1MDJA

High resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human nfkb (residues 56-68 of the p50 subunit of nfkb)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title Solution structure of human thioredoxin in a mixed disulfide intermediate complex with its target peptide from the transcription factor NF kappa B.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (electron transport/peptide)
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1995-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1mdjA00
2HRNA 3QAGA 4Z7XA 3ZMLA 3J7Yk 1SKSB 3QOUA 1A0RP 2H1BA 4GF0A 1SL0B 4TVEA 5D8IA 1KNGA 2HSYA 2DJ3A 4PURA 4HI7A 3Q74A 1GSUA 1U87A 5GSSA 1QXHA 4Q5NA 4LL4B 1AC1A 1THXA 5FT3A 4LMVA 4ECIA 1THOA 4IQ1A 3TKQA 3TRQA 5IMVA 1XWGA 5G1LA 4JU5A 5DCHA 2FA4A 3FZAA 3Q19A 4GSNA 5ECMB 5KEJA 2A2RA 3HDCA 3F63A 4MDCA 1T3BA 1M0UA 1BX9A 2FWEA 4L5OA 22GSA 3FR9A 1AUCA 4AJ6A 3APQA 1TDIA 3KMOA 2NPBA 3KGKA 3A3TA 3NIVA 4WEYA 2C0EA 4GQFA 5DALB 3W8SA 2ZNMA 1W4VA 4GWRA 3PR8A 4TKYA 3FKFA 1TXXA 2KP2A 2B7JA 4EUYA 3WT2A 3CXGA 4IBPA 1EGRA 1BAYA 2HNLA 5J41A 2LQOA 3F9UA 2B7KA 8GSSA 2OE1A 1K3LA 5CNWA 4HOJA 1SD8A 3IA1A 4LA1A 5IPHA 1WMJA 1GRXA 2A4VA 1XOAA 5ENUA 4AF2A 1GLPA 1M9BA 1PSQA 3M9JA 5GZZB 2KOKA 3ZTLA 3EVIA 3KH7A 5AISA 2VCXA 3I6AA 5J4UA 2CQ9A 4N0VA 1OC9A 3ERFA 3US3A 2VLUA 1SL1B 5A4UA 3GIXA 3L0HA 1MEKA 1A0FA 1GSQA 2H70A 3TRPA 4O92A 3ZREA 4AJ7A 2YPMA 3PGTA 3GKXA 2IN3A 4V2LA 1XW6A 4GQCA 3NZNA 3VWXA 2G2QA 2X8GA 3WGXA 5JWQB 1SL2B 3D4TA 3E0UA 3BD2A 4N10A 3ZITA 1YKCA 4TR1B 1B4PA 1W89A 3GX0A 5LD0A 3GRXA 1O81A 3BBYA 2IMDA 4NHWA 4IGJA 4WBRD 1F9MA 3HHVA 4NHZA 3MDKA 1MD4A 4ID0A 2AAWA 3GKNA 1VF3A 2MMZA 3D6IA 2EC4A 5JCWA 3GN3A 4E8EA 1V57A 4YAVA 3ZL5A 4JEDA 2JADA 3G7YA 4L0UA 4YQUA 3TJBA 2V1MA 2FD3A 1PL1A 4RQRA 3UIWA 4FYUA 4PGTA 1H75A 3H4KA 3GUSA 1HNBA 4ZBAA 3IV4A 3GH6A 5IOWA 3F4RA 3VWVA 3I43A 2OKAA 4ZB8A 1TRWA 2GSTA 3GA4A 4L0WA 1A8LA 3MSZA 3D4MA 5ELGA 4X0XA 4OCFA 2CVBA 5IO2A 2FY6A 1SKWB 2PGTA 2C8UA 2DIZA 1X9SB 2YWOA 2OACA 1Z6MA 2CAQA 4BVXA 2I4AA 2REMA 3GYKA 4OFMA 1PX7A 3O3TA 4FYBA 1XXUA 4NV2A 1EOHA 5CRGA 3SBCA 1B4QA 4EVMA 1ACVA 4G2EA 1WJKA 2B5YA 3QD9A 1VRSD 1MDKA 1SK0A 5D96A 2DJKA 2B5EA 3IR4A 3IRAA 2OE3A 1NHYA 3IK7A 4GSSA 1R7HA 4ACSA 1ZGNA 4ZL7A 2PVOC 2L6DA 1ERVA 1FOVA 4BL7A 1T7PB 1XVQA 1EP7A 2L5OA 14GSA 2LKUA 1VF2A 1PRXA 3CRTA 2DSAA 2WFCA 5B8BA 4GSTA 1O85A 4MPGA 5B6MA 1AIUA 3HCZA 4K6XA 2TRXA 5J9CA 2D2ZA 1WIKA 2DJ2A 1RQMA 4LMWA 3UBLA 2HZEA 3ERGA 4GCIA 3BOAA 4K2DA 3CYNA 5ECIB 3D21A 2VUPA 1WOUA 3UARA 1AQWA 4RUVA 1U3IA 4MF7A 3ZZXA 3TGZA 1GSFA 2AB6A 1YEPA 4KA0A 6GSXA 4I8BA 4TR0A 1SYRA 1EZKA 1ZOFA 3ED3A 1XWAA 1NSWA 1WRYA 1G6YA 2OBKA 2E2GA 5IPGA 2CVDA 3R2QA 2R4VA 3EURA 1BG5A 1K0DA 1IYHA 4MPFA 1VGLA 4RQXA 4WF4A 2RIIA 1FO5A 3KTBA 3TOTA 2OE0A 3WD6A 4HEA2 4F9ZA 2B1KA 2ZCTA 3S9FA 1GWCA 1A2LA 3QPMA 1BQ7A 4EF0A 2DMMA 2VL2C 4ULXA 1K0BA 1GUMA 1PD21 3LJRA 1Z6NA 4WXTA 4I6XA 1OC3A 2MZCA 1ZL9A 4P3YB 4EC0A 4ZB6A 2R2JA 3AY8A 1LBKA 5G2ZA 1E6BA 2OADA 3LXZA 2VD0A 2VD1A 2VLVA 5B7CA 2MBSA 3M3MA 3QFBC 2PBJA 2FLSA 5A4WA 4HUAA 2GLRA 2YWIA 3EE2A 2DC5A 1N8JA 5JWOB 4KNDA 5A5KA 4DSRA 1K0OA 3WYWA 1SJIA 1AW9A 5ECNB 1TW9A 2GDRA 3HVXA 5AN1A 4NPBA 4BWSA 1JZWA 2H6XA 4MH2A 3P7XA 2LUSA 5KN3A 1QUWA 3UVTA 4WR5A 1USBA 4QQ7A 2HZEB 2L6CA 1URMA 3DXBA 5H5SA 1XBSA 1NW2A 3KP8A 3FZ5A 3O6TA 1A2MA 2HFDA 4LLRA 4ZL9A 3N5OA 1JHBA 2H1GA 3EU4A 1HD2A 4AGSA 4ISDA 4HU7A 4O32A 2FHEA 2H1AA 2CAIA 1OC8A 3P90A 4JRRA 2GQLA 1MDIA 1HYUA 3UAPA 4V2NA 3TDGA 3UJ1A 6GSYA 4JZQA 2JU5A 9GSSA 2BJXA 1GUKA 2K9FA 2RM5A 3CMIA 2QGVA 1A8YA 5CO3A 1AQXA 5ID2B 3F4SA 5KN0A 1SENA 2R37A 2IMIA 2H0HA 2PPTA 1DE2A 5F8BA 5DQSA 2GQKA 3F0IA 4MMMA 4V2MA 4MK3A 4PQHA 1BEDA 5E59A 4POKA 3IAM2 3DGQA 2WS2A 2YP6A 1A23A 1EV9A 5IM9A 1WP0A 2VO4A 3FZ9A 3G9BA 2X8CA 1N2AA 1TI1A 4F0CA 3IC4A 3KEBA 1JZOA 3GSSA 1F37A 3DVXA 4ML6A 2JSZA 2VCQA 2LJKA 1OVNA 1GP1A 4O5RA 3TCOA 6GSTA 2O7KA 2MYGA 3HJOA 4XS4A 4WETA 1GL8A 1C72A 1IYIA 1JLVA 2CZ3A 1YF1A 4XCSA 1Z7PA 11GSA 1FW1A 2N5AA 3RHBA 3W8JA 1TTZA 4TR4A 3P8WA 4CW9A 1T4ZA 4XRDA 1XW9A 4NMUA 5F06A 4IELA 2FA8A 3L78A 4F2IA 3ZIVA 2ON5A 4HDEA 3VLNA 3IPZA 3C73A 1R5AA 3Q18A 2OA7A 4OMVA 2PWJA 4N0ZA 4HJ2A 2F3MA 3APSA 1TOFA 2XC2A 3C8EA 3ERWA 4KE3A 1K0MA 1OKDA 4OO5A 4DSSA 4TXOA 2YCDA 4XS6A 2VAFA 3F6DA 4LL1B 2YWNA 1FHEA 2KP1A 4V1Ag 3LGCA 2FNOA 3EYTA 2GSQA 5ELAA 3VURA 3VPTA 2LQQA 2H6ZA 2HRFA 4WF5A 4IP6A 4H86A 2PN8A 4NV5A 1GTUA 1GLQA 1DSBA 3WT1A 1HNAA 2GTUA 5J3RA 1GSYA 2XBIA 2L59A 1GUHA 2MMAA 1TRUA 1UVZA 4XRAA 2DJ1A 16GSA 5JCGA 2H0GA 3TB2A 3VWWA 1K0AA 5DJMA 4G9HA 1B9YC 3LFLA 2M46A 4FO5A 2CX3A 2WDUA 18GSA 5GSTA 1M9AA 3HZ8A 1GSDA 4IJ3A 4ZB9A 4Q5RA 4RI6A 1PMTA 2A2SA 4TRXA 4XS4B 2VCZA 3J7Yb 5JCUA 1TRVA 2IWTA 5DQYA 3TRXA 4EO3A 3M1GA 1Y6EA 2DIYA 5ECQB 2CX4A 4KDYA 2IFQA 2ES7A 2DJ0A 1XZOA 5ECRB 6GSVA 1XVWA 5HR0A 3U6VA 2DLXA 3C7MA 4KX4A 4ZIJA 5G1KA 1SU9A 4QL9A 4MF6A 3GL5A 4KB3A 4YQMA 5KN2A 1XFLA 3A2WA 5DJLA 4J2FA 5E4WA 1VF1A 2GZZA 1YJ6A 4BA7A 1XOBA 3ZVJA 5CRHA 4DEJA 4K1FA 3IE3A 1ZCPA 1X5EA 3DWVA 2VCWA 4K0NA 2H0IA 2R3XA 2V2GA 4DSQA 3UVHA 2B1LA 1DUGA 3ZRDA 3CSIA 2I9HA 3HKRA 1B8XA 2LV3A 4XS1A 1I5GA 1O6JA 2XPEA 1QQ2A 1CQGA 4G19A 1OC9B 4ML1A 1G0TA 2CV4A 1F3BA 1BJXA 4ZL8A 2CVKA 3ZLPA 2LRTA 4E8HA 4EDYA 3L9UA 4HJMA 1J9BA 1KEBA 1WPIA 4PQIA 3CSJA 3MAKA 1G7OA 1BYEA 3M8NA 4KUNA 2LEGA 3GFKA 3IDVA 3QAVA 1O8XA 2E7PA 5C04A 4BWQA 2GSSA 4RI7A 3U5RE 2IL3A 1EOGA 5HFKA 2H75A 3FEUA 4K7OA 1T00A 1VF4A 2IMEA 2WCIA 4OFTA 1PQNA 2IFQB 5DBQA 1M2BA 1V98A 5ECLB 1E2YA 3GSTA 4EKZA 1F6MC 5ECKB 1ON4A 13GSA 4XTSA 5AIVA 4I2TA 1J08A 3VFIA 5L71A 2LRCA 4IHUA 2BTOT 3L4NA 3ME7A 3ZMKA 4TXVA 3MWHA 2WB9A 5HFGA 1OE8A 3K8NA 5D9TA 3TKPA 1PA3A 2J9HA 3GKMA 5AGYA 3IHQA 4IW9A 1FVJA 2OBIA 5FWGA 1FG4A 3KM6A 2E2MA 3W6GA 1ZYEA 1ERWA 2PU9C 4HQSA 1FVKA 1Z9HA 3BCKA 1TI3A 3HD5A 2AUVA 2WZ9A 3APOA 4POLA 2X99A 3VI7A 3GV1A 3TJKA 5F07A 2C4JA 4MA9A 2YZHA 4F03A 1V2AA 1TRSA 3CBUA 2EIOA 2JZRA 1TK8B 1X5CA 5F0GA 5C00A 2H19A 4L5LA 2JSYA 1Q98A 3UL3A 1ERTA 4NAXA 1JZDA 2FWHA 5HR3A 4BPYA 2Z9SA 1TK5B 3F6FA 3TKSC 2VOCA 3I9V2 3P2AA 3D22A 5D9XA 1HQOA 5EVOA 1DE1A 2MMOA 4HZ2A 5EPFA 4KDUA 3G7IA 2O8VB 2JL4A 2GS3A 2OJLA 3VPQA 1H4OA 2B3SA 3H8QA 4KH7A 4BVYA 2V6OA 2GGTA 2J23A 5GAND 1O8WA 2HSHA 1PN9A 3GNJA 2NBSA 2QSIA 3FYGA 1SD9A 3FY7A 4J56E 6GSSA 2ON7A 3CTFA 4EDZA 2YWMA 3IAS2 1SK2A 2L4CA 5CREA 4D73A 3KXOA 1PL2A 4K0GA 3LXTA 2V32A 2GZPA 5J5NA 3CRUA 1PGTA 1GNWA 1X9MB 2LJAA 4TW5A 1B9XC 2YZUA 4KGIA 2IMKA 5HR1A 2H01A 4X43A 10GSA 2GSRA 5D93A 3QR6A 1X0RA 5AIXA 4KCAA 1UA5A 2LNTA 2HE3A 2C3TA 2RM6A 4TN8A 3M9KA 1YEXA 2O89A 3CTGA 2F9SA 2WRTA 2M80A 3M0FA 3E9JB 2G0FA 2QKEA 3PINA 1EEMA 3E3EA 3KD0A 4GXZA 5DALA 1EV4A 3FHKA 3FK8A 2DJJA 3QMXA 2M72A 6GSUA 2IJYA 3RDWA 2DMLA 2O87A 2C1YA 3V1WA 1XPVA 3F3RA 4PUAA 1EP8A 1U3AA 2VCTA 4MJCA 2C0DA 3LEFA 2NDOA 4MZWA 1EGOA 2LSTA 1M2AA 20GSA 1M2DA 4GTUA 5DCGA 1SJ6A 4KW6A 4MP4A 1GTBA 3Q6OA 1KBNA 3FR6A 2XBQA 5GAPD 3KMNA 2YNXA 5HFIA 2TRCP 3FRCA 2V6KA 2VL3A 4Q5QA 1NHOA 7GSSA 4KSOA 3LORA 2B6MA 3EINA 3GX8A 2YN1A 2KLXA 5HR2A 2WGRA 19GSA 5INYA 2YJ7A 2CT6A 1ZYQB 3RBTA 4OCEA 3TJGA 3ZFLA 3JCML 4D73B 3HZ4A 4KCEA 1EWXA 2CA8A 1WWJA 3MNGA 1FB6A 1KTEA 1Z7RA 4GLTA 1U6TA 5DVBA 2K8SA 3DVWA 1GNEA 1Q4JA 4HU9A 3I69A 1ERUA 2MMNA 3EC3A 4YH2A 4K9ZA 1ML6A 4G10A 4ECBA 4TR1A 3RPNA 2K8VA 3QCPA 1ABAA 1YF0A 2GT6A 3LG6A 1CQHA 2HI7A 4ZBBA 3DEXA 3RHCA 4MZBA 4ZILA 5IO0A 3DKSA 2EIQA 4EL1A 2P5QA 2R5GA 3TUEA 5COHA 3HVSA 2PVQA 2CZ2A 4MJAA 3FZ4A 5ECHB 4I2UA 5B8AA 1OAZA 1JLWA 2X64A 4MJBA 1ST9A 1J0FA 2I81A 3F8UA 1Z3EA 1A24A 3DIEA 3ISOA 2HZFA 2H71A 2LTKA 2VLTA 1YKAA 1GTIA 3EMXA 2F8AA 5JWRB 3HXSA 1K0CA 4IP1A 2H30A 2I1UA 4N30A 1V9WA 1M7TA 3HJPA 4IVFA 2FCHA 5CAXA 1ZZYA 1G6WA 1XCCA 2VM2A 1XWKA 2GZYA 4GRFA 2C0GA 1QGVA 1R26A 1TK0B 1OKTA 1YZXA 5LNKe 2YJHA 2JZTA 4HZ4A 2H76A 2HT9A 3ZVJD 2YV7A 3HJMA 5G5FA 3HYPA 2FUG2 1RK4A 4F82A 5LCZA 1B48A 3OR5A 4XIHA 5B6NA 4PXOA 4HS1A 1V58A 4MCUA 2FWFA 4POBA 3D0ZA 1NM3A 1PX6A 1UN2A 3KJYA 4NXIA 5ECSA 5CRDA 2ZUPA 5IQYA 4WR4A 3LQ7A 2O85A 4CDOA 1SKRB 1GULA 1TU7A 2H73A 2F51A 2L57A 1MTCA 2KUCA 4HQZA 1YDKA 4ILFA 4ZBDA 3H1NA 5J9BA 3HA9A 1MDJA 4V1Ap 4K7NA 4DSSB 3VK9A 4TXOB 1ILOA 5CRWA 3O76A 3IOSA 3L9SA 2AYTA 2XHFA 2VL9A 1T8EB 4KDXA 4TR3A 2GQMA 1ZMAA 3C1RA 3PH9A 1M99A 2H74A 5IIZA 2PMTA 5ECOB 1R4WA 3DD3A 4WBJA 3GURA 2IIYA 1GTAA 3VWUA 2AJQB 3HVVA 2VL2A 3IXRA 3ZYWA 4PX1A 3HY2A 2H66A 3QAWA 2C0FA 2XPDA 2AV4A 3KZQA 4JBBA 1QMVA 1TP9A 3GHAA 3UEMA 5CP1A 3DMLA 2R6KA 1SJZA 3KIJA 3TKSA 4PNGA 1X5DA 2F8FA 3VI5A 4IJIA 4IN0A 4L8EA 3ME8A 2GT5A 1XWCA 3DRNA 3GL3A 4FYCA 2C3QA 2L4QA 3EWLA 1WE0A 4FH8A 1LU4A 4MLYA 2VM1A 2X8HA 3C71A 1S3CA 5IMFA 3KP9A 1AXDA 5D9VA 3RAZA 2GVPA 5FHIA 2KHPA 3F3QA 3BJ5A 3RPPA 2JACA 1GSEA 1DBYA 5DAKA 1TJDA 2LJRA 4ECJA 6GSWA 2TIRA 5IMDA 5ECPB 3QDNA 2K6VA 2LS5A 2P31A 4POMA 1I9DA 1FB0A 4PQ1A 4YAPA 4NWYA 3L9VA 4MZCA 4OWYA 1UC7A 3ZIJA 3FR3A 1RW1A 3TOUA 2H1DA 1O73A 2WULA 2MBTA 3LYKA 5DDLA 3D5JA 3FW2A 3NOFA 4KSMA 3LWAA 1MD3A 2LRNA 4F0BA 3H93A 4IQAA 1U88A 1JFUA 4I97A 5D9WA 4JR6A 1PKWA 2PERA 4CHSA 2HLSA 1T4YA 4OO4A 1SK1A 5CYYA 1G7EA 4PNFA 5HQPA 3WGEA 3KH9A 4QL7A 4WKWA 2P5RA 5IMCA 4X1UA 4OD7A 5ABRA 2RLIA 1TKDB 3CSHA 1FAAA 3TJJA 1XW5A 3GTUA 1F3AA 3A2VA 3QFAC 2L5LA 2VCVA 1SYXA 2RUFA 1K3OA 5EY6A 1YQ1A 2RUEA 5IMZA 4KAEA 3A5WA 2JZSA 3KTLA 5G5EA 2FGXA 2FWGA 3TKRA 4MF5A 2VIMA 2ALBA 2I3YA 1T1VA 1K3YA 1AQVA 5ID2A 2WJUA 2NVLA 2N5BA 3A2XA 5DAKB 3SWLA 4J57E 1TU8A 3GKKA 2C3NA 4JE1A 3IBHA 2DBCA 3G7JA 4EXJA 2V41A 2C80A 2AHEA 3LSZA 1OE7A 1PKZA 2YOIA 3UOMA 5F05A 3TJFA 1YY7A 3GMFA 3KCMA 1QK8A 3H79A 2B5XA 2HXKA 4K7IA 3TKSE 1JZRA 2IMFA 4MH3A 2QC7A 2K18A 17GSA 1HNCA 1XIYA 3EU3A 3EMPA 2PUKC 2H72A 2LNSA 2H8LA 1EEJA 3DYRA 1LJRA 1S3DA 2E0QA 1GSSA 3C1SA 1GH2A 5IMAA 3UMAA 4I5QA 2BMXA 4DVCA 2EIRA 4IS0A 2NTOA 4FIWA 5G30A 1XWBA 5IOXA 3IK9A 3BCIA 3LYPA 4Q5FA 3UBKA 1AAZA 4K8MA 1R5PA 5H5RA 4PUFC 1X9WB 5H5QA 4O7HA 4EE0A 4ZXGA 1QFNA 3GTUB 4N11A 2IPAA 2YANA 4AJ8A 3F4TA 3ZFBA 4OFNA 2YV9A 3N9JA 1Z5YE 5A4VA 4MABA 3WGDA 2H6YA 2N5FA 1V40A 4XHMA 5KN1A 1OYJA 4IKHA 2P0GA 1K0NA 5G31A 4JR4A 1O7UA 1F2EA 2HYXA 4ECCA 1Y25A 5D73A 3GH9A 4MJEA 5EL8A 4YQVA 12GSA 1A2JA 1S3AA 4TOPA
