G0I A;  1VF3 A;  2NBS A;  3EUR A;  4ULX A;  9GSS A;  2L5L A;  3FRC A;  1TRU A;  4TR4 A;  1XG8 A;  4K5S A;  4TRX A;  3UBL A;  5G5F A;  3C73 A;  4BVX A;  3DXB A;  3MNG A;  2B6M A;  3FHK A;  5E4W A;  3US3 A;  3KTL A;  4FIW A;  4ECB A;  4HZ2 A;  4BL7 B;  2C0F A;  3TJK A;  4WET A;  4HUA A;  4K8M A;  2L57 A;  2PU9 C;  3W6G A;  3LW9 A;  1OKD A;  2HFD A;  3M0F A;  3VWV A;  5B6M A;  1E6B A;  1TRV A;  2LKU A;  3WGX A;  1S3A A;  3TJF A;  2YJ7 A;  1Q98 A;  4ZB9 A;  1BJX A;  3BCK A;  1O7U A;  4YQM A;  1XCC A;  4NAX A;  2NVL A;  4IQ1 A;  4OCF A;  4JBB A;  4BVX B;  3G7J A;  2O8V B;  4EVM A;  2LTK A;  2YZH A;  4ZL7 A;  2JZR A;  2YJH A;  3GMF A;  1GTB A;  1MEK A;  2DSA A;  1FVJ A;  2E2G A;  3U5R E;  5C00 A;  3APQ A;  1EP8 A;  1T00 A;  2RM6 A;  2L4C A;  4I2U A;  4DSQ A;  3C8E A;  1Z6N A;  1X9S B;  1PN0 A;  3D6I A;  3M1G A;  5F07 A;  3TKR A;  4A5P A;  2XBI A;  2H76 A;  5J41 A;  4N0V A;  5CP1 A;  3HY2 A;  5HFG A;  3IR4 A;  11GS A;  1G6Y A;  2YWO A;  1ABA A;  2CX3 A;  1MDK A;  3VFI A;  2PUK C;  3ZFL A;  4F0B A;  4WBR D;  4GTU A;  4MZW A;  2R3X A;  1Y6E A;  3F0I A;  1UVZ A;  4JZQ A;  1OKT A;  4FYU A;  5IPH A;  1O6J A;  2HSY A;  2AJQ B;  4F03 A;  2VD0 A;  4X0X A;  2H71 A;  5ELA A;  2RUF A;  5CO3 A;  1YEX A;  3SWL A;  2I81 A;  3TJG A;  1YF0 A;  1J08 A;  2H30 A;  2CT6 A;  2WUL A;  2HRA A;  4KW6 A;  3TUE A;  3EVI A;  2I1U A;  4XS6 A;  2AB6 A;  2WFC A;  4LA1 A;  6GSX A;  4XS1 A;  1XFL A;  3QPM A;  2IPA A;  3C1R A;  1NM3 A;  1XW6 A;  3GHA A;  5H5R A;  3RDW A;  3L78 A;  4L8E A;  2MBS A;  1K3O A;  5BRT A;  4AJ8 A;  5ELG A;  2RII A;  1A0R P;  3EWL A;  5JWR B;  4Z2R A;  3VI7 A;  4PXO A;  5J9C A;  4GSS A;  2J9H A;  5CRD A;  2R2J A;  3ZFB A;  3M9J A;  2PPT A;  2GZY A;  3DWV A;  5IMA A;  1K3Y A;  1M2A A;  1TDI A;  4PX1 A;  1LU4 A;  3CXG A;  4N11 A;  2FWH A;  4BPY A;  4MMM A;  2V1M A;  4IW9 A;  2GQM A;  3QFA C;  3H79 A;  5DCG A;  1QFN A;  3F8U A;  2G2Q A;  1ZMA A;  1XWK A;  3QAW A;  1JZD A;  2HYX A;  5IIZ A;  3I43 A;  3FZ4 A;  3GYK A;  1K0C A;  4MH3 A;  2IMI A;  4L0U A;  3HVX A;  5CRW A;  1GUH A;  2C3Q A;  4LMW A;  5KN3 A;  2IMD A;  3HCZ A;  3D22 A;  2C80 A;  17GS A;  5IQY A;  4PQI A;  4POB A;  1TRW A;  4NMU A;  1HNA A;  1MDJ A;  5DBQ A;  1ZL9 A;  5ECI B;  3GN3 A;  3LSZ A;  1AAZ A;  3ZZX A;  2MMZ A;  2VM2 A;  2GQK A;  3GH9 A;  3G9B A;  3RHB A;  1AIU A;  4USS A;  3ZIV A;  4ACS A;  2RLI A;  20GS A;  1EP7 A;  4GCI A;  3HXS A;  2O7K A;  2VLV A;  1M3J A;  2PMT A;  1S3R A;  1SK0 A;  1K0O A;  1KNG A;  3HVN A;  3KIJ A;  1M2D A;  1XIY A;  3D5J A;  1GSY A;  2PBJ A;  2PGT A;  1VF2 A;  1Y25 A;  2GZP A;  1FAA A;  2DJ1 A;  4MH2 A;  3ZRD A;  5DAK A;  4Q5N A;  1SYR A;  4YAV A;  4Q5Q A;  4X1U A;  4Z2U A;  3Q18 A;  1TK0 B;  2E0Q A;  2HI7 A;  3WGE A;  1MDI A;  5G1L A;  3LWA A;  3C71 A;  1TRS A;  2LJR A;  2DJ0 A;  2M46 A;  2XBQ A;  5ECN B;  1QXH A;  3ZIJ A;  5DQS A;  2EIQ A;  2H1A A;  3FY7 A;  4TOP A;  5ECP B;  4MLY A;  3QDN A;  2BTO T;  2R0P A;  4MJA A;  1K3L A;  1FW1 A;  4WBJ A;  4F9Z A;  2C0E A;  4EO3 A;  4F2I A;  1XOA A;  1T7P B;  1CQG A;  4HJM A;  3I69 A;  3LXZ A;  5DAK B;  1MTC A;  3IBH A;  3QD9 A;  2LUS A;  2DC5 A;  3I9V 2;  5D9V A;  2GT5 A;  2NDO A;  2MBT A;  2E2M A;  3IK9 A;  5D9T A;  3UVH A;  4XS4 A;  1GWC A;  3TRQ A;  3VPQ A;  5JWQ B;  5EPF A;  4O5R A;  1W89 A;  1O8W A;  1R26 A;  4HZ4 A;  3A5I A;  2OKA A;  3GX8 A;  1ILO A;  1AQV A;  3ZMK A;  3TJJ A;  2CX4 A;  4KND A;  5IOX A;  4Z2T A;  1YQ1 A;  4JU5 A;  1PFO A;  3TGZ A;  4KF9 A;  4J56 E;  3F6D A;  4AGS A;  4Z7X A;  2OAD A;  1QMV A;  4EKZ A;  1AQW A;  1G7O A;  