3IPZA

Crystal structure of arabidopsis monothiol glutaredoxin atgrxcp
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
109
structure length
109
Chain Sequence
SALTPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKAMCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structure of Arabidopsis chloroplastic monothiol glutaredoxin AtGRXcp.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Electron transport, oxidoreductase
total genus 35
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ipzA01
1FVJA 4ECIA 3LXTA 5GAND 5CRGA 2EIQA 1G6YA 4ZBBA 3SWLA 4K2DA 1BYEA 4TN8A 1AUCA 5DALB 2D2ZA 4CW9A 1TRVA 1XVQA 4HJMA 3DIEA 1GTBA 2H73A 2NPBA 4RQRA 2FA8A 5C00A 2H30A 3RPPA 2GT5A 4OO5A 3KP9A 2A2RA 2CA8A 2B7JA 5G5EA 2YJ7A 1K0BA 2DC5A 3KXOA 5FWGA 1F3AA 1O8WA 1YJ6A 3D6IA 4YH2A 2WULA 3VI5A 5L71A 3P7XA 2GSQA 2EIOA 1MD3A 2B1KA 2X8HA 2FHEA 3NIVA 3CTFA 6GSXA 4HUAA 3TUEA 2K6VA 1G7OA 1YQ1A 4KUNA 2DJ2A 2JL4A 4XTSA 2C0FA 1XBSA 3P2AA 1AAZA 3ZMKA 1TW9A 3RHBA 1WIKA 1H75A 4X43A 5D9XA 2CX3A 3Q19A 3VWVA 1UA5A 3GRXA 4ZBAA 2V6OA 2AYTA 1QQ2A 2AAWA 4FYUA 5AN1A 3TJKA 3KTBA 1X0RA 1X5CA 3CRTA 5KN2A 3EURA 2HRNA 1A2MA 4GWRA 3C71A 1Z9HA 1G7EA 3EC3A 1PL1A 2VLUA 2N5BA 3V1WA 3ERFA 3TRQA 3GMFA 3G9BA 3HHVA 4GLTA 1IYHA 4MCUA 1TOFA 2C3QA 4LL1B 1V98A 1IYIA 2KOKA 4KW6A 2VD0A 3GSSA 1SL2B 2H19A 3P8WA 4JU5A 1FHEA 4LL4B 1LJRA 3H8QA 2AUVA 1O73A 2H8LA 4FH8A 2A4VA 4RI6A 2CX4A 5IMCA 4IS0A 4WEYA 3M0FA 1VF4A 4YAVA 2FCHA 1FW1A 5IQYA 5H5SA 3KH7A 5F05A 3TKSE 2WS2A 3RPNA 3U6VA 5CRHA 1DE2A 4WR4A 1WE0A 2PERA 2E0QA 5A4UA 2YZHA 2CV4A 5IO2A 2FLSA 3HVXA 1BEDA 1FG4A 2BMXA 2F3MA 4NHZA 4JRRA 1RK4A 2OE1A 1DE1A 2KLXA 4ZB6A 4I2UA 3M9JA 4GSNA 4Q5FA 2XBQA 3GKNA 3GYKA 4NV5A 5ELGA 2BJXA 2C0EA 1WMJA 3BOAA 3TCOA 2NVLA 2DBCA 1BAYA 2LEGA 4O7HA 3IRAA 3ZREA 3VFIA 3BCIA 3MDKA 3GNJA 14GSA 4G10A 3L9SA 1M7TA 4POLA 3UARA 2I81A 1GH2A 2M80A 1AQWA 4ZL8A 4NMUA 1PKWA 2GGTA 4GSSA 3JCML 1V2AA 4JBBA 1OE7A 4IJ3A 1EP7A 3UVHA 4ECCA 1S3CA 1AW9A 3IV4A 1K0MA 1WP0A 5IOXA 1LU4A 2L5OA 1HNAA 1ZMAA 3H1NA 1A8YA 2IIYA 2H1GA 1GSQA 1V40A 3L9VA 2C3TA 2R5GA 4GF0A 1E2YA 5A5KA 3DEXA 3EU4A 1XOAA 1NSWA 4HJ2A 5D96A 5DCGA 4MABA 4D73A 3EINA 5DDLA 3IA1A 4LLRA 12GSA 3UMAA 4L5LA 3GN3A 3RDWA 2H1AA 3I6AA 2B5XA 5IPHA 5AISA 2GLRA 3PR8A 5JCUA 4BWSA 1B48A 1EOHA 1SJIA 1URMA 3CYNA 1B4QA 1CQHA 2FWHA 2PVQA 4ZL9A 5EVOA 1XW6A 5EL8A 1XVWA 3UOMA 3S9FA 5D8IA 3N9JA 5IMDA 5DAKA 3ZZXA 1PQNA 3FZ4A 18GSA 2H74A 4IKHA 3VWXA 2A2SA 2GDRA 3CSJA 3QPMA 2DSAA 1JZDA 2IMKA 1V57A 4TOPA 5E4WA 3BJ5A 4HDEA 1OKDA 1MTCA 1QXHA 1YY7A 3EMXA 3F4RA 5B7CA 2RUEA 4L0UA 4K7OA 3DRNA 1CQGA 1WPIA 1THXA 2FY6A 3HXSA 4NV2A 2HSHA 4TXOB 3GHAA 4AJ8A 4KAEA 2C80A 3W8JA 5GAPD 4YQVA 3QFBC 1ACVA 2AB6A 3ZLPA 3DXBA 4F0CA 3VPTA 2HRFA 3ZFBA 4HQZA 3QOUA 4XRAA 1EWXA 3GIXA 3LXZA 3F4TA 4BA7A 1GSSA 1G6WA 3RHCA 1GSUA 2HSYA 1A2LA 4KSMA 2RM6A 1ZGNA 4FYCA 4HQSA 4MMMA 3BCKA 2GQLA 4V1Ag 2GZZA 4G9HA 2VIMA 2HT9A 3UEMA 1KNGA 1YEXA 4GRFA 3TKSC 4GQFA 3QFAC 3G7JA 3LJRA 3W6GA 3FR6A 4I8BA 4O32A 3PGTA 2VO4A 1F6MC 4MH3A 4ULXA 1R5AA 1SKWB 3D21A 3TJFA 2FA4A 2VCQA 1Q4JA 2JACA 3FHKA 2JZTA 4ISDA 1TP9A 1GULA 4GSTA 1KEBA 2DIYA 4ML6A 3IXRA 1GTIA 4Q5QA 2VAFA 4EKZA 2WRTA 2CVBA 5G1LA 5IMFA 4MH2A 3KMNA 1Z3EA 2LJKA 1R4WA 3EU3A 5CRWA 2HZEA 4HS1A 1Z7PA 3MSZA 3ZITA 3TRPA 2OACA 1XWAA 5AGYA 1TRSA 2F8AA 5ABRA 1I9DA 4P3YB 4GCIA 1TU7A 3CRUA 1BQ7A 5E59A 3H93A 1OAZA 3EVIA 5D9VA 3GL3A 4MF6A 1JZWA 3J7Yk 2O7KA 3WGDA 2EC4A 3EYTA 1Y25A 2XC2A 1Z7RA 3RAZA 5ECKB 5FHIA 1R5PA 1X9SB 2H6XA 4XS4A 4N11A 2PWJA 1N8JA 3TJGA 1X9MB 1XW5A 1SJ6A 4OD7A 4PNFA 1FB0A 3WT1A 3FY7A 4I97A 3NOFA 5JWOB 2V41A 3HZ4A 1BJXA 4J56E 5J3RA 1DUGA 5B8BA 5HR1A 3VURA 5FT3A 2E7PA 4FO5A 1GSFA 4WF5A 5ECLB 3GURA 3QD9A 3UVTA 5DBQA 5G5FA 1FVKA 1ZOFA 2GSRA 3GTUB 3IAS2 3IAM2 2F9SA 1A0RP 3L4NA 1GWCA 4K0NA 1PD21 1PX6A 2K8VA 4LMVA 4EL1A 2KUCA 5IOWA 4EO3A 3F63A 2ZCTA 4PUFC 3HDCA 3W8SA 5ECPB 4ECJA 1TJDA 5KN3A 2FNOA 2YWIA 3ZYWA 1WJKA 4QL7A 4K9ZA 2H6YA 2YZUA 2N5AA 3ERWA 4K7IA 4WBRD 2M72A 2VL3A 5CYYA 3HD5A 3L0HA 1B4PA 3GKKA 2YOIA 3VPQA 3OR5A 4G2EA 2MMOA 4KDYA 4F82A 3PINA 2M46A 5ENUA 2DJ0A 2O89A 2IN3A 2O87A 3QAWA 1XWCA 4TR1A 4IW9A 3GX8A 4PQ1A 2REMA 1J0FA 1Z6MA 3IDVA 4KDXA 3M9KA 3FK8A 3E3EA 4X1UA 3E9JB 3UL3A 3C73A 6GSTA 4XRDA 1ERVA 2J23A 2TRCP 4TW5A 3HJPA 5JCGA 1MDJA 2C3NA 1MDKA 1TRWA 2LSTA 4DEJA 1PRXA 3P90A 1GLQA 4MK3A 1OKTA 1PSQA 4IQ1A 2CZ3A 2WB9A 1QK8A 5J9BA 1C72A 1B9YC 2WFCA 2CVDA 1SL1B 3TGZA 2H0IA 4XS1A 1JZRA 2EIRA 3WT2A 1XWBA 4TKYA 1NM3A 1A0FA 3F4SA 2PN8A 5IPGA 3G7YA 3TKSA 2YP6A 5B8AA 2DMLA 3O3TA 4HZ2A 3C7MA 5JCWA 4GTUA 3ED3A 5GZZB 2WDUA 1XIYA 4PXOA 1ML6A 2KHPA 4TVEA 5IM9A 3LSZA 3LYPA 2OA7A 5LD0A 4RQXA 4KA0A 2CZ2A 5HFKA 5ECIB 4EUYA 3C1RA 3ERGA 2MMZA 5IO0A 4EF0A 1NHOA 3DGQA 4BWQA 4YQMA 5ECMB 3MAKA 3UBLA 1K3YA 4DSRA 2MMAA 3I43A 4MZWA 4ZXGA 2YWNA 4F2IA 4POBA 3TDGA 3VWUA 1K0AA 2H70A 5HQPA 3DMLA 3GKMA 2AV4A 4IGJA 3M8NA 2RIIA 4KH7A 3ZIJA 3D4MA 4PURA 4PGTA 2B6MA 1SK0A 1U6TA 5A4WA 3QDNA 1G0TA 5LCZA 2HYXA 2P0GA 1B8XA 1S3DA 5CP1A 3FYGA 3M3MA 1HYUA 3TKQA 4NXIA 5IMAA 1OE8A 5GSTA 1V9WA 1GUMA 3GV1A 1K0CA 2FWGA 4WXTA 4KCEA 4NAXA 4FYBA 5CAXA 1OC3A 3ISOA 1TK8B 2G2QA 4J2FA 2TIRA 1J9BA 3EWLA 2C8UA 2O85A 3CSIA 3ME7A 8GSSA 3FR9A 2P5RA 1U87A 5HR2A 4OO4A 1VGLA 1OVNA 2FGXA 1T1VA 3F8UA 1YDKA 1SK2A 1N2AA 3KGKA 1WWJA 3QMXA 1YZXA 2XPDA 4N30A 5DQSA 1OC9A 2IMFA 5G31A 2YJHA 1GSDA 3F0IA 2P31A 1F9MA 2J9HA 3BBYA 2R3XA 2TRXA 4IHUA 1PL2A 2YWMA 4MF5A 2GTUA 2FWEA 2VCVA 3KTLA 2R2JA 3HZ8A 4H86A 1B9XC 4QQ7A 3US3A 3L9UA 3TJJA 2K18A 1U3AA 1YKCA 2V1MA 4K1FA 1PN9A 3HJOA 1USBA 4MJCA 2L6DA 3KEBA 4MDCA 2IMIA 2DIZA 4V2MA 2I1UA 1SJZA 1FOVA 1YF1A 1BX9A 2RUFA 1WOUA 1Z6NA 3QAVA 1ZZYA 2YV7A 1O6JA 4LA1A 2FUG2 3QCPA 3ZVJD 3LWAA 2IFQA 3LG6A 1PA3A 2L5LA 2LNTA 4JEDA 3GH9A 2HLSA 3D22A 3TB2A 4D73B 2PVOC 4X0XA 4KDUA 1XW9A 4XHMA 1T4YA 5DCHA 3TJBA 2LTKA 4G19A 2AJQB 1SKRB 5ECHB 5J9CA 2H01A 2RLIA 3APSA 4O92A 3D0ZA 2L4QA 3R2QA 2NBSA 2VL2C 10GSA 2QC7A 4KX4A 4O5RA 1PGTA 2VCZA 1NW2A 3LEFA 5DAKB 3UBKA 1JLVA 2B1LA 1ZL9A 4ZILA 5ECOB 1OC8A 4L8EA 1JHBA 1GTAA 3CXGA 2OJLA 3RBTA 1EGRA 4AGSA 3UAPA 2YWOA 5ECRB 2JZSA 1Z5YE 3ZMLA 4TXVA 4PQHA 1GNWA 5ECSA 3WGEA 4MP4A 2PGTA 3WYWA 3FZAA 1RW1A 1SU9A 6GSWA 1O8XA 3ZL5A 3KZQA 2CAQA 1SL0B 1A2JA 4AJ7A 4I2TA 1M2DA 1HD2A 2IMEA 3FZ9A 1VF1A 2R6KA 5DVBA 6GSSA 2YN1A 2VLVA 1TXXA 2B5EA 4EE0A 3A2XA 1SKSB 1HQOA 2IWTA 4L0WA 1TK0B 3IPZA 2G0FA 1SENA 1PX7A 1QFNA 2CAIA 1GP1A 4V2LA 2HI7A 1ABAA 3HCZA 5D93A 3LGCA 2OBIA 2PBJA 1XCCA 2YANA 3KD0A 5CO3A 2VCXA 3QR6A 3M1GA 4XIHA 3ZTLA 1XZOA 3WD6A 5CNWA 5ECQB 2LRCA 1K0OA 2C1YA 3U5RE 4HZ4A 1T7PB 4BL7A 4QL9A 4MZBA 4KE3A 2ES7A 3H79A 1TKDB 1PMTA 3IK7A 3H4KA 2OE3A 3ZVJA 4K0GA 4TR4A 2H1DA 3F6DA 1SK1A 2KP2A 2V2GA 1XXUA 5G30A 1LBKA 2QGVA 2IPAA 4IELA 1M0UA 2C4JA 2L59A 3UIWA 4MPGA 2VOCA 3UJ1A 2FD3A 2HNLA 3GL5A 3CBUA 4GXZA 5HR3A 3GA4A 2HZEB 3C1SA 2MBSA 3KIJA 1SYRA 2H0GA 3I9V2 1F3BA 3A5WA 4OFNA 3TOUA 5J41A 4EDZA 1MEKA 2MZCA 1EEJA 1GUHA 4ZB8A 1GTUA 2X8CA 4IBPA 1QUWA 4WR5A 2C0GA 2HE3A 3VLNA 2JADA 2H0HA 2V6KA 4EVMA 4E8EA 3ZFLA 4KCAA 3GUSA 3GX0A 3GFKA 5AIVA 3A2WA 1O85A 2YPMA 2PMTA 3I69A 1TDIA 4WF4A 1JLWA 2CQ9A 5DJMA 3HVVA 1GL8A 1AIUA 3APQA 3WGXA 4XS6A 2OKAA 4V1Ap 1QGVA 2GQMA 5HFGA 4AJ6A 4XS4B 4PX1A 2F8FA 1ERTA 3Q18A 1YF0A 1X5EA 4HU9A 3D5JA 1AC1A 2DJ1A 3L78A 4F9ZA 3TKPA 5F07A 1EV9A 2JU5A 4MPFA 2LNSA 4N10A 2GT6A 1VF2A 1I5GA 2I4AA 2B7KA 2ON5A 2P5QA 2GZPA 3SBCA 2NDOA 3DD3A 1Q98A 4PNGA 3KMOA 3LORA 3AY8A 5LNKe 2PPTA 3CSHA 3IK9A 4POMA 2X64A 2LJRA 4I6XA 4ZB9A 1S3AA 3DWVA 6GSUA 5F8BA 3FKFA 1M99A 2JZRA 2VL2A 1K3OA 1UC7A 3GKXA 1AQXA 4MA9A 1AQVA 3DKSA 4TRXA 4YAPA 2ALBA 3NZNA 4DSSA 2GQKA 4I5QA 4OCEA 2NTOA 3KP8A 4ML1A 5KN1A 1EZKA 1K0DA 1TI1A 2N5FA 2XBIA 4GQCA 1W89A 5COHA 1M9BA 2C0DA 4EXJA 1EGOA 17GSA 2I3YA 4ID0A 3G7IA 2K8SA 5H5QA 4AF2A 1V58A 1EEMA 1YEPA 1GSEA 4TR1B 3GH6A 1KTEA 4HI7A 4POKA 1W4VA 3J7Yb 5D9WA 4HOJA 4IJIA 2L6CA 20GSA 5INYA 3F3RA 4MJBA 1YKAA 1XFLA 2HZFA 4ECBA 2LS5A 2IL3A 4BVYA 1ERUA 1NHYA 2VM1A 1A24A 1EP8A 1ZCPA 1THOA 2YCDA 3EMPA 4EC0A 4FIWA 1Y6EA 3MWHA 4MZCA 4IVFA 2LRNA 2YNXA 4HEA2 1O81A 2VCTA 2GZYA 5H5RA 2F51A 2X99A 5DJLA 3HY2A 5G1KA 1UVZA 4RUVA 3FRCA 3LFLA 1TK5B 2MYGA 4DSSB 4WBJA 2VL9A 1TTZA 4ACSA 3KH9A 3TKRA 4ZL7A 1X5DA 1AXDA 4OMVA 4MF7A 1O7UA 4JZQA 2K9FA 1U3IA 2H71A 2XPEA 3A3TA 2JSYA 13GSA 3Q74A 4MLYA 1T8EB 1DBYA 3VK9A 2PU9C 1TRUA 3PH9A 1ON4A 2LKUA 5HFIA 4TXOA 3ZRDA 2GS3A 4NPBA 5AIXA 1MDIA 4TR3A 5IMZA 3FW2A 1M9AA 5JWQB 7GSSA 1M2AA 6GSVA 4OFTA 3N5OA 2CVKA 4MJAA 5EPFA 2ZNMA 1F37A 3O6TA 6GSYA 2VM2A 5GSSA 4BPYA 1OYJA 3O76A 2DMMA 4LMWA 4F0BA 3E0UA 3MNGA 1KBNA 2GVPA 3F6FA 1R7HA 3DYRA 1UN2A 1FO5A 4Z7XA 4ILFA 3F9UA 2RM5A 4JE1A 2I9HA 5ELAA 1QMVA 5B6MA 1H4OA 3FEUA 1BG5A 1J08A 5D9TA 9GSSA 4NHWA 1XWKA 2Z9SA 2JSZA 5G2ZA 3BD2A 5HR0A 5J5NA 5F0GA 3ME8A 1SD9A 4IP1A 2OADA 3IHQA 3CTGA 4KNDA 2H76A 2H75A 3VI7A 3F3QA 1X9WB 4OWYA 4WKWA 1A23A 3FZ5A 3C8EA 3HYPA 5KEJA 3HVSA 3Q6OA 2LRTA 2BTOT 2GSTA 2L57A 2MMNA 2YV9A 3TRXA 4JR6A 2DJ3A 2LQQA 11GSA 3IOSA 1F2EA 1WRYA 1EOGA 3DVXA 1ILOA 2WJUA 1ST9A 2IJYA 1U88A 2DJKA 1OC9B 2X8GA 2B3SA 1PKZA 2E2GA 1XPVA 1ERWA 2DLXA 3LYKA 5ID2A 4HU7A 3IE3A 2V32A 2LQOA 1ZYEA 5B6NA 1JFUA 4PQIA 1DSBA 19GSA 1TI3A 4OCFA 4KB3A 5CREA 5J4UA 3EE2A 4KSOA 2KP1A 3K8NA 2VUPA 2LUSA 2HXKA 1SYXA 4N0VA 4CHSA 3GSTA 4CDOA 2B5YA 4ZBDA 4DSQA 3A2VA 5KN0A 1E6BA 5JWRB 4N0ZA 1T3BA 1RQMA 4L5OA 3IBHA 2DJJA 1TU8A 5CRDA 4Q5RA 2MBTA 2PUKC 2WZ9A 1VF3A 4KGIA 2QSIA 2OBKA 2IFQB 4V2NA 5IIZA 5EY6A 1GRXA 4XCSA 1XWGA 5DQYA 2H66A 4IN0A 4PUAA 3IR4A 1GNEA 4Q5NA 2FWFA 3CMIA 3ZIVA 2LV3A 3VWWA 1SD8A 2R4VA 3KJYA 1GSYA 2HFDA 1MD4A 1K3LA 2AHEA 2GSSA 3GTUA 2CT6A 1K0NA 1GUKA 5ECNB 2VCWA 5DALA 2OE0A 2VLTA 3D4TA 5ID2B 2LJAA 1T00A 2O8VB 3KCMA 4WETA 1GLPA 4K6XA 3DVWA 1R26A 2R37A 22GSA 4K8MA 2XHFA 3HKRA 4K7NA 3IC4A 5D73A 4NWYA 1FB6A 2WGRA 5A4VA 2ZUPA 4YQUA 4ZIJA 2WCIA 3KM6A 1VRSD 2H6ZA 2IMDA 2H72A 1T4ZA 4DVCA 3TOTA 5IMVA 1EV4A 16GSA 1A8LA 1FAAA 4JR4A 2ON7A 1ZYQB 1HNBA 2E2MA 3QAGA 4BVXA 3HA9A 3LQ7A 4E8HA 4RI7A 1XOBA 2QKEA 4EDYA 1M2BA 3HJMA 4OFMA 3APOA 2H1BA 4IQAA 1JZOA 2VD1A 4MJEA 2L4CA 5C04A 4J57E 5F06A 3FR3A 1HNCA 4TR0A 4IP6A 4F03A