chains in the Genus database with same CATH superfamily
2HRNA 3QAGA 4Z7XA 3ZMLA 3J7Yk 1SKSB 3QOUA 1A0RP 2H1BA 4YKFA 4GF0A 1SL0B 4TVEA 5D8IA 1KNGA 2HSYA 2DJ3A 5BRTA 4HSCX 4PURA 4HI7A 3Q74A 1GSUA 1U87A 5GSSA 1QXHA 4Q5NA 4LL4B 1AC1A 1THXA 5FT3A 4LMVA 4ECIA 1THOA 4IQ1A 3TKQA 3TRQA 5IMVA 1XWGA 5G1LA 4JU5A 5DCHA 2FA4A 3FZAA 3Q19A 4GSNA 5ECMB 5KEJA 2A2RA 3HDCA 3F63A 4MDCA 1T3BA 1M0UA 4Z2TA 1BX9A 2FWEA 4L5OA 22GSA 3FR9A 1AUCA 4AJ6A 3APQA 1TDIA 3KMOA 2NPBA 3KGKA 3A3TA 3NIVA 4WEYA 2C0EA 4GQFA 5DALB 3W8SA 2ZNMA 1W4VA 4GWRA 3PR8A 4TKYA 3FKFA 1TXXA 2KP2A 2B7JA 4EUYA 3WT2A 3CXGA 4IBPA 1EGRA 1BAYA 2HNLA 5J41A 2LQOA 3F9UA 2B7KA 8GSSA 2OE1A 1K3LA 5CNWA 4HOJA 1SD8A 3IA1A 4LA1A 5IPHA 1WMJA 1GRXA 2A4VA 1XOAA 5ENUA 4AF2A 1GLPA 1M9BA 1PSQA 3M9JA 5GZZB 2KOKA 3ZTLA 3EVIA 3KH7A 5AISA 2VCXA 3I6AA 3EPTA 5J4UA 2CQ9A 4N0VA 1OC9A 3ERFA 3US3A 2VLUA 1SL1B 5A4UA 3GIXA 3L0HA 1MEKA 1A0FA 1GSQA 2H70A 3TRPA 4O92A 3ZREA 4AJ7A 2YPMA 3PGTA 3GKXA 2R0PA 2IN3A 4V2LA 1XW6A 4GQCA 3NZNA 3VWXA 2G2QA 1ZYNA 2X8GA 3WGXA 5JWQB 1SL2B 3D4TA 3E0UA 3BD2A 4N10A 3ZITA 1YKCA 4TR1B 1B4PA 1W89A 3GX0A 5LD0A 3GRXA 1O81A 3BBYA 2IMDA 4O5UA 4NHWA 4IGJA 4WBRD 1F9MA 3HHVA 4NHZA 3MDKA 1MD4A 4ID0A 2AAWA 3GKNA 1VF3A 2MMZA 3D6IA 2EC4A 5JCWA 3GN3A 4E8EA 1V57A 4YAVA 3ZL5A 4JEDA 2JADA 3G7YA 4L0UA 4YQUA 3TJBA 2V1MA 2FD3A 1PL1A 4RQRA 3UIWA 3CQFA 4FYUA 4PGTA 1H75A 3H4KA 3GUSA 1HNBA 4ZBAA 4YKGA 3IV4A 3GH6A 5IOWA 3F4RA 3VWVA 3I43A 5KOWA 2OKAA 4ZB8A 1M3IA 1TRWA 2GSTA 3GA4A 4L0WA 1A8LA 3MSZA 3D4MA 5ELGA 4X0XA 4OCFA 2CVBA 5IO2A 2FY6A 1SKWB 2PGTA 2C8UA 2DIZA 1X9SB 2YWOA 2OACA 1Z6MA 2CAQA 4BVXA 2I4AA 2REMA 3GYKA 4OFMA 1PX7A 3O3TA 4FYBA 1XXUA 4NV2A 1EOHA 5CRGA 3SBCA 1B4QA 4EVMA 1ACVA 4G2EA 1WJKA 2B5YA 3QD9A 1VRSD 1MDKA 1SK0A 5D96A 2DJKA 2B5EA 3IR4A 3IRAA 2OE3A 1NHYA 3IK7A 4GSSA 1R7HA 4ACSA 1ZGNA 4ZL7A 2PVOC 2L6DA 1ERVA 1FOVA 4BL7A 1T7PB 1XVQA 1EP7A 2L5OA 14GSA 2LKUA 1VF2A 1PRXA 3CRTA 2DSAA 2WFCA 4MNNA 5B8BA 4GSTA 1O85A 4MPGA 5B6MA 1AIUA 3HCZA 4K6XA 2TRXA 5J9CA 2D2ZA 1WIKA 2DJ2A 1RQMA 4LMWA 3UBLA 2HZEA 3ERGA 4GCIA 3BOAA 4K2DA 3CYNA 5ECIB 3D21A 2VUPA 1WOUA 3UARA 1AQWA 4RUVA 1U3IA 4MF7A 3ZZXA 3TGZA 1GSFA 2AB6A 1YEPA 4KA0A 6GSXA 4I8BA 4TR0A 1SYRA 1EZKA 1ZOFA 3ED3A 1M3JA 1XWAA 1NSWA 1WRYA 1G6YA 2OBKA 2E2GA 5IPGA 2CVDA 3R2QA 2R4VA 3FMWA 3EURA 1BG5A 1K0DA 1IYHA 4MPFA 1VGLA 4RQXA 4WF4A 2RIIA 4Z2UA 1FO5A 3KTBA 3TOTA 2OE0A 3WD6A 4HEA2 4F9ZA 2B1KA 2ZCTA 3S9FA 1GWCA 1A2LA 3QPMA 1BQ7A 4EF0A 2DMMA 2VL2C 4ULXA 1K0BA 1GUMA 1PD21 3LJRA 1Z6NA 4WXTA 4I6XA 1OC3A 2MZCA 1ZL9A 4P3YB 4EC0A 4ZB6A 2R2JA 3AY8A 1LBKA 5G2ZA 1E6BA 2OADA 3LXZA 2VD0A 2VD1A 2VLVA 5B7CA 2MBSA 4BL7B 3M3MA 3QFBC 2PBJA 2FLSA 5A4WA 4HUAA 2GLRA 2YWIA 3EE2A 2DC5A 1N8JA 5JWOB 4KNDA 1FOHA 5A5KA 4DSRA 1K0OA 3WYWA 1SJIA 1AW9A 5ECNB 1TW9A 2GDRA 3HVXA 5AN1A 2QA2A 4NPBA 4BWSA 3LW9A 1JZWA 2H6XA 4MH2A 3P7XA 2LUSA 5KN3A 1QUWA 3UVTA 4WR5A 1USBA 4QQ7A 2HZEB 2L6CA 1URMA 3DXBA 5H5SA 1XBSA 1NW2A 3KP8A 3FZ5A 3O6TA 1A2MA 2HFDA 4LLRA 4ZL9A 3N5OA 1JHBA 2H1GA 3EU4A 1HD2A 2HRAA 4ISDA 4HU7A 4AGSA 4O32A 2FHEA 2H1AA 2CAIA 1OC8A 3P90A 4JRRA 2GQLA 1MDIA 1HYUA 3UAPA 4V2NA 3TDGA 3UJ1A 6GSYA 4JZQA 2JU5A 9GSSA 2BJXA 1GUKA 2K9FA 2RM5A 3CMIA 2QGVA 1A8YA 5CO3A 1AQXA 5ID2B 3F4SA 5KN0A 1SENA 2R37A 2IMIA 3MYDA 2H0HA 2PPTA 1DE2A 5F8BA 5DQSA 2GQKA 3F0IA 4MMMA 4V2MA 4MK3A 4PQHA 1BEDA 5E59A 4POKA 3IAM2 3DGQA 2WS2A 2YP6A 1A23A 1EV9A 5IM9A 1WP0A 2VO4A 3FZ9A 3G9BA 4A5PA 2X8CA 1N2AA 1TI1A 4F0CA 3IC4A 3KEBA 1JZOA 3GSSA 1F37A 3DVXA 4ML6A 2JSZA 2VCQA 2LJKA 1OVNA 1GP1A 4O5RA 3TCOA 6GSTA 2O7KA 2MYGA 3HJOA 1S3RA 4WETA 4XS4A 1C72A 1GL8A 1IYIA 1JLVA 2CZ3A 1YF1A 4XCSA 1Z7PA 11GSA 1FW1A 2N5AA 3RHBA 3W8JA 1TTZA 4TR4A 3P8WA 4CW9A 1T4ZA 4XRDA 1XW9A 4NMUA 5F06A 4CY8A 4IELA 2FA8A 3L78A 4F2IA 3ZIVA 2ON5A 4HDEA 2A4HA 3VLNA 3IPZA 3C73A 1R5AA 3Q18A 2OA7A 4OMVA 2PWJA 4N0ZA 4HJ2A 2F3MA 3APSA 1TOFA 2XC2A 3C8EA 3ERWA 4KE3A 1K0MA 1OKDA 4OO5A 4DSSA 2HSMA 4TXOA 2YCDA 4XS6A 2VAFA 3F6DA 4LL1B 2YWNA 1FHEA 2R0CA 2KP1A 4V1Ag 3LGCA 2FNOA 3EYTA 2GSQA 5ELAA 3VURA 3VPTA 2LQQA 2H6ZA 2HRFA 4WF5A 4IP6A 4H86A 2PN8A 4NV5A 1GTUA 1GLQA 1DSBA 3WT1A 1HNAA 2GTUA 5J3RA 1GSYA 2XBIA 2L59A 1GUHA 2MMAA 1TRUA 1UVZA 4XRAA 2DJ1A 16GSA 5JCGA 2H0GA 3TB2A 3VWWA 1K0AA 5DJMA 4G9HA 1B9YC 3LFLA 2M46A 4FO5A 2CX3A 2WDUA 18GSA 5GSTA 1M9AA 3HZ8A 1GSDA 4IJ3A 4ZB9A 4Q5RA 4RI6A 1PMTA 2A2SA 4TRXA 4XS4B 2VCZA 3J7Yb 5JCUA 1TRVA 2IWTA 5DQYA 3TRXA 4EO3A 3M1GA 1Y6EA 2DIYA 5ECQB 2CX4A 4KDYA 2IFQA 2R0GA 2ES7A 2DJ0A 1XZOA 5ECRB 6GSVA 1XVWA 5HR0A 3U6VA 2DLXA 3C7MA 4KX4A 4ZIJA 5G1KA 1SU9A 4QL9A 4MF6A 3GL5A 4KB3A 3A5IA 4YQMA 5KN2A 1XFLA 3A2WA 5DJLA 4J2FA 5E4WA 1VF1A 2GZZA 1YJ6A 4BA7A 1XOBA 3ZVJA 5CRHA 4DEJA 4K1FA 3IE3A 1ZCPA 1X5EA 3DWVA 2VCWA 4K0NA 2H0IA 2R3XA 2V2GA 4DSQA 3UVHA 2B1LA 1DUGA 3ZRDA 3CSIA 2I9HA 3HKRA 1B8XA 2LV3A 4XS1A 1I5GA 1O6JA 2XPEA 1QQ2A 3IHGA 1CQGA 4G19A 1OC9B 4ML1A 1G0TA 2CV4A 1F3BA 1BJXA 4ZL8A 2CVKA 3ZLPA 2LRTA 4E8HA 4EDYA 3L9UA 4HJMA 1J9BA 1KEBA 1WPIA 4PQIA 3CSJA 3MAKA 1G7OA 1BYEA 3M8NA 4KUNA 2LEGA 3GFKA 3IDVA 3QAVA 1O8XA 2E7PA 5C04A 4BWQA 2GSSA 4RI7A 3U5RE 2IL3A 1EOGA 4X4JA 5HFKA 2H75A 3FEUA 4K7OA 1T00A 1VF4A 2IMEA 2WCIA 4OFTA 1PQNA 2IFQB 5DBQA 1M2BA 1V98A 5ECLB 1E2YA 3GSTA 4EKZA 1F6MC 5ECKB 1ON4A 13GSA 4XTSA 5AIVA 4I2TA 1J08A 3VFIA 5L71A 2LRCA 4IHUA 2QA1A 2BTOT 3L4NA 3ME7A 3ZMKA 4TXVA 4ICYA 3MWHA 2WB9A 5HFGA 1OE8A 3K8NA 5D9TA 3TKPA 1PA3A 2J9HA 4K5RA 3GKMA 5AGYA 4K5SA 3IHQA 4IW9A 1FVJA 2OBIA 5FWGA 1FG4A 3KM6A 2E2MA 4G0LA 3W6GA 1ZYEA 1ERWA 2PU9C 4HQSA 1FVKA 1Z9HA 3BCKA 1TI3A 3HD5A 2AUVA 2WZ9A 3APOA 4POLA 2X99A 3VI7A 3GV1A 3TJKA 5F07A 2C4JA 4BVXB 4MA9A 2YZHA 4F03A 1V2AA 1TRSA 3CBUA 2EIOA 2JZRA 1TK8B 1X5CA 5F0GA 5C00A 2H19A 4L5LA 2JSYA 1Q98A 3UL3A 1ERTA 4NAXA 1JZDA 2FWHA 5HR3A 4BPYA 2Z9SA 1TK5B 3F6FA 3TKSC 2VOCA 3I9V2 3P2AA 3D22A 5D9XA 1HQOA 5EVOA 1DE1A 2MMOA 4HZ2A 5EPFA 4KDUA 3G7IA 2O8VB 2JL4A 2GS3A 2OJLA 3VPQA 1H4OA 2B3SA 3H8QA 4KH7A 4BVYA 2V6OA 2GGTA 2J23A 5GAND 1O8WA 1XG8A 2HSHA 1PN9A 3GNJA 2NBSA 2QSIA 3FYGA 1SD9A 3FY7A 4J56E 6GSSA 2ON7A 3CTFA 4EDZA 2YWMA 3IAS2 1SK2A 2L4CA 5CREA 4D73A 3KXOA 1PL2A 4K0GA 3LXTA 2V32A 2GZPA 5J5NA 3CRUA 1PGTA 1GNWA 1X9MB 2LJAA 4TW5A 1B9XC 2YZUA 4KGIA 2IMKA 5HR1A 2H01A 4X43A 10GSA 2GSRA 5D93A 3QR6A 1X0RA 5AIXA 4KCAA 1UA5A 2LNTA 2HE3A 2C3TA 2RM6A 4TN8A 3M9KA 1YEXA 2O89A 3CTGA 5KOXA 2F9SA 2WRTA 2M80A 3M0FA 3E9JB 2G0FA 2QKEA 3PINA 1EEMA 3E3EA 2X4AA 3KD0A 4GXZA 5DALA 1EV4A 3FHKA 3FK8A 2DJJA 3QMXA 2M72A 6GSUA 2IJYA 3RDWA 2DMLA 2O87A 2C1YA 3V1WA 1XPVA 3F3RA 4PUAA 1EP8A 4O5QA 1U3AA 2VCTA 4MJCA 2C0DA 3LEFA 2NDOA 4MZWA 1EGOA 2LSTA 1M2AA 20GSA 1M2DA 4GTUA 5DCGA 1SJ6A 4KW6A 4MP4A 1GTBA 3Q6OA 1KBNA 3PPUA 3FR6A 2XBQA 5GAPD 3KMNA 2YNXA 5HFIA 4BVYB 2TRCP 3FRCA 2V6KA 2VL3A 4Q5QA 1NHOA 7GSSA 4KSOA 3LORA 2B6MA 3EINA 3GX8A 2YN1A 2KLXA 5HR2A 2WGRA 19GSA 5INYA 2YJ7A 2CT6A 1ZYQB 3RBTA 4OCEA 3TJGA 3ZFLA 3JCML 4D73B 3HZ4A 4KCEA 1EWXA 2CA8A 1WWJA 3MNGA 1FB6A 1KTEA 1Z7RA 4GLTA 1U6TA 5DVBA 2K8SA 3DVWA 1GNEA 1Q4JA 4HU9A 3I69A 1ERUA 2MMNA 3EC3A 4YH2A 4K9ZA 1ML6A 4G10A 4ECBA 4TR1A 3RPNA 2K8VA 3QCPA 1ABAA 1YF0A 2GT6A 3LG6A 1CQHA 2HI7A 4ZBBA 3DEXA 3RHCA 4MZBA 4ZILA 5IO0A 3DKSA 2EIQA 4EL1A 2P5QA 4EIPA 2R5GA 3TUEA 5COHA 3HVSA 2PVQA 2CZ2A 4MJAA 3FZ4A 5ECHB 4I2UA 5B8AA 1OAZA 1JLWA 2X64A 4MJBA 1ST9A 1J0FA 2I81A 3F8UA 1Z3EA 1A24A 3DIEA 3ISOA 2HZFA 2H71A 2LTKA 2VLTA 1YKAA 1GTIA 3EMXA 2F8AA 5JWRB 3HXSA 1K0CA 4IP1A 2H30A 2I1UA 4N30A 1V9WA 1M7TA 3HJPA 4IVFA 2FCHA 5CAXA 1ZZYA 4CY6A 1G6WA 1XCCA 2VM2A 1XWKA 2GZYA 4GRFA 2C0GA 1QGVA 1R26A 1TK0B 1OKTA 1YZXA 5LNKe 2YJHA 2JZTA 4HZ4A 2H76A 2HT9A 3ZVJD 2YV7A 3HJMA 5G5FA 3HYPA 2FUG2 1RK4A 4F82A 5LCZA 1B48A 3OR5A 4XIHA 5B6NA 4PXOA 4HS1A 1V58A 4MCUA 2FWFA 4POBA 3D0ZA 1NM3A 1PX6A 1UN2A 3KJYA 4NXIA 5ECSA 5CRDA 3HVNA 2ZUPA 5IQYA 4WR4A 4BIKA 3LQ7A 2O85A 4K2XA 2DKHA 4CDOA 1SKRB 1GULA 1TU7A 2H73A 2F51A 2L57A 1MTCA 2KUCA 4HQZA 1YDKA 4ILFA 4ZBDA 3H1NA 5J9BA 3HA9A 1MDJA 4V1Ap 4K7NA 4DSSB 3VK9A 4TXOB 1ILOA 5CRWA 3O76A 3IOSA 3L9SA 2AYTA 2XHFA 2VL9A 1T8EB 4KDXA 4TR3A 2GQMA 1ZMAA 3C1RA 3PH9A 3IC8A 1M99A 2H74A 5IIZA 2PMTA 5ECOB 1R4WA 3DD3A 4WBJA 3GURA 2IIYA 1GTAA 3VWUA 1ZYPA 2AJQB 3HVVA 2A2PA 2VL2A 3IXRA 3ZYWA 4PX1A 3HY2A 2H66A 3QAWA 2C0FA 2XPDA 2AV4A 3KZQA 4JBBA 1QMVA 1TP9A 3GHAA 3UEMA 5CP1A 3DMLA 2R6KA 1SJZA 3KIJA 3TKSA 4PNGA 4Z2RA 1X5DA 4FQUA 2F8FA 3VI5A 4IJIA 1PN0A 4IN0A 4L8EA 3ME8A 2GT5A 1XWCA 3DRNA 3GL3A 4FYCA 2C3QA 2L4QA 3EWLA 1WE0A 4FH8A 1LU4A 2X49A 4MLYA 2VM1A 2X8HA 3C71A 1S3CA 5IMFA 3KP9A 1AXDA 5D9VA 