2NTO A;  4BVY A;  6GST A;  2GTU A;  5EVO A;  1A24 A;  1M9B A;  4QL9 A;  4O5U A;  5JCG A;  3ME8 A;  1F3A A;  5EL8 A;  1Q4J A;  1BAY A;  5B8A A;  3UJ1 A;  2C3N A;  4GXZ A;  4P3Y B;  4KCA A;  4NPB A;  4XS4 B;  1NW2 A;  5G5E A;  2HZE A;  4LL1 B;  5D93 A;  2DKI A;  1JZO A;  1S3C A;  2FWG A;  5ECS A;  2OE1 A;  3KCM A;  16GS A;  5HFI A;  2O87 A;  4PUR A;  1SL1 B;  2RUE A;  3PGT A;  1FB0 A;  1ERT A;  4K5R A;  2CV4 A;  4K7O A;  2KHP A;  4D73 B;  4ML6 A;  3ERF A;  1M3I A;  4L5O A;  5ECO B;  1O85 A;  3HDC A;  3LGC A;  4N30 A;  4KUN A;  1TKD B;  3FZA A;  5B8B A;  4BVY B;  2YP6 A;  3A3T A;  1B4Q A;  4ZIJ A;  1VF4 A;  2H74 A;  2AAW A;  1FO5 A;  3M8N A;  4GQF A;  4K2X A;  2BMX A;  1ZYQ B;  3MAK A;  3RAZ A;  2ES7 A;  1T8E B;  3FZ9 A;  5B7C A;  1SK1 A;  5CYY A;  2VUP A;  2AV4 A;  1ZYN A;  2HZE B;  4IN0 A;  3KJY A;  3WT1 A;  1TXX A;  4K6X A;  2L59 A;  4TR1 A;  4K0G A;  4IHU A;  3R3E A;  2FY6 A;  3UBK A;  2F8F A;  5A4W A;  3CTF A;  3IAM 2;  5D73 A;  4NXI A;  1F2E A;  3GX0 A;  1F37 A;  3BBY A;  4ZBB A;  2MMN A;  2KP1 A;  4KE3 A;  3L0H A;  5IMF A;  4WR5 A;  3FW2 A;  1T1V A;  2REM A;  4IJI A;  1R4W A;  3TCO A;  1FOH A;  3EMP A;  3R2Q A;  1AUC A;  2GLR A;  1RK4 A;  4KCE A;  1J9B A;  4WR4 A;  2H6Z A;  4KSO A;  1GUK A;  3GKX A;  19GS A;  5HR1 A;  2CVB A;  2G0F A;  3KGK A;  4TR1 B;  1F6M C;  5D8I A;  4WKW A;  2WJU A;  1ERW A;  4XTS A;  3APS A;  1TJD A;  2V6K A;  2XPE A;  1AC1 A;  1FOV A;  2H1B A;  1U88 A;  4IBP A;  1V57 A;  4TXO A;  1VRS D;  4V2M A;  1GTU A;  1X5E A;  3IPZ A;  4NHW A;  4QQ7 A;  5F8B A;  1XXU A;  3TDG A;  2K8V A;  1Z9H A;  1OC8 A;  1GTA A;  3GFK A;  2EIO A;  1GNW A;  4MPF A;  3CRU A;  2QA2 A;  4HDE A;  4H86 A;  3QR6 A;  2VO4 A;  1YZX A;  2O85 A;  1PN9 A;  2K8S A;  4V2N A;  1O8X A;  1ZCP A;  3HYP A;  4IEL A;  4ZB6 A;  2H8L A;  3DYR A;  3KH7 A;  3TKS E;  5A4U A;  1U3A A;  1V40 A;  4OO5 A;  3HVS A;  4DVC A;  1A0F A;  2IFQ A;  2XC2 A;  1XPV A;  3Q6O A;  1Z3E A;  3ISO A;  4KH7 A;  3F4R A;  3LYP A;  1RQM A;  1YJ6 A;  5ECH B;  1XWA A;  2CA8 A;  1BQ7 A;  2OJL A;  4TXO B;  1I5G A;  3IC8 A;  1SD8 A;  1ZOF A;  2B1L A;  5IMZ A;  2DML A;  2R5G A;  4HEA 2;  4FYB A;  1WJK A;  3GUS A;  3TJB A;  1ML6 A;  4ZB8 A;  1THX A;  1U3I A;  4E8H A;  3LG6 A;  3FYG A;  1EGO A;  2FWE A;  2MYG A;  3ERW A;  2N5A A;  2IFQ B;  2LJA A;  3Q19 A;  2MZC A;  2R4V A;  3RPP A;  1PMT A;  1OE8 A;  3C1S A;  3ZIT A;  1GSF A;  3VWU A;  3S9F A;  2KLX A;  3ZVJ D;  4PNG A;  1A23 A;  2YPM A;  2AHE A;  2YV7 A;  5B6N A;  1HNB A;  2C0G A;  3F9U A;  1ZYP A;  4NV2 A;  1ON4 A;  2GSR A;  3V1W A;  2GSS A;  2NPB A;  2A2P A;  4K7N A;  1K0B A;  2C3T A;  2YV9 A;  4MF7 A;  1SKR B;  4K0N A;  4LL4 B;  4GSN A;  3HJP A;  2H0H A;  1J0F A;  5F05 A;  3ZLP A;  2FGX A;  2VL9 A;  3FR6 A;  3PH9 A;  3QFB C;  2IL3 A;  5FWG A;  5HR3 A;  3KZQ A;  5IO0 A;  4V1A g;  2IMK A;  2L6C A;  4EDY A;  2LRT A;  3GL5 A;  4BA7 A;  3PIN A;  4JE1 A;  4PQH A;  3LYK A;  2OBI A;  1I9D A;  2X8H A;  1WRY A;  2P5Q A;  1R5A A;  3EIN A;  5KOX A;  5F0G A;  1PKW A;  2A4V A;  3ZML A;  5J3R A;  4BIK A;  4EC0 A;  4PQ1 A;  2HXK A;  3D4T A;  3FMW A;  4KAE A;  1PD2 1;  3J7Y k;  1LBK A;  1M99 A;  4OFM A;  3ZVJ A;  4ZL8 A;  2OE3 A;  4KX4 A;  4PNF A;  1G7E A;  1XWG A;  3E9J B;  3TKQ A;  1TW9 A;  1U6T A;  3E3E A;  2JSY A;  4I8B A;  2A2R A;  2A4H A;  2VOC A;  4POM A;  5LD0 A;  2XPD A;  2IWT A;  3N9J A;  2WCI A;  1SU9 A;  2X4A A;  3P2A A;  3KP9 A;  2M80 A;  5DAL A;  3ED3 A;  2X64 A;  2H66 A;  2EIR A;  1Z5Y E;  3BOA A;  1A8Y A;  3IXR A;  3IC4 A;  2HLS A;  4DSS A;  5CRG A;  1TI1 A;  4ZIL A;  