chains in the Genus database with same CATH superfamily
1FVJA 4ECIA 3LXTA 5GAND 5CRGA 2EIQA 1G6YA 4ZBBA 3SWLA 3LW9A 4K2DA 1BYEA 4TN8A 2HSMA 1AUCA 5DALB 2D2ZA 4CW9A 1TRVA 1XVQA 4HJMA 3DIEA 1GTBA 2H73A 2NPBA 4RQRA 2FA8A 5C00A 2H30A 3RPPA 2GT5A 4OO5A 3KP9A 2A2RA 2CA8A 2B7JA 5G5EA 2YJ7A 1K0BA 2DC5A 3KXOA 5FWGA 1F3AA 1O8WA 1YJ6A 3D6IA 4YH2A 2WULA 3VI5A 5L71A 3P7XA 2GSQA 2EIOA 1MD3A 2B1KA 2X8HA 2FHEA 3NIVA 3CTFA 6GSXA 4HUAA 3TUEA 2K6VA 1G7OA 1YQ1A 4KUNA 2DJ2A 2JL4A 4XTSA 2C0FA 1XBSA 3P2AA 1AAZA 3ZMKA 1TW9A 3RHBA 1WIKA 1H75A 4X43A 5D9XA 2CX3A 3Q19A 3VWVA 1UA5A 3GRXA 4ZBAA 2V6OA 3HVNA 2AYTA 1QQ2A 2AAWA 4FYUA 5AN1A 3TJKA 3KTBA 1X0RA 1X5CA 3CRTA 5KN2A 3EURA 2HRNA 1A2MA 4GWRA 3C71A 1Z9HA 1G7EA 3EC3A 1PL1A 2VLUA 2N5BA 3V1WA 3ERFA 3TRQA 3GMFA 3G9BA 3HHVA 4GLTA 1IYHA 4MCUA 1TOFA 2C3QA 4LL1B 1V98A 1IYIA 2KOKA 4KW6A 2VD0A 3GSSA 1SL2B 2H19A 3P8WA 4JU5A 1FHEA 4LL4B 1LJRA 3H8QA 2AUVA 1O73A 2H8LA 4FH8A 2A4VA 4RI6A 2CX4A 5IMCA 4IS0A 4WEYA 3M0FA 1VF4A 4YAVA 2FCHA 1FW1A 5IQYA 5H5SA 5KOWA 3KH7A 5F05A 3TKSE 2WS2A 3RPNA 3U6VA 5CRHA 1DE2A 5BMUA 4WR4A 1WE0A 2PERA 2E0QA 5A4UA 2YZHA 2CV4A 5IO2A 2FLSA 3HVXA 1BEDA 1FG4A 2BMXA 2F3MA 4NHZA 4JRRA 1RK4A 2OE1A 1DE1A 2KLXA 4ZB6A 4I2UA 3M9JA 4GSNA 4Q5FA 2XBQA 3GKNA 3GYKA 4NV5A 5ELGA 2BJXA 2C0EA 1WMJA 3BOAA 3TCOA 2NVLA 2DBCA 4X4JA 1BAYA 2LEGA 4O7HA 3IRAA 3ZREA 3VFIA 3BCIA 3MDKA 3GNJA 14GSA 4G10A 3L9SA 1M7TA 4POLA 3UARA 2I81A 1GH2A 2M80A 1AQWA 4ZL8A 4NMUA 1PKWA 2GGTA 4GSSA 3JCML 1V2AA 4JBBA 1OE7A 4IJ3A 1EP7A 3UVHA 4ECCA 1S3CA 1AW9A 3IV4A 1K0MA 1WP0A 5IOXA 1LU4A 2L5OA 1HNAA 1ZMAA 3H1NA 1A8YA 2IIYA 2H1GA 1GSQA 1V40A 3L9VA 2C3TA 2R5GA 4GF0A 1E2YA 5A5KA 3DEXA 3EU4A 1XOAA 1NSWA 4HJ2A 5D96A 5DCGA 4MABA 4D73A 3EINA 5DDLA 3IA1A 4LLRA 12GSA 3UMAA 4L5LA 3GN3A 3RDWA 2H1AA 3I6AA 2B5XA 5IPHA 5AISA 2GLRA 3PR8A 5JCUA 4BWSA 1B48A 1EOHA 1SJIA 1URMA 3CYNA 1B4QA 1CQHA 2FWHA 2PVQA 4ZL9A 5EVOA 1XW6A 5EL8A 1XVWA 3UOMA 3S9FA 5D8IA 3N9JA 5IMDA 5DAKA 3ZZXA 1PQNA 3FZ4A 18GSA 2H74A 4IKHA 3VWXA 2A2SA 2GDRA 3CSJA 3QPMA 4O5UA 2DSAA 1JZDA 2IMKA 1V57A 4TOPA 5E4WA 3BJ5A 4HDEA 1OKDA 1MTCA 1QXHA 1YY7A 3EMXA 3F4RA 5B7CA 2RUEA 4L0UA 4K7OA 3DRNA 1CQGA 1WPIA 1THXA 2FY6A 3HXSA 4NV2A 2HSHA 4TXOB 3GHAA 4AJ8A 4KAEA 2C80A 3W8JA 5GAPD 4YQVA 3QFBC 4YKFA 1ACVA 2AB6A 3ZLPA 3DXBA 4F0CA 3VPTA 2HRFA 3ZFBA 4HQZA 3QOUA 4XRAA 1EWXA 3GIXA 3LXZA 3F4TA 4BA7A 1GSSA 1G6WA 3RHCA 1GSUA 2HSYA 1A2LA 4KSMA 2RM6A 1ZGNA 4FYCA 4HQSA 4MMMA 3BCKA 2GQLA 2DKIA 4V1Ag 2GZZA 4G9HA 2VIMA 2HT9A 2X49A 3UEMA 1KNGA 1YEXA 4GRFA 3TKSC 4GQFA 3QFAC 3G7JA 3LJRA 1ZYPA 3W6GA 3FR6A 4I8BA 4O32A 3PGTA 2VO4A 1F6MC 3EPTA 4MH3A 4ULXA 1R5AA 1SKWB 3D21A 3TJFA 2FA4A 2VCQA 1Q4JA 2JACA 3FHKA 2JZTA 4ISDA 1TP9A 1GULA 4GSTA 1KEBA 2DIYA 4ML6A 2QA2A 3IXRA 1GTIA 4Q5QA 2VAFA 4EKZA 2WRTA 2CVBA 4A5PA 3CQFA 5G1LA 5IMFA 4MH2A 3KMNA 1Z3EA 2LJKA 1R4WA 3EU3A 5CRWA 2HZEA 2R0GA 4HS1A 1Z7PA 3MSZA 3ZITA 3TRPA 2OACA 1XWAA 5AGYA 1TRSA 2F8AA 5ABRA 1I9DA 4P3YB 4GCIA 2R0PA 1TU7A 3CRUA 1BQ7A 5E59A 3H93A 1OAZA 3EVIA 5D9VA 3GL3A 4MF6A 1JZWA 3J7Yk 2O7KA 3WGDA 2EC4A 3EYTA 1Y25A 2XC2A 1Z7RA 3RAZA 5ECKB 5FHIA 1R5PA 1X9SB 2H6XA 4XS4A 4EIPA 4N11A 2PWJA 1N8JA 3TJGA 1X9MB 1XW5A 1SJ6A 4OD7A 4PNFA 1FB0A 3WT1A 3FY7A 4I97A 3NOFA 4G0KA 5JWOB 2V41A 3HZ4A 1BJXA 4J56E 5J3RA 1DUGA 5B8BA 5HR1A 3VURA 5FT3A 2E7PA 4FO5A 1GSFA 4WF5A 5ECLB 3GURA 3QD9A 3UVTA 5DBQA 5G5FA 1FVKA 1ZOFA 2GSRA 3GTUB 3IAS2 3IAM2 2F9SA 1A0RP 3L4NA 1GWCA 4K0NA 1PD21 1PX6A 2K8VA 4LMVA 4EL1A 2KUCA 5IOWA 4CY8A 4EO3A 3F63A 2ZCTA 4PUFC 3HDCA 3W8SA 5ECPB 4ECJA 1TJDA 5KN3A 2FNOA 2YWIA 3ZYWA 1WJKA 4QL7A 4K9ZA 2H6YA 2YZUA 2N5AA 3ERWA 4K7IA 4WBRD 2M72A 2VL3A 5CYYA 3HD5A 3L0HA 1B4PA 3GKKA 2YOIA 3VPQA 3OR5A 4G2EA 2MMOA 4KDYA 4F82A 3PINA 2M46A 5ENUA 2DJ0A 2O89A 2IN3A 2O87A 4BVXB 1XG8A 3QAWA 1XWCA 4TR1A 4IW9A 3GX8A 4PQ1A 2REMA 1J0FA 1Z6MA 3IDVA 4KDXA 3M9KA 3FK8A 3E3EA 4X1UA 3E9JB 3UL3A 3C73A 6GSTA 4XRDA 1ERVA 2J23A 2TRCP 4TW5A 3HJPA 5JCGA 1MDJA 2C3NA 1MDKA 1TRWA 2LSTA 4DEJA 1PRXA 3P90A 1GLQA 4MK3A 1OKTA 1PSQA 4IQ1A 1FOHA 2CZ3A 2WB9A 1QK8A 5J9BA 1C72A 1B9YC 2WFCA 2CVDA 1SL1B 3TGZA 2H0IA 4XS1A 4K5RA 1JZRA 2EIRA 3WT2A 1XWBA 4TKYA 1NM3A 1A0FA 3F4SA 2PN8A 5IPGA 3G7YA 3TKSA 2YP6A 5B8AA 2DMLA 3O3TA 4O5QA 4HZ2A 3C7MA 5JCWA 4GTUA 3ED3A 5GZZB 2WDUA 1XIYA 4PXOA 1ML6A 2KHPA 4TVEA 5IM9A 3LSZA 3LYPA 2OA7A 5LD0A 4RQXA 4KA0A 4ICYA 2CZ2A 5HFKA 5ECIB 4EUYA 3C1RA 3ERGA 2MMZA 5IO0A 4EF0A 1NHOA 3DGQA 4BWQA 4YQMA 5ECMB 3MAKA 3UBLA 1K3YA 3IC8A 4DSRA 2MMAA 3I43A 4MZWA 4ZXGA 2YWNA 4F2IA 4POBA 3TDGA 3VWUA 1K0AA 2H70A 5HQPA 3R3EA 1PFOA 3DMLA 3GKMA 2AV4A 4IGJA 3M8NA 2RIIA 4KH7A 3ZIJA 3D4MA 4PURA 4PGTA 2B6MA 1SK0A 1U6TA 4K5SA 3QDNA 5A4WA 1G0TA 5LCZA 2HYXA 2P0GA 1B8XA 1S3DA 5CP1A 3MIXA 1S3RA 3FYGA 3M3MA 1HYUA 3TKQA 4NXIA 5IMAA 1OE8A 5GSTA 1V9WA 1GUMA 3GV1A 1K0CA 2FWGA 4WXTA 4KCEA 4NAXA 4FYBA 5CAXA 1OC3A 3ISOA 1TK8B 2G2QA 4J2FA 2TIRA 1J9BA 3EWLA 2C8UA 2O85A 3CSIA 3ME7A 8GSSA 3FR9A 2P5RA 1U87A 5HR2A 4OO4A 1VGLA 1OVNA 2FGXA 1T1VA 3F8UA 1YDKA 1SK2A 1N2AA 3KGKA 1WWJA 3QMXA 1YZXA 2XPDA 4N30A 5DQSA 1OC9A 2IMFA 2QA1A 5G31A 2YJHA 1GSDA 3F0IA 2P31A 1F9MA 2J9HA 3BBYA 2R3XA 2TRXA 4IHUA 1PL2A 2YWMA 4MF5A 2GTUA 2FWEA 2VCVA 3KTLA 2R2JA 3HZ8A 4H86A 1B9XC 4QQ7A 3US3A 3L9UA 3TJJA 2K18A 1U3AA 1YKCA 2V1MA 4K1FA 1PN9A 3HJOA 1USBA 4MJCA 2L6DA 3KEBA 5BRTA 4MDCA 2IMIA 2DIZA 4V2MA 2I1UA 1SJZA 1FOVA 1YF1A 1BX9A 2RUFA 1WOUA 1Z6NA 3QAVA 1ZZYA 2YV7A 1O6JA 4LA1A 2FUG2 3QCPA 3ZVJD 3LWAA 2IFQA 3LG6A 2A2PA 1PA3A 2L5LA 2LNTA 4JEDA 2HRAA 3GH9A 2HLSA 3D22A 3TB2A 4D73B 2PVOC 4X0XA 4KDUA 1XW9A 4XHMA 1T4YA 5DCHA 3TJBA 2LTKA 4G19A 2AJQB 1SKRB 5ECHB 5J9CA 2H01A 2RLIA 3APSA 1M3IA 4O92A 3D0ZA 2L4QA 3R2QA 2NBSA 4G0IA 2VL2C 10GSA 2QC7A 4KX4A 4O5RA 1PGTA 2VCZA 1NW2A 3LEFA 5DAKB 3UBKA 1JLVA 2B1LA 1ZL9A 4ZILA 5ECOB 1OC8A 4L8EA 1JHBA 1GTAA 3CXGA 2OJLA 3RBTA 1EGRA 4AGSA 3UAPA 2YWOA 5ECRB 2JZSA 1Z5YE 3ZMLA 4TXVA 4PQHA 1GNWA 5ECSA 3WGEA 4MP4A 2PGTA 3WYWA 3FZAA 1RW1A 1SU9A 6GSWA 1O8XA 3ZL5A 3KZQA 2CAQA 1SL0B 1A2JA 4AJ7A 4I2TA 1M2DA 1HD2A 2IMEA 3FZ9A 1VF1A 2R6KA 5DVBA 6GSSA 1PN0A 2YN1A 2VLVA 1TXXA 2B5EA 4EE0A 3A2XA 1SKSB 1HQOA 2IWTA 4L0WA 1TK0B 3IPZA 2G0FA 1SENA 1PX7A 1QFNA 2CAIA 1GP1A 4V2LA 2HI7A 4Z2UA 1ABAA 3HCZA 5D93A 3LGCA 2A4HA 2OBIA 2PBJA 1XCCA 2YANA 3KD0A 5CO3A 2VCXA 3QR6A 3M1GA 4XIHA 3ZTLA 1XZOA 3WD6A 5CNWA 5ECQB 2LRCA 1K0OA 2C1YA 3U5RE 4HZ4A 1T7PB 5KOXA 4BL7A 4QL9A 4MZBA 4KE3A 2ES7A 3H79A 1TKDB 1PMTA 3IK7A 2R0CA 3H4KA 2OE3A 3ZVJA 4K0GA 4TR4A 2H1DA 3F6DA 1SK1A 2KP2A 2V2GA 1XXUA 5G30A 1LBKA 2QGVA 2IPAA 4IELA 1M0UA 2C4JA 2L59A 3UIWA 4MPGA 2VOCA 3UJ1A 2FD3A 2HNLA 3GL5A 3CBUA 4GXZA 5HR3A 3GA4A 2HZEB 3IHGA 3C1SA 2MBSA 3KIJA 1SYRA 2H0GA 3I9V2 1F3BA 3A5WA 4OFNA 3TOUA 5J41A 4EDZA 1MEKA 2MZCA 1EEJA 1GUHA 4ZB8A 1GTUA 2X8CA 4IBPA 1QUWA 4WR5A 2C0GA 2HE3A 3A5IA 3VLNA 4K2XA 2JADA 2H0HA 2V6KA 4EVMA 4E8EA 3ZFLA 4KCAA 3GUSA 3GX0A 3GFKA 5AIVA 3A2WA 1O85A 2YPMA 2PMTA 3I69A 1TDIA 4WF4A 1JLWA 2CQ9A 5DJMA 3HVVA 1GL8A 1AIUA 3APQA 3WGXA 4XS6A 2OKAA 4V1Ap 1QGVA 2GQMA 5HFGA 4AJ6A 4XS4B 4PX1A 2F8FA 1ERTA 3Q18A 1YF0A 1X5EA 4HU9A 4MNNA 3D5JA 1AC1A 2DJ1A 4BL7B 3L78A 4F9ZA 3TKPA 5F07A 1EV9A 2JU5A 4MPFA 2LNSA 4N10A 2GT6A 1VF2A 1I5GA 2I4AA 2B7KA 2ON5A 2P5QA 2GZPA 3SBCA 2NDOA 3DD3A 1Q98A 4PNGA 3KMOA 3LORA 4BIKA 3AY8A 5LNKe 2PPTA 3CSHA 3IK9A 4POMA 2X64A 2LJRA 4I6XA 4ZB9A 1S3AA 3DWVA 6GSUA 5F8BA 3FKFA 1M99A 2JZRA 2VL2A 1K3OA 1UC7A 3GKXA 1AQXA 4MA9A 1AQVA 3DKSA 4TRXA 4YAPA 2ALBA 3NZNA 4DSSA 2GQKA 4I5QA 4OCEA 2NTOA 3KP8A 4ML1A 5KN1A 1EZKA 1K0DA 1TI1A 2N5FA 2XBIA 4GQCA 1W89A 5COHA 1M9BA 2C0DA 4EXJA 1EGOA 17GSA 2I3YA 4ID0A 3G7IA 2K8SA 5H5QA 4AF2A 1V58A 1EEMA 1YEPA 1GSEA 4TR1B 3GH6A 1KTEA 4HI7A 4POKA 1W4VA 3J7Yb 5D9WA 4HOJA 4IJIA 2L6CA 2X4AA 20GSA 5INYA 3F3RA 4MJBA 1YKAA 2DKHA 1XFLA 2HZFA 4ECBA 2LS5A 2IL3A 4BVYA 1ERUA 1NHYA 2VM1A 1A24A 1EP8A 4HSCX 1ZCPA 1THOA 2YCDA 3EMPA 4EC0A 4FIWA 1Y6EA 3MWHA 3MYDA 4MZCA 4IVFA 2LRNA 2YNXA 4HEA2 4FQUA 1O81A 2VCTA 2GZYA 5H5RA 2F51A 2X99A 5DJLA 3HY2A 5G1KA 1UVZA 4RUVA 3FRCA 3LFLA 1TK5B 2MYGA 4DSSB 4WBJA 2VL9A 1TTZA 4ACSA 3KH9A 3TKRA 4ZL7A 1X5DA 1AXDA 4OMVA 4MF7A 1O7UA 4JZQA 2K9FA 1U3IA 2H71A 2XPEA 3A3TA 2JSYA 13GSA 3Q74A 4MLYA 1T8EB 1DBYA 3VK9A 2PU9C 1TRUA 3PH9A 1ON4A 2LKUA 5HFIA 4TXOA 3ZRDA 2GS3A 4NPBA 5AIXA 1MDIA 4TR3A 5IMZA 3FW2A 1M9AA 5JWQB 7GSSA 1M2AA 6GSVA 4OFTA 3N5OA 2CVKA 4MJAA 5EPFA 2ZNMA 1F37A 3O6TA 6GSYA 2VM2A 5GSSA 4BPYA 4BVYB 1OYJA 3O76A 2DMMA 4LMWA 4F0BA 3E0UA 3MNGA 1KBNA 2GVPA 3F6FA 1R7HA 3DYRA 1UN2A 1FO5A 4Z7XA 4ILFA 3F9UA 2RM5A 4JE1A 2I9HA 5ELAA 1QMVA 5B6MA 1H4OA 3FEUA 1BG5A 1J08A 4CY6A 