3RAZA 2GVPA 5FHIA 2KHPA 3F3QA 3BJ5A 3RPPA 2JACA 1GSEA 1DBYA 5DAKA 1TJDA 2LJRA 4ECJA 6GSWA 2TIRA 5IMDA 5ECPB 3QDNA 2K6VA 2LS5A 2P31A 4POMA 1I9DA 1FB0A 4PQ1A 4YAPA 2DKIA 4NWYA 3L9VA 4MZCA 4OWYA 1UC7A 3ZIJA 3FR3A 1RW1A 3TOUA 2H1DA 1O73A 2WULA 2MBTA 3LYKA 5DDLA 5BMUA 3D5JA 3FW2A 3NOFA 4KSMA 3LWAA 1MD3A 2LRNA 4F0BA 3H93A 4IQAA 1U88A 1JFUA 4I97A 5D9WA 4JR6A 1PKWA 2PERA 4CHSA 2HLSA 1T4YA 2UZ8A 4KF9A 4OO4A 1SK1A 5CYYA 1G7EA 4PNFA 5HQPA 3WGEA 3KH9A 4QL7A 4WKWA 2P5RA 5IMCA 4X1UA 4OD7A 5ABRA 2RLIA 1TKDB 3CSHA 1FAAA 3TJJA 1XW5A 3GTUA 1F3AA 3A2VA 3QFAC 2L5LA 2VCVA 1SYXA 2RUFA 1K3OA 5EY6A 1YQ1A 2RUEA 5IMZA 4KAEA 3A5WA 2JZSA 3KTLA 5G5EA 2FGXA 2FWGA 3TKRA 4MF5A 2VIMA 4EIQA 2ALBA 2I3YA 1T1VA 1K3YA 1AQVA 5ID2A 2WJUA 1PFOA 4USSA 2NVLA 2N5BA 3A2XA 5DAKB 3SWLA 4J57E 1TU8A 3GKKA 2C3NA 4JE1A 3IBHA 2DBCA 3G7JA 4EXJA 2V41A 2C80A 2AHEA 3LSZA 1OE7A 1PKZA 2YOIA 3UOMA 5F05A 3TJFA 4G0IA 1YY7A 3GMFA 3KCMA 1QK8A 3MIXA 2HRKA 3H79A 2B5XA 2HXKA 4K7IA 3TKSE 1JZRA 2IMFA 4MH3A 2QC7A 2K18A 17GSA 1HNCA 1XIYA 3EU3A 3EMPA 2PUKC 2H72A 2LNSA 2H8LA 1EEJA 3DYRA 1LJRA 1S3DA 2E0QA 1GSSA 3C1SA 1GH2A 5IMAA 3UMAA 3R3EA 4I5QA 2BMXA 4DVCA 2EIRA 4IS0A 2NTOA 4FIWA 5G30A 1XWBA 5IOXA 3IK9A 3BCIA 3LYPA 4Q5FA 3UBKA 1AAZA 4K8MA 1R5PA 5H5RA 4PUFC 1X9WB 5H5QA 4O7HA 4EE0A 4ZXGA 1QFNA 3GTUB 4N11A 2IPAA 2YANA 4AJ8A 3F4TA 3ZFBA 4OFNA 2YV9A 3N9JA 1Z5YE 5A4VA 4MABA 3WGDA 2H6YA 2N5FA 4PTSA 1V40A 4XHMA 5KN1A 1OYJA 4IKHA 2P0GA 1K0NA 5G31A 4JR4A 1O7UA 1F2EA 2HYXA 4ECCA 1Y25A 5D73A 3GH9A 4MJEA 5EL8A 4YQVA 12GSA 1A2JA 1S3AA 4G0KA 4TOPA
chains in the Genus database with same CATH topology
2HRNA 3QAGA 4Z7XA 3ZMLA 3J7Yk 1SKSB 3QOUA 1A0RP 2H1BA 4YKFA 4GF0A 1SL0B 4TVEA 5D8IA 1KNGA 2HSYA 2DJ3A 5BRTA 4PURA 4HI7A 3Q74A 1GSUA 1U87A 5GSSA 1QXHA 4Q5NA 4LL4B 1AC1A 1THXA 5FT3A 4LMVA 4ECIA 1THOA 4IQ1A 3TKQA 3TRQA 5IMVA 1XWGA 5G1LA 4JU5A 5DCHA 2FA4A 3FZAA 3Q19A 4GSNA 5ECMB 5KEJA 2A2RA 3HDCA 3F63A 4MDCA 1T3BA 1M0UA 4Z2TA 1BX9A 2FWEA 4L5OA 22GSA 3FR9A 1AUCA 4AJ6A 3APQA 1TDIA 3KMOA 2NPBA 3KGKA 3A3TA 3NIVA 4WEYA 2C0EA 4GQFA 5DALB 3W8SA 2ZNMA 1W4VA 4GWRA 3PR8A 4TKYA 3FKFA 1TXXA 2KP2A 2B7JA 4EUYA 3WT2A 3CXGA 4IBPA 1EGRA 1BAYA 2HNLA 5J41A 2LQOA 3F9UA 2B7KA 8GSSA 2OE1A 1K3LA 5CNWA 4HOJA 1SD8A 3IA1A 4LA1A 5IPHA 1WMJA 1GRXA 2A4VA 1XOAA 5ENUA 4AF2A 1GLPA 1M9BA 1PSQA 3M9JA 5GZZB 2KOKA 3ZTLA 3EVIA 3KH7A 5AISA 2VCXA 3I6AA 3EPTA 5J4UA 2CQ9A 4N0VA 1OC9A 3ERFA 3US3A 2VLUA 1SL1B 5A4UA 3GIXA 3L0HA 1MEKA 1A0FA 1GSQA 2H70A 3TRPA 4O92A 3ZREA 4AJ7A 2YPMA 3PGTA 3GKXA 2R0PA 2IN3A 4V2LA 1XW6A 4GQCA 3NZNA 3VWXA 2G2QA 1ZYNA 2X8GA 3WGXA 5JWQB 1SL2B 3D4TA 3E0UA 3BD2A 4N10A 3ZITA 1YKCA 4TR1B 1B4PA 1W89A 3GX0A 5LD0A 3GRXA 1O81A 3BBYA 2IMDA 4O5UA 4NHWA 4IGJA 4WBRD 1F9MA 3HHVA 4NHZA 3MDKA 1MD4A 4ID0A 2AAWA 3GKNA 1VF3A 2MMZA 3D6IA 2EC4A 5JCWA 3GN3A 4E8EA 1V57A 4YAVA 3ZL5A 4JEDA 2JADA 3G7YA 4L0UA 4YQUA 3TJBA 2V1MA 2FD3A 1PL1A 4RQRA 3UIWA 4FYUA 4PGTA 1H75A 3H4KA 3GUSA 1HNBA 4ZBAA 4YKGA 3IV4A 3GH6A 5IOWA 3F4RA 3VWVA 3I43A 5KOWA 2OKAA 4ZB8A 1TRWA 2GSTA 3GA4A 4L0WA 1A8LA 3MSZA 3D4MA 5ELGA 4X0XA 4OCFA 2CVBA 5IO2A 2FY6A 1SKWB 2PGTA 2C8UA 2DIZA 1X9SB 2YWOA 2OACA 1Z6MA 2CAQA 4BVXA 2I4AA 2REMA 3GYKA 4OFMA 1PX7A 3O3TA 4FYBA 1XXUA 4NV2A 1EOHA 5CRGA 3SBCA 1B4QA 4EVMA 1ACVA 4G2EA 1WJKA 2B5YA 3QD9A 1VRSD 1MDKA 1SK0A 5D96A 2DJKA 2B5EA 3IR4A 3IRAA 2OE3A 1NHYA 3IK7A 4GSSA 1R7HA 4ACSA 1ZGNA 4ZL7A 2PVOC 2L6DA 1ERVA 1FOVA 4BL7A 1T7PB 1XVQA 1EP7A 2L5OA 14GSA 2LKUA 1VF2A 1PRXA 3CRTA 2DSAA 2WFCA 4MNNA 5B8BA 4GSTA 1O85A 4MPGA 5B6MA 1AIUA 3HCZA 4K6XA 2TRXA 5J9CA 2D2ZA 1WIKA 2DJ2A 1RQMA 4LMWA 3UBLA 2HZEA 3ERGA 4GCIA 3BOAA 4K2DA 3CYNA 5ECIB 3D21A 2VUPA 1WOUA 3UARA 1AQWA 4RUVA 1U3IA 4MF7A 3ZZXA 3TGZA 1GSFA 2AB6A 1YEPA 4KA0A 6GSXA 4I8BA 4TR0A 1SYRA 1EZKA 1ZOFA 3ED3A 1XWAA 1NSWA 1WRYA 1G6YA 2OBKA 2E2GA 5IPGA 2CVDA 3R2QA 2R4VA 3FMWA 3EURA 1BG5A 1K0DA 1IYHA 4MPFA 1VGLA 4RQXA 4WF4A 2RIIA 4Z2UA 1FO5A 3KTBA 3TOTA 2OE0A 3WD6A 4HEA2 4F9ZA 2B1KA 2ZCTA 3S9FA 1GWCA 1A2LA 3QPMA 1BQ7A 4EF0A 2DMMA 2VL2C 4ULXA 1K0BA 1GUMA 1PD21 3LJRA 1Z6NA 4WXTA 4I6XA 1OC3A 2MZCA 1ZL9A 4P3YB 4EC0A 4ZB6A 2R2JA 3AY8A 1LBKA 5G2ZA 1E6BA 2OADA 3LXZA 2VD0A 2VD1A 2VLVA 5B7CA 2MBSA 4BL7B 3M3MA 3QFBC 2PBJA 2FLSA 5A4WA 4HUAA 2GLRA 2YWIA 3EE2A 2DC5A 1N8JA 5JWOB 4KNDA 1FOHA 5A5KA 4DSRA 1K0OA 3WYWA 1SJIA 1AW9A 5ECNB 1TW9A 2GDRA 3HVXA 5AN1A 2QA2A 4NPBA 4BWSA 3LW9A 1JZWA 2H6XA 4MH2A 3P7XA 2LUSA 5KN3A 1QUWA 3UVTA 4WR5A 1USBA 4QQ7A 2HZEB 2L6CA 1URMA 3DXBA 5H5SA 1XBSA 1NW2A 3KP8A 3FZ5A 3O6TA 1A2MA 2HFDA 4LLRA 4ZL9A 3N5OA 1JHBA 2H1GA 3EU4A 1HD2A 2HRAA 4ISDA 4HU7A 4AGSA 4O32A 2FHEA 2H1AA 2CAIA 1OC8A 3P90A 4JRRA 2GQLA 1MDIA 1HYUA 3UAPA 4V2NA 3TDGA 3UJ1A 6GSYA 4JZQA 2JU5A 9GSSA 2BJXA 1GUKA 2K9FA 2RM5A 3CMIA 2QGVA 1A8YA 5CO3A 1AQXA 5ID2B 3F4SA 5KN0A 1SENA 2R37A 2IMIA 3MYDA 2H0HA 2PPTA 1DE2A 5F8BA 5DQSA 2GQKA 3F0IA 4MMMA 4V2MA 4MK3A 4PQHA 1BEDA 5E59A 4POKA 3IAM2 3DGQA 2WS2A 2YP6A 1A23A 1EV9A 5IM9A 1WP0A 2VO4A 3FZ9A 3G9BA 4A5PA 2X8CA 1N2AA 1TI1A 4F0CA 3IC4A 3KEBA 1JZOA 3GSSA 1F37A 3DVXA 4ML6A 2JSZA 2VCQA 2LJKA 1OVNA 1GP1A 4O5RA 3TCOA 6GSTA 2O7KA 2MYGA 3HJOA 4XS4A 4WETA 1GL8A 1C72A 1IYIA 1JLVA 2CZ3A 1YF1A 4XCSA 1Z7PA 11GSA 1FW1A 2N5AA 3RHBA 3W8JA 1TTZA 4TR4A 3P8WA 4CW9A 1T4ZA 4XRDA 1XW9A 4NMUA 5F06A 4CY8A 4IELA 2FA8A 3L78A 4F2IA 3ZIVA 2ON5A 4HDEA 2A4HA 3VLNA 3IPZA 3C73A 1R5AA 3Q18A 2OA7A 4OMVA 2PWJA 4N0ZA 4HJ2A 2F3MA 3APSA 1TOFA 2XC2A 3C8EA 3ERWA 4KE3A 1K0MA 1OKDA 4OO5A 4DSSA 2HSMA 4TXOA 2YCDA 4XS6A 2VAFA 3F6DA 4LL1B 2YWNA 1FHEA 2R0CA 2KP1A 4V1Ag 3LGCA 2FNOA 3EYTA 2GSQA 5ELAA 3VURA 3VPTA 2LQQA 2H6ZA 2HRFA 4WF5A 4IP6A 4H86A 2PN8A 4NV5A 1GTUA 1GLQA 1DSBA 3WT1A 1HNAA 2GTUA 5J3RA 1GSYA 2XBIA 2L59A 1GUHA 2MMAA 1TRUA 1UVZA 4XRAA 2DJ1A 16GSA 5JCGA 2H0GA 3TB2A 3VWWA 1K0AA 5DJMA 4G9HA 1B9YC 3LFLA 2M46A 4FO5A 2CX3A 2WDUA 18GSA 5GSTA 1M9AA 3HZ8A 1GSDA 4IJ3A 4ZB9A 4Q5RA 4RI6A 1PMTA 2A2SA 4TRXA 4XS4B 2VCZA 3J7Yb 5JCUA 1TRVA 2IWTA 5DQYA 3TRXA 4EO3A 3M1GA 1Y6EA 2DIYA 5ECQB 2CX4A 4KDYA 2IFQA 2R0GA 2ES7A 2DJ0A 1XZOA 5ECRB 6GSVA 1XVWA 5HR0A 3U6VA 2DLXA 3C7MA 4KX4A 4ZIJA 5G1KA 1SU9A 4QL9A 4MF6A 3GL5A 4KB3A 3A5IA 4YQMA 5KN2A 1XFLA 3A2WA 5DJLA 4J2FA 5E4WA 1VF1A 2GZZA 1YJ6A 4BA7A 1XOBA 3ZVJA 5CRHA 4DEJA 4K1FA 3IE3A 1ZCPA 1X5EA 3DWVA 2VCWA 4K0NA 2H0IA 2R3XA 2V2GA 4DSQA 3UVHA 2B1LA 1DUGA 3ZRDA 3CSIA 2I9HA 3HKRA 1B8XA 2LV3A 4XS1A 1I5GA 1O6JA 2XPEA 1QQ2A 3IHGA 1CQGA 4G19A 1OC9B 4ML1A 1G0TA 2CV4A 1F3BA 1BJXA 4ZL8A 2CVKA 3ZLPA 2LRTA 4E8HA 4EDYA 3L9UA 4HJMA 1J9BA 1KEBA 1WPIA 4PQIA 3CSJA 3MAKA 1G7OA 1BYEA 3M8NA 4KUNA 2LEGA 3GFKA 3IDVA 3QAVA 1O8XA 2E7PA 5C04A 4BWQA 2GSSA 4RI7A 3U5RE 2IL3A 1EOGA 4X4JA 5HFKA 2H75A 3FEUA 4K7OA 1T00A 1VF4A 2IMEA 2WCIA 4OFTA 1PQNA 2IFQB 5DBQA 1M2BA 1V98A 5ECLB 1E2YA 3GSTA 4EKZA 1F6MC 5ECKB 1ON4A 13GSA 4XTSA 5AIVA 4I2TA 1J08A 3VFIA 5L71A 2LRCA 4IHUA 2QA1A 2BTOT 3L4NA 3ME7A 3ZMKA 4TXVA 4ICYA 3MWHA 2WB9A 5HFGA 1OE8A 3K8NA 5D9TA 3TKPA 1PA3A 2J9HA 4K5RA 3GKMA 5AGYA 4K5SA 3IHQA 4IW9A 1FVJA 2OBIA 5FWGA 1FG4A 3KM6A 2E2MA 4G0LA 3W6GA 1ZYEA 1ERWA 2PU9C 4HQSA 1FVKA 1Z9HA 3BCKA 1TI3A 3HD5A 2AUVA 2WZ9A 3APOA 4POLA 2X99A 3VI7A 3GV1A 3TJKA 5F07A 2C4JA 4BVXB 4MA9A 2YZHA 4F03A 1V2AA 1TRSA 3CBUA 2EIOA 2JZRA 1TK8B 1X5CA 5F0GA 5C00A 2H19A 4L5LA 2JSYA 1Q98A 3UL3A 1ERTA 4NAXA 1JZDA 2FWHA 5HR3A 4BPYA 2Z9SA 1TK5B 3F6FA 3TKSC 2VOCA 3I9V2 3P2AA 3D22A 5D9XA 1HQOA 5EVOA 1DE1A 2MMOA 4HZ2A 5EPFA 4KDUA 3G7IA 2O8VB 2JL4A 2GS3A 2OJLA 3VPQA 1H4OA 2B3SA 3H8QA 4KH7A 4BVYA 2V6OA 2GGTA 2J23A 5GAND 1O8WA 2HSHA 1PN9A 3GNJA 2NBSA 2QSIA 3FYGA 1SD9A 3FY7A 4J56E 6GSSA 2ON7A 3CTFA 4EDZA 2YWMA 3IAS2 1SK2A 2L4CA 5CREA 4D73A 3KXOA 1PL2A 4K0GA 3LXTA 2V32A 2GZPA 5J5NA 3CRUA 1PGTA 1GNWA 1X9MB 2LJAA 4TW5A 1B9XC 2YZUA 4KGIA 2IMKA 5HR1A 2H01A 4X43A 10GSA 2GSRA 5D93A 3QR6A 1X0RA 5AIXA 4KCAA 1UA5A 2LNTA 2HE3A 2C3TA 2RM6A 4TN8A 3M9KA 1YEXA 2O89A 3CTGA 5KOXA 2F9SA 2WRTA 2M80A 3M0FA 3E9JB 2G0FA 2QKEA 3PINA 1EEMA 3E3EA 2X4AA 3KD0A 4GXZA 5DALA 1EV4A 3FHKA 3FK8A 2DJJA 3QMXA 2M72A 6GSUA 2IJYA 3RDWA 2DMLA 2O87A 2C1YA 3V1WA 1XPVA 3F3RA 4PUAA 1EP8A 4O5QA 1U3AA 2VCTA 4MJCA 2C0DA 3LEFA 2NDOA 4MZWA 1EGOA 2LSTA 1M2AA 20GSA 1M2DA 4GTUA 5DCGA 1SJ6A 4KW6A 4MP4A 1GTBA 3Q6OA 1KBNA 3PPUA 3FR6A 2XBQA 5GAPD 3KMNA 2YNXA 5HFIA 4BVYB 2TRCP 3FRCA 2V6KA 2VL3A 4Q5QA 1NHOA 7GSSA 4KSOA 3LORA 2B6MA 3EINA 3GX8A 2YN1A 2KLXA 5HR2A 2WGRA 19GSA 5INYA 2YJ7A 2CT6A 1ZYQB 3RBTA 4OCEA 3TJGA 3ZFLA 3JCML 4D73B 3HZ4A 4KCEA 1EWXA 2CA8A 1WWJA 3MNGA 1FB6A 1KTEA 1Z7RA 4GLTA 1U6TA 5DVBA 2K8SA 3DVWA 1GNEA 1Q4JA 4HU9A 3I69A 1ERUA 2MMNA 3EC3A 4YH2A 4K9ZA 1ML6A 4G10A 4ECBA 4TR1A 3RPNA 2K8VA 3QCPA 1ABAA 1YF0A 2GT6A 3LG6A 1CQHA 2HI7A 4ZBBA 3DEXA 3RHCA 4MZBA 4ZILA 5IO0A 3DKSA 2EIQA 4EL1A 2P5QA 4EIPA 2R5GA 3TUEA 5COHA 3HVSA 2PVQA 2CZ2A 4MJAA 3FZ4A 5ECHB 4I2UA 5B8AA 1OAZA 1JLWA 2X64A 4MJBA 1ST9A 1J0FA 2I81A 3F8UA 1Z3EA 1A24A 3DIEA 3ISOA 2HZFA 2H71A 2LTKA 2VLTA 1YKAA 1GTIA 3EMXA 2F8AA 5JWRB 3HXSA 1K0CA 4IP1A 2H30A 2I1UA 4N30A 1V9WA 1M7TA 3HJPA 4IVFA 2FCHA 5CAXA 1ZZYA 4CY6A 1G6WA 1XCCA 2VM2A 1XWKA 2GZYA 4GRFA 2C0GA 1QGVA 1R26A 1TK0B 1OKTA 1YZXA 5LNKe 2YJHA 2JZTA 4HZ4A 2H76A 2HT9A 3ZVJD 2YV7A 3HJMA 5G5FA 3HYPA 2FUG2 1RK4A 4F82A 5LCZA 1B48A 3OR5A 4XIHA 5B6NA 4PXOA 4HS1A 1V58A 4MCUA 2FWFA 4POBA 3D0ZA 1NM3A 1PX6A 1UN2A 3KJYA 4NXIA 5ECSA 5CRDA 2ZUPA 5IQYA 4WR4A 3LQ7A 2O85A 