4MF5 A;  4Q5F A;  1F3B A;  1YEP A;  4G19 A;  1YKC A;  2JZS A;  3GKN A;  1XBS A;  2V41 A;  1X5D A;  2H1G A;  5FT3 A;  2R6K A;  1LJR A;  1B48 A;  4N0Z A;  2YZU A;  1W4V A;  2VLU A;  3IHG A;  2VD1 A;  2AYT A;  5KN2 A;  4XCS A;  1SJI A;  3UIW A;  1EOG A;  4OO4 A;  3BCI A;  3H8Q A;  4NHZ A;  1BYE A;  3LEF A;  3D21 A;  1R5P A;  2TRX A;  4RUV A;  2FUG 2;  3L9U A;  2HE3 A;  5DAL B;  2WS2 A;  4G10 A;  2FWF A;  3KMN A;  4ISD A;  2ALB A;  4FQU A;  1OE7 A;  4ZXG A;  3F63 A;  4DSS B;  3GL3 A;  1X0R A;  2QGV A;  3FEU A;  3IK7 A;  5DVB A;  2V32 A;  22GS A;  3W8J A;  1PL1 A;  2VL3 A;  1HD2 A;  1X9M B;  3PR8 A;  4HJ2 A;  2DBC A;  1N8J A;  4OFN A;  2K9F A;  1PX7 A;  1NHO A;  2F51 A;  3UAR A;  2C4J A;  3WGD A;  3BJ5 A;  1XWC A;  1XW9 A;  1DBY A;  3FZ5 A;  5HR2 A;  1QK8 A;  3ME7 A;  1SK2 A;  2V2G A;  4I2T A;  4YKF A;  1OC9 A;  2VCV A;  2P31 A;  2P0G A;  1GUM A;  3GNJ A;  2LRN A;  4G2E A;  5GST A;  3D0Z A;  1GLQ A;  1JLV A;  2CAQ A;  1RW1 A;  2HT9 A;  5KEJ A;  2GZZ A;  1PX6 A;  5EY6 A;  3E0U A;  2GS3 A;  1K0M A;  4RI6 A;  5F06 A;  2B5X A;  5AGY A;  5CRH A;  2X8G A;  4AJ6 A;  4V1A p;  5ID2 A;  2OE0 A;  3QOU A;  2HNL A;  5J9B A;  4D73 A;  2ON7 A;  4O7H A;  3A5W A;  4IP1 A;  2C8U A;  2LRC A;  1B4P A;  2H19 A;  3GH6 A;  1TOF A;  3F4T A;  1JHB A;  1GL8 A;  1YDK A;  4BWS A;  2LQO A;  3D4M A;  2X99 A;  1WIK A;  1GP1 A;  2HSM A;  2PVQ A;  1MD4 A;  2VCT A;  1OC9 B;  2HZF A;  1TU7 A;  3HVV A;  3L9V A;  1OC3 A;  5ENU A;  2YN1 A;  2KUC A;  3MIX A;  2HRF A;  4GRF A;  1K0A A;  2PN8 A;  3GKM A;  1Z7P A;  5DJM A;  2WZ9 A;  6GSY A;  2B3S A;  2MMA A;  1DSB A;  1UC7 A;  3GV1 A;  4TN8 A;  5ID2 B;  3TRP A;  2DJ3 A;  3CSJ A;  4KDX A;  4TXV A;  4YAP A;  4I97 A;  5H5S A;  5GAP D;  2H75 A;  1WMJ A;  2WB9 A;  3DIE A;  2DJK A;  4ML1 A;  2O89 A;  1V98 A;  1SJ6 A;  2X8C A;  4F82 A;  3IOS A;  2GDR A;  2LJK A;  3RPN A;  3DD3 A;  3TB2 A;  4KGI A;  1FVK A;  1DUG A;  2GGT A;  1A2M A;  2VLT A;  3KM6 A;  5IMD A;  7GSS A;  2N5F A;  2B5Y A;  2VCZ A;  4JED A;  4IS0 A;  3HJM A;  4IJ3 A;  4AF2 A;  4MA9 A;  3IRA A;  2KOK A;  3QAG A;  2GT6 A;  2ZCT A;  2JAD A;  3DVX A;  2JAC A;  1PRX A;  2L6D A;  2V6O A;  1YY7 A;  1THO A;  2K6V A;  5D96 A;  4O32 A;  4NV5 A;  3QAV A;  5G31 A;  4X4J A;  1TK5 B;  2TIR A;  2FD3 A;  2FLS A;  4O5Q A;  2C0D A;  5ABR A;  2L4Q A;  1U87 A;  1A2L A;  3N5O A;  3G7I A;  2YWM A;  18GS A;  3O6T A;  1USB A;  2Z9S A;  1GLP A;  4MJB A;  4HU7 A;  4IQA A;  1AXD A;  4FO5 A;  2X49 A;  3UAP A;  1GSU A;  3EPT A;  3QCP A;  3TOU A;  4PUA A;  3UOM A;  2QSI A;  3HHV A;  3ZRE A;  3EYT A;  1GSD A;  4ZL9 A;  1FHE A;  2DIZ A;  1SKW B;  4F0C A;  1ERU A;  3P8W A;  3SBC A;  2YCD A;  6GSU A;  3FR9 A;  4Q5R A;  2EC4 A;  2DMM A;  3F3Q A;  3M3M A;  5ECL B;  3VPT A;  1AQX A;  1C72 A;  4JRR A;  2N5B A;  1NSW A;  1N2A A;  4ZBD A;  2HRN A;  3TKS A;  3H1N A;  3AY8 A;  3GSS A;  5IOW A;  2P5R A;  1HNC A;  1XZO A;  5DDL A;  3ZL5 A;  1M2B A;  8GSS A;  3TKP A;  2H6Y A;  5JCW A;  2TRC P;  2XHF A;  4GST A;  1PA3 A;  1JFU A;  4GF0 A;  1JLW A;  3GRX A;  1KTE A;  2VIM A;  4L0W A;  4X43 A;  2GQL A;  2I9H A;  2VAF A;  5KOW A;  4MDC A;  5AIS A;  1T3B A;  1SEN A;  2IME A;  2JZT A;  5ECM B;  2L5O A;  3DGQ A;  2C1Y A;  2WGR A;  2QC7 A;  2QA1 A;  4I5Q A;  3VI5 A;  3DVW A;  1M7T A;  3GKK A;  1M9A A;  2IMF A;  4J2F A;  4YQU A;  1WE0 A;  2LNS A;  2H6X A;  1PL2 A;  2CVD A;  3OR5 A;  4ECC A;  1YKA A;  3GUR A;  3IHQ A;  4TR3 A;  5A5K A;  4MP4 A;  1EOH A;  4ECJ A;  3A2W A;  3CQF A;  1BX9 A;  2LEG A;  2VL2 A;  2RM5 A;  1UN2 A;  2GST A;  3UL3 A;  4HSC X;  4K2D A;  