5D9TA 9GSSA 4NHWA 1XWKA 2Z9SA 2JSZA 4Z2RA 5G2ZA 3BD2A 5HR0A 5J5NA 5F0GA 3ME8A 1SD9A 4IP1A 2OADA 3IHQA 3CTGA 4KNDA 2H76A 4G0LA 2H75A 3VI7A 3F3QA 1X9WB 4KF9A 4OWYA 3FMWA 4WKWA 1A23A 3FZ5A 3C8EA 3HYPA 5KEJA 3HVSA 3Q6OA 2LRTA 2BTOT 2GSTA 2L57A 2MMNA 2YV9A 3TRXA 4JR6A 2DJ3A 2LQQA 11GSA 3IOSA 1F2EA 1WRYA 1EOGA 3DVXA 1ILOA 4Z2TA 2WJUA 3PPUA 1ST9A 2IJYA 1U88A 2DJKA 1OC9B 2X8GA 2B3SA 1PKZA 2E2GA 1XPVA 1ERWA 2DLXA 3LYKA 5ID2A 4HU7A 3IE3A 2V32A 2LQOA 1ZYEA 5B6NA 1JFUA 4PQIA 1DSBA 19GSA 1TI3A 4OCFA 4KB3A 5CREA 5J4UA 3EE2A 4KSOA 2KP1A 3K8NA 2VUPA 2LUSA 2HXKA 1SYXA 4N0VA 4CHSA 3GSTA 4CDOA 2B5YA 4ZBDA 4DSQA 3A2VA 5KN0A 1E6BA 5JWRB 4N0ZA 1T3BA 1RQMA 4L5OA 3IBHA 2DJJA 1TU8A 5CRDA 4Q5RA 2MBTA 2PUKC 2WZ9A 1VF3A 4KGIA 2QSIA 2OBKA 2IFQB 4V2NA 5IIZA 5EY6A 4PTSA 1GRXA 4XCSA 1XWGA 5DQYA 2H66A 4IN0A 4PUAA 3IR4A 1GNEA 4Q5NA 2HRKA 2FWFA 3CMIA 3ZIVA 2LV3A 3VWWA 1SD8A 2R4VA 3KJYA 1GSYA 2HFDA 1MD4A 1K3LA 2AHEA 2GSSA 3GTUA 2CT6A 1ZYNA 1K0NA 1GUKA 5ECNB 2VCWA 5DALA 2OE0A 2VLTA 3D4TA 5ID2B 2LJAA 1M3JA 1T00A 2O8VB 3KCMA 4WETA 1GLPA 4K6XA 3DVWA 1R26A 2R37A 22GSA 4K8MA 2XHFA 3HKRA 4K7NA 3IC4A 5D73A 4NWYA 1FB6A 4EIQA 2WGRA 5A4VA 2ZUPA 4YQUA 4ZIJA 2WCIA 3KM6A 1VRSD 2H6ZA 2IMDA 2H72A 1T4ZA 4DVCA 3TOTA 5IMVA 1EV4A 16GSA 1A8LA 1FAAA 4YKGA 2UZ8A 4JR4A 2ON7A 1ZYQB 1HNBA 2E2MA 4USSA 3QAGA 4BVXA 3HA9A 3LQ7A 4E8HA 4RI7A 1XOBA 2QKEA 4EDYA 1M2BA 3HJMA 4OFMA 3APOA 2H1BA 4IQAA 1JZOA 2VD1A 4MJEA 2L4CA 5C04A 4J57E 5F06A 3FR3A 1HNCA 4TR0A 4IP6A 4F03A
chains in the Genus database with same CATH topology
1FVJA 4ECIA 3LXTA 5GAND 5CRGA 2EIQA 1G6YA 4ZBBA 3SWLA 3LW9A 4K2DA 1BYEA 4TN8A 2HSMA 1AUCA 5DALB 2D2ZA 4CW9A 1TRVA 1XVQA 4HJMA 3DIEA 1GTBA 2H73A 2NPBA 4RQRA 2FA8A 5C00A 2H30A 3RPPA 2GT5A 4OO5A 3KP9A 2A2RA 2CA8A 2B7JA 5G5EA 2YJ7A 1K0BA 2DC5A 3KXOA 5FWGA 1F3AA 1O8WA 1YJ6A 3D6IA 4YH2A 2WULA 3VI5A 5L71A 3P7XA 2GSQA 2EIOA 1MD3A 2B1KA 2X8HA 2FHEA 3NIVA 3CTFA 6GSXA 4HUAA 3TUEA 2K6VA 1G7OA 1YQ1A 4KUNA 2DJ2A 2JL4A 4XTSA 2C0FA 1XBSA 3P2AA 1AAZA 3ZMKA 1TW9A 3RHBA 1WIKA 1H75A 4X43A 5D9XA 2CX3A 3Q19A 3VWVA 1UA5A 3GRXA 4ZBAA 2V6OA 2AYTA 1QQ2A 2AAWA 4FYUA 5AN1A 3TJKA 3KTBA 1X0RA 1X5CA 3CRTA 5KN2A 3EURA 2HRNA 1A2MA 4GWRA 3C71A 1Z9HA 1G7EA 3EC3A 1PL1A 2VLUA 2N5BA 3V1WA 3ERFA 3TRQA 3GMFA 3G9BA 3HHVA 4GLTA 1IYHA 4MCUA 1TOFA 2C3QA 4LL1B 1V98A 1IYIA 2KOKA 4KW6A 2VD0A 3GSSA 1SL2B 2H19A 3P8WA 4JU5A 1FHEA 4LL4B 1LJRA 3H8QA 2AUVA 1O73A 2H8LA 4FH8A 2A4VA 4RI6A 2CX4A 5IMCA 4IS0A 4WEYA 3M0FA 1VF4A 4YAVA 2FCHA 1FW1A 5IQYA 5H5SA 5KOWA 3KH7A 5F05A 3TKSE 2WS2A 3RPNA 3U6VA 5CRHA 1DE2A 5BMUA 4WR4A 1WE0A 2PERA 2E0QA 5A4UA 2YZHA 2CV4A 5IO2A 2FLSA 3HVXA 1BEDA 1FG4A 2BMXA 2F3MA 4NHZA 4JRRA 1RK4A 2OE1A 1DE1A 2KLXA 4ZB6A 4I2UA 3M9JA 4GSNA 4Q5FA 2XBQA 3GKNA 3GYKA 4NV5A 5ELGA 2BJXA 2C0EA 1WMJA 3BOAA 3TCOA 2NVLA 2DBCA 4X4JA 1BAYA 2LEGA 4O7HA 3IRAA 3ZREA 3VFIA 3BCIA 3MDKA 3GNJA 14GSA 4G10A 3L9SA 1M7TA 4POLA 3UARA 2I81A 1GH2A 2M80A 1AQWA 4ZL8A 4NMUA 1PKWA 2GGTA 4GSSA 3JCML 1V2AA 4JBBA 1OE7A 4IJ3A 1EP7A 3UVHA 4ECCA 1S3CA 1AW9A 3IV4A 1K0MA 1WP0A 5IOXA 1LU4A 2L5OA 1HNAA 1ZMAA 3H1NA 1A8YA 2IIYA 2H1GA 1GSQA 1V40A 3L9VA 2C3TA 2R5GA 4GF0A 1E2YA 5A5KA 3DEXA 3EU4A 1XOAA 1NSWA 4HJ2A 5D96A 5DCGA 4MABA 4D73A 3EINA 5DDLA 3IA1A 4LLRA 12GSA 3UMAA 4L5LA 3GN3A 3RDWA 2H1AA 3I6AA 2B5XA 5IPHA 5AISA 2GLRA 3PR8A 5JCUA 4BWSA 1B48A 1EOHA 1SJIA 1URMA 3CYNA 1B4QA 1CQHA 2FWHA 2PVQA 4ZL9A 5EVOA 1XW6A 5EL8A 1XVWA 3UOMA 3S9FA 5D8IA 3N9JA 5IMDA 5DAKA 3ZZXA 1PQNA 3FZ4A 18GSA 2H74A 4IKHA 3VWXA 2A2SA 2GDRA 3CSJA 3QPMA 4O5UA 2DSAA 1JZDA 2IMKA 1V57A 4TOPA 5E4WA 3BJ5A 4HDEA 1OKDA 1MTCA 1QXHA 1YY7A 3EMXA 3F4RA 5B7CA 2RUEA 4L0UA 4K7OA 3DRNA 1CQGA 1WPIA 1THXA 2FY6A 3HXSA 4NV2A 2HSHA 4TXOB 3GHAA 4AJ8A 4KAEA 2C80A 3W8JA 5GAPD 4YQVA 3QFBC 4YKFA 1ACVA 2AB6A 3ZLPA 3DXBA 4F0CA 3VPTA 2HRFA 3ZFBA 4HQZA 3QOUA 4XRAA 1EWXA 3GIXA 3LXZA 3F4TA 4BA7A 1GSSA 1G6WA 3RHCA 1GSUA 2HSYA 1A2LA 4KSMA 2RM6A 1ZGNA 4FYCA 4HQSA 4MMMA 3BCKA 2GQLA 2DKIA 4V1Ag 2GZZA 4G9HA 2VIMA 2HT9A 2X49A 3UEMA 1KNGA 1YEXA 4GRFA 3TKSC 4GQFA 3QFAC 3G7JA 3LJRA 1ZYPA 3W6GA 3FR6A 4I8BA 4O32A 3PGTA 2VO4A 1F6MC 3EPTA 4MH3A 4ULXA 1R5AA 1SKWB 3D21A 3TJFA 2FA4A 2VCQA 1Q4JA 2JACA 3FHKA 2JZTA 4ISDA 1TP9A 1GULA 4GSTA 1KEBA 2DIYA 4ML6A 2QA2A 3IXRA 1GTIA 4Q5QA 2VAFA 4EKZA 2WRTA 2CVBA 4A5PA 5G1LA 5IMFA 4MH2A 3KMNA 1Z3EA 2LJKA 1R4WA 3EU3A 5CRWA 2HZEA 2R0GA 4HS1A 1Z7PA 3MSZA 3ZITA 3TRPA 2OACA 1XWAA 5AGYA 1TRSA 2F8AA 5ABRA 1I9DA 4P3YB 4GCIA 2R0PA 1TU7A 3CRUA 1BQ7A 5E59A 3H93A 1OAZA 3EVIA 5D9VA 3GL3A 4MF6A 1JZWA 3J7Yk 2O7KA 3WGDA 2EC4A 3EYTA 1Y25A 2XC2A 1Z7RA 3RAZA 5ECKB 5FHIA 1R5PA 1X9SB 2H6XA 4XS4A 4EIPA 4N11A 2PWJA 1N8JA 3TJGA 1X9MB 1XW5A 1SJ6A 4OD7A 4PNFA 1FB0A 3WT1A 3FY7A 4I97A 3NOFA 4G0KA 5JWOB 2V41A 3HZ4A 1BJXA 4J56E 5J3RA 1DUGA 5B8BA 5HR1A 3VURA 5FT3A 2E7PA 4FO5A 1GSFA 4WF5A 5ECLB 3GURA 3QD9A 3UVTA 5DBQA 5G5FA 1FVKA 1ZOFA 2GSRA 3GTUB 3IAS2 3IAM2 2F9SA 1A0RP 3L4NA 1GWCA 4K0NA 1PD21 1PX6A 2K8VA 4LMVA 4EL1A 2KUCA 5IOWA 4CY8A 4EO3A 3F63A 2ZCTA 4PUFC 3HDCA 3W8SA 5ECPB 4ECJA 1TJDA 5KN3A 2FNOA 2YWIA 3ZYWA 1WJKA 4QL7A 4K9ZA 2H6YA 2YZUA 2N5AA 3ERWA 4K7IA 4WBRD 2M72A 2VL3A 5CYYA 3HD5A 3L0HA 1B4PA 3GKKA 2YOIA 3VPQA 3OR5A 4G2EA 2MMOA 4KDYA 4F82A 3PINA 2M46A 5ENUA 2DJ0A 2O89A 2IN3A 2O87A 4BVXB 3QAWA 1XWCA 4TR1A 4IW9A 3GX8A 4PQ1A 2REMA 1J0FA 1Z6MA 3IDVA 4KDXA 3M9KA 3FK8A 3E3EA 4X1UA 3E9JB 3UL3A 3C73A 6GSTA 4XRDA 1ERVA 2J23A 2TRCP 4TW5A 3HJPA 5JCGA 1MDJA 2C3NA 1MDKA 1TRWA 2LSTA 4DEJA 1PRXA 3P90A 1GLQA 4MK3A 1OKTA 1PSQA 4IQ1A 1FOHA 2CZ3A 2WB9A 1QK8A 5J9BA 1C72A 1B9YC 2WFCA 2CVDA 1SL1B 3TGZA 2H0IA 4XS1A 4K5RA 1JZRA 2EIRA 3WT2A 1XWBA 4TKYA 1NM3A 1A0FA 3F4SA 2PN8A 5IPGA 3G7YA 3TKSA 2YP6A 5B8AA 2DMLA 3O3TA 4O5QA 4HZ2A 3C7MA 5JCWA 4GTUA 3ED3A 5GZZB 2WDUA 1XIYA 4PXOA 1ML6A 2KHPA 4TVEA 5IM9A 3LSZA 3LYPA 2OA7A 5LD0A 4RQXA 4KA0A 4ICYA 2CZ2A 5HFKA 5ECIB 4EUYA 3C1RA 3ERGA 2MMZA 5IO0A 4EF0A 1NHOA 3DGQA 4BWQA 4YQMA 5ECMB 3MAKA 3UBLA 1K3YA 3IC8A 4DSRA 2MMAA 3I43A 4MZWA 4ZXGA 2YWNA 4F2IA 4POBA 3TDGA 3VWUA 1K0AA 2H70A 5HQPA 3R3EA 3DMLA 3GKMA 2AV4A 4IGJA 3M8NA 2RIIA 4KH7A 3ZIJA 3D4MA 4PURA 4PGTA 2B6MA 1SK0A 1U6TA 4K5SA 3QDNA 5A4WA 1G0TA 5LCZA 2HYXA 2P0GA 1B8XA 1S3DA 5CP1A 3MIXA 3FYGA 3M3MA 1HYUA 3TKQA 4NXIA 5IMAA 1OE8A 5GSTA 1V9WA 1GUMA 3GV1A 1K0CA 2FWGA 4WXTA 4KCEA 4NAXA 4FYBA 5CAXA 1OC3A 3ISOA 1TK8B 2G2QA 4J2FA 2TIRA 1J9BA 3EWLA 2C8UA 2O85A 3CSIA 3ME7A 8GSSA 3FR9A 2P5RA 1U87A 5HR2A 4OO4A 1VGLA 1OVNA 2FGXA 1T1VA 3F8UA 1YDKA 1SK2A 1N2AA 3KGKA 1WWJA 3QMXA 1YZXA 2XPDA 4N30A 5DQSA 1OC9A 2IMFA 2QA1A 5G31A 2YJHA 1GSDA 3F0IA 2P31A 1F9MA 2J9HA 3BBYA 2R3XA 2TRXA 4IHUA 1PL2A 2YWMA 4MF5A 2GTUA 2FWEA 2VCVA 3KTLA 2R2JA 3HZ8A 4H86A 1B9XC 4QQ7A 3US3A 3L9UA 3TJJA 2K18A 1U3AA 1YKCA 2V1MA 4K1FA 1PN9A 3HJOA 1USBA 4MJCA 2L6DA 3KEBA 5BRTA 4MDCA 2IMIA 2DIZA 4V2MA 2I1UA 1SJZA 1FOVA 1YF1A 1BX9A 2RUFA 1WOUA 1Z6NA 3QAVA 1ZZYA 2YV7A 1O6JA 4LA1A 2FUG2 3QCPA 3ZVJD 3LWAA 2IFQA 3LG6A 2A2PA 1PA3A 2L5LA 2LNTA 4JEDA 2HRAA 3GH9A 2HLSA 3D22A 3TB2A 4D73B 2PVOC 4X0XA 4KDUA 1XW9A 4XHMA 1T4YA 5DCHA 3TJBA 2LTKA 4G19A 2AJQB 1SKRB 5ECHB 5J9CA 2H01A 2RLIA 3APSA 4O92A 3D0ZA 2L4QA 3R2QA 2NBSA 4G0IA 2VL2C 10GSA 2QC7A 4KX4A 4O5RA 1PGTA 2VCZA 1NW2A 3LEFA 5DAKB 3UBKA 1JLVA 2B1LA 1ZL9A 4ZILA 5ECOB 1OC8A 4L8EA 1JHBA 1GTAA 3CXGA 2OJLA 3RBTA 1EGRA 4AGSA 3UAPA 2YWOA 5ECRB 2JZSA 1Z5YE 3ZMLA 4TXVA 4PQHA 1GNWA 5ECSA 3WGEA 4MP4A 2PGTA 3WYWA 3FZAA 1RW1A 1SU9A 6GSWA 1O8XA 3ZL5A 3KZQA 2CAQA 1SL0B 1A2JA 4AJ7A 4I2TA 1M2DA 1HD2A 2IMEA 3FZ9A 1VF1A 2R6KA 5DVBA 6GSSA 1PN0A 2YN1A 2VLVA 1TXXA 2B5EA 4EE0A 3A2XA 1SKSB 1HQOA 2IWTA 4L0WA 1TK0B 3IPZA 2G0FA 1SENA 1PX7A 1QFNA 2CAIA 1GP1A 4V2LA 2HI7A 4Z2UA 1ABAA 3HCZA 5D93A 3LGCA 2A4HA 2OBIA 2PBJA 1XCCA 2YANA 3KD0A 5CO3A 2VCXA 3QR6A 3M1GA 4XIHA 3ZTLA 1XZOA 3WD6A 5CNWA 5ECQB 2LRCA 1K0OA 2C1YA 3U5RE 4HZ4A 1T7PB 5KOXA 4BL7A 4QL9A 4MZBA 4KE3A 2ES7A 3H79A 1TKDB 1PMTA 3IK7A 2R0CA 3H4KA 2OE3A 3ZVJA 4K0GA 4TR4A 2H1DA 3F6DA 1SK1A 2KP2A 2V2GA 1XXUA 5G30A 1LBKA 2QGVA 2IPAA 4IELA 1M0UA 2C4JA 2L59A 3UIWA 4MPGA 2VOCA 3UJ1A 2FD3A 2HNLA 3GL5A 3CBUA 4GXZA 5HR3A 3GA4A 2HZEB 3IHGA 3C1SA 2MBSA 3KIJA 1SYRA 2H0GA 3I9V2 1F3BA 3A5WA 4OFNA 3TOUA 5J41A 4EDZA 1MEKA 2MZCA 1EEJA 1GUHA 4ZB8A 1GTUA 2X8CA 4IBPA 1QUWA 4WR5A 2C0GA 2HE3A 3A5IA 3VLNA 4K2XA 2JADA 2H0HA 2V6KA 4EVMA 4E8EA 3ZFLA 4KCAA 3GUSA 3GX0A 3GFKA 5AIVA 3A2WA 1O85A 2YPMA 2PMTA 3I69A 1TDIA 4WF4A 1JLWA 2CQ9A 5DJMA 3HVVA 1GL8A 1AIUA 3APQA 3WGXA 4XS6A 2OKAA 4V1Ap 1QGVA 2GQMA 5HFGA 4AJ6A 4XS4B 4PX1A 2F8FA 1ERTA 3Q18A 1YF0A 1X5EA 4HU9A 4MNNA 3D5JA 1AC1A 2DJ1A 4BL7B 3L78A 4F9ZA 3TKPA 5F07A 1EV9A 2JU5A 4MPFA 2LNSA 4N10A 2GT6A 1VF2A 1I5GA 2I4AA 2B7KA 2ON5A 2P5QA 2GZPA 3SBCA 2NDOA 3DD3A 1Q98A 4PNGA 3KMOA 3LORA 3AY8A 5LNKe 2PPTA 3CSHA 3IK9A 4POMA 2X64A 2LJRA 4I6XA 4ZB9A 1S3AA 3DWVA 6GSUA 5F8BA 3FKFA 1M99A 2JZRA 2VL2A 1K3OA 1UC7A 3GKXA 1AQXA 4MA9A 1AQVA 3DKSA 4TRXA 4YAPA 2ALBA 3NZNA 4DSSA 2GQKA 4I5QA 4OCEA 2NTOA 3KP8A 4ML1A 5KN1A 1EZKA 1K0DA 1TI1A 2N5FA 2XBIA 4GQCA 1W89A 5COHA 1M9BA 2C0DA 4EXJA 1EGOA 17GSA 2I3YA 4ID0A 3G7IA 2K8SA 5H5QA 4AF2A 1V58A 1EEMA 1YEPA 1GSEA 4TR1B 3GH6A 1KTEA 4HI7A 4POKA 1W4VA 3J7Yb 5D9WA 4HOJA 4IJIA 2L6CA 2X4AA 20GSA 5INYA 3F3RA 4MJBA 1YKAA 2DKHA 1XFLA 2HZFA 4ECBA 2LS5A 2IL3A 4BVYA 1ERUA 1NHYA 2VM1A 1A24A 1EP8A 1ZCPA 1THOA 2YCDA 3EMPA 4EC0A 4FIWA 1Y6EA 3MWHA 3MYDA 4MZCA 