4K2XA 2DKHA 4CDOA 1SKRB 1GULA 1TU7A 2H73A 2F51A 2L57A 1MTCA 2KUCA 4HQZA 1YDKA 4ILFA 4ZBDA 3H1NA 5J9BA 3HA9A 1MDJA 4V1Ap 4K7NA 4DSSB 3VK9A 4TXOB 1ILOA 5CRWA 3O76A 3IOSA 3L9SA 2AYTA 2XHFA 2VL9A 1T8EB 4KDXA 4TR3A 2GQMA 1ZMAA 3C1RA 3PH9A 3IC8A 1M99A 2H74A 5IIZA 2PMTA 5ECOB 1R4WA 3DD3A 4WBJA 3GURA 2IIYA 1GTAA 3VWUA 1ZYPA 2AJQB 3HVVA 2A2PA 2VL2A 3IXRA 3ZYWA 4PX1A 3HY2A 2H66A 3QAWA 2C0FA 2XPDA 2AV4A 3KZQA 4JBBA 1QMVA 1TP9A 3GHAA 3UEMA 5CP1A 3DMLA 2R6KA 1SJZA 3KIJA 3TKSA 4PNGA 4Z2RA 1X5DA 4FQUA 2F8FA 3VI5A 4IJIA 1PN0A 4IN0A 4L8EA 3ME8A 2GT5A 1XWCA 3DRNA 3GL3A 4FYCA 2C3QA 2L4QA 3EWLA 1WE0A 4FH8A 1LU4A 2X49A 4MLYA 2VM1A 2X8HA 3C71A 1S3CA 5IMFA 3KP9A 1AXDA 5D9VA 3RAZA 2GVPA 5FHIA 2KHPA 3F3QA 3BJ5A 3RPPA 2JACA 1GSEA 1DBYA 5DAKA 1TJDA 2LJRA 4ECJA 6GSWA 2TIRA 5IMDA 5ECPB 3QDNA 2K6VA 2LS5A 2P31A 4POMA 1I9DA 1FB0A 4PQ1A 4YAPA 2DKIA 4NWYA 3L9VA 4MZCA 4OWYA 1UC7A 3ZIJA 3FR3A 1RW1A 3TOUA 2H1DA 1O73A 2WULA 2MBTA 3LYKA 5DDLA 5BMUA 3D5JA 3FW2A 3NOFA 4KSMA 3LWAA 1MD3A 2LRNA 4F0BA 3H93A 4IQAA 1U88A 1JFUA 4I97A 5D9WA 4JR6A 1PKWA 2PERA 4CHSA 2HLSA 1T4YA 2UZ8A 4KF9A 4OO4A 1SK1A 5CYYA 1G7EA 4PNFA 5HQPA 3WGEA 3KH9A 4QL7A 4WKWA 2P5RA 5IMCA 4X1UA 4OD7A 5ABRA 2RLIA 1TKDB 3CSHA 1FAAA 3TJJA 1XW5A 3GTUA 1F3AA 3A2VA 3QFAC 2L5LA 2VCVA 1SYXA 2RUFA 1K3OA 5EY6A 1YQ1A 2RUEA 5IMZA 4KAEA 3A5WA 2JZSA 3KTLA 5G5EA 2FGXA 2FWGA 3TKRA 4MF5A 2VIMA 4EIQA 2ALBA 2I3YA 1T1VA 1K3YA 1AQVA 5ID2A 2WJUA 4USSA 2NVLA 2N5BA 3A2XA 5DAKB 3SWLA 4J57E 1TU8A 3GKKA 2C3NA 4JE1A 3IBHA 2DBCA 3G7JA 4EXJA 2V41A 2C80A 2AHEA 3LSZA 1OE7A 1PKZA 2YOIA 3UOMA 5F05A 3TJFA 4G0IA 1YY7A 3GMFA 3KCMA 1QK8A 3MIXA 2HRKA 3H79A 2B5XA 2HXKA 4K7IA 3TKSE 1JZRA 2IMFA 4MH3A 2QC7A 2K18A 17GSA 1HNCA 1XIYA 3EU3A 3EMPA 2PUKC 2H72A 2LNSA 2H8LA 1EEJA 3DYRA 1LJRA 1S3DA 2E0QA 1GSSA 3C1SA 1GH2A 5IMAA 3UMAA 3R3EA 4I5QA 2BMXA 4DVCA 2EIRA 4IS0A 2NTOA 4FIWA 5G30A 1XWBA 5IOXA 3IK9A 3BCIA 3LYPA 4Q5FA 3UBKA 1AAZA 4K8MA 1R5PA 5H5RA 4PUFC 1X9WB 5H5QA 4O7HA 4EE0A 4ZXGA 1QFNA 3GTUB 4N11A 2IPAA 2YANA 4AJ8A 3F4TA 3ZFBA 4OFNA 2YV9A 3N9JA 1Z5YE 5A4VA 4MABA 3WGDA 2H6YA 2N5FA 4PTSA 1V40A 4XHMA 5KN1A 1OYJA 4IKHA 2P0GA 1K0NA 5G31A 4JR4A 1O7UA 1F2EA 2HYXA 4ECCA 1Y25A 5D73A 3GH9A 4MJEA 5EL8A 4YQVA 12GSA 1A2JA 1S3AA 4G0KA 4TOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRN A;  3QAG A;  4Z7X A;  3ZML A;  3J7Y k;  1SKS B;  3QOU A;  1A0R P;  2H1B A;  4GF0 A;  1SL0 B;  4TVE A;  5D8I A;  1KNG A;  2HSY A;  2DJ3 A;  4PUR A;  4HI7 A;  3Q74 A;  1GSU A;  1U87 A;  5GSS A;  1QXH A;  4Q5N A;  4LL4 B;  1AC1 A;  1THX A;  5FT3 A;  4LMV A;  4ECI A;  1THO A;  4IQ1 A;  3TKQ A;  3TRQ A;  5IMV A;  1XWG A;  5G1L A;  4JU5 A;  5DCH A;  2FA4 A;  3FZA A;  3Q19 A;  4GSN A;  5ECM B;  5KEJ A;  2A2R A;  3HDC A;  3F63 A;  4MDC A;  1T3B A;  1M0U A;  1BX9 A;  2FWE A;  4L5O A;  22GS A;  3FR9 A;  1AUC A;  4AJ6 A;  3APQ A;  1TDI A;  3KMO A;  2NPB A;  3KGK A;  3A3T A;  3NIV A;  4WEY A;  2C0E A;  4GQF A;  5DAL B;  3W8S A;  2ZNM A;  1W4V A;  4GWR A;  3PR8 A;  4TKY A;  3FKF A;  1TXX A;  2KP2 A;  2B7J A;  4EUY A;  3WT2 A;  3CXG A;  4IBP A;  1EGR A;  1BAY A;  2HNL A;  5J41 A;  2LQO A;  3F9U A;  2B7K A;  8GSS A;  2OE1 A;  1K3L A;  5CNW A;  4HOJ A;  1SD8 A;  3IA1 A;  4LA1 A;  5IPH A;  1WMJ A;  1GRX A;  2A4V A;  1XOA A;  5ENU A;  4AF2 A;  1GLP A;  1M9B A;  1PSQ A;  3M9J A;  5GZZ B;  2KOK A;  3ZTL A;  3EVI A;  3KH7 A;  5AIS A;  2VCX A;  3I6A A;  5J4U A;  2CQ9 A;  4N0V A;  1OC9 A;  3ERF A;  3US3 A;  2VLU A;  1SL1 B;  5A4U A;  3GIX A;  3L0H A;  1MEK A;  1A0F A;  1GSQ A;  2H70 A;  3TRP A;  4O92 A;  3ZRE A;  4AJ7 A;  2YPM A;  3PGT A;  3GKX A;  2IN3 A;  4V2L A;  1XW6 A;  4GQC A;  3NZN A;  3VWX A;  2G2Q A;  2X8G A;  3WGX A;  5JWQ B;  1SL2 B;  3D4T A;  3E0U A;  3BD2 A;  4N10 A;  3ZIT A;  1YKC A;  4TR1 B;  1B4P A;  1W89 A;  3GX0 A;  5LD0 A;  3GRX A;  1O81 A;  3BBY A;  2IMD A;  4NHW A;  4IGJ A;  4WBR D;  1F9M A;  3HHV A;  4NHZ A;  3MDK A;  1MD4 A;  4ID0 A;  2AAW A;  3GKN A;  1VF3 A;  2MMZ A;  3D6I A;  2EC4 A;  5JCW A;  3GN3 A;  4E8E A;  1V57 A;  4YAV A;  3ZL5 A;  4JED A;  2JAD A;  3G7Y A;  4L0U A;  4YQU A;  3TJB A;  2V1M A;  2FD3 A;  1PL1 A;  4RQR A;  3UIW A;  4FYU A;  4PGT A;  1H75 A;  3H4K A;  3GUS A;  1HNB A;  4ZBA A;  3IV4 A;  3GH6 A;  5IOW A;  3F4R A;  3VWV A;  3I43 A;  2OKA A;  4ZB8 A;  1TRW A;  2GST A;  3GA4 A;  4L0W A;  1A8L A;  3MSZ A;  3D4M A;  5ELG A;  4X0X A;  4OCF A;  2CVB A;  5IO2 A;  2FY6 A;  1SKW B;  2PGT A;  2C8U A;  2DIZ A;  1X9S B;  2YWO A;  2OAC A;  1Z6M A;  2CAQ A;  4BVX A;  2I4A A;  2REM A;  3GYK A;  4OFM A;  1PX7 A;  3O3T A;  4FYB A;  1XXU A;  4NV2 A;  1EOH A;  5CRG A;  3SBC A;  1B4Q A;  4EVM A;  1ACV A;  4G2E A;  1WJK A;  2B5Y A;  3QD9 A;  1VRS D;  1MDK A;  1SK0 A;  5D96 A;  2DJK A;  2B5E A;  3IR4 A;  3IRA A;  2OE3 A;  1NHY A;  3IK7 A;  4GSS A;  1R7H A;  4ACS A;  1ZGN A;  4ZL7 A;  2PVO C;  2L6D A;  1ERV A;  1FOV A;  4BL7 A;  1T7P B;  1XVQ A;  1EP7 A;  2L5O A;  14GS A;  2LKU A;  1VF2 A;  1PRX A;  3CRT A;  2DSA A;  2WFC A;  5B8B A;  4GST A;  1O85 A;  4MPG A;  5B6M A;  1AIU A;  3HCZ A;  4K6X A;  2TRX A;  5J9C A;  2D2Z A;  1WIK A;  2DJ2 A;  1RQM A;  4LMW A;  3UBL A;  2HZE A;  3ERG A;  4GCI A;  3BOA A;  4K2D A;  3CYN A;  5ECI B;  3D21 A;  2VUP A;  1WOU A;  3UAR A;  1AQW A;  4RUV A;  1U3I A;  4MF7 A;  3ZZX A;  3TGZ A;  1GSF A;  2AB6 A;  1YEP A;  4KA0 A;  6GSX A;  4I8B A;  4TR0 A;  1SYR A;  1EZK A;  1ZOF A;  3ED3 A;  1XWA A;  1NSW A;  1WRY A;  1G6Y A;  2OBK A;  2E2G A;  5IPG A;  2CVD A;  3R2Q A;  2R4V A;  3EUR A;  1BG5 A;  1K0D A;  1IYH A;  4MPF A;  1VGL A;  4RQX A;  4WF4 A;  2RII A;  1FO5 A;  3KTB A;  3TOT A;  2OE0 A;  3WD6 A;  4HEA 2;  4F9Z A;  2B1K A;  2ZCT A;  3S9F A;  1GWC A;  1A2L A;  3QPM A;  1BQ7 A;  4EF0 A;  2DMM A;  2VL2 C;  4ULX A;  1K0B A;  1GUM A;  1PD2 1;  3LJR A;  1Z6N A;  4WXT A;  4I6X A;  1OC3 A;  2MZC A;  1ZL9 A;  4P3Y B;  4EC0 A;  4ZB6 A;  2R2J A;  3AY8 A;  1LBK A;  5G2Z A;  1E6B A;  2OAD A;  3LXZ A;  2VD0 A;  2VD1 A;  2VLV A;  5B7C A;  2MBS A;  3M3M A;  3QFB C;  2PBJ A;  2FLS A;  5A4W A;  4HUA A;  2GLR A;  2YWI A;  3EE2 A;  2DC5 A;  1N8J A;  5JWO B;  4KND A;  5A5K A;  4DSR A;  1K0O A;  3WYW A;  1SJI A;  1AW9 A;  5ECN B;  1TW9 A;  2GDR A;  3HVX A;  5AN1 A;  4NPB A;  4BWS A;  1JZW A;  2H6X A;  4MH2 A;  3P7X A;  2LUS A;  5KN3 A;  1QUW A;  3UVT A;  4WR5 A;  1USB A;  4QQ7 A;  2HZE B;  2L6C A;  1URM A;  3DXB A;  5H5S A;  1XBS A;  1NW2 A;  3KP8 A;  3FZ5 A;  3O6T A;  1A2M A;  2HFD A;  4LLR A;  4ZL9 A;  3N5O A;  1JHB A;  2H1G A;  3EU4 A;  1HD2 A;  4AGS A;  4ISD A;  4HU7 A;  4O32 A;  2FHE A;  2H1A A;  2CAI A;  1OC8 A;  3P90 A;  4JRR A;  2GQL A;  1MDI A;  1HYU A;  3UAP A;  4V2N A;  3TDG A;  3UJ1 A;  6GSY A;  4JZQ A;  2JU5 A;  9GSS A;  2BJX A;  1GUK A;  2K9F A;  2RM5 A;  3CMI A;  2QGV A;  1A8Y A;  5CO3 A;  1AQX A;  5ID2 B;  3F4S A;  5KN0 A;  1SEN A;  2R37 A;  2IMI A;  2H0H A;  2PPT A;  1DE2 A;  5F8B A;  5DQS A;  2GQK A;  3F0I A;  4MMM A;  4V2M A;  4MK3 A;  4PQH A;  1BED A;  5E59 A;  4POK A;  3IAM 2;  3DGQ A;  2WS2 A;  2YP6 A;  1A23 A;  1EV9 A;  5IM9 A;  1WP0 A;  2VO4 A;  3FZ9 A;  3G9B A;  2X8C A;  1N2A A;  1TI1 A;  4F0C A;  3IC4 A;  3KEB A;  1JZO A;  3GSS A;  1F37 A;  3DVX A;  4ML6 A;  2JSZ A;  2VCQ A;  2LJK A;  1OVN A;  1GP1 A;  4O5R A;  3TCO A;  6GST A;  2O7K A;  2MYG A;  3HJO A;  4XS4 A;  4WET A;  1GL8 A;  1C72 A;  1IYI A;  1JLV A;  2CZ3 A;  1YF1 A;  4XCS A;  1Z7P A;  11GS A;  1FW1 A;  2N5A A;  3RHB A;  3W8J A;  1TTZ A;  4TR4 A;  3P8W A;  4CW9 A;  1T4Z A;  4XRD A;  1XW9 A;  4NMU A;  5F06 A;  4IEL A;  2FA8 A;  3L78 A;  4F2I A;  3ZIV A;  2ON5 A;  4HDE A;  3VLN A;  3IPZ A;  3C73 A;  1R5A A;  3Q18 A;  2OA7 A;  4OMV A;  2PWJ A;  4N0Z A;  4HJ2 A;  2F3M A;  3APS A;  1TOF A;  2XC2 A;  3C8E A;  3ERW A;  4KE3 A;  1K0M A;  1OKD A;  4OO5 A;  4DSS A;  4TXO A;  2YCD A;  4XS6 A;  2VAF A;  3F6D A;  4LL1 B;  2YWN A;  1FHE A;  2KP1 A;  4V1A g;  3LGC A;  2FNO A;  3EYT A;  2GSQ A;  5ELA A;  3VUR A;  3VPT A;  2LQQ A;  2H6Z A;  2HRF A;  4WF5 A;  4IP6 A;  4H86 A;  2PN8 A;  4NV5 A;  1GTU A;  1GLQ A;  1DSB A;  3WT1 A;  1HNA A;  2GTU A;  5J3R A;  1GSY A;  2XBI A;  2L59 A;  1GUH A;  2MMA A;  1TRU A;  1UVZ A;  4XRA A;  2DJ1 A;  16GS A;  5JCG A;  2H0G A;  3TB2 A;  3VWW A;  1K0A A;  5DJM A;  4G9H A;  1B9Y C;  3LFL A;  2M46 A;  4FO5 A;  2CX3 A;  2WDU A;  18GS A;  5GST A;  1M9A A;  3HZ8 A;  1GSD A;  4IJ3 A;  4ZB9 A;  4Q5R A;  4RI6 A;  1PMT A;  2A2S A;  4TRX A;  4XS4 B;  2VCZ A;  3J7Y b;  5JCU A;  1TRV A;  2IWT A;  5DQY A;  3TRX A;  4EO3 A;  3M1G A;  1Y6E A;  2DIY A;  5ECQ B;  2CX4 A;  4KDY A;  2IFQ A;  2ES7 A;  2DJ0 A;  1XZO A;  5ECR B;  6GSV A;  1XVW A;  5HR0 A;  3U6V A;  2DLX A;  3C7M A;  4KX4 A;  4ZIJ A;  5G1K A;  1SU9 A;  4QL9 A;  4MF6 A;  3GL5 A;  4KB3 A;  4YQM A;  5KN2 A;  1XFL A;  3A2W A;  5DJL A;  4J2F A;  5E4W A;  1VF1 A;  2GZZ A;  1YJ6 A;  4BA7 A;  1XOB A;  3ZVJ A;  5CRH A;  4DEJ A;  4K1F A;  3IE3 A;  1ZCP A;  1X5E A;  3DWV A;  2VCW A;  4K0N A;  2H0I A;  2R3X A;  2V2G A;  4DSQ A;  3UVH A;  2B1L A;  1DUG A;  3ZRD A;  3CSI A;  2I9H A;  3HKR A;  1B8X A;  2LV3 A;  4XS1 A;  1I5G A;  1O6J A;  2XPE A;  1QQ2 A;  1CQG A;  4G19 A;  1OC9 B;  4ML1 A;  1G0T A;  2CV4 A;  1F3B A;  1BJX A;  4ZL8 A;  2CVK A;  3ZLP A;  