3KD0 A;  3J7Y b;  4OFT A;  2VM1 A;  1T4Y A;  4EDZ A;  2LST A;  5AIV A;  2PVO C;  3F3R A;  3GTU A;  2YAN A;  3HZ8 A;  1IYH A;  2JSZ A;  5FHI A;  4G0K A;  1BG5 A;  1EV4 A;  3GA4 A;  3NZN A;  3PPU A;  4OCE A;  4CY8 A;  3MDK A;  4KB3 A;  4LMV A;  3VUR A;  4EXJ A;  3L4N A;  4JR6 A;  1TTZ A;  4WF5 A;  1EEJ A;  3P7X A;  4WXT A;  1V58 A;  2H73 A;  2JU5 A;  2IJY A;  2PWJ A;  2YOI A;  3IA1 A;  5COH A;  4WEY A;  1S3D A;  1DE1 A;  3L9S A;  1B9Y C;  4MZC A;  5KN0 A;  4TVE A;  2ZUP A;  1AW9 A;  4FYC A;  2K18 A;  4ILF A;  1QGV A;  4MJC A;  2MMO A;  3ZTL A;  3KTB A;  3LXT A;  1TK8 B;  1GRX A;  3GTU B;  3VWX A;  3MYD A;  3HJO A;  1XW5 A;  2R0C A;  4PTS A;  3U6V A;  5AN1 A;  1URM A;  2FA8 A;  5JCU A;  4LLR A;  4HU9 A;  4JR4 A;  4YQV A;  5A4V A;  3VWW A;  3NOF A;  5INY A;  1Z6M A;  3FK8 A;  4ZBA A;  4N10 A;  4XHM A;  5DQY A;  3ERG A;  4K1F A;  4PGT A;  4KDU A;  3IDV A;  4NWY A;  3CSH A;  3HD5 A;  2VCW A;  4ID0 A;  1TP9 A;  3A2V A;  1DE2 A;  1WOU A;  3KXO A;  4DSR A;  4XRA A;  2OBK A;  2VCX A;  3WYW A;  2WRT A;  2YNX A;  4HQS A;  1WP0 A;  1TI3 A;  1FB6 A;  4J57 E;  4MF6 A;  2LQQ A;  2HRK A;  2FCH A;  1GSS A;  5G30 A;  2B7J A;  1OAZ A;  2OAC A;  1X9W B;  5D9W A;  1HYU A;  2M72 A;  2B1K A;  3H4K A;  2AUV A;  3CBU A;  3UEM A;  4MPG A;  1ACV A;  3DRN A;  3Q74 A;  4MJE A;  3TRX A;  3RHC A;  1GSQ A;  3FR3 A;  1VGL A;  2H1D A;  1ST9 A;  5GSS A;  4TW5 A;  1EWX A;  3MSZ A;  5L71 A;  1K0N A;  1XVW A;  2F9S A;  4YH2 A;  1ZZY A;  4MCU A;  5J5N A;  1H75 A;  4POL A;  6GSV A;  1A8L A;  1O73 A;  5DJL A;  1O81 A;  3UMA A;  2H0I A;  4KA0 A;  2QKE A;  2GVP A;  3CTG A;  2KP2 A;  4MNN A;  2I3Y A;  3NIV A;  5IMC A;  4ECI A;  2IIY A;  1SD9 A;  5G2Z A;  4GLT A;  3EU3 A;  1CQH A;  2DJ2 A;  5CNW A;  2DLX A;  5G1K A;  1EEM A;  1YF1 A;  4EF0 A;  5HR0 A;  1UA5 A;  1XOB A;  4AJ7 A;  1F9M A;  4MAB A;  3KP8 A;  1G6W A;  2FHE A;  3LJR A;  1SYX A;  5CRE A;  3LFL A;  5HFK A;  4G9H A;  2OA7 A;  2CQ9 A;  4I6X A;  4FH8 A;  4PUF C;  1B9X C;  3CRT A;  4KSM A;  1EZK A;  3DML A;  5J4U A;  3F4S A;  3ZYW A;  1R7H A;  1Z7R A;  2PER A;  1VF1 A;  3MWH A;  2FNO A;  6GSS A;  3BD2 A;  4XRD A;  1QQ2 A;  3JCM L;  4K9Z A;  5C04 A;  1M0U A;  2FA4 A;  1JZW A;  1X5C A;  4MZB A;  2YWN A;  4IP6 A;  2BJX A;  2H72 A;  4XIH A;  2HSH A;  2YWI A;  4YKG A;  3QMX A;  1GUL A;  5H5Q A;  14GS A;  4CW9 A;  2R37 A;  1WPI A;  5LNK e;  4OD7 A;  4IGJ A;  5JWO B;  2I4A A;  1GSE A;  4QL7 A;  5LCZ A;  5E59 A;  3M9K A;  3LQ7 A;  4IKH A;  3GST A;  3KMO A;  2CAI A;  3TOT A;  1QUW A;  3CSI A;  3KH9 A;  4GQC A;  4V2L A;  2H01 A;  4BWQ A;  1V2A A;  2F3M A;  3CMI A;  1SL2 B;  3HZ4 A;  1HQO A;  1OYJ A;  3HKR A;  3F6F A;  5CAX A;  4CY6 A;  3EU4 A;  5GZZ B;  1SJZ A;  3IE3 A;  1IYI A;  2CZ3 A;  1G0T A;  4TKY A;  1ZYE A;  2DIY A;  3WD6 A;  3UVT A;  2JL4 A;  3IV4 A;  1EGR A;  2DJJ A;  3KEB A;  4RI7 A;  3RBT A;  1KEB A;  2D2Z A;  10GS A;  3IAS 2;  2LNT A;  1K0D A;  4GWR A;  3H93 A;  4E8E A;  5ECQ B;  2GSQ A;  3HA9 A;  1FG4 A;  2IN3 A;  3APO A;  4KDY A;  1XWB A;  1KBN A; 
#chains in the Genus database with same CATH homology