4IVFA 2LRNA 2YNXA 4HEA2 4FQUA 1O81A 2VCTA 2GZYA 5H5RA 2F51A 2X99A 5DJLA 3HY2A 5G1KA 1UVZA 4RUVA 3FRCA 3LFLA 1TK5B 2MYGA 4DSSB 4WBJA 2VL9A 1TTZA 4ACSA 3KH9A 3TKRA 4ZL7A 1X5DA 1AXDA 4OMVA 4MF7A 1O7UA 4JZQA 2K9FA 1U3IA 2H71A 2XPEA 3A3TA 2JSYA 13GSA 3Q74A 4MLYA 1T8EB 1DBYA 3VK9A 2PU9C 1TRUA 3PH9A 1ON4A 2LKUA 5HFIA 4TXOA 3ZRDA 2GS3A 4NPBA 5AIXA 1MDIA 4TR3A 5IMZA 3FW2A 1M9AA 5JWQB 7GSSA 1M2AA 6GSVA 4OFTA 3N5OA 2CVKA 4MJAA 5EPFA 2ZNMA 1F37A 3O6TA 6GSYA 2VM2A 5GSSA 4BPYA 4BVYB 1OYJA 3O76A 2DMMA 4LMWA 4F0BA 3E0UA 3MNGA 1KBNA 2GVPA 3F6FA 1R7HA 3DYRA 1UN2A 1FO5A 4Z7XA 4ILFA 3F9UA 2RM5A 4JE1A 2I9HA 5ELAA 1QMVA 5B6MA 1H4OA 3FEUA 1BG5A 1J08A 4CY6A 5D9TA 9GSSA 4NHWA 1XWKA 2Z9SA 2JSZA 4Z2RA 5G2ZA 3BD2A 5HR0A 5J5NA 5F0GA 3ME8A 1SD9A 4IP1A 2OADA 3IHQA 3CTGA 4KNDA 2H76A 4G0LA 2H75A 3VI7A 3F3QA 1X9WB 4KF9A 4OWYA 3FMWA 4WKWA 1A23A 3FZ5A 3C8EA 3HYPA 5KEJA 3HVSA 3Q6OA 2LRTA 2BTOT 2GSTA 2L57A 2MMNA 2YV9A 3TRXA 4JR6A 2DJ3A 2LQQA 11GSA 3IOSA 1F2EA 1WRYA 1EOGA 3DVXA 1ILOA 4Z2TA 2WJUA 3PPUA 1ST9A 2IJYA 1U88A 2DJKA 1OC9B 2X8GA 2B3SA 1PKZA 2E2GA 1XPVA 1ERWA 2DLXA 3LYKA 5ID2A 4HU7A 3IE3A 2V32A 2LQOA 1ZYEA 5B6NA 1JFUA 4PQIA 1DSBA 19GSA 1TI3A 4OCFA 4KB3A 5CREA 5J4UA 3EE2A 4KSOA 2KP1A 3K8NA 2VUPA 2LUSA 2HXKA 1SYXA 4N0VA 4CHSA 3GSTA 4CDOA 2B5YA 4ZBDA 4DSQA 3A2VA 5KN0A 1E6BA 5JWRB 4N0ZA 1T3BA 1RQMA 4L5OA 3IBHA 2DJJA 1TU8A 5CRDA 4Q5RA 2MBTA 2PUKC 2WZ9A 1VF3A 4KGIA 2QSIA 2OBKA 2IFQB 4V2NA 5IIZA 5EY6A 4PTSA 1GRXA 4XCSA 1XWGA 5DQYA 2H66A 4IN0A 4PUAA 3IR4A 1GNEA 4Q5NA 2HRKA 2FWFA 3CMIA 3ZIVA 2LV3A 3VWWA 1SD8A 2R4VA 3KJYA 1GSYA 2HFDA 1MD4A 1K3LA 2AHEA 2GSSA 3GTUA 2CT6A 1ZYNA 1K0NA 1GUKA 5ECNB 2VCWA 5DALA 2OE0A 2VLTA 3D4TA 5ID2B 2LJAA 1T00A 2O8VB 3KCMA 4WETA 1GLPA 4K6XA 3DVWA 1R26A 2R37A 22GSA 4K8MA 2XHFA 3HKRA 4K7NA 3IC4A 5D73A 4NWYA 1FB6A 4EIQA 2WGRA 5A4VA 2ZUPA 4YQUA 4ZIJA 2WCIA 3KM6A 1VRSD 2H6ZA 2IMDA 2H72A 1T4ZA 4DVCA 3TOTA 5IMVA 1EV4A 16GSA 1A8LA 1FAAA 4YKGA 2UZ8A 4JR4A 2ON7A 1ZYQB 1HNBA 2E2MA 4USSA 3QAGA 4BVXA 3HA9A 3LQ7A 4E8HA 4RI7A 1XOBA 2QKEA 4EDYA 1M2BA 3HJMA 4OFMA 3APOA 2H1BA 4IQAA 1JZOA 2VD1A 4MJEA 2L4CA 5C04A 4J57E 5F06A 3FR3A 1HNCA 4TR0A 4IP6A 4F03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FVJ A;  4ECI A;  3LXT A;  5GAN D;  5CRG A;  2EIQ A;  1G6Y A;  4ZBB A;  3SWL A;  4K2D A;  1BYE A;  4TN8 A;  1AUC A;  5DAL B;  2D2Z A;  4CW9 A;  1TRV A;  1XVQ A;  4HJM A;  3DIE A;  1GTB A;  2H73 A;  2NPB A;  4RQR A;  2FA8 A;  5C00 A;  2H30 A;  3RPP A;  2GT5 A;  4OO5 A;  3KP9 A;  2A2R A;  2CA8 A;  2B7J A;  5G5E A;  2YJ7 A;  1K0B A;  2DC5 A;  3KXO A;  5FWG A;  1F3A A;  1O8W A;  1YJ6 A;  3D6I A;  4YH2 A;  2WUL A;  3VI5 A;  5L71 A;  3P7X A;  2GSQ A;  2EIO A;  1MD3 A;  2B1K A;  2X8H A;  2FHE A;  3NIV A;  3CTF A;  6GSX A;  4HUA A;  3TUE A;  2K6V A;  1G7O A;  1YQ1 A;  4KUN A;  2DJ2 A;  2JL4 A;  4XTS A;  2C0F A;  1XBS A;  3P2A A;  1AAZ A;  3ZMK A;  1TW9 A;  3RHB A;  1WIK A;  1H75 A;  4X43 A;  5D9X A;  2CX3 A;  3Q19 A;  3VWV A;  1UA5 A;  3GRX A;  4ZBA A;  2V6O A;  2AYT A;  1QQ2 A;  2AAW A;  4FYU A;  5AN1 A;  3TJK A;  3KTB A;  1X0R A;  1X5C A;  3CRT A;  5KN2 A;  3EUR A;  2HRN A;  1A2M A;  4GWR A;  3C71 A;  1Z9H A;  1G7E A;  3EC3 A;  1PL1 A;  2VLU A;  2N5B A;  3V1W A;  3ERF A;  3TRQ A;  3GMF A;  3G9B A;  3HHV A;  4GLT A;  1IYH A;  4MCU A;  1TOF A;  2C3Q A;  4LL1 B;  1V98 A;  1IYI A;  2KOK A;  4KW6 A;  2VD0 A;  3GSS A;  1SL2 B;  2H19 A;  3P8W A;  4JU5 A;  1FHE A;  4LL4 B;  1LJR A;  3H8Q A;  2AUV A;  1O73 A;  2H8L A;  4FH8 A;  2A4V A;  4RI6 A;  2CX4 A;  5IMC A;  4IS0 A;  4WEY A;  3M0F A;  1VF4 A;  4YAV A;  2FCH A;  1FW1 A;  5IQY A;  5H5S A;  3KH7 A;  5F05 A;  3TKS E;  2WS2 A;  3RPN A;  3U6V A;  5CRH A;  1DE2 A;  4WR4 A;  1WE0 A;  2PER A;  2E0Q A;  5A4U A;  2YZH A;  2CV4 A;  5IO2 A;  2FLS A;  3HVX A;  1BED A;  1FG4 A;  2BMX A;  2F3M A;  4NHZ A;  4JRR A;  1RK4 A;  2OE1 A;  1DE1 A;  2KLX A;  4ZB6 A;  4I2U A;  3M9J A;  4GSN A;  4Q5F A;  2XBQ A;  3GKN A;  3GYK A;  4NV5 A;  5ELG A;  2BJX A;  2C0E A;  1WMJ A;  3BOA A;  3TCO A;  2NVL A;  2DBC A;  1BAY A;  2LEG A;  4O7H A;  3IRA A;  3ZRE A;  3VFI A;  3BCI A;  3MDK A;  3GNJ A;  14GS A;  4G10 A;  3L9S A;  1M7T A;  4POL A;  3UAR A;  2I81 A;  1GH2 A;  2M80 A;  1AQW A;  4ZL8 A;  4NMU A;  1PKW A;  2GGT A;  4GSS A;  3JCM L;  1V2A A;  4JBB A;  1OE7 A;  4IJ3 A;  1EP7 A;  3UVH A;  4ECC A;  1S3C A;  1AW9 A;  3IV4 A;  1K0M A;  1WP0 A;  5IOX A;  1LU4 A;  2L5O A;  1HNA A;  1ZMA A;  3H1N A;  1A8Y A;  2IIY A;  2H1G A;  1GSQ A;  1V40 A;  3L9V A;  2C3T A;  2R5G A;  4GF0 A;  1E2Y A;  5A5K A;  3DEX A;  3EU4 A;  1XOA A;  1NSW A;  4HJ2 A;  5D96 A;  5DCG A;  4MAB A;  4D73 A;  3EIN A;  5DDL A;  3IA1 A;  4LLR A;  12GS A;  3UMA A;  4L5L A;  3GN3 A;  3RDW A;  2H1A A;  3I6A A;  2B5X A;  5IPH A;  5AIS A;  2GLR A;  3PR8 A;  5JCU A;  4BWS A;  1B48 A;  1EOH A;  1SJI A;  1URM A;  3CYN A;  1B4Q A;  1CQH A;  2FWH A;  2PVQ A;  4ZL9 A;  5EVO A;  1XW6 A;  5EL8 A;  1XVW A;  3UOM A;  3S9F A;  5D8I A;  3N9J A;  5IMD A;  5DAK A;  3ZZX A;  1PQN A;  3FZ4 A;  18GS A;  2H74 A;  4IKH A;  3VWX A;  2A2S A;  2GDR A;  3CSJ A;  3QPM A;  2DSA A;  1JZD A;  2IMK A;  1V57 A;  4TOP A;  5E4W A;  3BJ5 A;  4HDE A;  1OKD A;  1MTC A;  1QXH A;  1YY7 A;  3EMX A;  3F4R A;  5B7C A;  2RUE A;  4L0U A;  4K7O A;  3DRN A;  1CQG A;  1WPI A;  1THX A;  2FY6 A;  3HXS A;  4NV2 A;  2HSH A;  4TXO B;  3GHA A;  4AJ8 A;  4KAE A;  2C80 A;  3W8J A;  5GAP D;  4YQV A;  3QFB C;  1ACV A;  2AB6 A;  3ZLP A;  3DXB A;  4F0C A;  3VPT A;  2HRF A;  3ZFB A;  4HQZ A;  3QOU A;  4XRA A;  1EWX A;  3GIX A;  3LXZ A;  3F4T A;  4BA7 A;  1GSS A;  1G6W A;  3RHC A;  1GSU A;  2HSY A;  1A2L A;  4KSM A;  2RM6 A;  1ZGN A;  4FYC A;  4HQS A;  4MMM A;  3BCK A;  2GQL A;  4V1A g;  2GZZ A;  4G9H A;  2VIM A;  2HT9 A;  3UEM A;  1KNG A;  1YEX A;  4GRF A;  3TKS C;  4GQF A;  3QFA C;  3G7J A;  3LJR A;  3W6G A;  3FR6 A;  4I8B A;  4O32 A;  3PGT A;  2VO4 A;  1F6M C;  4MH3 A;  4ULX A;  1R5A A;  1SKW B;  3D21 A;  3TJF A;  2FA4 A;  2VCQ A;  1Q4J A;  2JAC A;  3FHK A;  2JZT A;  4ISD A;  1TP9 A;  1GUL A;  4GST A;  1KEB A;  2DIY A;  4ML6 A;  3IXR A;  1GTI A;  4Q5Q A;  2VAF A;  4EKZ A;  2WRT A;  2CVB A;  5G1L A;  5IMF A;  4MH2 A;  3KMN A;  1Z3E A;  2LJK A;  1R4W A;  3EU3 A;  5CRW A;  2HZE A;  4HS1 A;  1Z7P A;  3MSZ A;  3ZIT A;  3TRP A;  2OAC A;  1XWA A;  5AGY A;  1TRS A;  2F8A A;  5ABR A;  1I9D A;  4P3Y B;  4GCI A;  1TU7 A;  3CRU A;  1BQ7 A;  5E59 A;  3H93 A;  1OAZ A;  3EVI A;  5D9V A;  3GL3 A;  4MF6 A;  1JZW A;  3J7Y k;  2O7K A;  3WGD A;  2EC4 A;  3EYT A;  1Y25 A;  2XC2 A;  1Z7R A;  3RAZ A;  5ECK B;  5FHI A;  1R5P A;  1X9S B;  2H6X A;  4XS4 A;  4N11 A;  2PWJ A;  1N8J A;  3TJG A;  1X9M B;  1XW5 A;  1SJ6 A;  4OD7 A;  4PNF A;  1FB0 A;  3WT1 A;  3FY7 A;  4I97 A;  3NOF A;  5JWO B;  2V41 A;  3HZ4 A;  1BJX A;  4J56 E;  5J3R A;  1DUG A;  5B8B A;  5HR1 A;  3VUR A;  5FT3 A;  2E7P A;  4FO5 A;  1GSF A;  4WF5 A;  5ECL B;  3GUR A;  3QD9 A;  3UVT A;  5DBQ A;  5G5F A;  1FVK A;  1ZOF A;  2GSR A;  3GTU B;  3IAS 2;  3IAM 2;  2F9S A;  1A0R P;  3L4N A;  1GWC A;  4K0N A;  1PD2 1;  1PX6 A;  2K8V A;  4LMV A;  4EL1 A;  2KUC A;  5IOW A;  4EO3 A;  3F63 A;  2ZCT A;  4PUF C;  3HDC A;  3W8S A;  5ECP B;  4ECJ A;  1TJD A;  5KN3 A;  2FNO A;  2YWI A;  3ZYW A;  1WJK A;  4QL7 A;  4K9Z A;  2H6Y A;  2YZU A;  2N5A A;  3ERW A;  4K7I A;  4WBR D;  2M72 A;  2VL3 A;  5CYY A;  3HD5 A;  3L0H A;  1B4P A;  3GKK A;  2YOI A;  3VPQ A;  3OR5 A;  4G2E A;  2MMO A;  4KDY A;  4F82 A;  3PIN A;  2M46 A;  5ENU A;  2DJ0 A;  2O89 A;  2IN3 A;  2O87 A;  3QAW A;  1XWC A;  4TR1 A;  4IW9 A;  3GX8 A;  4PQ1 A;  2REM A;  1J0F A;  1Z6M A;  3IDV A;  4KDX A;  3M9K A;  3FK8 A;  3E3E A;  4X1U A;  3E9J B;  3UL3 A;  3C73 A;  6GST A;  4XRD A;  1ERV A;  2J23 A;  2TRC P;  4TW5 A;  3HJP A;  5JCG A;  1MDJ A;  2C3N A;  1MDK A;  1TRW A;  2LST A;  4DEJ A;  1PRX A;  3P90 A;  1GLQ A;  4MK3 A;  1OKT A;  1PSQ A;  4IQ1 A;  2CZ3 A;  2WB9 A;  1QK8 A;  5J9B A;  1C72 A;  1B9Y C;  2WFC A;  2CVD A;  1SL1 B;  3TGZ A;  2H0I A;  4XS1 A;  1JZR A;  2EIR A;  3WT2 A;  1XWB A;  4TKY A;  1NM3 A;  1A0F A;  3F4S A;  2PN8 A;  5IPG A;  3G7Y A;  3TKS A;  2YP6 A;  5B8A A;  2DML A;  3O3T A;  4HZ2 A;  3C7M A;  5JCW A;  4GTU A;  3ED3 A;  5GZZ B;  2WDU A;  1XIY A;  4PXO A;  1ML6 A;  2KHP A;  4TVE A;  5IM9 A;  3LSZ A;  3LYP A;  2OA7 A;  5LD0 A;  4RQX A;  4KA0 A;  2CZ2 A;  5HFK A;  5ECI B;  4EUY A;  3C1R A;  3ERG A;  2MMZ A;  5IO0 A;  4EF0 A;  1NHO A;  3DGQ A;  4BWQ A;  4YQM A;  5ECM B;  3MAK A;  3UBL A;  1K3Y A;  4DSR A;  2MMA A;  3I43 A;  4MZW A;  4ZXG A;  2YWN A;  4F2I A;  4POB A;  3TDG A;  3VWU A;  1K0A A;  2H70 A;  5HQP A;  3DML A;  3GKM A;  2AV4 A;  4IGJ A;  3M8N A;  2RII A;  4KH7 A;  3ZIJ A;  3D4M A;  4PUR A;  4PGT A;  2B6M A;  1SK0 A;  1U6T A;  5A4W A;  3QDN A;  1G0T A;  5LCZ A;  2HYX A;  2P0G A;  1B8X A;  1S3D A;  5CP1 A;  3FYG A;  3M3M A;  1HYU A;  3TKQ A;  4NXI A;  5IMA A;  1OE8 A;  5GST A;  1V9W A;  1GUM A;  3GV1 A;  1K0C A;  2FWG A;  4WXT A;  4KCE A;  4NAX A;  4FYB A;  5CAX A;  1OC3 A;  3ISO A;  1TK8 B;  2G2Q A;  4J2F A;  2TIR A;  1J9B A;  3EWL A;  2C8U A;  2O85 A;  3CSI A;  3ME7 A;  8GSS A;  3FR9 A;  2P5R A;  1U87 A;  5HR2 A;  4OO4 A;  1VGL A;  1OVN A;  2FGX A;  1T1V A;  3F8U A;  1YDK A;  1SK2 A;  1N2A