2LRT A;  4E8H A;  4EDY A;  3L9U A;  4HJM A;  1J9B A;  1KEB A;  1WPI A;  4PQI A;  3CSJ A;  3MAK A;  1G7O A;  1BYE A;  3M8N A;  4KUN A;  2LEG A;  3GFK A;  3IDV A;  3QAV A;  1O8X A;  2E7P A;  5C04 A;  4BWQ A;  2GSS A;  4RI7 A;  3U5R E;  2IL3 A;  1EOG A;  5HFK A;  2H75 A;  3FEU A;  4K7O A;  1T00 A;  1VF4 A;  2IME A;  2WCI A;  4OFT A;  1PQN A;  2IFQ B;  5DBQ A;  1M2B A;  1V98 A;  5ECL B;  1E2Y A;  3GST A;  4EKZ A;  1F6M C;  5ECK B;  1ON4 A;  13GS A;  4XTS A;  5AIV A;  4I2T A;  1J08 A;  3VFI A;  5L71 A;  2LRC A;  4IHU A;  2BTO T;  3L4N A;  3ME7 A;  3ZMK A;  4TXV A;  3MWH A;  2WB9 A;  5HFG A;  1OE8 A;  3K8N A;  5D9T A;  3TKP A;  1PA3 A;  2J9H A;  3GKM A;  5AGY A;  3IHQ A;  4IW9 A;  1FVJ A;  2OBI A;  5FWG A;  1FG4 A;  3KM6 A;  2E2M A;  3W6G A;  1ZYE A;  1ERW A;  2PU9 C;  4HQS A;  1FVK A;  1Z9H A;  3BCK A;  1TI3 A;  3HD5 A;  2AUV A;  2WZ9 A;  3APO A;  4POL A;  2X99 A;  3VI7 A;  3GV1 A;  3TJK A;  5F07 A;  2C4J A;  4MA9 A;  2YZH A;  4F03 A;  1V2A A;  1TRS A;  3CBU A;  2EIO A;  2JZR A;  1TK8 B;  1X5C A;  5F0G A;  5C00 A;  2H19 A;  4L5L A;  2JSY A;  1Q98 A;  3UL3 A;  1ERT A;  4NAX A;  1JZD A;  2FWH A;  5HR3 A;  4BPY A;  2Z9S A;  1TK5 B;  3F6F A;  3TKS C;  2VOC A;  3I9V 2;  3P2A A;  3D22 A;  5D9X A;  1HQO A;  5EVO A;  1DE1 A;  2MMO A;  4HZ2 A;  5EPF A;  4KDU A;  3G7I A;  2O8V B;  2JL4 A;  2GS3 A;  2OJL A;  3VPQ A;  1H4O A;  2B3S A;  3H8Q A;  4KH7 A;  4BVY A;  2V6O A;  2GGT A;  2J23 A;  5GAN D;  1O8W A;  2HSH A;  1PN9 A;  3GNJ A;  2NBS A;  2QSI A;  3FYG A;  1SD9 A;  3FY7 A;  4J56 E;  6GSS A;  2ON7 A;  3CTF A;  4EDZ A;  2YWM A;  3IAS 2;  1SK2 A;  2L4C A;  5CRE A;  4D73 A;  3KXO A;  1PL2 A;  4K0G A;  3LXT A;  2V32 A;  2GZP A;  5J5N A;  3CRU A;  1PGT A;  1GNW A;  1X9M B;  2LJA A;  4TW5 A;  1B9X C;  2YZU A;  4KGI A;  2IMK A;  5HR1 A;  2H01 A;  4X43 A;  10GS A;  2GSR A;  5D93 A;  3QR6 A;  1X0R A;  5AIX A;  4KCA A;  1UA5 A;  2LNT A;  2HE3 A;  2C3T A;  2RM6 A;  4TN8 A;  3M9K A;  1YEX A;  2O89 A;  3CTG A;  2F9S A;  2WRT A;  2M80 A;  3M0F A;  3E9J B;  2G0F A;  2QKE A;  3PIN A;  1EEM A;  3E3E A;  3KD0 A;  4GXZ A;  5DAL A;  1EV4 A;  3FHK A;  3FK8 A;  2DJJ A;  3QMX A;  2M72 A;  6GSU A;  2IJY A;  3RDW A;  2DML A;  2O87 A;  2C1Y A;  3V1W A;  1XPV A;  3F3R A;  4PUA A;  1EP8 A;  1U3A A;  2VCT A;  4MJC A;  2C0D A;  3LEF A;  2NDO A;  4MZW A;  1EGO A;  2LST A;  1M2A A;  20GS A;  1M2D A;  4GTU A;  5DCG A;  1SJ6 A;  4KW6 A;  4MP4 A;  1GTB A;  3Q6O A;  1KBN A;  3FR6 A;  2XBQ A;  5GAP D;  3KMN A;  2YNX A;  5HFI A;  2TRC P;  3FRC A;  2V6K A;  2VL3 A;  4Q5Q A;  1NHO A;  7GSS A;  4KSO A;  3LOR A;  2B6M A;  3EIN A;  3GX8 A;  2YN1 A;  2KLX A;  5HR2 A;  2WGR A;  19GS A;  5INY A;  2YJ7 A;  2CT6 A;  1ZYQ B;  3RBT A;  4OCE A;  3TJG A;  3ZFL A;  3JCM L;  4D73 B;  3HZ4 A;  4KCE A;  1EWX A;  2CA8 A;  1WWJ A;  3MNG A;  1FB6 A;  1KTE A;  1Z7R A;  4GLT A;  1U6T A;  5DVB A;  2K8S A;  3DVW A;  1GNE A;  1Q4J A;  4HU9 A;  3I69 A;  1ERU A;  2MMN A;  3EC3 A;  4YH2 A;  4K9Z A;  1ML6 A;  4G10 A;  4ECB A;  4TR1 A;  3RPN A;  2K8V A;  3QCP A;  1ABA A;  1YF0 A;  2GT6 A;  3LG6 A;  1CQH A;  2HI7 A;  4ZBB A;  3DEX A;  3RHC A;  4MZB A;  4ZIL A;  5IO0 A;  3DKS A;  2EIQ A;  4EL1 A;  2P5Q A;  2R5G A;  3TUE A;  5COH A;  3HVS A;  2PVQ A;  2CZ2 A;  4MJA A;  3FZ4 A;  5ECH B;  4I2U A;  5B8A A;  1OAZ A;  1JLW A;  2X64 A;  4MJB A;  1ST9 A;  1J0F A;  2I81 A;  3F8U A;  1Z3E A;  1A24 A;  3DIE A;  3ISO A;  2HZF A;  2H71 A;  2LTK A;  2VLT A;  1YKA A;  1GTI A;  3EMX A;  2F8A A;  5JWR B;  3HXS A;  1K0C A;  4IP1 A;  2H30 A;  2I1U A;  4N30 A;  1V9W A;  1M7T A;  3HJP A;  4IVF A;  2FCH A;  5CAX A;  1ZZY A;  1G6W A;  1XCC A;  2VM2 A;  1XWK A;  2GZY A;  4GRF A;  2C0G A;  1QGV A;  1R26 A;  1TK0 B;  1OKT A;  1YZX A;  5LNK e;  2YJH A;  2JZT A;  4HZ4 A;  2H76 A;  2HT9 A;  3ZVJ D;  2YV7 A;  3HJM A;  5G5F A;  3HYP A;  2FUG 2;  1RK4 A;  4F82 A;  5LCZ A;  1B48 A;  3OR5 A;  4XIH A;  5B6N A;  4PXO A;  4HS1 A;  1V58 A;  4MCU A;  2FWF A;  4POB A;  3D0Z A;  1NM3 A;  1PX6 A;  1UN2 A;  3KJY A;  4NXI A;  5ECS A;  5CRD A;  2ZUP A;  5IQY A;  4WR4 A;  3LQ7 A;  2O85 A;  4CDO A;  1SKR B;  1GUL A;  1TU7 A;  2H73 A;  2F51 A;  2L57 A;  1MTC A;  2KUC A;  4HQZ A;  1YDK A;  4ILF A;  4ZBD A;  3H1N A;  5J9B A;  3HA9 A;  1MDJ A;  4V1A p;  4K7N A;  4DSS B;  3VK9 A;  4TXO B;  1ILO A;  5CRW A;  3O76 A;  3IOS A;  3L9S A;  2AYT A;  2XHF A;  2VL9 A;  1T8E B;  4KDX A;  4TR3 A;  2GQM A;  1ZMA A;  3C1R A;  3PH9 A;  1M99 A;  2H74 A;  5IIZ A;  2PMT A;  5ECO B;  1R4W A;  3DD3 A;  4WBJ A;  3GUR A;  2IIY A;  1GTA A;  3VWU A;  2AJQ B;  3HVV A;  2VL2 A;  3IXR A;  3ZYW A;  4PX1 A;  3HY2 A;  2H66 A;  3QAW A;  2C0F A;  2XPD A;  2AV4 A;  3KZQ A;  4JBB A;  1QMV A;  1TP9 A;  3GHA A;  3UEM A;  5CP1 A;  3DML A;  2R6K A;  1SJZ A;  3KIJ A;  3TKS A;  4PNG A;  1X5D A;  2F8F A;  3VI5 A;  4IJI A;  4IN0 A;  4L8E A;  3ME8 A;  2GT5 A;  1XWC A;  3DRN A;  3GL3 A;  4FYC A;  2C3Q A;  2L4Q A;  3EWL A;  1WE0 A;  4FH8 A;  1LU4 A;  4MLY A;  2VM1 A;  2X8H A;  3C71 A;  1S3C A;  5IMF A;  3KP9 A;  1AXD A;  5D9V A;  3RAZ A;  2GVP A;  5FHI A;  2KHP A;  3F3Q A;  3BJ5 A;  3RPP A;  2JAC A;  1GSE A;  1DBY A;  5DAK A;  1TJD A;  2LJR A;  4ECJ A;  6GSW A;  2TIR A;  5IMD A;  5ECP B;  3QDN A;  2K6V A;  2LS5 A;  2P31 A;  4POM A;  1I9D A;  1FB0 A;  4PQ1 A;  4YAP A;  4NWY A;  3L9V A;  4MZC A;  4OWY A;  1UC7 A;  3ZIJ A;  3FR3 A;  1RW1 A;  3TOU A;  2H1D A;  1O73 A;  2WUL A;  2MBT A;  3LYK A;  5DDL A;  3D5J A;  3FW2 A;  3NOF A;  4KSM A;  3LWA A;  1MD3 A;  2LRN A;  4F0B A;  3H93 A;  4IQA A;  1U88 A;  1JFU A;  4I97 A;  5D9W A;  4JR6 A;  1PKW A;  2PER A;  4CHS A;  2HLS A;  1T4Y A;  4OO4 A;  1SK1 A;  5CYY A;  1G7E A;  4PNF A;  5HQP A;  3WGE A;  3KH9 A;  4QL7 A;  4WKW A;  2P5R A;  5IMC A;  4X1U A;  4OD7 A;  5ABR A;  2RLI A;  1TKD B;  3CSH A;  1FAA A;  3TJJ A;  1XW5 A;  3GTU A;  1F3A A;  3A2V A;  3QFA C;  2L5L A;  2VCV A;  1SYX A;  2RUF A;  1K3O A;  5EY6 A;  1YQ1 A;  2RUE A;  5IMZ A;  4KAE A;  3A5W A;  2JZS A;  3KTL A;  5G5E A;  2FGX A;  2FWG A;  3TKR A;  4MF5 A;  2VIM A;  2ALB A;  2I3Y A;  1T1V A;  1K3Y A;  1AQV A;  5ID2 A;  2WJU A;  2NVL A;  2N5B A;  3A2X A;  5DAK B;  3SWL A;  4J57 E;  1TU8 A;  3GKK A;  2C3N A;  4JE1 A;  3IBH A;  2DBC A;  3G7J A;  4EXJ A;  2V41 A;  2C80 A;  2AHE A;  3LSZ A;  1OE7 A;  1PKZ A;  2YOI A;  3UOM A;  5F05 A;  3TJF A;  1YY7 A;  3GMF A;  3KCM A;  1QK8 A;  3H79 A;  2B5X A;  2HXK A;  4K7I A;  3TKS E;  1JZR A;  2IMF A;  4MH3 A;  2QC7 A;  2K18 A;  17GS A;  1HNC A;  1XIY A;  3EU3 A;  3EMP A;  2PUK C;  2H72 A;  2LNS A;  2H8L A;  1EEJ A;  3DYR A;  1LJR A;  1S3D A;  2E0Q A;  1GSS A;  3C1S A;  1GH2 A;  5IMA A;  3UMA A;  4I5Q A;  2BMX A;  4DVC A;  2EIR A;  4IS0 A;  2NTO A;  4FIW A;  5G30 A;  1XWB A;  5IOX A;  3IK9 A;  3BCI A;  3LYP A;  4Q5F A;  3UBK A;  1AAZ A;  4K8M A;  1R5P A;  5H5R A;  4PUF C;  1X9W B;  5H5Q A;  4O7H A;  4EE0 A;  4ZXG A;  1QFN A;  3GTU B;  4N11 A;  2IPA A;  2YAN A;  4AJ8 A;  3F4T A;  3ZFB A;  4OFN A;  2YV9 A;  3N9J A;  1Z5Y E;  5A4V A;  4MAB A;  3WGD A;  2H6Y A;  2N5F A;  1V40 A;  4XHM A;  5KN1 A;  1OYJ A;  4IKH A;  2P0G A;  1K0N A;  5G31 A;  4JR4 A;  1O7U A;  1F2E A;  2HYX A;  4ECC A;  1Y25 A;  5D73 A;  3GH9 A;  4MJE A;  5EL8 A;  4YQV A;  12GS A;  1A2J A;  1S3A A;  4TOP A; 
#chains in the Genus database with same CATH topology
 2HRN A;  3QAG A;  4Z7X A;  3ZML A;  3J7Y k;  1SKS B;  3QOU A;  1A0R P;  2H1B A;  4YKF A;  4GF0 A;  1SL0 B;  4TVE A;  5D8I A;  1KNG A;  2HSY A;  2DJ3 A;  5BRT A;  4HSC X;  4PUR A;  4HI7 A;  3Q74 A;  1GSU A;  1U87 A;  5GSS A;  1QXH A;  4Q5N A;  4LL4 B;  1AC1 A;  1THX A;  5FT3 A;  4LMV A;  4ECI A;  1THO A;  4IQ1 A;  3TKQ A;  3TRQ A;  5IMV A;  1XWG A;  5G1L A;  4JU5 A;  5DCH A;  2FA4 A;  3FZA A;  3Q19 A;  4GSN A;  5ECM B;  5KEJ A;  2A2R A;  3HDC A;  3F63 A;  4MDC A;  1T3B A;  1M0U A;  4Z2T A;  1BX9 A;  2FWE A;  4L5O A;  22GS A;  3FR9 A;  1AUC A;  4AJ6 A;  3APQ A;  1TDI A;  3KMO A;  2NPB A;  3KGK A;  3A3T A;  3NIV A;  4WEY A;  2C0E A;  4GQF A;  5DAL B;  3W8S A;  2ZNM A;  1W4V A;  4GWR A;  3PR8 A;  4TKY A;  3FKF A;  1TXX A;  2KP2 A;  2B7J A;  4EUY A;  3WT2 A;  3CXG A;  4IBP A;  1EGR A;  1BAY A;  2HNL A;  5J41 A;  2LQO A;  3F9U A;  2B7K A;  8GSS A;  2OE1 A;  1K3L A;  5CNW A;  4HOJ A;  1SD8 A;  3IA1 A;  4LA1 A;  5IPH A;  1WMJ A;  1GRX A;  2A4V A;  1XOA A;  5ENU A;  4AF2 A;  1GLP A;  1M9B A;  1PSQ A;  3M9J A;  5GZZ B;  2KOK A;  3ZTL A;  3EVI A;  3KH7 A;  5AIS A;  2VCX A;  3I6A A;  3EPT A;  5J4U A;  2CQ9 A;  4N0V A;  1OC9 A;  3ERF A;  3US3 A;  2VLU A;  1SL1 B;  5A4U A;  3GIX A;  3L0H A;  1MEK A;  1A0F A;  1GSQ A;  2H70 A;  3TRP A;  4O92 A;  3ZRE A;  4AJ7 A;  2YPM A;  3PGT A;  3GKX A;  2R0P A;  2IN3 A;  4V2L A;  1XW6 A;  4GQC A;  3NZN A;  3VWX A;  2G2Q A;  1ZYN A;  2X8G A;  3WGX A;  5JWQ B;  1SL2 B;  3D4T A;  3E0U A;  3BD2 A;  4N10 A;  3ZIT A;  1YKC A;  4TR1 B;  1B4P A;  1W89 A;  3GX0 A;  5LD0 A;  3GRX A;  1O81 A;  3BBY A;  2IMD A;  4O5U A;  4NHW A;  4IGJ A;  4WBR D;  1F9M A;  3HHV A;  4NHZ A;  3MDK A;  1MD4 A;  4ID0 A;  2AAW A;  3GKN A;  1VF3 A;  2MMZ A;  3D6I A;  2EC4 A;  5JCW A;  3GN3 A;  4E8E A;  1V57 A;  4YAV A;  3ZL5 A;  4JED A;  2JAD A;  3G7Y A;  4L0U A;  4YQU A;  3TJB