 2B5E A;  5IMV A;  2ZNM A;  1PQN A;  3K8N A;  5IM9 A;  1E2Y A;  1ZGN A;  4HOJ A;  4G0L A;  3VK9 A;  1BED A;  4RQR A;  5KN1 A;  1T4Z A;  5ECR B;  5GAN D;  4HS1 A;  3LOR A;  4POK A;  3A2X A;  1JZR A;  4O92 A;  1XVQ A;  4DEJ A;  1PSQ A;  4EUY A;  4EL1 A;  1GNE A;  5IO2 A;  1GTI A;  2UZ8 A;  2H0G A;  4HQZ A;  2CVK A;  1ERV A;  1V9W A;  4EE0 A;  3TKS C;  2F8A A;  3O3T A;  1OVN A;  2WDU A;  3CYN A;  4EIP A;  5DCH A;  3C7M A;  1MD3 A;  3O76 A;  2A2S A;  5HQP A;  3EE2 A;  4L5L A;  1B8X A;  1TU8 A;  5AIX A;  1NHY A;  3WT2 A;  3EMX A;  5IPG A;  2CZ2 A;  2VCQ A;  6GSW A;  3FKF A;  3EC3 A;  4ICY A;  4EIQ A;  2J23 A;  13GS A;  4TR0 A;  4CDO A;  3DEX A;  2ON5 A;  4HI7 A;  3GIX A;  3I6A A;  1A2J A;  12GS A;  2E7P A;  3VLN A;  2LS5 A;  2R0G A;  4MK3 A;  4IVF A;  2B7K A;  3DKS A;  4BL7 A;  1PKZ A;  5ECK B;  3P90 A;  1H4O A;  2H70 A;  4OMV A;  5BMU A;  3G7Y A;  2DKH A;  4OWY A;  2LV3 A;  1SKS B;  4K7I A;  2VL2 C;  4WF4 A;  5D9X A;  1SL0 B;  1PGT A;  4CHS A;  1EV9 A;  3W8S A;  1GH2 A;  4RQX A;  1WWJ A;  4G0I A;  1VF3 A;  2NBS A;  3EUR A;  4ULX A;  9GSS A;  2L5L A;  3FRC A;  1TRU A;  4TR4 A;  4K5S A;  4TRX A;  3UBL A;  5G5F A;  3C73 A;  4BVX A;  3DXB A;  3MNG A;  2B6M A;  3FHK A;  5E4W A;  3US3 A;  3KTL A;  4FIW A;  4ECB A;  4HZ2 A;  4BL7 B;  2C0F A;  3TJK A;  4WET A;  4HUA A;  4K8M A;  2L57 A;  2PU9 C;  3W6G A;  3LW9 A;  1OKD A;  2HFD A;  3M0F A;  3VWV A;  5B6M A;  1E6B A;  1TRV A;  2LKU A;  3WGX A;  1S3A A;  3TJF A;  2YJ7 A;  1Q98 A;  4ZB9 A;  1BJX A;  3BCK A;  1O7U A;  4YQM A;  1XCC A;  4NAX A;  2NVL A;  4IQ1 A;  4OCF A;  4JBB A;  4BVX B;  3G7J A;  2O8V B;  4EVM A;  2LTK A;  2YZH A;  4ZL7 A;  2JZR A;  2YJH A;  3GMF A;  1GTB A;  1MEK A;  2DSA A;  1FVJ A;  2E2G A;  3U5R E;  5C00 A;  3APQ A;  1EP8 A;  1T00 A;  2RM6 A;  2L4C A;  4I2U A;  4DSQ A;  3C8E A;  1Z6N A;  1X9S B;  1PN0 A;  3D6I A;  3M1G A;  5F07 A;  3TKR A;  4A5P A;  2XBI A;  2H76 A;  5J41 A;  4N0V A;  5CP1 A;  3HY2 A;  5HFG A;  3IR4 A;  11GS A;  1G6Y A;  2YWO A;  1ABA A;  2CX3 A;  1MDK A;  3VFI A;  2PUK C;  3ZFL A;  4F0B A;  4WBR D;  4GTU A;  4MZW A;  2R3X A;  1Y6E A;  3F0I A;  1UVZ A;  4JZQ A;  1OKT A;  4FYU A;  5IPH A;  1O6J A;  2HSY A;  2AJQ B;  4F03 A;  2VD0 A;  4X0X A;  2H71 A;  5ELA A;  2RUF A;  5CO3 A;  1YEX A;  3SWL A;  2I81 A;  3TJG A;  1YF0 A;  1J08 A;  2H30 A;  2CT6 A;  2WUL A;  2HRA A;  4KW6 A;  3TUE A;  3EVI A;  2I1U A;  4XS6 A;  2AB6 A;  2WFC A;  4LA1 A;  6GSX A;  4XS1 A;  1XFL A;  3QPM A;  2IPA A;  3C1R A;  1NM3 A;  1XW6 A;  3GHA A;  5H5R A;  3RDW A;  3L78 A;  4L8E A;  2MBS A;  1K3O A;  5BRT A;  4AJ8 A;  5ELG A;  2RII A;  1A0R P;  3EWL A;  5JWR B;  4Z2R A;  3VI7 A;  4PXO A;  5J9C A;  4GSS A;  2J9H A;  5CRD A;  2R2J A;  3ZFB A;  3M9J A;  2PPT A;  2GZY A;  3DWV A;  5IMA A;  1K3Y A;  1M2A A;  1TDI A;  4PX1 A;  1LU4 A;  3CXG A;  4N11 A;  2FWH A;  4BPY A;  4MMM A;  2V1M A;  4IW9 A;  2GQM A;  3QFA C;  3H79 A;  5DCG A;  1QFN A;  3F8U A;  2G2Q A;  1ZMA A;  1XWK A;  3QAW A;  1JZD A;  2HYX A;  5IIZ A;  3I43 A;  3FZ4 A;  3GYK A;  1K0C A;  4MH3 A;  2IMI A;  4L0U A;  3HVX A;  5CRW A;  1GUH A;  2C3Q A;  4LMW A;  5KN3 A;  2IMD A;  3HCZ A;  3D22 A;  2C80 A;  17GS A;  5IQY A;  4PQI A;  4POB A;  1TRW A;  4NMU A;  1HNA A;  1MDJ A;  5DBQ A;  1ZL9 A;  5ECI B;  3GN3 A;  3LSZ A;  1AAZ A;  3ZZX A;  2MMZ A;  2VM2 A;  2GQK A;  3GH9 A;  3G9B A;  3RHB A;  1AIU A;  4USS A;  3ZIV A;  4ACS A;  2RLI A;  20GS A;  1EP7 A;  4GCI A;  3HXS A;  2O7K A;  2VLV A;  2PMT A;  1SK0 A;  1K0O A;  1KNG A;  3KIJ A;  1M2D A;  1XIY A;  3D5J A;  1GSY A;  2PBJ A;  2PGT A;  1VF2 A;  1Y25 A;  2GZP A;  1FAA A;  2DJ1 A;  4MH2 A;  3ZRD A;  5DAK A;  4Q5N A;  1SYR A;  4YAV A;  4Q5Q A;  4X1U A;  4Z2U A;  3Q18 A;  1TK0 B;  2E0Q A;  2HI7 A;  3WGE A;  1MDI A;  5G1L A;  3LWA A;  3C71 A;  1TRS A;  2LJR A;  2DJ0 A;  2M46 A;  2XBQ A;  5ECN B;  1QXH A;  3ZIJ A;  5DQS A;  2EIQ A;  2H1A A;  3FY7 A;  4TOP A;  5ECP B;  4MLY A;  3QDN A;  2BTO T;  2R0P A;  4MJA A;  1K3L A;  1FW1 A;  4WBJ A;  4F9Z A;  2C0E A;  4EO3 A;  4F2I A;  1XOA