A;  3KGK A;  1WWJ A;  3QMX A;  1YZX A;  2XPD A;  4N30 A;  5DQS A;  1OC9 A;  2IMF A;  5G31 A;  2YJH A;  1GSD A;  3F0I A;  2P31 A;  1F9M A;  2J9H A;  3BBY A;  2R3X A;  2TRX A;  4IHU A;  1PL2 A;  2YWM A;  4MF5 A;  2GTU A;  2FWE A;  2VCV A;  3KTL A;  2R2J A;  3HZ8 A;  4H86 A;  1B9X C;  4QQ7 A;  3US3 A;  3L9U A;  3TJJ A;  2K18 A;  1U3A A;  1YKC A;  2V1M A;  4K1F A;  1PN9 A;  3HJO A;  1USB A;  4MJC A;  2L6D A;  3KEB A;  4MDC A;  2IMI A;  2DIZ A;  4V2M A;  2I1U A;  1SJZ A;  1FOV A;  1YF1 A;  1BX9 A;  2RUF A;  1WOU A;  1Z6N A;  3QAV A;  1ZZY A;  2YV7 A;  1O6J A;  4LA1 A;  2FUG 2;  3QCP A;  3ZVJ D;  3LWA A;  2IFQ A;  3LG6 A;  1PA3 A;  2L5L A;  2LNT A;  4JED A;  3GH9 A;  2HLS A;  3D22 A;  3TB2 A;  4D73 B;  2PVO C;  4X0X A;  4KDU A;  1XW9 A;  4XHM A;  1T4Y A;  5DCH A;  3TJB A;  2LTK A;  4G19 A;  2AJQ B;  1SKR B;  5ECH B;  5J9C A;  2H01 A;  2RLI A;  3APS A;  4O92 A;  3D0Z A;  2L4Q A;  3R2Q A;  2NBS A;  2VL2 C;  10GS A;  2QC7 A;  4KX4 A;  4O5R A;  1PGT A;  2VCZ A;  1NW2 A;  3LEF A;  5DAK B;  3UBK A;  1JLV A;  2B1L A;  1ZL9 A;  4ZIL A;  5ECO B;  1OC8 A;  4L8E A;  1JHB A;  1GTA A;  3CXG A;  2OJL A;  3RBT A;  1EGR A;  4AGS A;  3UAP A;  2YWO A;  5ECR B;  2JZS A;  1Z5Y E;  3ZML A;  4TXV A;  4PQH A;  1GNW A;  5ECS A;  3WGE A;  4MP4 A;  2PGT A;  3WYW A;  3FZA A;  1RW1 A;  1SU9 A;  6GSW A;  1O8X A;  3ZL5 A;  3KZQ A;  2CAQ A;  1SL0 B;  1A2J A;  4AJ7 A;  4I2T A;  1M2D A;  1HD2 A;  2IME A;  3FZ9 A;  1VF1 A;  2R6K A;  5DVB A;  6GSS A;  2YN1 A;  2VLV A;  1TXX A;  2B5E A;  4EE0 A;  3A2X A;  1SKS B;  1HQO A;  2IWT A;  4L0W A;  1TK0 B;  3IPZ A;  2G0F A;  1SEN A;  1PX7 A;  1QFN A;  2CAI A;  1GP1 A;  4V2L A;  2HI7 A;  1ABA A;  3HCZ A;  5D93 A;  3LGC A;  2OBI A;  2PBJ A;  1XCC A;  2YAN A;  3KD0 A;  5CO3 A;  2VCX A;  3QR6 A;  3M1G A;  4XIH A;  3ZTL A;  1XZO A;  3WD6 A;  5CNW A;  5ECQ B;  2LRC A;  1K0O A;  2C1Y A;  3U5R E;  4HZ4 A;  1T7P B;  4BL7 A;  4QL9 A;  4MZB A;  4KE3 A;  2ES7 A;  3H79 A;  1TKD B;  1PMT A;  3IK7 A;  3H4K A;  2OE3 A;  3ZVJ A;  4K0G A;  4TR4 A;  2H1D A;  3F6D A;  1SK1 A;  2KP2 A;  2V2G A;  1XXU A;  5G30 A;  1LBK A;  2QGV A;  2IPA A;  4IEL A;  1M0U A;  2C4J A;  2L59 A;  3UIW A;  4MPG A;  2VOC A;  3UJ1 A;  2FD3 A;  2HNL A;  3GL5 A;  3CBU A;  4GXZ A;  5HR3 A;  3GA4 A;  2HZE B;  3C1S A;  2MBS A;  3KIJ A;  1SYR A;  2H0G A;  3I9V 2;  1F3B A;  3A5W A;  4OFN A;  3TOU A;  5J41 A;  4EDZ A;  1MEK A;  2MZC A;  1EEJ A;  1GUH A;  4ZB8 A;  1GTU A;  2X8C A;  4IBP A;  1QUW A;  4WR5 A;  2C0G A;  2HE3 A;  3VLN A;  2JAD A;  2H0H A;  2V6K A;  4EVM A;  4E8E A;  3ZFL A;  4KCA A;  3GUS A;  3GX0 A;  3GFK A;  5AIV A;  3A2W A;  1O85 A;  2YPM A;  2PMT A;  3I69 A;  1TDI A;  4WF4 A;  1JLW A;  2CQ9 A;  5DJM A;  3HVV A;  1GL8 A;  1AIU A;  3APQ A;  3WGX A;  4XS6 A;  2OKA A;  4V1A p;  1QGV A;  2GQM A;  5HFG A;  4AJ6 A;  4XS4 B;  4PX1 A;  2F8F A;  1ERT A;  3Q18 A;  1YF0 A;  1X5E A;  4HU9 A;  3D5J A;  1AC1 A;  2DJ1 A;  3L78 A;  4F9Z A;  3TKP A;  5F07 A;  1EV9 A;  2JU5 A;  4MPF A;  2LNS A;  4N10 A;  2GT6 A;  1VF2 A;  1I5G A;  2I4A A;  2B7K A;  2ON5 A;  2P5Q A;  2GZP A;  3SBC A;  2NDO A;  3DD3 A;  1Q98 A;  4PNG A;  3KMO A;  3LOR A;  3AY8 A;  5LNK e;  2PPT A;  3CSH A;  3IK9 A;  4POM A;  2X64 A;  2LJR A;  4I6X A;  4ZB9 A;  1S3A A;  3DWV A;  6GSU A;  5F8B A;  3FKF A;  1M99 A;  2JZR A;  2VL2 A;  1K3O A;  1UC7 A;  3GKX A;  1AQX A;  4MA9 A;  1AQV A;  3DKS A;  4TRX A;  4YAP A;  2ALB A;  3NZN A;  4DSS A;  2GQK A;  4I5Q A;  4OCE A;  2NTO A;  3KP8 A;  4ML1 A;  5KN1 A;  1EZK A;  1K0D A;  1TI1 A;  2N5F A;  2XBI A;  4GQC A;  1W89 A;  5COH A;  1M9B A;  2C0D A;  4EXJ A;  1EGO A;  17GS A;  2I3Y A;  4ID0 A;  3G7I A;  2K8S A;  5H5Q A;  4AF2 A;  1V58 A;  1EEM A;  1YEP A;  1GSE A;  4TR1 B;  3GH6 A;  1KTE A;  4HI7 A;  4POK A;  1W4V A;  3J7Y b;  5D9W A;  4HOJ A;  4IJI A;  2L6C A;  20GS A;  5INY A;  3F3R A;  4MJB A;  1YKA A;  1XFL A;  2HZF A;  4ECB A;  2LS5 A;  2IL3 A;  4BVY A;  1ERU A;  1NHY A;  2VM1 A;  1A24 A;  1EP8 A;  1ZCP A;  1THO A;  2YCD A;  3EMP A;  4EC0 A;  4FIW A;  1Y6E A;  3MWH A;  4MZC A;  4IVF A;  2LRN A;  2YNX A;  4HEA 2;  1O81 A;  2VCT A;  2GZY A;  5H5R A;  2F51 A;  2X99 A;  5DJL A;  3HY2 A;  5G1K A;  1UVZ A;  4RUV A;  3FRC A;  3LFL A;  1TK5 B;  2MYG A;  4DSS B;  4WBJ A;  2VL9 A;  1TTZ A;  4ACS A;  3KH9 A;  3TKR A;  4ZL7 A;  1X5D A;  1AXD A;  4OMV A;  4MF7 A;  1O7U A;  4JZQ A;  2K9F A;  1U3I A;  2H71 A;  2XPE A;  3A3T A;  2JSY A;  13GS A;  3Q74 A;  4MLY A;  1T8E B;  1DBY A;  3VK9 A;  2PU9 C;  1TRU A;  3PH9 A;  1ON4 A;  2LKU A;  5HFI A;  4TXO A;  3ZRD A;  2GS3 A;  4NPB A;  5AIX A;  1MDI A;  4TR3 A;  5IMZ A;  3FW2 A;  1M9A A;  5JWQ B;  7GSS A;  1M2A A;  6GSV A;  4OFT A;  3N5O A;  2CVK A;  4MJA A;  5EPF A;  2ZNM A;  1F37 A;  3O6T A;  6GSY A;  2VM2 A;  5GSS A;  4BPY A;  1OYJ A;  3O76 A;  2DMM A;  4LMW A;  4F0B A;  3E0U A;  3MNG A;  1KBN A;  2GVP A;  3F6F A;  1R7H A;  3DYR A;  1UN2 A;  1FO5 A;  4Z7X A;  4ILF A;  3F9U A;  2RM5 A;  4JE1 A;  2I9H A;  5ELA A;  1QMV A;  5B6M A;  1H4O A;  3FEU A;  1BG5 A;  1J08 A;  5D9T A;  9GSS A;  4NHW A;  1XWK A;  2Z9S A;  2JSZ A;  5G2Z A;  3BD2 A;  5HR0 A;  5J5N A;  5F0G A;  3ME8 A;  1SD9 A;  4IP1 A;  2OAD A;  3IHQ A;  3CTG A;  4KND A;  2H76 A;  2H75 A;  3VI7 A;  3F3Q A;  1X9W B;  4OWY A;  4WKW A;  1A23 A;  3FZ5 A;  3C8E A;  3HYP A;  5KEJ A;  3HVS A;  3Q6O A;  2LRT A;  2BTO T;  2GST A;  2L57 A;  2MMN A;  2YV9 A;  3TRX A;  4JR6 A;  2DJ3 A;  2LQQ A;  11GS A;  3IOS A;  1F2E A;  1WRY A;  1EOG A;  3DVX A;  1ILO A;  2WJU A;  1ST9 A;  2IJY A;  1U88 A;  2DJK A;  1OC9 B;  2X8G A;  2B3S A;  1PKZ A;  2E2G A;  1XPV A;  1ERW A;  2DLX A;  3LYK A;  5ID2 A;  4HU7 A;  3IE3 A;  2V32 A;  2LQO A;  1ZYE A;  5B6N A;  1JFU A;  4PQI A;  1DSB A;  19GS A;  1TI3 A;  4OCF A;  4KB3 A;  5CRE A;  5J4U A;  3EE2 A;  4KSO A;  2KP1 A;  3K8N A;  2VUP A;  2LUS A;  2HXK A;  1SYX A;  4N0V A;  4CHS A;  3GST A;  4CDO A;  2B5Y A;  4ZBD A;  4DSQ A;  3A2V A;  5KN0 A;  1E6B A;  5JWR B;  4N0Z A;  1T3B A;  1RQM A;  4L5O A;  3IBH A;  2DJJ A;  1TU8 A;  5CRD A;  4Q5R A;  2MBT A;  2PUK C;  2WZ9 A;  1VF3 A;  4KGI A;  2QSI A;  2OBK A;  2IFQ B;  4V2N A;  5IIZ A;  5EY6 A;  1GRX A;  4XCS A;  1XWG A;  5DQY A;  2H66 A;  4IN0 A;  4PUA A;  3IR4 A;  1GNE A;  4Q5N A;  2FWF A;  3CMI A;  3ZIV A;  2LV3 A;  3VWW A;  1SD8 A;  2R4V A;  3KJY A;  1GSY A;  2HFD A;  1MD4 A;  1K3L A;  2AHE A;  2GSS A;  3GTU A;  2CT6 A;  1K0N A;  1GUK A;  5ECN B;  2VCW A;  5DAL A;  2OE0 A;  2VLT A;  3D4T A;  5ID2 B;  2LJA A;  1T00 A;  2O8V B;  3KCM A;  4WET A;  1GLP A;  4K6X A;  3DVW A;  1R26 A;  2R37 A;  22GS A;  4K8M A;  2XHF A;  3HKR A;  4K7N A;  3IC4 A;  5D73 A;  4NWY A;  1FB6 A;  2WGR A;  5A4V A;  2ZUP A;  4YQU A;  4ZIJ A;  2WCI A;  3KM6 A;  1VRS D;  2H6Z A;  2IMD A;  2H72 A;  1T4Z A;  4DVC A;  3TOT A;  5IMV A;  1EV4 A;  16GS A;  1A8L A;  1FAA A;  4JR4 A;  2ON7 A;  1ZYQ B;  1HNB A;  2E2M A;  3QAG A;  4BVX A;  3HA9 A;  3LQ7 A;  4E8H A;  4RI7 A;  1XOB A;  2QKE A;  4EDY A;  1M2B A;  3HJM A;  4OFM A;  3APO A;  2H1B A;  4IQA A;  1JZO A;  2VD1 A;  4MJE A;  2L4C A;  5C04 A;  4J57 E;  5F06 A;  3FR3 A;  1HNC A;  4TR0 A;  4IP6 A;  4F03 A; 
#chains in the Genus database with same CATH topology
 1FVJ A;  4ECI A;  3LXT A;  5GAN D;  5CRG A;  2EIQ A;  1G6Y A;  4ZBB A;  3SWL A;  3LW9 A;  4K2D A;  1BYE A;  4TN8 A;  2HSM A;  1AUC A;  5DAL B;  2D2Z A;  4CW9 A;  1TRV A;  1XVQ A;  4HJM A;  3DIE A;  1GTB A;  2H73 A;  2NPB A;  4RQR A;  2FA8 A;  5C00 A;  2H30 A;  3RPP A;  2GT5 A;  4OO5 A;  3KP9 A;  2A2R A;  2CA8 A;  2B7J A;  5G5E A;  2YJ7 A;  1K0B A;  2DC5 A;  3KXO A;  5FWG A;  1F3A A;  1O8W A;  1YJ6 A;  3D6I A;  4YH2 A;  2WUL A;  3VI5 A;  5L71 A;  3P7X A;  2GSQ A;  2EIO A;  1MD3 A;  2B1K A;  2X8H A;  2FHE A;  3NIV A;  3CTF A;  6GSX A;  4HUA A;  3TUE A;  2K6V A;  1G7O A;  1YQ1 A;  4KUN A;  2DJ2 A;  2JL4 A;  4XTS A;  2C0F A;  1XBS A;  3P2A A;  1AAZ A;  3ZMK A;  1TW9 A;  3RHB A;  1WIK A;  1H75 A;  4X43 A;  5D9X A;  2CX3 A;  3Q19 A;  3VWV A;  1UA5 A;  3GRX A;  4ZBA A;  2V6O A;  3HVN A;  2AYT A;  1QQ2 A;  2AAW A;  4FYU A;  5AN1 A;  3TJK A;  3KTB A;  1X0R A;  1X5C A;  3CRT A;  5KN2 A;  3EUR A;  2HRN A;  1A2M A;  4GWR A;  3C71 A;  1Z9H A;  1G7E A;  3EC3 A;  1PL1 A;  2VLU A;  2N5B A;  3V1W A;  3ERF A;  3TRQ A;  3GMF A;  3G9B A;  3HHV A;  4GLT A;  1IYH A;  4MCU A;  1TOF A;  2C3Q A;  4LL1 B;  1V98 A;  1IYI A;  2KOK A;  4KW6 A;  2VD0 A;  3GSS A;  1SL2 B;  2H19 A;  3P8W A;  4JU5 A;  1FHE A;  4LL4 B;  1LJR A;  3H8Q A;  2AUV A;  1O73 A;  2H8L A;  4FH8 A;  2A4V A;  4RI6 A;  2CX4 A;  5IMC A;  4IS0 A;  4WEY A;  3M0F A;  1VF4 A;  4YAV A;  2FCH A;  1FW1 A;  5IQY A;  5H5S A;  5KOW A;  3KH7 A;  5F05 A;  3TKS E;  2WS2 A;  3RPN A;  3U6V A;  5CRH A;  1DE2 A;  5BMU A;  4WR4 A;  1WE0 A;  2PER A;  2E0Q A;  5A4U A;  2YZH A;  2CV4 A;  5IO2 A;  2FLS A;  3HVX A;  1BED A;  1FG4 A;  2BMX A;  2F3M A;  4NHZ A;  4JRR A;  1RK4 A;  2OE1 A;  1DE1 A;  2KLX A;  4ZB6 A;  4I2U A;  3M9J A;  4GSN A;  4Q5F A;  2XBQ A;  3GKN A;  3GYK A;  4NV5 A;  5ELG A;  2BJX A;  2C0E A;  1WMJ A;  3BOA A;  3TCO A;  2NVL A;  2DBC A;  4X4J A;  1BAY A;  2LEG A;  4O7H A;  3IRA A;  3ZRE A;  3VFI A;  3BCI A;  3MDK A;  3GNJ A;  14GS A;  4G10 A;  3L9S A;  1M7T A;  4POL