A;  2V1M A;  2FD3 A;  1PL1 A;  4RQR A;  3UIW A;  3CQF A;  4FYU A;  4PGT A;  1H75 A;  3H4K A;  3GUS A;  1HNB A;  4ZBA A;  4YKG A;  3IV4 A;  3GH6 A;  5IOW A;  3F4R A;  3VWV A;  3I43 A;  5KOW A;  2OKA A;  4ZB8 A;  1M3I A;  1TRW A;  2GST A;  3GA4 A;  4L0W A;  1A8L A;  3MSZ A;  3D4M A;  5ELG A;  4X0X A;  4OCF A;  2CVB A;  5IO2 A;  2FY6 A;  1SKW B;  2PGT A;  2C8U A;  2DIZ A;  1X9S B;  2YWO A;  2OAC A;  1Z6M A;  2CAQ A;  4BVX A;  2I4A A;  2REM A;  3GYK A;  4OFM A;  1PX7 A;  3O3T A;  4FYB A;  1XXU A;  4NV2 A;  1EOH A;  5CRG A;  3SBC A;  1B4Q A;  4EVM A;  1ACV A;  4G2E A;  1WJK A;  2B5Y A;  3QD9 A;  1VRS D;  1MDK A;  1SK0 A;  5D96 A;  2DJK A;  2B5E A;  3IR4 A;  3IRA A;  2OE3 A;  1NHY A;  3IK7 A;  4GSS A;  1R7H A;  4ACS A;  1ZGN A;  4ZL7 A;  2PVO C;  2L6D A;  1ERV A;  1FOV A;  4BL7 A;  1T7P B;  1XVQ A;  1EP7 A;  2L5O A;  14GS A;  2LKU A;  1VF2 A;  1PRX A;  3CRT A;  2DSA A;  2WFC A;  4MNN A;  5B8B A;  4GST A;  1O85 A;  4MPG A;  5B6M A;  1AIU A;  3HCZ A;  4K6X A;  2TRX A;  5J9C A;  2D2Z A;  1WIK A;  2DJ2 A;  1RQM A;  4LMW A;  3UBL A;  2HZE A;  3ERG A;  4GCI A;  3BOA A;  4K2D A;  3CYN A;  5ECI B;  3D21 A;  2VUP A;  1WOU A;  3UAR A;  1AQW A;  4RUV A;  1U3I A;  4MF7 A;  3ZZX A;  3TGZ A;  1GSF A;  2AB6 A;  1YEP A;  4KA0 A;  6GSX A;  4I8B A;  4TR0 A;  1SYR A;  1EZK A;  1ZOF A;  3ED3 A;  1M3J A;  1XWA A;  1NSW A;  1WRY A;  1G6Y A;  2OBK A;  2E2G A;  5IPG A;  2CVD A;  3R2Q A;  2R4V A;  3FMW A;  3EUR A;  1BG5 A;  1K0D A;  1IYH A;  4MPF A;  1VGL A;  4RQX A;  4WF4 A;  2RII A;  4Z2U A;  1FO5 A;  3KTB A;  3TOT A;  2OE0 A;  3WD6 A;  4HEA 2;  4F9Z A;  2B1K A;  2ZCT A;  3S9F A;  1GWC A;  1A2L A;  3QPM A;  1BQ7 A;  4EF0 A;  2DMM A;  2VL2 C;  4ULX A;  1K0B A;  1GUM A;  1PD2 1;  3LJR A;  1Z6N A;  4WXT A;  4I6X A;  1OC3 A;  2MZC A;  1ZL9 A;  4P3Y B;  4EC0 A;  4ZB6 A;  2R2J A;  3AY8 A;  1LBK A;  5G2Z A;  1E6B A;  2OAD A;  3LXZ A;  2VD0 A;  2VD1 A;  2VLV A;  5B7C A;  2MBS A;  4BL7 B;  3M3M A;  3QFB C;  2PBJ A;  2FLS A;  5A4W A;  4HUA A;  2GLR A;  2YWI A;  3EE2 A;  2DC5 A;  1N8J A;  5JWO B;  4KND A;  1FOH A;  5A5K A;  4DSR A;  1K0O A;  3WYW A;  1SJI A;  1AW9 A;  5ECN B;  1TW9 A;  2GDR A;  3HVX A;  5AN1 A;  2QA2 A;  4NPB A;  4BWS A;  3LW9 A;  1JZW A;  2H6X A;  4MH2 A;  3P7X A;  2LUS A;  5KN3 A;  1QUW A;  3UVT A;  4WR5 A;  1USB A;  4QQ7 A;  2HZE B;  2L6C A;  1URM A;  3DXB A;  5H5S A;  1XBS A;  1NW2 A;  3KP8 A;  3FZ5 A;  3O6T A;  1A2M A;  2HFD A;  4LLR A;  4ZL9 A;  3N5O A;  1JHB A;  2H1G A;  3EU4 A;  1HD2 A;  2HRA A;  4ISD A;  4HU7 A;  4AGS A;  4O32 A;  2FHE A;  2H1A A;  2CAI A;  1OC8 A;  3P90 A;  4JRR A;  2GQL A;  1MDI A;  1HYU A;  3UAP A;  4V2N A;  3TDG A;  3UJ1 A;  6GSY A;  4JZQ A;  2JU5 A;  9GSS A;  2BJX A;  1GUK A;  2K9F A;  2RM5 A;  3CMI A;  2QGV A;  1A8Y A;  5CO3 A;  1AQX A;  5ID2 B;  3F4S A;  5KN0 A;  1SEN A;  2R37 A;  2IMI A;  3MYD A;  2H0H A;  2PPT A;  1DE2 A;  5F8B A;  5DQS A;  2GQK A;  3F0I A;  4MMM A;  4V2M A;  4MK3 A;  4PQH A;  1BED A;  5E59 A;  4POK A;  3IAM 2;  3DGQ A;  2WS2 A;  2YP6 A;  1A23 A;  1EV9 A;  5IM9 A;  1WP0 A;  2VO4 A;  3FZ9 A;  3G9B A;  4A5P A;  2X8C A;  1N2A A;  1TI1 A;  4F0C A;  3IC4 A;  3KEB A;  1JZO A;  3GSS A;  1F37 A;  3DVX A;  4ML6 A;  2JSZ A;  2VCQ A;  2LJK A;  1OVN A;  1GP1 A;  4O5R A;  3TCO A;  6GST A;  2O7K A;  2MYG A;  3HJO A;  1S3R A;  4WET A;  4XS4 A;  1C72 A;  1GL8 A;  1IYI A;  1JLV A;  2CZ3 A;  1YF1 A;  4XCS A;  1Z7P A;  11GS A;  1FW1 A;  2N5A A;  3RHB A;  3W8J A;  1TTZ A;  4TR4 A;  3P8W A;  4CW9 A;  1T4Z A;  4XRD A;  1XW9 A;  4NMU A;  5F06 A;  4CY8 A;  4IEL A;  2FA8 A;  3L78 A;  4F2I A;  3ZIV A;  2ON5 A;  4HDE A;  2A4H A;  3VLN A;  3IPZ A;  3C73 A;  1R5A A;  3Q18 A;  2OA7 A;  4OMV A;  2PWJ A;  4N0Z A;  4HJ2 A;  2F3M A;  3APS A;  1TOF A;  2XC2 A;  3C8E A;  3ERW A;  4KE3 A;  1K0M A;  1OKD A;  4OO5 A;  4DSS A;  2HSM A;  4TXO A;  2YCD A;  4XS6 A;  2VAF A;  3F6D A;  4LL1 B;  2YWN A;  1FHE A;  2R0C A;  2KP1 A;  4V1A g;  3LGC A;  2FNO A;  3EYT A;  2GSQ A;  5ELA A;  3VUR A;  3VPT A;  2LQQ A;  2H6Z A;  2HRF A;  4WF5 A;  4IP6 A;  4H86 A;  2PN8 A;  4NV5 A;  1GTU A;  1GLQ A;  1DSB A;  3WT1 A;  1HNA A;  2GTU A;  5J3R A;  1GSY A;  2XBI A;  2L59 A;  1GUH A;  2MMA A;  1TRU A;  1UVZ A;  4XRA A;  2DJ1 A;  16GS A;  5JCG A;  2H0G A;  3TB2 A;  3VWW A;  1K0A A;  5DJM A;  4G9H A;  1B9Y C;  3LFL A;  2M46 A;  4FO5 A;  2CX3 A;  2WDU A;  18GS A;  5GST A;  1M9A A;  3HZ8 A;  1GSD A;  4IJ3 A;  4ZB9 A;  4Q5R A;  4RI6 A;  1PMT A;  2A2S A;  4TRX A;  4XS4 B;  2VCZ A;  3J7Y b;  5JCU A;  1TRV A;  2IWT A;  5DQY A;  3TRX A;  4EO3 A;  3M1G A;  1Y6E A;  2DIY A;  5ECQ B;  2CX4 A;  4KDY A;  2IFQ A;  2R0G A;  2ES7 A;  2DJ0 A;  1XZO A;  5ECR B;  6GSV A;  1XVW A;  5HR0 A;  3U6V A;  2DLX A;  3C7M A;  4KX4 A;  4ZIJ A;  5G1K A;  1SU9 A;  4QL9 A;  4MF6 A;  3GL5 A;  4KB3 A;  3A5I A;  4YQM A;  5KN2 A;  1XFL A;  3A2W A;  5DJL A;  4J2F A;  5E4W A;  1VF1 A;  2GZZ A;  1YJ6 A;  4BA7 A;  1XOB A;  3ZVJ A;  5CRH A;  4DEJ A;  4K1F A;  3IE3 A;  1ZCP A;  1X5E A;  3DWV A;  2VCW A;  4K0N A;  2H0I A;  2R3X A;  2V2G A;  4DSQ A;  3UVH A;  2B1L A;  1DUG A;  3ZRD A;  3CSI A;  2I9H A;  3HKR A;  1B8X A;  2LV3 A;  4XS1 A;  1I5G A;  1O6J A;  2XPE A;  1QQ2 A;  3IHG A;  1CQG A;  4G19 A;  1OC9 B;  4ML1 A;  1G0T A;  2CV4 A;  1F3B A;  1BJX A;  4ZL8 A;  2CVK A;  3ZLP A;  2LRT A;  4E8H A;  4EDY A;  3L9U A;  4HJM A;  1J9B A;  1KEB A;  1WPI A;  4PQI A;  3CSJ A;  3MAK A;  1G7O A;  1BYE A;  3M8N A;  4KUN A;  2LEG A;  3GFK A;  3IDV A;  3QAV A;  1O8X A;  2E7P A;  5C04 A;  4BWQ A;  2GSS A;  4RI7 A;  3U5R E;  2IL3 A;  1EOG A;  4X4J A;  5HFK A;  2H75 A;  3FEU A;  4K7O A;  1T00 A;  1VF4 A;  2IME A;  2WCI A;  4OFT A;  1PQN A;  2IFQ B;  5DBQ A;  1M2B A;  1V98 A;  5ECL B;  1E2Y A;  3GST A;  4EKZ A;  1F6M C;  5ECK B;  1ON4 A;  13GS A;  4XTS A;  5AIV A;  4I2T A;  1J08 A;  3VFI A;  5L71 A;  2LRC A;  4IHU A;  2QA1 A;  2BTO T;  3L4N A;  3ME7 A;  3ZMK A;  4TXV A;  4ICY A;  3MWH A;  2WB9 A;  5HFG A;  1OE8 A;  3K8N A;  5D9T A;  3TKP A;  1PA3 A;  2J9H A;  4K5R A;  3GKM A;  5AGY A;  4K5S A;  3IHQ A;  4IW9 A;  1FVJ A;  2OBI A;  5FWG A;  1FG4 A;  3KM6 A;  2E2M A;  4G0L A;  3W6G A;  1ZYE A;  1ERW A;  2PU9 C;  4HQS A;  1FVK A;  1Z9H A;  3BCK A;  1TI3 A;  3HD5 A;  2AUV A;  2WZ9 A;  3APO A;  4POL A;  2X99 A;  3VI7 A;  3GV1 A;  3TJK A;  5F07 A;  2C4J A;  4BVX B;  4MA9 A;  2YZH A;  4F03 A;  1V2A A;  1TRS A;  3CBU A;  2EIO A;  2JZR A;  1TK8 B;  1X5C A;  5F0G A;  5C00 A;  2H19 A;  4L5L A;  2JSY A;  1Q98 A;  3UL3 A;  1ERT A;  4NAX A;  1JZD A;  2FWH A;  5HR3 A;  4BPY A;  2Z9S A;  1TK5 B;  3F6F A;  3TKS C;  2VOC A;  3I9V 2;  3P2A A;  3D22 A;  5D9X A;  1HQO A;  5EVO A;  1DE1 A;  2MMO A;  4HZ2 A;  5EPF A;  4KDU A;  3G7I A;  2O8V B;  2JL4 A;  2GS3 A;  2OJL A;  3VPQ A;  1H4O A;  2B3S A;  3H8Q A;  4KH7 A;  4BVY A;  2V6O A;  2GGT A;  2J23 A;  5GAN D;  1O8W A;  1XG8 A;  2HSH A;  1PN9 A;  3GNJ A;  2NBS A;  2QSI A;  3FYG A;  1SD9 A;  3FY7 A;  4J56 E;  6GSS A;  2ON7 A;  3CTF A;  4EDZ A;  2YWM A;  3IAS 2;  1SK2 A;  2L4C A;  5CRE A;  4D73 A;  3KXO A;  1PL2 A;  4K0G A;  3LXT A;  2V32 A;  2GZP A;  5J5N A;  3CRU A;  1PGT A;  1GNW A;  1X9M B;  2LJA A;  4TW5 A;  1B9X C;  2YZU A;  4KGI A;  2IMK A;  5HR1 A;  2H01 A;  4X43 A;  10GS A;  2GSR A;  5D93 A;  3QR6 A;  1X0R A;  5AIX A;  4KCA A;  1UA5 A;  2LNT A;  2HE3 A;  2C3T A;  2RM6 A;  4TN8 A;  3M9K A;  1YEX A;  2O89 A;  3CTG A;  5KOX A;  2F9S A;  2WRT A;  2M80 A;  3M0F A;  3E9J B;  2G0F A;  2QKE A;  3PIN A;  1EEM A;  3E3E A;  2X4A A;  3KD0 A;  4GXZ A;  5DAL A;  1EV4 A;  3FHK A;  3FK8 A;  2DJJ A;  3QMX A;  2M72 A;  6GSU A;  2IJY A;  3RDW A;  2DML A;  2O87 A;  2C1Y A;  3V1W A;  1XPV A;  3F3R A;  4PUA A;  1EP8 A;  4O5Q A;  1U3A A;  2VCT A;  4MJC A;  2C0D A;  3LEF A;  2NDO A;  4MZW A;  1EGO A;  2LST A;  1M2A A;  20GS A;  1M2D A;  4GTU A;  5DCG A;  1SJ6 A;  4KW6 A;  4MP4 A;  1GTB A;  3Q6O A;  1KBN A;  3PPU A;  3FR6 A;  2XBQ A;  5GAP D;  3KMN A;  2YNX A;  5HFI A;  4BVY B;  2TRC P;  3FRC A;  2V6K A;  2VL3 A;  4Q5Q A;  1NHO A;  7GSS A;  4KSO A;  3LOR A;  2B6M A;  3EIN A;  3GX8 A;  2YN1 A;  2KLX A;  5HR2 A;  2WGR A;  19GS A;  5INY A;  2YJ7 A;  2CT6 A;  1ZYQ B;  3RBT A;  4OCE A;  3TJG A;  3ZFL A;  3JCM L;  4D73 B;  3HZ4 A;  4KCE A;  1EWX A;  2CA8 A;  1WWJ A;  3MNG A;  1FB6 A;  1KTE A;  1Z7R A;  4GLT A;  1U6T A;  5DVB A;  2K8S A;  3DVW A;  1GNE A;  1Q4J A;  4HU9 A;  3I69 A;  1ERU A;  2MMN A;  3EC3 A;  4YH2 A;  4K9Z A;  1ML6 A;  4G10 A;  4ECB A;  4TR1 A;  3RPN A;  2K8V A;  3QCP A;  1ABA A;  1YF0 A;  2GT6 A;  3LG6 A;  1CQH A;  2HI7 A;  4ZBB A;  3DEX A;  3RHC A;  4MZB A;  4ZIL A;  5IO0 A;  3DKS A;  2EIQ A;  4EL1 A;  2P5Q A;  4EIP A;  2R5G A;  3TUE A;  5COH A;  3HVS A;  2PVQ A;  2CZ2 A;  4MJA A;  3FZ4 A;  5ECH B;  4I2U A;  5B8A A;  1OAZ A;  1JLW A;  2X64 A;  4MJB A;  1ST9 A;  1J0F A;  2I81 A;  3F8U A;  1Z3E A;  1A24 A;  3DIE A;  3ISO A;  2HZF A;  2H71 A;  2LTK A;  2VLT A;  1YKA A;  1GTI A;  3EMX A;  2F8A A;  5JWR B;  3HXS A;  1K0C A;  4IP1 A;  2H30 A;  2I1U A;  4N30 A;  1V9W A;  1M7T A;  3HJP A;  4IVF A;  2FCH A;  5CAX A;  1ZZY A;  4CY6 A;  1G6W A;  1XCC A;  2VM2 A;  1XWK A;  2GZY A;  4GRF A;  2C0G A;  1QGV A;  1R26 A;  1TK0 B;  