A;  1T7P B;  1CQG A;  4HJM A;  3I69 A;  3LXZ A;  5DAK B;  1MTC A;  3IBH A;  3QD9 A;  2LUS A;  2DC5 A;  3I9V 2;  5D9V A;  2GT5 A;  2NDO A;  2MBT A;  2E2M A;  3IK9 A;  5D9T A;  3UVH A;  4XS4 A;  1GWC A;  3TRQ A;  3VPQ A;  5JWQ B;  5EPF A;  4O5R A;  1W89 A;  1O8W A;  1R26 A;  4HZ4 A;  3A5I A;  2OKA A;  3GX8 A;  1ILO A;  1AQV A;  3ZMK A;  3TJJ A;  2CX4 A;  4KND A;  5IOX A;  4Z2T A;  1YQ1 A;  4JU5 A;  3TGZ A;  4KF9 A;  4J56 E;  3F6D A;  4AGS A;  4Z7X A;  2OAD A;  1QMV A;  4EKZ A;  1AQW A;  1G7O A;  2NTO A;  4BVY A;  6GST A;  2GTU A;  5EVO A;  1A24 A;  1M9B A;  4QL9 A;  4O5U A;  5JCG A;  3ME8 A;  1F3A A;  5EL8 A;  1Q4J A;  1BAY A;  5B8A A;  3UJ1 A;  2C3N A;  4GXZ A;  4P3Y B;  4KCA A;  4NPB A;  4XS4 B;  1NW2 A;  5G5E A;  2HZE A;  4LL1 B;  5D93 A;  2DKI A;  1JZO A;  1S3C A;  2FWG A;  5ECS A;  2OE1 A;  3KCM A;  16GS A;  5HFI A;  2O87 A;  4PUR A;  1SL1 B;  2RUE A;  3PGT A;  1FB0 A;  1ERT A;  4K5R A;  2CV4 A;  4K7O A;  2KHP A;  4D73 B;  4ML6 A;  3ERF A;  4L5O A;  5ECO B;  1O85 A;  3HDC A;  3LGC A;  4N30 A;  4KUN A;  1TKD B;  3FZA A;  5B8B A;  4BVY B;  2YP6 A;  3A3T A;  1B4Q A;  4ZIJ A;  1VF4 A;  2H74 A;  2AAW A;  1FO5 A;  3M8N A;  4GQF A;  4K2X A;  2BMX A;  1ZYQ B;  3MAK A;  3RAZ A;  2ES7 A;  1T8E B;  3FZ9 A;  5B7C A;  1SK1 A;  5CYY A;  2VUP A;  2AV4 A;  1ZYN A;  2HZE B;  4IN0 A;  3KJY A;  3WT1 A;  1TXX A;  4K6X A;  2L59 A;  4TR1 A;  4K0G A;  4IHU A;  3R3E A;  2FY6 A;  3UBK A;  2F8F A;  5A4W A;  3CTF A;  3IAM 2;  5D73 A;  4NXI A;  1F2E A;  3GX0 A;  1F37 A;  3BBY A;  4ZBB A;  2MMN A;  2KP1 A;  4KE3 A;  3L0H A;  5IMF A;  4WR5 A;  3FW2 A;  1T1V A;  2REM A;  4IJI A;  1R4W A;  3TCO A;  1FOH A;  3EMP A;  3R2Q A;  1AUC A;  2GLR A;  1RK4 A;  4KCE A;  1J9B A;  4WR4 A;  2H6Z A;  4KSO A;  1GUK A;  3GKX A;  19GS A;  5HR1 A;  2CVB A;  2G0F A;  3KGK A;  4TR1 B;  1F6M C;  5D8I A;  4WKW A;  2WJU A;  1ERW A;  4XTS A;  3APS A;  1TJD A;  2V6K A;  2XPE A;  1AC1 A;  1FOV A;  2H1B A;  1U88 A;  4IBP A;  1V57 A;  4TXO A;  1VRS D;  4V2M A;  1GTU A;  1X5E A;  3IPZ A;  4NHW A;  4QQ7 A;  5F8B A;  1XXU A;  3TDG A;  2K8V A;  1Z9H A;  1OC8 A;  1GTA A;  3GFK A;  2EIO A;  1GNW A;  4MPF A;  3CRU A;  2QA2 A;  4HDE A;  4H86 A;  3QR6 A;  2VO4 A;  1YZX A;  2O85 A;  1PN9 A;  2K8S A;  4V2N A;  1O8X A;  1ZCP A;  3HYP A;  4IEL A;  4ZB6 A;  2H8L A;  3DYR A;  3KH7 A;  3TKS E;  5A4U A;  1U3A A;  1V40 A;  4OO5 A;  3HVS A;  4DVC A;  1A0F A;  2IFQ A;  2XC2 A;  1XPV A;  3Q6O A;  1Z3E A;  3ISO A;  4KH7 A;  3F4R A;  3LYP A;  1RQM A;  1YJ6 A;  5ECH B;  1XWA A;  2CA8 A;  1BQ7 A;  2OJL A;  4TXO B;  1I5G A;  3IC8 A;  1SD8 A;  1ZOF A;  2B1L A;  5IMZ A;  2DML A;  2R5G A;  4HEA 2;  4FYB A;  1WJK A;  3GUS A;  3TJB A;  1ML6 A;  4ZB8 A;  1THX A;  1U3I A;  4E8H A;  3LG6 A;  3FYG A;  1EGO A;  2FWE A;  2MYG A;  3ERW A;  2N5A A;  2IFQ B;  2LJA A;  3Q19 A;  2MZC A;  2R4V A;  3RPP A;  1PMT A;  1OE8 A;  3C1S A;  3ZIT A;  1GSF A;  3VWU A;  3S9F A;  2KLX A;  3ZVJ D;  4PNG A;  1A23 A;  2YPM A;  2AHE A;  2YV7 A;  5B6N A;  1HNB A;  2C0G A;  3F9U A;  1ZYP A;  4NV2 A;  1ON4 A;  2GSR A;  3V1W A;  2GSS A;  2NPB A;  2A2P A;  4K7N A;  1K0B A;  2C3T A;  2YV9 A;  4MF7 A;  1SKR B;  4K0N A;  4LL4 B;  4GSN A;  3HJP A;  2H0H A;  1J0F A;  5F05 A;  3ZLP A;  2FGX A;  2VL9 A;  3FR6 A;  3PH9 A;  3QFB C;  2IL3 A;  5FWG A;  5HR3 A;  3KZQ A;  5IO0 A;  4V1A g;  2IMK A;  2L6C A;  4EDY A;  2LRT A;  3GL5 A;  4BA7 A;  3PIN A;  4JE1 A;  4PQH A;  3LYK A;  2OBI A;  1I9D A;  2X8H A;  1WRY A;  2P5Q A;  1R5A A;  3EIN A;  5KOX A;  5F0G A;  1PKW A;  2A4V A;  3ZML A;  5J3R A;  4EC0 