A;  3UAR A;  2I81 A;  1GH2 A;  2M80 A;  1AQW A;  4ZL8 A;  4NMU A;  1PKW A;  2GGT A;  4GSS A;  3JCM L;  1V2A A;  4JBB A;  1OE7 A;  4IJ3 A;  1EP7 A;  3UVH A;  4ECC A;  1S3C A;  1AW9 A;  3IV4 A;  1K0M A;  1WP0 A;  5IOX A;  1LU4 A;  2L5O A;  1HNA A;  1ZMA A;  3H1N A;  1A8Y A;  2IIY A;  2H1G A;  1GSQ A;  1V40 A;  3L9V A;  2C3T A;  2R5G A;  4GF0 A;  1E2Y A;  5A5K A;  3DEX A;  3EU4 A;  1XOA A;  1NSW A;  4HJ2 A;  5D96 A;  5DCG A;  4MAB A;  4D73 A;  3EIN A;  5DDL A;  3IA1 A;  4LLR A;  12GS A;  3UMA A;  4L5L A;  3GN3 A;  3RDW A;  2H1A A;  3I6A A;  2B5X A;  5IPH A;  5AIS A;  2GLR A;  3PR8 A;  5JCU A;  4BWS A;  1B48 A;  1EOH A;  1SJI A;  1URM A;  3CYN A;  1B4Q A;  1CQH A;  2FWH A;  2PVQ A;  4ZL9 A;  5EVO A;  1XW6 A;  5EL8 A;  1XVW A;  3UOM A;  3S9F A;  5D8I A;  3N9J A;  5IMD A;  5DAK A;  3ZZX A;  1PQN A;  3FZ4 A;  18GS A;  2H74 A;  4IKH A;  3VWX A;  2A2S A;  2GDR A;  3CSJ A;  3QPM A;  4O5U A;  2DSA A;  1JZD A;  2IMK A;  1V57 A;  4TOP A;  5E4W A;  3BJ5 A;  4HDE A;  1OKD A;  1MTC A;  1QXH A;  1YY7 A;  3EMX A;  3F4R A;  5B7C A;  2RUE A;  4L0U A;  4K7O A;  3DRN A;  1CQG A;  1WPI A;  1THX A;  2FY6 A;  3HXS A;  4NV2 A;  2HSH A;  4TXO B;  3GHA A;  4AJ8 A;  4KAE A;  2C80 A;  3W8J A;  5GAP D;  4YQV A;  3QFB C;  4YKF A;  1ACV A;  2AB6 A;  3ZLP A;  3DXB A;  4F0C A;  3VPT A;  2HRF A;  3ZFB A;  4HQZ A;  3QOU A;  4XRA A;  1EWX A;  3GIX A;  3LXZ A;  3F4T A;  4BA7 A;  1GSS A;  1G6W A;  3RHC A;  1GSU A;  2HSY A;  1A2L A;  4KSM A;  2RM6 A;  1ZGN A;  4FYC A;  4HQS A;  4MMM A;  3BCK A;  2GQL A;  2DKI A;  4V1A g;  2GZZ A;  4G9H A;  2VIM A;  2HT9 A;  2X49 A;  3UEM A;  1KNG A;  1YEX A;  4GRF A;  3TKS C;  4GQF A;  3QFA C;  3G7J A;  3LJR A;  1ZYP A;  3W6G A;  3FR6 A;  4I8B A;  4O32 A;  3PGT A;  2VO4 A;  1F6M C;  3EPT A;  4MH3 A;  4ULX A;  1R5A A;  1SKW B;  3D21 A;  3TJF A;  2FA4 A;  2VCQ A;  1Q4J A;  2JAC A;  3FHK A;  2JZT A;  4ISD A;  1TP9 A;  1GUL A;  4GST A;  1KEB A;  2DIY A;  4ML6 A;  2QA2 A;  3IXR A;  1GTI A;  4Q5Q A;  2VAF A;  4EKZ A;  2WRT A;  2CVB A;  4A5P A;  3CQF A;  5G1L A;  5IMF A;  4MH2 A;  3KMN A;  1Z3E A;  2LJK A;  1R4W A;  3EU3 A;  5CRW A;  2HZE A;  2R0G A;  4HS1 A;  1Z7P A;  3MSZ A;  3ZIT A;  3TRP A;  2OAC A;  1XWA A;  5AGY A;  1TRS A;  2F8A A;  5ABR A;  1I9D A;  4P3Y B;  4GCI A;  2R0P A;  1TU7 A;  3CRU A;  1BQ7 A;  5E59 A;  3H93 A;  1OAZ A;  3EVI A;  5D9V A;  3GL3 A;  4MF6 A;  1JZW A;  3J7Y k;  2O7K A;  3WGD A;  2EC4 A;  3EYT A;  1Y25 A;  2XC2 A;  1Z7R A;  3RAZ A;  5ECK B;  5FHI A;  1R5P A;  1X9S B;  2H6X A;  4XS4 A;  4EIP A;  4N11 A;  2PWJ A;  1N8J A;  3TJG A;  1X9M B;  1XW5 A;  1SJ6 A;  4OD7 A;  4PNF A;  1FB0 A;  3WT1 A;  3FY7 A;  4I97 A;  3NOF A;  4G0K A;  5JWO B;  2V41 A;  3HZ4 A;  1BJX A;  4J56 E;  5J3R A;  1DUG A;  5B8B A;  5HR1 A;  3VUR A;  5FT3 A;  2E7P A;  4FO5 A;  1GSF A;  4WF5 A;  5ECL B;  3GUR A;  3QD9 A;  3UVT A;  5DBQ A;  5G5F A;  1FVK A;  1ZOF A;  2GSR A;  3GTU B;  3IAS 2;  3IAM 2;  2F9S A;  1A0R P;  3L4N A;  1GWC A;  4K0N A;  1PD2 1;  1PX6 A;  2K8V A;  4LMV A;  4EL1 A;  2KUC A;  5IOW A;  4CY8 A;  4EO3 A;  3F63 A;  2ZCT A;  4PUF C;  3HDC A;  3W8S A;  5ECP B;  4ECJ A;  1TJD A;  5KN3 A;  2FNO A;  2YWI A;  3ZYW A;  1WJK A;  4QL7 A;  4K9Z A;  2H6Y A;  2YZU A;  2N5A A;  3ERW A;  4K7I A;  4WBR D;  2M72 A;  2VL3 A;  5CYY A;  3HD5 A;  3L0H A;  1B4P A;  3GKK A;  2YOI A;  3VPQ A;  3OR5 A;  4G2E A;  2MMO A;  4KDY A;  4F82 A;  3PIN A;  2M46 A;  5ENU A;  2DJ0 A;  2O89 A;  2IN3 A;  2O87 A;  4BVX B;  1XG8 A;  3QAW A;  1XWC A;  4TR1 A;  4IW9 A;  3GX8 A;  4PQ1 A;  2REM A;  1J0F A;  1Z6M A;  3IDV A;  4KDX A;  3M9K A;  3FK8 A;  3E3E A;  4X1U A;  3E9J B;  3UL3 A;  3C73 A;  6GST A;  4XRD A;  1ERV A;  2J23 A;  2TRC P;  4TW5 A;  3HJP A;  5JCG A;  1MDJ A;  2C3N A;  1MDK A;  1TRW A;  2LST A;  4DEJ A;  1PRX A;  3P90 A;  1GLQ A;  4MK3 A;  1OKT A;  1PSQ A;  4IQ1 A;  1FOH A;  2CZ3 A;  2WB9 A;  1QK8 A;  5J9B A;  1C72 A;  1B9Y C;  2WFC A;  2CVD A;  1SL1 B;  3TGZ A;  2H0I A;  4XS1 A;  4K5R A;  1JZR A;  2EIR A;  3WT2 A;  1XWB A;  4TKY A;  1NM3 A;  1A0F A;  3F4S A;  2PN8 A;  5IPG A;  3G7Y A;  3TKS A;  2YP6 A;  5B8A A;  2DML A;  3O3T A;  4O5Q A;  4HZ2 A;  3C7M A;  5JCW A;  4GTU A;  3ED3 A;  5GZZ B;  2WDU A;  1XIY A;  4PXO A;  1ML6 A;  2KHP A;  4TVE A;  5IM9 A;  3LSZ A;  3LYP A;  2OA7 A;  5LD0 A;  4RQX A;  4KA0 A;  4ICY A;  2CZ2 A;  5HFK A;  5ECI B;  4EUY A;  3C1R A;  3ERG A;  2MMZ A;  5IO0 A;  4EF0 A;  1NHO A;  3DGQ A;  4BWQ A;  4YQM A;  5ECM B;  3MAK A;  3UBL A;  1K3Y A;  3IC8 A;  4DSR A;  2MMA A;  3I43 A;  4MZW A;  4ZXG A;  2YWN A;  4F2I A;  4POB A;  3TDG A;  3VWU A;  1K0A A;  2H70 A;  5HQP A;  3R3E A;  1PFO A;  3DML A;  3GKM A;  2AV4 A;  4IGJ A;  3M8N A;  2RII A;  4KH7 A;  3ZIJ A;  3D4M A;  4PUR A;  4PGT A;  2B6M A;  1SK0 A;  1U6T A;  4K5S A;  3QDN A;  5A4W A;  1G0T A;  5LCZ A;  2HYX A;  2P0G A;  1B8X A;  1S3D A;  5CP1 A;  3MIX A;  1S3R A;  3FYG A;  3M3M A;  1HYU A;  3TKQ A;  4NXI A;  5IMA A;  1OE8 A;  5GST A;  1V9W A;  1GUM A;  3GV1 A;  1K0C A;  2FWG A;  4WXT A;  4KCE A;  4NAX A;  4FYB A;  5CAX A;  1OC3 A;  3ISO A;  1TK8 B;  2G2Q A;  4J2F A;  2TIR A;  1J9B A;  3EWL A;  2C8U A;  2O85 A;  3CSI A;  3ME7 A;  8GSS A;  3FR9 A;  2P5R A;  1U87 A;  5HR2 A;  4OO4 A;  1VGL A;  1OVN A;  2FGX A;  1T1V A;  3F8U A;  1YDK A;  1SK2 A;  1N2A A;  3KGK A;  1WWJ A;  3QMX A;  1YZX A;  2XPD A;  4N30 A;  5DQS A;  1OC9 A;  2IMF A;  2QA1 A;  5G31 A;  2YJH A;  1GSD A;  3F0I A;  2P31 A;  1F9M A;  2J9H A;  3BBY A;  2R3X A;  2TRX A;  4IHU A;  1PL2 A;  2YWM A;  4MF5 A;  2GTU A;  2FWE A;  2VCV A;  3KTL A;  2R2J A;  3HZ8 A;  4H86 A;  1B9X C;  4QQ7 A;  3US3 A;  3L9U A;  3TJJ A;  2K18 A;  1U3A A;  1YKC A;  2V1M A;  4K1F A;  1PN9 A;  3HJO A;  1USB A;  4MJC A;  2L6D A;  3KEB A;  5BRT A;  4MDC A;  2IMI A;  2DIZ A;  4V2M A;  2I1U A;  1SJZ A;  1FOV A;  1YF1 A;  1BX9 A;  2RUF A;  1WOU A;  1Z6N A;  3QAV A;  1ZZY A;  2YV7 A;  1O6J A;  4LA1 A;  2FUG 2;  3QCP A;  3ZVJ D;  3LWA A;  2IFQ A;  3LG6 A;  2A2P A;  1PA3 A;  2L5L A;  2LNT A;  4JED A;  2HRA A;  3GH9 A;  2HLS A;  3D22 A;  3TB2 A;  4D73 B;  2PVO C;  4X0X A;  4KDU A;  1XW9 A;  4XHM A;  1T4Y A;  5DCH A;  3TJB A;  2LTK A;  4G19 A;  2AJQ B;  1SKR B;  5ECH B;  5J9C A;  2H01 A;  2RLI A;  3APS A;  1M3I A;  4O92 A;  3D0Z A;  2L4Q A;  3R2Q A;  2NBS A;  4G0I A;  2VL2 C;  10GS A;  2QC7 A;  4KX4 A;  4O5R A;  1PGT A;  2VCZ A;  1NW2 A;  3LEF A;  5DAK B;  3UBK A;  1JLV A;  2B1L A;  1ZL9 A;  4ZIL A;  5ECO B;  1OC8 A;  4L8E A;  1JHB A;  1GTA A;  3CXG A;  2OJL A;  3RBT A;  1EGR A;  4AGS A;  3UAP A;  2YWO A;  5ECR B;  2JZS A;  1Z5Y E;  3ZML A;  4TXV A;  4PQH A;  1GNW A;  5ECS A;  3WGE A;  4MP4 A;  2PGT A;  3WYW A;  3FZA A;  1RW1 A;  1SU9 A;  6GSW A;  1O8X A;  3ZL5 A;  3KZQ A;  2CAQ A;  1SL0 B;  1A2J A;  4AJ7 A;  4I2T A;  1M2D A;  1HD2 A;  2IME A;  3FZ9 A;  1VF1 A;  2R6K A;  5DVB A;  6GSS A;  1PN0 A;  2YN1 A;  2VLV A;  1TXX A;  2B5E A;  4EE0 A;  3A2X A;  1SKS B;  1HQO A;  2IWT A;  4L0W A;  1TK0 B;  3IPZ A;  2G0F A;  1SEN A;  1PX7 A;  1QFN A;  2CAI A;  1GP1 A;  4V2L A;  2HI7 A;  4Z2U A;  1ABA A;  3HCZ A;  5D93 A;  3LGC A;  2A4H A;  2OBI A;  2PBJ A;  1XCC A;  2YAN A;  3KD0 A;  5CO3 A;  2VCX A;  3QR6 A;  3M1G A;  4XIH A;  3ZTL A;  1XZO A;  3WD6 A;  5CNW A;  5ECQ B;  2LRC A;  1K0O A;  2C1Y A;  3U5R E;  4HZ4 A;  1T7P B;  5KOX A;  4BL7 A;  4QL9 A;  4MZB A;  4KE3 A;  2ES7 A;  3H79 A;  1TKD B;  1PMT A;  3IK7 A;  2R0C A;  3H4K A;  2OE3 A;  3ZVJ A;  4K0G A;  4TR4 A;  2H1D A;  3F6D A;  1SK1 A;  2KP2 A;  2V2G A;  1XXU A;  5G30 A;  1LBK A;  2QGV A;  2IPA A;  4IEL A;  1M0U A;  2C4J A;  2L59 A;  3UIW A;  4MPG A;  2VOC A;  3UJ1 A;  2FD3 A;  2HNL A;  3GL5 A;  3CBU A;  4GXZ A;  5HR3 A;  3GA4 A;  2HZE B;  3IHG A;  3C1S A;  2MBS A;  3KIJ A;  1SYR A;  2H0G A;  3I9V 2;  1F3B A;  3A5W A;  4OFN A;  3TOU A;  5J41 A;  4EDZ A;  1MEK A;  2MZC A;  1EEJ A;  1GUH A;  4ZB8 A;  1GTU A;  2X8C A;  4IBP A;  1QUW A;  4WR5 A;  2C0G A;  2HE3 A;  3A5I A;  3VLN A;  4K2X A;  2JAD A;  2H0H A;  2V6K A;  4EVM A;  4E8E A;  3ZFL A;  4KCA A;  3GUS A;  3GX0 A;  3GFK A;  5AIV A;  3A2W A;  1O85 A;  2YPM A;  2PMT A;  3I69 A;  1TDI A;  4WF4 A;  1JLW A;  2CQ9 A;  5DJM A;  3HVV A;  1GL8 A;  1AIU A;  3APQ A;  3WGX A;  4XS6 A;  2OKA A;  4V1A p;  1QGV A;  2GQM A;  5HFG A;  4AJ6 A;  4XS4 B;  4PX1 A;  2F8F A;  1ERT A;  3Q18 A;  1YF0 A;  1X5E A;  4HU9 A;  4MNN A;  3D5J A;  1AC1 A;  2DJ1 A;  4BL7 B;  3L78 A;  4F9Z A;  3TKP A;  5F07 A;  1EV9 A;  2JU5 A;  4MPF A;  2LNS A;  4N10 A;  2GT6 A;  1VF2 A;  1I5G A;  2I4A A;  2B7K A;  2ON5 A;  2P5Q A;  2GZP A;  3SBC A;  2NDO A;  3DD3 A;  1Q98 A;  4PNG A;  3KMO A;  3LOR A;  4BIK A;  3AY8 A;  5LNK e;  2PPT A;  3CSH A;  3IK9 A;  4POM A;  2X64 A;  2LJR A;  4I6X A;  4ZB9 A;  1S3A A;  3DWV A;  6GSU A;  5F8B A;  3FKF A;  1M99 A;  2JZR A;  2VL2 A;  1K3O A;  1UC7 A;  3GKX A;  1AQX A;  4MA9 A;  1AQV A;  3DKS A;  4TRX A;  4YAP A;  2ALB A;  3NZN A;  4DSS A;  2GQK A;  4I5Q A;  4OCE A;  2NTO A;  3KP8 A;  4ML1 A;  5KN1 A;  1EZK A;  1K0D A;  1TI1 A;  2N5F A;  2XBI A;  4GQC A;  1W89 A;  5COH A;  1M9B A;  2C0D A;  4EXJ A;  1EGO A;  17GS A;  2I3Y A;  4ID0 A;  3G7I A;  2K8S A;  5H5Q A;  4AF2 A;  1V58 A;  1EEM A;  1YEP A;  1GSE A;  4TR1 B;  3GH6 A;  