1OKT A;  1YZX A;  5LNK e;  2YJH A;  2JZT A;  4HZ4 A;  2H76 A;  2HT9 A;  3ZVJ D;  2YV7 A;  3HJM A;  5G5F A;  3HYP A;  2FUG 2;  1RK4 A;  4F82 A;  5LCZ A;  1B48 A;  3OR5 A;  4XIH A;  5B6N A;  4PXO A;  4HS1 A;  1V58 A;  4MCU A;  2FWF A;  4POB A;  3D0Z A;  1NM3 A;  1PX6 A;  1UN2 A;  3KJY A;  4NXI A;  5ECS A;  5CRD A;  3HVN A;  2ZUP A;  5IQY A;  4WR4 A;  4BIK A;  3LQ7 A;  2O85 A;  4K2X A;  2DKH A;  4CDO A;  1SKR B;  1GUL A;  1TU7 A;  2H73 A;  2F51 A;  2L57 A;  1MTC A;  2KUC A;  4HQZ A;  1YDK A;  4ILF A;  4ZBD A;  3H1N A;  5J9B A;  3HA9 A;  1MDJ A;  4V1A p;  4K7N A;  4DSS B;  3VK9 A;  4TXO B;  1ILO A;  5CRW A;  3O76 A;  3IOS A;  3L9S A;  2AYT A;  2XHF A;  2VL9 A;  1T8E B;  4KDX A;  4TR3 A;  2GQM A;  1ZMA A;  3C1R A;  3PH9 A;  3IC8 A;  1M99 A;  2H74 A;  5IIZ A;  2PMT A;  5ECO B;  1R4W A;  3DD3 A;  4WBJ A;  3GUR A;  2IIY A;  1GTA A;  3VWU A;  1ZYP A;  2AJQ B;  3HVV A;  2A2P A;  2VL2 A;  3IXR A;  3ZYW A;  4PX1 A;  3HY2 A;  2H66 A;  3QAW A;  2C0F A;  2XPD A;  2AV4 A;  3KZQ A;  4JBB A;  1QMV A;  1TP9 A;  3GHA A;  3UEM A;  5CP1 A;  3DML A;  2R6K A;  1SJZ A;  3KIJ A;  3TKS A;  4PNG A;  4Z2R A;  1X5D A;  4FQU A;  2F8F A;  3VI5 A;  4IJI A;  1PN0 A;  4IN0 A;  4L8E A;  3ME8 A;  2GT5 A;  1XWC A;  3DRN A;  3GL3 A;  4FYC A;  2C3Q A;  2L4Q A;  3EWL A;  1WE0 A;  4FH8 A;  1LU4 A;  2X49 A;  4MLY A;  2VM1 A;  2X8H A;  3C71 A;  1S3C A;  5IMF A;  3KP9 A;  1AXD A;  5D9V A;  3RAZ A;  2GVP A;  5FHI A;  2KHP A;  3F3Q A;  3BJ5 A;  3RPP A;  2JAC A;  1GSE A;  1DBY A;  5DAK A;  1TJD A;  2LJR A;  4ECJ A;  6GSW A;  2TIR A;  5IMD A;  5ECP B;  3QDN A;  2K6V A;  2LS5 A;  2P31 A;  4POM A;  1I9D A;  1FB0 A;  4PQ1 A;  4YAP A;  2DKI A;  4NWY A;  3L9V A;  4MZC A;  4OWY A;  1UC7 A;  3ZIJ A;  3FR3 A;  1RW1 A;  3TOU A;  2H1D A;  1O73 A;  2WUL A;  2MBT A;  3LYK A;  5DDL A;  5BMU A;  3D5J A;  3FW2 A;  3NOF A;  4KSM A;  3LWA A;  1MD3 A;  2LRN A;  4F0B A;  3H93 A;  4IQA A;  1U88 A;  1JFU A;  4I97 A;  5D9W A;  4JR6 A;  1PKW A;  2PER A;  4CHS A;  2HLS A;  1T4Y A;  2UZ8 A;  4KF9 A;  4OO4 A;  1SK1 A;  5CYY A;  1G7E A;  4PNF A;  5HQP A;  3WGE A;  3KH9 A;  4QL7 A;  4WKW A;  2P5R A;  5IMC A;  4X1U A;  4OD7 A;  5ABR A;  2RLI A;  1TKD B;  3CSH A;  1FAA A;  3TJJ A;  1XW5 A;  3GTU A;  1F3A A;  3A2V A;  3QFA C;  2L5L A;  2VCV A;  1SYX A;  2RUF A;  1K3O A;  5EY6 A;  1YQ1 A;  2RUE A;  5IMZ A;  4KAE A;  3A5W A;  2JZS A;  3KTL A;  5G5E A;  2FGX A;  2FWG A;  3TKR A;  4MF5 A;  2VIM A;  4EIQ A;  2ALB A;  2I3Y A;  1T1V A;  1K3Y A;  1AQV A;  5ID2 A;  2WJU A;  1PFO A;  4USS A;  2NVL A;  2N5B A;  3A2X A;  5DAK B;  3SWL A;  4J57 E;  1TU8 A;  3GKK A;  2C3N A;  4JE1 A;  3IBH A;  2DBC A;  3G7J A;  4EXJ A;  2V41 A;  2C80 A;  2AHE A;  3LSZ A;  1OE7 A;  1PKZ A;  2YOI A;  3UOM A;  5F05 A;  3TJF A;  4G0I A;  1YY7 A;  3GMF A;  3KCM A;  1QK8 A;  3MIX A;  2HRK A;  3H79 A;  2B5X A;  2HXK A;  4K7I A;  3TKS E;  1JZR A;  2IMF A;  4MH3 A;  2QC7 A;  2K18 A;  17GS A;  1HNC A;  1XIY A;  3EU3 A;  3EMP A;  2PUK C;  2H72 A;  2LNS A;  2H8L A;  1EEJ A;  3DYR A;  1LJR A;  1S3D A;  2E0Q A;  1GSS A;  3C1S A;  1GH2 A;  5IMA A;  3UMA A;  3R3E A;  4I5Q A;  2BMX A;  4DVC A;  2EIR A;  4IS0 A;  2NTO A;  4FIW A;  5G30 A;  1XWB A;  5IOX A;  3IK9 A;  3BCI A;  3LYP A;  4Q5F A;  3UBK A;  1AAZ A;  4K8M A;  1R5P A;  5H5R A;  4PUF C;  1X9W B;  5H5Q A;  4O7H A;  4EE0 A;  4ZXG A;  1QFN A;  3GTU B;  4N11 A;  2IPA A;  2YAN A;  4AJ8 A;  3F4T A;  3ZFB A;  4OFN A;  2YV9 A;  3N9J A;  1Z5Y E;  5A4V A;  4MAB A;  3WGD A;  2H6Y A;  2N5F A;  4PTS A;  1V40 A;  4XHM A;  5KN1 A;  1OYJ A;  4IKH A;  2P0G A;  1K0N A;  5G31 A;  4JR4 A;  1O7U A;  1F2E A;  2HYX A;  4ECC A;  1Y25 A;  5D73 A;  3GH9 A;  4MJE A;  5EL8 A;  4YQV A;  12GS A;  1A2J A;  1S3A A;  4G0K A;  4TOP A; 
#chains in the Genus database with same CATH homology
 2HRN A;  3QAG A;  4Z7X A;  3ZML A;  3J7Y k;  1SKS B;  3QOU A;  1A0R P;  2H1B A;  4YKF A;  4GF0 A;  1SL0 B;  4TVE A;  5D8I A;  1KNG A;  2HSY A;  2DJ3 A;  5BRT A;  4PUR A;  4HI7 A;  3Q74 A;  1GSU A;  1U87 A;  5GSS A;  1QXH A;  4Q5N A;  4LL4 B;  1AC1 A;  1THX A;  5FT3 A;  4LMV A;  4ECI A;  1THO A;  4IQ1 A;  3TKQ A;  3TRQ A;  5IMV A;  1XWG A;  5G1L A;  4JU5 A;  5DCH A;  2FA4 A;  3FZA A;  3Q19 A;  4GSN A;  5ECM B;  5KEJ A;  2A2R A;  3HDC A;  3F63 A;  4MDC A;  1T3B A;  1M0U A;  4Z2T A;  1BX9 A;  2FWE A;  4L5O A;  22GS A;  3FR9 A;  1AUC A;  4AJ6 A;  3APQ A;  1TDI A;  3KMO A;  2NPB A;  3KGK A;  3A3T A;  3NIV A;  4WEY A;  2C0E A;  4GQF A;  5DAL B;  3W8S A;  2ZNM A;  1W4V A;  4GWR A;  3PR8 A;  4TKY A;  3FKF A;  1TXX A;  2KP2 A;  2B7J A;  4EUY A;  3WT2 A;  3CXG A;  4IBP A;  1EGR A;  1BAY A;  2HNL A;  5J41 A;  2LQO A;  3F9U A;  2B7K A;  8GSS A;  2OE1 A;  1K3L A;  5CNW A;  4HOJ A;  1SD8 A;  3IA1 A;  4LA1 A;  5IPH A;  1WMJ A;  1GRX A;  2A4V A;  1XOA A;  5ENU A;  4AF2 A;  1GLP A;  1M9B A;  1PSQ A;  3M9J A;  5GZZ B;  2KOK A;  3ZTL A;  3EVI A;  3KH7 A;  5AIS A;  2VCX A;  3I6A A;  3EPT A;  5J4U A;  2CQ9 A;  4N0V A;  1OC9 A;  3ERF A;  3US3 A;  2VLU A;  1SL1 B;  5A4U A;  3GIX A;  3L0H A;  1MEK A;  1A0F A;  1GSQ A;  2H70 A;  3TRP A;  4O92 A;  3ZRE A;  4AJ7 A;  2YPM A;  3PGT A;  3GKX A;  2R0P A;  2IN3 A;  4V2L A;  1XW6 A;  4GQC A;  3NZN A;  3VWX A;  2G2Q A;  1ZYN A;  2X8G A;  3WGX A;  5JWQ B;  1SL2 B;  3D4T A;  3E0U A;  3BD2 A;  4N10 A;  3ZIT A;  1YKC A;  4TR1 B;  1B4P A;  1W89 A;  3GX0 A;  5LD0 A;  3GRX A;  1O81 A;  3BBY A;  2IMD A;  4O5U A;  4NHW A;  4IGJ A;  4WBR D;  1F9M A;  3HHV A;  4NHZ A;  3MDK A;  1MD4 A;  4ID0 A;  2AAW A;  3GKN A;  1VF3 A;  2MMZ A;  3D6I A;  2EC4 A;  5JCW A;  3GN3 A;  4E8E A;  1V57 A;  4YAV A;  3ZL5 A;  4JED A;  2JAD A;  3G7Y A;  4L0U A;  4YQU A;  3TJB A;  2V1M A;  2FD3 A;  1PL1 A;  4RQR A;  3UIW A;  4FYU A;  4PGT A;  1H75 A;  3H4K A;  3GUS A;  1HNB A;  4ZBA A;  4YKG A;  3IV4 A;  3GH6 A;  5IOW A;  3F4R A;  3VWV A;  3I43 A;  5KOW A;  2OKA A;  4ZB8 A;  1TRW A;  2GST A;  3GA4 A;  4L0W A;  1A8L A;  3MSZ A;  3D4M A;  5ELG A;  4X0X A;  4OCF A;  2CVB A;  5IO2 A;  2FY6 A;  1SKW B;  2PGT A;  2C8U A;  2DIZ A;  1X9S B;  2YWO A;  2OAC A;  1Z6M A;  2CAQ A;  4BVX A;  2I4A A;  2REM A;  3GYK A;  4OFM A;  1PX7 A;  3O3T A;  4FYB A;  1XXU A;  4NV2 A;  1EOH A;  5CRG A;  3SBC A;  1B4Q A;  4EVM A;  1ACV A;  4G2E A;  1WJK A;  2B5Y A;  3QD9 A;  1VRS D;  1MDK A;  1SK0 A;  5D96 A;  2DJK A;  2B5E A;  3IR4 A;  3IRA A;  2OE3 A;  1NHY A;  3IK7 A;  4GSS A;  1R7H A;  4ACS A;  1ZGN A;  4ZL7 A;  2PVO C;  2L6D A;  1ERV A;  1FOV A;  4BL7 A;  1T7P B;  1XVQ A;  1EP7 A;  2L5O A;  14GS A;  2LKU A;  1VF2 A;  1PRX A;  3CRT A;  2DSA A;  2WFC A;  4MNN A;  5B8B A;  4GST A;  1O85 A;  4MPG A;  5B6M A;  1AIU A;  3HCZ A;  4K6X A;  2TRX A;  5J9C A;  2D2Z A;  1WIK A;  2DJ2 A;  1RQM A;  4LMW A;  3UBL A;  2HZE A;  3ERG A;  4GCI A;  3BOA A;  4K2D A;  3CYN A;  5ECI B;  3D21 A;  2VUP A;  1WOU A;  3UAR A;  1AQW A;  4RUV A;  1U3I A;  4MF7 A;  3ZZX A;  3TGZ A;  1GSF A;  2AB6 A;  1YEP A;  4KA0 A;  6GSX A;  4I8B A;  4TR0 A;  1SYR A;  1EZK A;  1ZOF A;  3ED3 A;  1XWA A;  1NSW A;  1WRY A;  1G6Y A;  2OBK A;  2E2G A;  5IPG A;  2CVD A;  3R2Q A;  2R4V A;  3FMW A;  3EUR A;  1BG5 A;  1K0D A;  1IYH A;  4MPF A;  1VGL A;  4RQX A;  4WF4 A;  2RII A;  4Z2U A;  1FO5 A;  3KTB A;  3TOT A;  2OE0 A;  3WD6 A;  4HEA 2;  4F9Z A;  2B1K A;  2ZCT A;  3S9F A;  1GWC A;  1A2L A;  3QPM A;  1BQ7 A;  4EF0 A;  2DMM A;  2VL2 C;  4ULX A;  1K0B A;  1GUM A;  1PD2 1;  3LJR A;  1Z6N A;  4WXT A;  4I6X A;  1OC3 A;  2MZC A;  1ZL9 A;  4P3Y B;  4EC0 A;  4ZB6 A;  2R2J A;  3AY8 A;  1LBK A;  5G2Z A;  1E6B A;  2OAD A;  3LXZ A;  2VD0 A;  2VD1 A;  2VLV A;  5B7C A;  2MBS A;  4BL7 B;  3M3M A;  3QFB C;  2PBJ A;  2FLS A;  5A4W A;  4HUA A;  2GLR A;  2YWI A;  3EE2 A;  2DC5 A;  1N8J A;  5JWO B;  4KND A;  1FOH A;  5A5K A;  4DSR A;  1K0O A;  3WYW A;  1SJI A;  1AW9 A;  5ECN B;  1TW9 A;  2GDR A;  3HVX A;  5AN1 A;  2QA2 A;  4NPB A;  4BWS A;  3LW9 A;  1JZW A;  2H6X A;  4MH2 A;  3P7X A;  2LUS A;  5KN3 A;  1QUW A;  3UVT A;  4WR5 A;  1USB A;  4QQ7 A;  2HZE B;  2L6C A;  1URM A;  3DXB A;  5H5S A;  1XBS A;  1NW2 A;  3KP8 A;  3FZ5 A;  3O6T A;  1A2M A;  2HFD A;  4LLR A;  4ZL9 A;  3N5O A;  1JHB A;  2H1G A;  3EU4 A;  1HD2 A;  2HRA A;  4ISD A;  4HU7 A;  4AGS A;  4O32 A;  2FHE A;  2H1A A;  2CAI A;  1OC8 A;  3P90 A;  4JRR A;  2GQL A;  1MDI A;  1HYU A;  3UAP A;  4V2N A;  3TDG A;  3UJ1 A;  6GSY A;  4JZQ A;  2JU5 A;  9GSS A;  2BJX A;  1GUK A;  2K9F A;  2RM5 A;  3CMI A;  2QGV A;  1A8Y A;  5CO3 A;  1AQX A;  5ID2 B;  3F4S A;  5KN0 A;  1SEN A;  2R37 A;  2IMI A;  3MYD A;  2H0H A;  2PPT A;  1DE2 A;  5F8B A;  5DQS A;  2GQK A;  3F0I A;  4MMM A;  4V2M A;  4MK3 A;  4PQH A;  1BED A;  5E59 A;  4POK A;  3IAM 2;  3DGQ A;  2WS2 A;  2YP6 A;  1A23 A;  1EV9 A;  5IM9 A;  1WP0 A;  2VO4 A;  3FZ9 A;  3G9B A;  4A5P A;  2X8C A;  1N2A A;  1TI1 A;  4F0C A;  3IC4 A;  3KEB A;  1JZO A;  3GSS A;  1F37 A;  3DVX A;  4ML6 A;  2JSZ A;  2VCQ A;  2LJK A;  1OVN A;  1GP1 A;  4O5R A;  3TCO A;  6GST A;  2O7K A;  2MYG A;  3HJO A;  4XS4 A;  4WET A;  1GL8 A;  1C72 A;  1IYI A;  1JLV A;  2CZ3 A;  1YF1 A;  4XCS A;  1Z7P A;  11GS A;  1FW1 A;  2N5A A;  3RHB A;  3W8J A;  1TTZ A;  4TR4 A;  3P8W A;  4CW9 A;  1T4Z A;  4XRD A;  1XW9 A;  4NMU A;  