A;  4PQ1 A;  2HXK A;  3D4T A;  3FMW A;  4KAE A;  1PD2 1;  3J7Y k;  1LBK A;  1M99 A;  4OFM A;  3ZVJ A;  4ZL8 A;  2OE3 A;  4KX4 A;  4PNF A;  1G7E A;  1XWG A;  3E9J B;  3TKQ A;  1TW9 A;  1U6T A;  3E3E A;  2JSY A;  4I8B A;  2A2R A;  2A4H A;  2VOC A;  4POM A;  5LD0 A;  2XPD A;  2IWT A;  3N9J A;  2WCI A;  1SU9 A;  2X4A A;  3P2A A;  3KP9 A;  2M80 A;  5DAL A;  3ED3 A;  2X64 A;  2H66 A;  2EIR A;  1Z5Y E;  3BOA A;  1A8Y A;  3IXR A;  3IC4 A;  2HLS A;  4DSS A;  5CRG A;  1TI1 A;  4ZIL A;  4MF5 A;  4Q5F A;  1F3B A;  1YEP A;  4G19 A;  1YKC A;  2JZS A;  3GKN A;  1XBS A;  2V41 A;  1X5D A;  2H1G A;  5FT3 A;  2R6K A;  1LJR A;  1B48 A;  4N0Z A;  2YZU A;  1W4V A;  2VLU A;  3IHG A;  2VD1 A;  2AYT A;  5KN2 A;  4XCS A;  1SJI A;  3UIW A;  1EOG A;  4OO4 A;  3BCI A;  3H8Q A;  4NHZ A;  1BYE A;  3LEF A;  3D21 A;  1R5P A;  2TRX A;  4RUV A;  2FUG 2;  3L9U A;  2HE3 A;  5DAL B;  2WS2 A;  4G10 A;  2FWF A;  3KMN A;  4ISD A;  2ALB A;  4FQU A;  1OE7 A;  4ZXG A;  3F63 A;  4DSS B;  3GL3 A;  1X0R A;  2QGV A;  3FEU A;  3IK7 A;  5DVB A;  2V32 A;  22GS A;  3W8J A;  1PL1 A;  2VL3 A;  1HD2 A;  1X9M B;  3PR8 A;  4HJ2 A;  2DBC A;  1N8J A;  4OFN A;  2K9F A;  1PX7 A;  1NHO A;  2F51 A;  3UAR A;  2C4J A;  3WGD A;  3BJ5 A;  1XWC A;  1XW9 A;  1DBY A;  3FZ5 A;  5HR2 A;  1QK8 A;  3ME7 A;  1SK2 A;  2V2G A;  4I2T A;  4YKF A;  1OC9 A;  2VCV A;  2P31 A;  2P0G A;  1GUM A;  3GNJ A;  2LRN A;  4G2E A;  5GST A;  3D0Z A;  1GLQ A;  1JLV A;  2CAQ A;  1RW1 A;  2HT9 A;  5KEJ A;  2GZZ A;  1PX6 A;  5EY6 A;  3E0U A;  2GS3 A;  1K0M A;  4RI6 A;  5F06 A;  2B5X A;  5AGY A;  5CRH A;  2X8G A;  4AJ6 A;  4V1A p;  5ID2 A;  2OE0 A;  3QOU A;  2HNL A;  5J9B A;  4D73 A;  2ON7 A;  4O7H A;  3A5W A;  4IP1 A;  2C8U A;  2LRC A;  1B4P A;  2H19 A;  3GH6 A;  1TOF A;  3F4T A;  1JHB A;  1GL8 A;  1YDK A;  4BWS A;  2LQO A;  3D4M A;  2X99 A;  1WIK A;  1GP1 A;  2HSM A;  2PVQ A;  1MD4 A;  2VCT A;  1OC9 B;  2HZF A;  1TU7 A;  3HVV A;  3L9V A;  1OC3 A;  5ENU A;  2YN1 A;  2KUC A;  3MIX A;  2HRF A;  4GRF A;  1K0A A;  2PN8 A;  3GKM A;  1Z7P A;  5DJM A;  2WZ9 A;  6GSY A;  2B3S A;  2MMA A;  1DSB A;  1UC7 A;  3GV1 A;  4TN8 A;  5ID2 B;  3TRP A;  2DJ3 A;  3CSJ A;  4KDX A;  4TXV A;  4YAP A;  4I97 A;  5H5S A;  5GAP D;  2H75 A;  1WMJ A;  2WB9 A;  3DIE A;  2DJK A;  4ML1 A;  2O89 A;  1V98 A;  1SJ6 A;  2X8C A;  4F82 A;  3IOS A;  2GDR A;  2LJK A;  3RPN A;  3DD3 A;  3TB2 A;  4KGI A;  1FVK A;  1DUG A;  2GGT A;  1A2M A;  2VLT A;  3KM6 A;  5IMD A;  7GSS A;  2N5F A;  2B5Y A;  2VCZ A;  4JED A;  4IS0 A;  3HJM A;  4IJ3 A;  4AF2 A;  4MA9 A;  3IRA A;  2KOK A;  3QAG A;  2GT6 A;  2ZCT A;  2JAD A;  3DVX A;  2JAC A;  1PRX A;  2L6D A;  2V6O A;  1YY7 A;  1THO A;  2K6V A;  5D96 A;  4O32 A;  4NV5 A;  3QAV A;  5G31 A;  4X4J A;  1TK5 B;  2TIR A;  2FD3 A;  2FLS A;  4O5Q A;  2C0D A;  5ABR A;  2L4Q A;  1U87 A;  1A2L A;  3N5O A;  3G7I A;  2YWM A;  18GS A;  3O6T A;  1USB A;  2Z9S A;  1GLP A;  4MJB A;  4HU7 A;  4IQA A;  1AXD A;  4FO5 A;  2X49 A;  3UAP A;  1GSU A;  3EPT A;  3QCP A;  3TOU A;  4PUA A;  3UOM A;  2QSI A;  3HHV A;  3ZRE A;  3EYT A;  1GSD A;  4ZL9 A;  1FHE A;  2DIZ A;  1SKW B;  4F0C A;  1ERU A;  3P8W A;  3SBC A;  2YCD A;  6GSU A;  3FR9 A;  4Q5R A;  2EC4 A;  2DMM A;  3F3Q A;  3M3M A;  5ECL B;  3VPT A;  1AQX A;  1C72 A;  4JRR A;  2N5B A;  1NSW A;  1N2A A;  4ZBD A;  2HRN A;  3TKS A;  3H1N A;  3AY8 A;  3GSS A;  5IOW A;  2P5R A;  1HNC A;  1XZO A;  5DDL A;  3ZL5 A;  1M2B A;  8GSS A;  3TKP A;  2H6Y A;  5JCW A;  2TRC P;  2XHF A;  4GST A;  1PA3 A;  1JFU A;  4GF0 A;  1JLW A;  3GRX A;  1KTE A;  2VIM A;  4L0W