1KTE A;  4HI7 A;  4POK A;  1W4V A;  3J7Y b;  5D9W A;  4HOJ A;  4IJI A;  2L6C A;  2X4A A;  20GS A;  5INY A;  3F3R A;  4MJB A;  1YKA A;  2DKH A;  1XFL A;  2HZF A;  4ECB A;  2LS5 A;  2IL3 A;  4BVY A;  1ERU A;  1NHY A;  2VM1 A;  1A24 A;  1EP8 A;  4HSC X;  1ZCP A;  1THO A;  2YCD A;  3EMP A;  4EC0 A;  4FIW A;  1Y6E A;  3MWH A;  3MYD A;  4MZC A;  4IVF A;  2LRN A;  2YNX A;  4HEA 2;  4FQU A;  1O81 A;  2VCT A;  2GZY A;  5H5R A;  2F51 A;  2X99 A;  5DJL A;  3HY2 A;  5G1K A;  1UVZ A;  4RUV A;  3FRC A;  3LFL A;  1TK5 B;  2MYG A;  4DSS B;  4WBJ A;  2VL9 A;  1TTZ A;  4ACS A;  3KH9 A;  3TKR A;  4ZL7 A;  1X5D A;  1AXD A;  4OMV A;  4MF7 A;  1O7U A;  4JZQ A;  2K9F A;  1U3I A;  2H71 A;  2XPE A;  3A3T A;  2JSY A;  13GS A;  3Q74 A;  4MLY A;  1T8E B;  1DBY A;  3VK9 A;  2PU9 C;  1TRU A;  3PH9 A;  1ON4 A;  2LKU A;  5HFI A;  4TXO A;  3ZRD A;  2GS3 A;  4NPB A;  5AIX A;  1MDI A;  4TR3 A;  5IMZ A;  3FW2 A;  1M9A A;  5JWQ B;  7GSS A;  1M2A A;  6GSV A;  4OFT A;  3N5O A;  2CVK A;  4MJA A;  5EPF A;  2ZNM A;  1F37 A;  3O6T A;  6GSY A;  2VM2 A;  5GSS A;  4BPY A;  4BVY B;  1OYJ A;  3O76 A;  2DMM A;  4LMW A;  4F0B A;  3E0U A;  3MNG A;  1KBN A;  2GVP A;  3F6F A;  1R7H A;  3DYR A;  1UN2 A;  1FO5 A;  4Z7X A;  4ILF A;  3F9U A;  2RM5 A;  4JE1 A;  2I9H A;  5ELA A;  1QMV A;  5B6M A;  1H4O A;  3FEU A;  1BG5 A;  1J08 A;  4CY6 A;  5D9T A;  9GSS A;  4NHW A;  1XWK A;  2Z9S A;  2JSZ A;  4Z2R A;  5G2Z A;  3BD2 A;  5HR0 A;  5J5N A;  5F0G A;  3ME8 A;  1SD9 A;  4IP1 A;  2OAD A;  3IHQ A;  3CTG A;  4KND A;  2H76 A;  4G0L A;  2H75 A;  3VI7 A;  3F3Q A;  1X9W B;  4KF9 A;  4OWY A;  3FMW A;  4WKW A;  1A23 A;  3FZ5 A;  3C8E A;  3HYP A;  5KEJ A;  3HVS A;  3Q6O A;  2LRT A;  2BTO T;  2GST A;  2L57 A;  2MMN A;  2YV9 A;  3TRX A;  4JR6 A;  2DJ3 A;  2LQQ A;  11GS A;  3IOS A;  1F2E A;  1WRY A;  1EOG A;  3DVX A;  1ILO A;  4Z2T A;  2WJU A;  3PPU A;  1ST9 A;  2IJY A;  1U88 A;  2DJK A;  1OC9 B;  2X8G A;  2B3S A;  1PKZ A;  2E2G A;  1XPV A;  1ERW A;  2DLX A;  3LYK A;  5ID2 A;  4HU7 A;  3IE3 A;  2V32 A;  2LQO A;  1ZYE A;  5B6N A;  1JFU A;  4PQI A;  1DSB A;  19GS A;  1TI3 A;  4OCF A;  4KB3 A;  5CRE A;  5J4U A;  3EE2 A;  4KSO A;  2KP1 A;  3K8N A;  2VUP A;  2LUS A;  2HXK A;  1SYX A;  4N0V A;  4CHS A;  3GST A;  4CDO A;  2B5Y A;  4ZBD A;  4DSQ A;  3A2V A;  5KN0 A;  1E6B A;  5JWR B;  4N0Z A;  1T3B A;  1RQM A;  4L5O A;  3IBH A;  2DJJ A;  1TU8 A;  5CRD A;  4Q5R A;  2MBT A;  2PUK C;  2WZ9 A;  1VF3 A;  4KGI A;  2QSI A;  2OBK A;  2IFQ B;  4V2N A;  5IIZ A;  5EY6 A;  4PTS A;  1GRX A;  4XCS A;  1XWG A;  5DQY A;  2H66 A;  4IN0 A;  4PUA A;  3IR4 A;  1GNE A;  4Q5N A;  2HRK A;  2FWF A;  3CMI A;  3ZIV A;  2LV3 A;  3VWW A;  1SD8 A;  2R4V A;  3KJY A;  1GSY A;  2HFD A;  1MD4 A;  1K3L A;  2AHE A;  2GSS A;  3GTU A;  2CT6 A;  1ZYN A;  1K0N A;  1GUK A;  5ECN B;  2VCW A;  5DAL A;  2OE0 A;  2VLT A;  3D4T A;  5ID2 B;  2LJA A;  1M3J A;  1T00 A;  2O8V B;  3KCM A;  4WET A;  1GLP A;  4K6X A;  3DVW A;  1R26 A;  2R37 A;  22GS A;  4K8M A;  2XHF A;  3HKR A;  4K7N A;  3IC4 A;  5D73 A;  4NWY A;  1FB6 A;  4EIQ A;  2WGR A;  5A4V A;  2ZUP A;  4YQU A;  4ZIJ A;  2WCI A;  3KM6 A;  1VRS D;  2H6Z A;  2IMD A;  2H72 A;  1T4Z A;  4DVC A;  3TOT A;  5IMV A;  1EV4 A;  16GS A;  1A8L A;  1FAA A;  4YKG A;  2UZ8 A;  4JR4 A;  2ON7 A;  1ZYQ B;  1HNB A;  2E2M A;  4USS A;  3QAG A;  4BVX A;  3HA9 A;  3LQ7 A;  4E8H A;  4RI7 A;  1XOB A;  2QKE A;  4EDY A;  1M2B A;  3HJM A;  4OFM A;  3APO A;  2H1B A;  4IQA A;  1JZO A;  2VD1 A;  4MJE A;  2L4C A;  5C04 A;  4J57 E;  5F06 A;  3FR3 A;  1HNC A;  4TR0 A;  4IP6 A;  4F03 A; 
#chains in the Genus database with same CATH homology
 1FVJ A;  4ECI A;  3LXT A;  5GAN D;  5CRG A;  2EIQ A;  1G6Y A;  4ZBB A;  3SWL A;  3LW9 A;  4K2D A;  1BYE A;  4TN8 A;  2HSM A;  1AUC A;  5DAL B;  2D2Z A;  4CW9 A;  1TRV A;  1XVQ A;  4HJM A;  3DIE A;  1GTB A;  2H73 A;  2NPB A;  4RQR A;  2FA8 A;  5C00 A;  2H30 A;  3RPP A;  2GT5 A;  4OO5 A;  3KP9 A;  2A2R A;  2CA8 A;  2B7J A;  5G5E A;  2YJ7 A;  1K0B A;  2DC5 A;  3KXO A;  5FWG A;  1F3A A;  1O8W A;  1YJ6 A;  3D6I A;  4YH2 A;  2WUL A;  3VI5 A;  5L71 A;  3P7X A;  2GSQ A;  2EIO A;  1MD3 A;  2B1K A;  2X8H A;  2FHE A;  3NIV A;  3CTF A;  6GSX A;  4HUA A;  3TUE A;  2K6V A;  1G7O A;  1YQ1 A;  4KUN A;  2DJ2 A;  2JL4 A;  4XTS A;  2C0F A;  1XBS A;  3P2A A;  1AAZ A;  3ZMK A;  1TW9 A;  3RHB A;  1WIK A;  1H75 A;  4X43 A;  5D9X A;  2CX3 A;  3Q19 A;  3VWV A;  1UA5 A;  3GRX A;  4ZBA A;  2V6O A;  2AYT A;  1QQ2 A;  2AAW A;  4FYU A;  5AN1 A;  3TJK A;  3KTB A;  1X0R A;  1X5C A;  3CRT A;  5KN2 A;  3EUR A;  2HRN A;  1A2M A;  4GWR A;  3C71 A;  1Z9H A;  1G7E A;  3EC3 A;  1PL1 A;  2VLU A;  2N5B A;  3V1W A;  3ERF A;  3TRQ A;  3GMF A;  3G9B A;  3HHV A;  4GLT A;  1IYH A;  4MCU A;  1TOF A;  2C3Q A;  4LL1 B;  1V98 A;  1IYI A;  2KOK A;  4KW6 A;  2VD0 A;  3GSS A;  1SL2 B;  2H19 A;  3P8W A;  4JU5 A;  1FHE A;  4LL4 B;  1LJR A;  3H8Q A;  2AUV A;  1O73 A;  2H8L A;  4FH8 A;  2A4V A;  4RI6 A;  2CX4 A;  5IMC A;  4IS0 A;  4WEY A;  3M0F A;  1VF4 A;  4YAV A;  2FCH A;  1FW1 A;  5IQY A;  5H5S A;  5KOW A;  3KH7 A;  5F05 A;  3TKS E;  2WS2 A;  3RPN A;  3U6V A;  5CRH A;  1DE2 A;  5BMU A;  4WR4 A;  1WE0 A;  2PER A;  2E0Q A;  5A4U A;  2YZH A;  2CV4 A;  5IO2 A;  2FLS A;  3HVX A;  1BED A;  1FG4 A;  2BMX A;  2F3M A;  4NHZ A;  4JRR A;  1RK4 A;  2OE1 A;  1DE1 A;  2KLX A;  4ZB6 A;  4I2U A;  3M9J A;  4GSN A;  4Q5F A;  2XBQ A;  3GKN A;  3GYK A;  4NV5 A;  5ELG A;  2BJX A;  2C0E A;  1WMJ A;  3BOA A;  3TCO A;  2NVL A;  2DBC A;  4X4J A;  1BAY A;  2LEG A;  4O7H A;  3IRA A;  3ZRE A;  3VFI A;  3BCI A;  3MDK A;  3GNJ A;  14GS A;  4G10 A;  3L9S A;  1M7T A;  4POL A;  3UAR A;  2I81 A;  1GH2 A;  2M80 A;  1AQW A;  4ZL8 A;  4NMU A;  1PKW A;  2GGT A;  4GSS A;  3JCM L;  1V2A A;  4JBB A;  1OE7 A;  4IJ3 A;  1EP7 A;  3UVH A;  4ECC A;  1S3C A;  1AW9 A;  3IV4 A;  1K0M A;  1WP0 A;  5IOX A;  1LU4 A;  2L5O A;  1HNA A;  1ZMA A;  3H1N A;  1A8Y A;  2IIY A;  2H1G A;  1GSQ A;  1V40 A;  3L9V A;  2C3T A;  2R5G A;  4GF0 A;  1E2Y A;  5A5K A;  3DEX A;  3EU4 A;  1XOA A;  1NSW A;  4HJ2 A;  5D96 A;  5DCG A;  4MAB A;  4D73 A;  3EIN A;  5DDL A;  3IA1 A;  4LLR A;  12GS A;  3UMA A;  4L5L A;  3GN3 A;  3RDW A;  2H1A A;  3I6A A;  2B5X A;  5IPH A;  5AIS A;  2GLR A;  3PR8 A;  5JCU A;  4BWS A;  1B48 A;  1EOH A;  1SJI A;  1URM A;  3CYN A;  1B4Q A;  1CQH A;  2FWH A;  2PVQ A;  4ZL9 A;  5EVO A;  1XW6 A;  5EL8 A;  1XVW A;  3UOM A;  3S9F A;  5D8I A;  3N9J A;  5IMD A;  5DAK A;  3ZZX A;  1PQN A;  3FZ4 A;  18GS A;  2H74 A;  4IKH A;  3VWX A;  2A2S A;  2GDR A;  3CSJ A;  3QPM A;  4O5U A;  2DSA A;  1JZD A;  2IMK A;  1V57 A;  4TOP A;  5E4W A;  3BJ5 A;  4HDE A;  1OKD A;  1MTC A;  1QXH A;  1YY7 A;  3EMX A;  3F4R A;  5B7C A;  2RUE A;  4L0U A;  4K7O A;  3DRN A;  1CQG A;  1WPI A;  1THX A;  2FY6 A;  3HXS A;  4NV2 A;  2HSH A;  4TXO B;  3GHA A;  4AJ8 A;  4KAE A;  2C80 A;  3W8J A;  5GAP D;  4YQV A;  3QFB C;  4YKF A;  1ACV A;  2AB6 A;  3ZLP A;  3DXB A;  4F0C A;  3VPT A;  2HRF A;  3ZFB A;  4HQZ A;  3QOU A;  4XRA A;  1EWX A;  3GIX A;  3LXZ A;  3F4T A;  4BA7 A;  1GSS A;  1G6W A;  3RHC A;  1GSU A;  2HSY A;  1A2L A;  4KSM A;  2RM6 A;  1ZGN A;  4FYC A;  4HQS A;  4MMM A;  3BCK A;  2GQL A;  2DKI A;  4V1A g;  2GZZ A;  4G9H A;  2VIM A;  2HT9 A;  2X49 A;  3UEM A;  1KNG A;  1YEX A;  4GRF A;  3TKS C;  4GQF A;  3QFA C;  3G7J A;  3LJR A;  1ZYP A;  3W6G A;  3FR6 A;  4I8B A;  4O32 A;  3PGT A;  2VO4 A;  1F6M C;  3EPT A;  4MH3 A;  4ULX A;  1R5A A;  1SKW B;  3D21 A;  3TJF A;  2FA4 A;  2VCQ A;  1Q4J A;  2JAC A;  3FHK A;  2JZT A;  4ISD A;  1TP9 A;  1GUL A;  4GST A;  1KEB A;  2DIY A;  4ML6 A;  2QA2 A;  3IXR A;  1GTI A;  4Q5Q A;  2VAF A;  4EKZ A;  2WRT A;  2CVB A;  4A5P A;  5G1L A;  5IMF A;  4MH2 A;  3KMN A;  1Z3E A;  2LJK A;  1R4W A;  3EU3 A;  5CRW A;  2HZE A;  2R0G A;  4HS1 A;  1Z7P A;  3MSZ A;  3ZIT A;  3TRP A;  2OAC A;  1XWA A;  5AGY A;  1TRS A;  2F8A A;  5ABR A;  1I9D A;  4P3Y B;  4GCI A;  2R0P A;  1TU7 A;  3CRU A;  1BQ7 A;  5E59 A;  3H93 A;  1OAZ A;  3EVI A;  5D9V A;  3GL3 A;  4MF6 A;  1JZW A;  3J7Y k;  2O7K A;  3WGD A;  2EC4 A;  3EYT A;  1Y25 A;  2XC2 A;  1Z7R A;  3RAZ A;  5ECK B;  5FHI A;  1R5P A;  1X9S B;  2H6X A;  4XS4 A;  4EIP A;  4N11 A;  2PWJ A;  1N8J A;  3TJG A;  1X9M B;  1XW5 A;  1SJ6 A;  4OD7 A;  4PNF A;  1FB0 A;  3WT1 A;  3FY7 A;  4I97 A;  3NOF A;  4G0K A;  5JWO B;  2V41 A;  3HZ4 A;  1BJX A;  4J56 E;  5J3R A;  1DUG A;  5B8B A;  5HR1 A;  3VUR A;  5FT3 A;  2E7P A;  4FO5 A;  1GSF A;  4WF5 A;  5ECL B;  3GUR A;  3QD9 A;  3UVT A;  5DBQ A;  5G5F A;  1FVK A;  1ZOF A;  2GSR A;  3GTU B;  3IAS 2;  3IAM 2;  2F9S A;  1A0R P;  3L4N A;  1GWC A;  4K0N A;  1PD2 1;  1PX6 A;  2K8V A;  4LMV A;  4EL1 A;  2KUC A;  5IOW A;  4CY8 A;  4EO3 A;  3F63 A;  2ZCT A;  4PUF C;  3HDC A;  3W8S A;  5ECP B;  4ECJ A;  1TJD A;  5KN3 A;  2FNO A;  2YWI A;  3ZYW A;  1WJK A;  4QL7 A;  4K9Z A;  2H6Y A;  2YZU A;  2N5A A;  3ERW A;  4K7I A;  4WBR D;  2M72 A;  2VL3 A;  5CYY A;  3HD5 A;  3L0H A;  1B4P A;  3GKK A;  2YOI A;  3VPQ A;  3OR5 A;  4G2E A;  2MMO A;  4KDY A;  4F82 A;  3PIN A;  2M46 A;  5ENU A;  2DJ0 A;  2O89 A;  2IN3 A;  2O87 A;  4BVX B;  3QAW A;  1XWC A;  4TR1 A;  4IW9 A;  3GX8 A;  4PQ1 A;  2REM A;  1J0F A;  1Z6M A;  3IDV A;  4KDX A;  3M9K A;  3FK8 A;  3E3E A;  4X1U A;  3E9J B;  3UL3 A;  3C73 A;  6GST A;  4XRD A;  1ERV A;  2J23 A;  2TRC P;  4TW5 A;  3HJP A;  5JCG A;  1MDJ A;  2C3N A;  1MDK A;  1TRW A;  2LST A;  4DEJ A;  1PRX A;  3P90 A;  1GLQ A;  4MK3 A;  1OKT A;  1PSQ A;  4IQ1 A;  1FOH A;  2CZ3 A;  2WB9 A;  1QK8 A;  5J9B A;  1C72 A;  1B9Y C;  2WFC A;  2CVD A;  1SL1 B;  3TGZ A;  2H0I A;  4XS1 A;  4K5R A;  1JZR A;  2EIR A;  3WT2 A;  1XWB A;  4TKY A;  1NM3 A;  1A0F A;  3F4S A;  2PN8 A;  5IPG A;  3G7Y A;  3TKS A;  2YP6 A;  5B8A A;  2DML A;  3O3T A;  4O5Q A;  4HZ2 A;  3C7M A;  5JCW A;  4GTU A;  3ED3 A;  5GZZ B;  2WDU A;  1XIY A;  4PXO A;  1ML6 A;  2KHP A;  4TVE A;  5IM9 A;  3LSZ A;  3LYP A;  2OA7 A;  5LD0 A;  4RQX A;  4KA0 A;  4ICY A;  2CZ2 A;  5HFK A;  5ECI B;  4EUY A;  3C1R A;  3ERG A;  2MMZ A;  5IO0 A;  4EF0 A;  1NHO A;  3DGQ A;  4BWQ A;  4YQM A;  5ECM B;  3MAK A;  3UBL A;  1K3Y A;  3IC8 A;  4DSR A;  2MMA A;  3I43 A;  4MZW A;  4ZXG A;  2YWN A;  4F2I A;  4POB A;  3TDG A;  3VWU A;  1K0A A;  2H70 A;  5HQP A;  3R3E A;  3DML A;  3GKM A;  2AV4 A;  4IGJ A;  3M8N A;  2RII A;  4KH7 A;  3ZIJ A;  3D4M A;  4PUR A;  4PGT A;  2B6M A;  1SK0 A;  1U6T A;  4K5S A;  3QDN A;  5A4W A;  1G0T A;  5LCZ A;  2HYX A;  2P0G A;  1B8X A;  1S3D A;  5CP1 A;  3MIX A;  3FYG A;  3M3M A;  1HYU A;  3TKQ A;  4NXI A;  5IMA A;  1OE8 A;  5GST A;  1V9W A;  1GUM A;  3GV1 A;  1K0C A;  2FWG A;  4WXT A;  4KCE A;  4NAX A;  4FYB A;  5CAX A;  1OC3 A;  3ISO A;  1TK8 B;  2G2Q A;  4J2F A;  2TIR A;  1J9B A;  3EWL A;  2C8U A;  2O85 A;  3CSI A;  3ME7 A;  8GSS A;  3FR9 A;  2P5R A;  1U87 A;  5HR2 A;  4OO4 A;  1VGL A;  1OVN A;  2FGX A;  1T1V A;  3F8U A;  1YDK A;  1SK2 A;  1N2A A;  3KGK A;  1WWJ A;  3QMX A;  1YZX A;  2XPD A;  4N30 A;  5DQS A;  1OC9 A;  2IMF A;  2QA1 A;  5G31 A;  2YJH A;  1GSD A;  3F0I A;  2P31 A;  1F9M A;  2J9H A;  3BBY A;  2R3X A;  2TRX A;  4IHU A;  1PL2 A;  2YWM A;  4MF5 A;  2GTU A;  2FWE A;  2VCV A;  3KTL A;  2R2J A;  3HZ8 A;  4H86 A;  1B9X C;  4QQ7 A;  3US3 A;  3L9U A;  3TJJ A;  2K18 A;  1U3A A;  1YKC A;  2V1M A;  4K1F A;  1PN9 A;  3HJO A;  1USB A;  4MJC A;  2L6D A;  3KEB A;  5BRT A;  4MDC A;  2IMI A;  2DIZ A;  4V2M A;  2I1U A;  1SJZ A;  1FOV A;  1YF1 A;  1BX9 A;  2RUF A;  1WOU A;  1Z6N A;  3QAV A;  1ZZY A;  2YV7 A;  1O6J A;  4LA1 A;  2FUG 2;  3QCP A;  3ZVJ D;  3LWA A;  2IFQ A;  3LG6 A;  2A2P A;  1PA3 A;  2L5L A;  2LNT A;  4JED A;  2HRA A;  3GH9 A;  2HLS A;  3D22 A;  3TB2 A;  4D73 B;  2PVO C;  4X0X A;  4KDU A;  1XW9 A;  4XHM A;  1T4Y A;  5DCH A;  3TJB A;  2LTK A;  4G19 A;  2AJQ B;  1SKR B;  5ECH B;  5J9C A;  2H01 A;  2RLI A;  3APS A;  4O92 A;  3D0Z A;  2L4Q A;  3R2Q A;  2NBS A;  4G0I A;  2VL2 C;  10GS A;  2QC7 A;  4KX4 A;  4O5R A;  1PGT A;  2VCZ A;  1NW2 A;  3LEF A;  5DAK B;  3UBK A;  1JLV A;  2B1L A;  1ZL9 A;  4ZIL A;  5ECO B;  1OC8 A;  4L8E A;  1JHB A;  1GTA A;  3CXG A;  2OJL A;  3RBT A;  1EGR A;  4AGS A;  3UAP A;  2YWO A;  5ECR B;  2JZS A;  1Z5Y E;  3ZML A;  4TXV A;  4PQH A;  1GNW A;  5ECS A;  3WGE A;  4MP4 A;  2PGT A;  3WYW A;  3FZA A;  1RW1 A;  1SU9 A;  6GSW A;  1O8X A;  3ZL5 A;  3KZQ A;  2CAQ A;  1SL0 B;  1A2J A;  4AJ7 A;  4I2T A;  1M2D A;  1HD2 A;  2IME A;  3FZ9 A;  1VF1 A;  2R6K A;  5DVB A;  6GSS A;  1PN0 A;  2YN1 A;  2VLV A;  1TXX A;  2B5E A;  4EE0 A;  3A2X A;  1SKS B;  1HQO A;  2IWT A;  4L0W A;  1TK0 B;  3IPZ A;  2G0F A;  1SEN A;  1PX7 A;  1QFN A;  2CAI A;  1GP1 A;  4V2L A;  2HI7 A;  4Z2U A;  1ABA A;  3HCZ A;  5D93 A;  3LGC A;  2A4H A;  2OBI A;  2PBJ A;  1XCC A;  2YAN A;  3KD0 A;  5CO3 A;  2VCX A;  3QR6 A;  3M1G A;  4XIH A;  3ZTL A;  1XZO A;  3WD6 A;  5CNW A;  5ECQ B;  2LRC A;  1K0O A;  2C1Y A;  3U5R E;  4HZ4 A;  1T7P B;  5KOX A;  4BL7 A;  4QL9 A;  4MZB A;  4KE3 A;  2ES7 A;  3H79 A;  1TKD B;  1PMT A;  3IK7 A;  2R0C A;  3H4K A;  2OE3 A;  3ZVJ A;  4K0G A;  4TR4 A;  2H1D A;  3F6D A;  1SK1 A;  2KP2 A;  2V2G A;  1XXU A;  5G30 A;  1LBK A;  2QGV A;  2IPA A;  4IEL A;  1M0U A;  2C4J A;  2L59 A;  3UIW A;  4MPG A;  2VOC A;  3UJ1 A;  2FD3 A;  2HNL A;  3GL5 A;  3CBU A;  4GXZ A;  5HR3 A;  3GA4 A;  2HZE B;  3IHG A;  3C1S A;  2MBS A;  3KIJ A;  1SYR A;  2H0G A;  3I9V 2;  1F3B A;  3A5W A;  4OFN A;  3TOU A;  5J41 A;  4EDZ A;  1MEK A;  2MZC A;  1EEJ A;  1GUH A;  4ZB8 A;  1GTU A;  2X8C A;  4IBP A;  1QUW A;  4WR5 A;  2C0G A;  2HE3 A;  3A5I A;  3VLN A;  4K2X A;  2JAD A;  2H0H A;  2V6K A;  4EVM A;  4E8E A;  3ZFL A;  4KCA A;  3GUS A;  3GX0 A;  3GFK A;  5AIV A;  3A2W A;  1O85 A;  2YPM A;  2PMT A;  3I69 A;  1TDI A;  4WF4 A;  1JLW A;  2CQ9 A;  5DJM A;  3HVV A;  1GL8 A;  1AIU A;  3APQ A;  3WGX A;  4XS6 A;  2OKA A;  4V1A p;  1QGV A;  2GQM A;  5HFG A;  4AJ6 A;  4XS4 B;  4PX1 A;  2F8F A;  1ERT A;  3Q18 A;  1YF0 A;  1X5E A;  4HU9 A;  4MNN A;  3D5J A;  1AC1 A;  2DJ1 A;  4BL7 B;  3L78 A;  4F9Z A;  3TKP A;  5F07 A;  1EV9 A;  2JU5 A;  4MPF A;  2LNS A;  4N10 A;  2GT6 A;  1VF2 A;  1I5G A;  2I4A A;  2B7K A;  2ON5 A;  2P5Q A;  2GZP A;  3SBC A;  2NDO A;  3DD3 A;  1Q98 A;  4PNG A;  3KMO A;  3LOR A;  3AY8 A;  5LNK e;  2PPT A;  3CSH A;  3IK9 A;  4POM A;  2X64 A;  2LJR A;  4I6X A;  4ZB9 A;  1S3A A;  3DWV A;  6GSU A;  5F8B A;  3FKF A;  1M99 A;  2JZR A;  2VL2 A;  1K3O A;  1UC7 A;  3GKX A;  1AQX A;  4MA9 A;  1AQV A;  3DKS A;  4TRX A;  4YAP A;  2ALB A;  3NZN A;  4DSS A;  2GQK A;  4I5Q A;  4OCE A;  2NTO A;  3KP8 A;  4ML1 A;  5KN1 A;  1EZK A;  1K0D A;  1TI1 A;  2N5F A;  2XBI A;  4GQC A;  1W89 A;  5COH A;  1M9B A;  2C0D A;  4EXJ A;  1EGO A;  17GS A;  2I3Y A;  4ID0 A;  3G7I A;  2K8S A;  5H5Q A;  4AF2 A;  1V58 A;  1EEM A;  1YEP A;  1GSE A;  4TR1 B;  3GH6 A;  1KTE A;  4HI7 A;  4POK A;  1W4V A;  3J7Y b;  5D9W A;  4HOJ A;  4IJI A;  2L6C A;  2X4A A;  20GS A;  5INY A;  3F3R A;  4MJB A;  1YKA A;  2DKH A;  1XFL A;  2HZF A;  4ECB A;  2LS5 A;  2IL3 A;  4BVY A;  1ERU A;  1NHY A;  2VM1 A;  1A24 A;  1EP8 A;  1ZCP A;  1THO A;  2YCD A;  3EMP A;  4EC0 A;  4FIW A;  1Y6E A;  3MWH A;  3MYD A;  4MZC A;  4IVF A;  2LRN A;  2YNX A;  4HEA 2;  4FQU A;  1O81 A;  2VCT A;  2GZY A;  5H5R A;  2F51 A;  2X99 A;  5DJL A;  3HY2 A;  5G1K A;  1UVZ A;  4RUV A;  3FRC A;  3LFL A;  1TK5 B;  2MYG A;  4DSS B;  4WBJ A;  2VL9 A;  1TTZ A;  4ACS A;  3KH9 A;  3TKR A;  4ZL7 A;  1X5D A;  1AXD A;  4OMV A;  4MF7 A;  1O7U A;  4JZQ A;  2K9F A;  1U3I A;  2H71 A;  2XPE A;  3A3T A;  2JSY A;  13GS A;  3Q74 A;  4MLY A;  1T8E B;  1DBY A;  3VK9 A;  2PU9 C;  1TRU A;  3PH9 A;  1ON4 A;  2LKU A;  5HFI A;  4TXO A;  3ZRD A;  2GS3 A;  4NPB A;  5AIX A;  1MDI A;  4TR3 A;  5IMZ A;  3FW2 A;  1M9A A;  5JWQ B;  7GSS A;  1M2A A;  6GSV A;  4OFT A;  3N5O A;  2CVK A;  4MJA A;  5EPF A;  2ZNM A;  1F37 A;  3O6T A;  6GSY A;  2VM2 A;  5GSS A;  4BPY A;  4BVY B;  1OYJ A;  3O76 A;  2DMM A;  4LMW A;  4F0B A;  3E0U A;  3MNG A;  1KBN A;  2GVP A;  3F6F A;  1R7H A;  3DYR A;  1UN2 A;  1FO5 A;  4Z7X A;  4ILF A;  3F9U A;  2RM5 A;  4JE1 A;  2I9H A;  5ELA A;  1QMV A;  5B6M A;  1H4O A;  3FEU A;  1BG5 A;  1J08 A;  4CY6 A;  5D9T A;  9GSS A;  4NHW A;  1XWK A;  2Z9S A;  2JSZ A;  4Z2R A;  5G2Z A;  3BD2 A;  5HR0 A;  5J5N A;  5F0G A;  3ME8 A;  1SD9 A;  4IP1 A;  2OAD A;  3IHQ A;  3CTG A;  4KND A;  2H76 A;  4G0L A;  2H75 A;  3VI7 A;  3F3Q A;  1X9W B;  4KF9 A;  4OWY A;  3FMW A;  4WKW A;  1A23 A;  3FZ5 A;  3C8E A;  3HYP A;  5KEJ A;  3HVS A;  3Q6O A;  2LRT A;  2BTO T;  2GST A;  2L57 A;  2MMN A;  2YV9 A;  3TRX A;  4JR6 A;  2DJ3 A;  2LQQ A;  11GS A;  3IOS A;  1F2E A;  1WRY A;  1EOG A;  3DVX A;  1ILO A;  4Z2T A;  2WJU A;  3PPU A;  1ST9 A;  2IJY A;  1U88 A;  2DJK A;  1OC9 B;  2X8G A;  2B3S A;  1PKZ A;  2E2G A;  1XPV A;  1ERW A;  2DLX A;  3LYK A;  5ID2 A;  4HU7 A;  3IE3 A;  2V32 A;  2LQO A;  1ZYE A;  5B6N A;  1JFU A;  4PQI A;  1DSB A;  19GS A;  1TI3 A;  4OCF A;  4KB3 A;  5CRE A;  5J4U A;  3EE2 A;  4KSO A;  2KP1 A;  3K8N A;  2VUP A;  2LUS A;  2HXK A;  1SYX A;  4N0V A;  4CHS A;  3GST A;  4CDO A;  2B5Y A;  4ZBD A;  4DSQ A;  3A2V A;  5KN0 A;  1E6B A;  5JWR B;  4N0Z A;  1T3B A;  1RQM A;  4L5O A;  3IBH A;  2DJJ A;  1TU8 A;  5CRD A;  4Q5R A;  2MBT A;  2PUK C;  2WZ9 A;  1VF3 A;  4KGI A;  2QSI A;  2OBK A;  2IFQ B;  4V2N A;  5IIZ A;  5EY6 A;  4PTS A;  1GRX A;  4XCS A;  1XWG A;  5DQY A;  2H66 A;  4IN0 A;  4PUA A;  3IR4 A;  1GNE A;  4Q5N A;  2HRK A;  2FWF A;  3CMI A;  3ZIV A;  2LV3 A;  3VWW A;  1SD8 A;  2R4V A;  3KJY A;  1GSY A;  2HFD A;  1MD4 A;  1K3L A;  2AHE A;  2GSS A;  3GTU A;  2CT6 A;  1ZYN A;  1K0N A;  1GUK A;  5ECN B;  2VCW A;  5DAL A;  2OE0 A;  2VLT A;  3D4T A;  5ID2 B;  2LJA A;  1T00 A;  2O8V B;  3KCM A;  4WET A;  1GLP A;  4K6X A;  3DVW A;  1R26 A;  2R37 A;  22GS A;  4K8M A;  2XHF A;  3HKR A;  4K7N A;  3IC4 A;  5D73 A;  4NWY A;  1FB6 A;  4EIQ A;  2WGR A;  5A4V A;  2ZUP A;  4YQU A;  4ZIJ A;  2WCI A;  3KM6 A;  1VRS D;  2H6Z A;  2IMD A;  2H72 A;  1T4Z A;  4DVC A;  3TOT A;  5IMV A;  1EV4 A;  16GS A;  1A8L A;  1FAA A;  4YKG A;  2UZ8 A;  4JR4 A;  2ON7 A;  1ZYQ B;  1HNB A;  2E2M A;  4USS A;  3QAG A;  4BVX A;  3HA9 A;  3LQ7 A;  4E8H A;  4RI7 A;  1XOB A;  2QKE A;  4EDY A;  1M2B A;  3HJM A;  4OFM A;  3APO A;  2H1B A;  4IQA A;  1JZO A;  2VD1 A;  4MJE A;  2L4C A;  5C04 A;  4J57 E;  5F06 A;  3FR3 A;  1HNC A;  4TR0 A;  4IP6 A;  4F03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...