A;  4X43 A;  2GQL A;  2I9H A;  2VAF A;  5KOW A;  4MDC A;  5AIS A;  1T3B A;  1SEN A;  2IME A;  2JZT A;  5ECM B;  2L5O A;  3DGQ A;  2C1Y A;  2WGR A;  2QC7 A;  2QA1 A;  4I5Q A;  3VI5 A;  3DVW A;  1M7T A;  3GKK A;  1M9A A;  2IMF A;  4J2F A;  4YQU A;  1WE0 A;  2LNS A;  2H6X A;  1PL2 A;  2CVD A;  3OR5 A;  4ECC A;  1YKA A;  3GUR A;  3IHQ A;  4TR3 A;  5A5K A;  4MP4 A;  1EOH A;  4ECJ A;  3A2W A;  1BX9 A;  2LEG A;  2VL2 A;  2RM5 A;  1UN2 A;  2GST A;  3UL3 A;  4K2D A;  3KD0 A;  3J7Y b;  4OFT A;  2VM1 A;  1T4Y A;  4EDZ A;  2LST A;  5AIV A;  2PVO C;  3F3R A;  3GTU A;  2YAN A;  3HZ8 A;  1IYH A;  2JSZ A;  5FHI A;  4G0K A;  1BG5 A;  1EV4 A;  3GA4 A;  3NZN A;  3PPU A;  4OCE A;  4CY8 A;  3MDK A;  4KB3 A;  4LMV A;  3VUR A;  4EXJ A;  3L4N A;  4JR6 A;  1TTZ A;  4WF5 A;  1EEJ A;  3P7X A;  4WXT A;  1V58 A;  2H73 A;  2JU5 A;  2IJY A;  2PWJ A;  2YOI A;  3IA1 A;  5COH A;  4WEY A;  1S3D A;  1DE1 A;  3L9S A;  1B9Y C;  4MZC A;  5KN0 A;  4TVE A;  2ZUP A;  1AW9 A;  4FYC A;  2K18 A;  4ILF A;  1QGV A;  4MJC A;  2MMO A;  3ZTL A;  3KTB A;  3LXT A;  1TK8 B;  1GRX A;  3GTU B;  3VWX A;  3MYD A;  3HJO A;  1XW5 A;  2R0C A;  4PTS A;  3U6V A;  5AN1 A;  1URM A;  2FA8 A;  5JCU A;  4LLR A;  4HU9 A;  4JR4 A;  4YQV A;  5A4V A;  3VWW A;  3NOF A;  5INY A;  1Z6M A;  3FK8 A;  4ZBA A;  4N10 A;  4XHM A;  5DQY A;  3ERG A;  4K1F A;  4PGT A;  4KDU A;  3IDV A;  4NWY A;  3CSH A;  3HD5 A;  2VCW A;  4ID0 A;  1TP9 A;  3A2V A;  1DE2 A;  1WOU A;  3KXO A;  4DSR A;  4XRA A;  2OBK A;  2VCX A;  3WYW A;  2WRT A;  2YNX A;  4HQS A;  1WP0 A;  1TI3 A;  1FB6 A;  4J57 E;  4MF6 A;  2LQQ A;  2HRK A;  2FCH A;  1GSS A;  5G30 A;  2B7J A;  1OAZ A;  2OAC A;  1X9W B;  5D9W A;  1HYU A;  2M72 A;  2B1K A;  3H4K A;  2AUV A;  3CBU A;  3UEM A;  4MPG A;  1ACV A;  3DRN A;  3Q74 A;  4MJE A;  3TRX A;  3RHC A;  1GSQ A;  3FR3 A;  1VGL A;  2H1D A;  1ST9 A;  5GSS A;  4TW5 A;  1EWX A;  3MSZ A;  5L71 A;  1K0N A;  1XVW A;  2F9S A;  4YH2 A;  1ZZY A;  4MCU A;  5J5N A;  1H75 A;  4POL A;  6GSV A;  1A8L A;  1O73 A;  5DJL A;  1O81 A;  3UMA A;  2H0I A;  4KA0 A;  2QKE A;  2GVP A;  3CTG A;  2KP2 A;  4MNN A;  2I3Y A;  3NIV A;  5IMC A;  4ECI A;  2IIY A;  1SD9 A;  5G2Z A;  4GLT A;  3EU3 A;  1CQH A;  2DJ2 A;  5CNW A;  2DLX A;  5G1K A;  1EEM A;  1YF1 A;  4EF0 A;  5HR0 A;  1UA5 A;  1XOB A;  4AJ7 A;  1F9M A;  4MAB A;  3KP8 A;  1G6W A;  2FHE A;  3LJR A;  1SYX A;  5CRE A;  3LFL A;  5HFK A;  4G9H A;  2OA7 A;  2CQ9 A;  4I6X A;  4FH8 A;  4PUF C;  1B9X C;  3CRT A;  4KSM A;  1EZK A;  3DML A;  5J4U A;  3F4S A;  3ZYW A;  1R7H A;  1Z7R A;  2PER A;  1VF1 A;  3MWH A;  2FNO A;  6GSS A;  3BD2 A;  4XRD A;  1QQ2 A;  3JCM L;  4K9Z A;  5C04 A;  1M0U A;  2FA4 A;  1JZW A;  1X5C A;  4MZB A;  2YWN A;  4IP6 A;  2BJX A;  2H72 A;  4XIH A;  2HSH A;  2YWI A;  4YKG A;  3QMX A;  1GUL A;  5H5Q A;  14GS A;  4CW9 A;  2R37 A;  1WPI A;  5LNK e;  4OD7 A;  4IGJ A;  5JWO B;  2I4A A;  1GSE A;  4QL7 A;  5LCZ A;  5E59 A;  3M9K A;  3LQ7 A;  4IKH A;  3GST A;  3KMO A;  2CAI A;  3TOT A;  1QUW A;  3CSI A;  3KH9 A;  4GQC A;  4V2L A;  2H01 A;  4BWQ A;  1V2A A;  2F3M A;  3CMI A;  1SL2 B;  3HZ4 A;  1HQO A;  1OYJ A;  3HKR A;  3F6F A;  5CAX A;  4CY6 A;  3EU4 A;  5GZZ B;  1SJZ A;  3IE3 A;  1IYI A;  2CZ3 A;  1G0T A;  4TKY A;  1ZYE A;  2DIY A;  3WD6 A;  3UVT A;  2JL4 A;  3IV4 A;  1EGR A;  2DJJ A;  3KEB A;  4RI7 A;  3RBT A;  1KEB A;  2D2Z A;  10GS A;  3IAS 2;  2LNT A;  1K0D A;  4GWR A;  3H93 A;  4E8E A;  5ECQ B;  2GSQ A;  3HA9 A;  1FG4 A;  2IN3 A;  3APO A;  4KDY A;  1XWB A;  1KBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...