5F06 A;  4CY8 A;  4IEL A;  2FA8 A;  3L78 A;  4F2I A;  3ZIV A;  2ON5 A;  4HDE A;  2A4H A;  3VLN A;  3IPZ A;  3C73 A;  1R5A A;  3Q18 A;  2OA7 A;  4OMV A;  2PWJ A;  4N0Z A;  4HJ2 A;  2F3M A;  3APS A;  1TOF A;  2XC2 A;  3C8E A;  3ERW A;  4KE3 A;  1K0M A;  1OKD A;  4OO5 A;  4DSS A;  2HSM A;  4TXO A;  2YCD A;  4XS6 A;  2VAF A;  3F6D A;  4LL1 B;  2YWN A;  1FHE A;  2R0C A;  2KP1 A;  4V1A g;  3LGC A;  2FNO A;  3EYT A;  2GSQ A;  5ELA A;  3VUR A;  3VPT A;  2LQQ A;  2H6Z A;  2HRF A;  4WF5 A;  4IP6 A;  4H86 A;  2PN8 A;  4NV5 A;  1GTU A;  1GLQ A;  1DSB A;  3WT1 A;  1HNA A;  2GTU A;  5J3R A;  1GSY A;  2XBI A;  2L59 A;  1GUH A;  2MMA A;  1TRU A;  1UVZ A;  4XRA A;  2DJ1 A;  16GS A;  5JCG A;  2H0G A;  3TB2 A;  3VWW A;  1K0A A;  5DJM A;  4G9H A;  1B9Y C;  3LFL A;  2M46 A;  4FO5 A;  2CX3 A;  2WDU A;  18GS A;  5GST A;  1M9A A;  3HZ8 A;  1GSD A;  4IJ3 A;  4ZB9 A;  4Q5R A;  4RI6 A;  1PMT A;  2A2S A;  4TRX A;  4XS4 B;  2VCZ A;  3J7Y b;  5JCU A;  1TRV A;  2IWT A;  5DQY A;  3TRX A;  4EO3 A;  3M1G A;  1Y6E A;  2DIY A;  5ECQ B;  2CX4 A;  4KDY A;  2IFQ A;  2R0G A;  2ES7 A;  2DJ0 A;  1XZO A;  5ECR B;  6GSV A;  1XVW A;  5HR0 A;  3U6V A;  2DLX A;  3C7M A;  4KX4 A;  4ZIJ A;  5G1K A;  1SU9 A;  4QL9 A;  4MF6 A;  3GL5 A;  4KB3 A;  3A5I A;  4YQM A;  5KN2 A;  1XFL A;  3A2W A;  5DJL A;  4J2F A;  5E4W A;  1VF1 A;  2GZZ A;  1YJ6 A;  4BA7 A;  1XOB A;  3ZVJ A;  5CRH A;  4DEJ A;  4K1F A;  3IE3 A;  1ZCP A;  1X5E A;  3DWV A;  2VCW A;  4K0N A;  2H0I A;  2R3X A;  2V2G A;  4DSQ A;  3UVH A;  2B1L A;  1DUG A;  3ZRD A;  3CSI A;  2I9H A;  3HKR A;  1B8X A;  2LV3 A;  4XS1 A;  1I5G A;  1O6J A;  2XPE A;  1QQ2 A;  3IHG A;  1CQG A;  4G19 A;  1OC9 B;  4ML1 A;  1G0T A;  2CV4 A;  1F3B A;  1BJX A;  4ZL8 A;  2CVK A;  3ZLP A;  2LRT A;  4E8H A;  4EDY A;  3L9U A;  4HJM A;  1J9B A;  1KEB A;  1WPI A;  4PQI A;  3CSJ A;  3MAK A;  1G7O A;  1BYE A;  3M8N A;  4KUN A;  2LEG A;  3GFK A;  3IDV A;  3QAV A;  1O8X A;  2E7P A;  5C04 A;  4BWQ A;  2GSS A;  4RI7 A;  3U5R E;  2IL3 A;  1EOG A;  4X4J A;  5HFK A;  2H75 A;  3FEU A;  4K7O A;  1T00 A;  1VF4 A;  2IME A;  2WCI A;  4OFT A;  1PQN A;  2IFQ B;  5DBQ A;  1M2B A;  1V98 A;  5ECL B;  1E2Y A;  3GST A;  4EKZ A;  1F6M C;  5ECK B;  1ON4 A;  13GS A;  4XTS A;  5AIV A;  4I2T A;  1J08 A;  3VFI A;  5L71 A;  2LRC A;  4IHU A;  2QA1 A;  2BTO T;  3L4N A;  3ME7 A;  3ZMK A;  4TXV A;  4ICY A;  3MWH A;  2WB9 A;  5HFG A;  1OE8 A;  3K8N A;  5D9T A;  3TKP A;  1PA3 A;  2J9H A;  4K5R A;  3GKM A;  5AGY A;  4K5S A;  3IHQ A;  4IW9 A;  1FVJ A;  2OBI A;  5FWG A;  1FG4 A;  3KM6 A;  2E2M A;  4G0L A;  3W6G A;  1ZYE A;  1ERW A;  2PU9 C;  4HQS A;  1FVK A;  1Z9H A;  3BCK A;  1TI3 A;  3HD5 A;  2AUV A;  2WZ9 A;  3APO A;  4POL A;  2X99 A;  3VI7 A;  3GV1 A;  3TJK A;  5F07 A;  2C4J A;  4BVX B;  4MA9 A;  2YZH A;  4F03 A;  1V2A A;  1TRS A;  3CBU A;  2EIO A;  2JZR A;  1TK8 B;  1X5C A;  5F0G A;  5C00 A;  2H19 A;  4L5L A;  2JSY A;  1Q98 A;  3UL3 A;  1ERT A;  4NAX A;  1JZD A;  2FWH A;  5HR3 A;  4BPY A;  2Z9S A;  1TK5 B;  3F6F A;  3TKS C;  2VOC A;  3I9V 2;  3P2A A;  3D22 A;  5D9X A;  1HQO A;  5EVO A;  1DE1 A;  2MMO A;  4HZ2 A;  5EPF A;  4KDU A;  3G7I A;  2O8V B;  2JL4 A;  2GS3 A;  2OJL A;  3VPQ A;  1H4O A;  2B3S A;  3H8Q A;  4KH7 A;  4BVY A;  2V6O A;  2GGT A;  2J23 A;  5GAN D;  1O8W A;  2HSH A;  1PN9 A;  3GNJ A;  2NBS A;  2QSI A;  3FYG A;  1SD9 A;  3FY7 A;  4J56 E;  6GSS A;  2ON7 A;  3CTF A;  4EDZ A;  2YWM A;  3IAS 2;  1SK2 A;  2L4C A;  5CRE A;  4D73 A;  3KXO A;  1PL2 A;  4K0G A;  3LXT A;  2V32 A;  2GZP A;  5J5N A;  3CRU A;  1PGT A;  1GNW A;  1X9M B;  2LJA A;  4TW5 A;  1B9X C;  2YZU A;  4KGI A;  2IMK A;  5HR1 A;  2H01 A;  4X43 A;  10GS A;  2GSR A;  5D93 A;  3QR6 A;  1X0R A;  5AIX A;  4KCA A;  1UA5 A;  2LNT A;  2HE3 A;  2C3T A;  2RM6 A;  4TN8 A;  3M9K A;  1YEX A;  2O89 A;  3CTG A;  5KOX A;  2F9S A;  2WRT A;  2M80 A;  3M0F A;  3E9J B;  2G0F A;  2QKE A;  3PIN A;  1EEM A;  3E3E A;  2X4A A;  3KD0 A;  4GXZ A;  5DAL A;  1EV4 A;  3FHK A;  3FK8 A;  2DJJ A;  3QMX A;  2M72 A;  6GSU A;  2IJY A;  3RDW A;  2DML A;  2O87 A;  2C1Y A;  3V1W A;  1XPV A;  3F3R A;  4PUA A;  1EP8 A;  4O5Q A;  1U3A A;  2VCT A;  4MJC A;  2C0D A;  3LEF A;  2NDO A;  4MZW A;  1EGO A;  2LST A;  1M2A A;  20GS A;  1M2D A;  4GTU A;  5DCG A;  1SJ6 A;  4KW6 A;  4MP4 A;  1GTB A;  3Q6O A;  1KBN A;  3PPU A;  3FR6 A;  2XBQ A;  5GAP D;  3KMN A;  2YNX A;  5HFI A;  4BVY B;  2TRC P;  3FRC A;  2V6K A;  2VL3 A;  4Q5Q A;  1NHO A;  7GSS A;  4KSO A;  3LOR A;  2B6M A;  3EIN A;  3GX8 A;  2YN1 A;  2KLX A;  5HR2 A;  2WGR A;  19GS A;  5INY A;  2YJ7 A;  2CT6 A;  1ZYQ B;  3RBT A;  4OCE A;  3TJG A;  3ZFL A;  3JCM L;  4D73 B;  3HZ4 A;  4KCE A;  1EWX A;  2CA8 A;  1WWJ A;  3MNG A;  1FB6 A;  1KTE A;  1Z7R A;  4GLT A;  1U6T A;  5DVB A;  2K8S A;  3DVW A;  1GNE A;  1Q4J A;  4HU9 A;  3I69 A;  1ERU A;  2MMN A;  3EC3 A;  4YH2 A;  4K9Z A;  1ML6 A;  4G10 A;  4ECB A;  4TR1 A;  3RPN A;  2K8V A;  3QCP A;  1ABA A;  1YF0 A;  2GT6 A;  3LG6 A;  1CQH A;  2HI7 A;  4ZBB A;  3DEX A;  3RHC A;  4MZB A;  4ZIL A;  5IO0 A;  3DKS A;  2EIQ A;  4EL1 A;  2P5Q A;  4EIP A;  2R5G A;  3TUE A;  5COH A;  3HVS A;  2PVQ A;  2CZ2 A;  4MJA A;  3FZ4 A;  5ECH B;  4I2U A;  5B8A A;  1OAZ A;  1JLW A;  2X64 A;  4MJB A;  1ST9 A;  1J0F A;  2I81 A;  3F8U A;  1Z3E A;  1A24 A;  3DIE A;  3ISO A;  2HZF A;  2H71 A;  2LTK A;  2VLT A;  1YKA A;  1GTI A;  3EMX A;  2F8A A;  5JWR B;  3HXS A;  1K0C A;  4IP1 A;  2H30 A;  2I1U A;  4N30 A;  1V9W A;  1M7T A;  3HJP A;  4IVF A;  2FCH A;  5CAX A;  1ZZY A;  4CY6 A;  1G6W A;  1XCC A;  2VM2 A;  1XWK A;  2GZY A;  4GRF A;  2C0G A;  1QGV A;  1R26 A;  1TK0 B;  1OKT A;  1YZX A;  5LNK e;  2YJH A;  2JZT A;  4HZ4 A;  2H76 A;  2HT9 A;  3ZVJ D;  2YV7 A;  3HJM A;  5G5F A;  3HYP A;  2FUG 2;  1RK4 A;  4F82 A;  5LCZ A;  1B48 A;  3OR5 A;  4XIH A;  5B6N A;  4PXO A;  4HS1 A;  1V58 A;  4MCU A;  2FWF A;  4POB A;  3D0Z A;  1NM3 A;  1PX6 A;  1UN2 A;  3KJY A;  4NXI A;  5ECS A;  5CRD A;  2ZUP A;  5IQY A;  4WR4 A;  3LQ7 A;  2O85 A;  4K2X A;  2DKH A;  4CDO A;  1SKR B;  1GUL A;  1TU7 A;  2H73 A;  2F51 A;  2L57 A;  1MTC A;  2KUC A;  4HQZ A;  1YDK A;  4ILF A;  4ZBD A;  3H1N A;  5J9B A;  3HA9 A;  1MDJ A;  4V1A p;  4K7N A;  4DSS B;  3VK9 A;  4TXO B;  1ILO A;  5CRW A;  3O76 A;  3IOS A;  3L9S A;  2AYT A;  2XHF A;  2VL9 A;  1T8E B;  4KDX A;  4TR3 A;  2GQM A;  1ZMA A;  3C1R A;  3PH9 A;  3IC8 A;  1M99 A;  2H74 A;  5IIZ A;  2PMT A;  5ECO B;  1R4W A;  3DD3 A;  4WBJ A;  3GUR A;  2IIY A;  1GTA A;  3VWU A;  1ZYP A;  2AJQ B;  3HVV A;  2A2P A;  2VL2 A;  3IXR A;  3ZYW A;  4PX1 A;  3HY2 A;  2H66 A;  3QAW A;  2C0F A;  2XPD A;  2AV4 A;  3KZQ A;  4JBB A;  1QMV A;  1TP9 A;  3GHA A;  3UEM A;  5CP1 A;  3DML A;  2R6K A;  1SJZ A;  3KIJ A;  3TKS A;  4PNG A;  4Z2R A;  1X5D A;  4FQU A;  2F8F A;  3VI5 A;  4IJI A;  1PN0 A;  4IN0 A;  4L8E A;  3ME8 A;  2GT5 A;  1XWC A;  3DRN A;  3GL3 A;  4FYC A;  2C3Q A;  2L4Q A;  3EWL A;  1WE0 A;  4FH8 A;  1LU4 A;  2X49 A;  4MLY A;  2VM1 A;  2X8H A;  3C71 A;  1S3C A;  5IMF A;  3KP9 A;  1AXD A;  5D9V A;  3RAZ A;  2GVP A;  5FHI A;  2KHP A;  3F3Q A;  3BJ5 A;  3RPP A;  2JAC A;  1GSE A;  1DBY A;  5DAK A;  1TJD A;  2LJR A;  4ECJ A;  6GSW A;  2TIR A;  5IMD A;  5ECP B;  3QDN A;  2K6V A;  2LS5 A;  2P31 A;  4POM A;  1I9D A;  1FB0 A;  4PQ1 A;  4YAP A;  2DKI A;  4NWY A;  3L9V A;  4MZC A;  4OWY A;  1UC7 A;  3ZIJ A;  3FR3 A;  1RW1 A;  3TOU A;  2H1D A;  1O73 A;  2WUL A;  2MBT A;  3LYK A;  5DDL A;  5BMU A;  3D5J A;  3FW2 A;  3NOF A;  4KSM A;  3LWA A;  1MD3 A;  2LRN A;  4F0B A;  3H93 A;  4IQA A;  1U88 A;  1JFU A;  4I97 A;  5D9W A;  4JR6 A;  1PKW A;  2PER A;  4CHS A;  2HLS A;  1T4Y A;  2UZ8 A;  4KF9 A;  4OO4 A;  1SK1 A;  5CYY A;  1G7E A;  4PNF A;  5HQP A;  3WGE A;  3KH9 A;  4QL7 A;  4WKW A;  2P5R A;  5IMC A;  4X1U A;  4OD7 A;  5ABR A;  2RLI A;  1TKD B;  3CSH A;  1FAA A;  3TJJ A;  1XW5 A;  3GTU A;  1F3A A;  3A2V A;  3QFA C;  2L5L A;  2VCV A;  1SYX A;  2RUF A;  1K3O A;  5EY6 A;  1YQ1 A;  2RUE A;  5IMZ A;  4KAE A;  3A5W A;  2JZS A;  3KTL A;  5G5E A;  2FGX A;  2FWG A;  3TKR A;  4MF5 A;  2VIM A;  4EIQ A;  2ALB A;  2I3Y A;  1T1V A;  1K3Y A;  1AQV A;  5ID2 A;  2WJU A;  4USS A;  2NVL A;  2N5B A;  3A2X A;  5DAK B;  3SWL A;  4J57 E;  1TU8 A;  3GKK A;  2C3N A;  4JE1 A;  3IBH A;  2DBC A;  3G7J A;  4EXJ A;  2V41 A;  2C80 A;  2AHE A;  3LSZ A;  1OE7 A;  1PKZ A;  2YOI A;  3UOM A;  5F05 A;  3TJF A;  4G0I A;  1YY7 A;  3GMF A;  3KCM A;  1QK8 A;  3MIX A;  2HRK A;  3H79 A;  2B5X A;  2HXK A;  4K7I A;  3TKS E;  1JZR A;  2IMF A;  4MH3 A;  2QC7 A;  2K18 A;  17GS A;  1HNC A;  1XIY A;  3EU3 A;  3EMP A;  2PUK C;  2H72 A;  2LNS A;  2H8L A;  1EEJ A;  3DYR A;  1LJR A;  1S3D A;  2E0Q A;  1GSS A;  3C1S A;  1GH2 A;  5IMA A;  3UMA A;  3R3E A;  4I5Q A;  2BMX A;  4DVC A;  2EIR A;  4IS0 A;  2NTO A;  4FIW A;  5G30 A;  1XWB A;  5IOX A;  3IK9 A;  3BCI A;  3LYP A;  4Q5F A;  3UBK A;  1AAZ A;  4K8M A;  1R5P A;  5H5R A;  4PUF C;  1X9W B;  5H5Q A;  4O7H A;  4EE0 A;  4ZXG A;  1QFN A;  3GTU B;  4N11 A;  2IPA A;  2YAN A;  4AJ8 A;  3F4T A;  3ZFB A;  4OFN A;  2YV9 A;  3N9J A;  1Z5Y E;  5A4V A;  4MAB A;  3WGD A;  2H6Y A;  2N5F A;  4PTS A;  1V40 A;  4XHM A;  5KN1 A;  1OYJ A;  4IKH A;  2P0G A;  1K0N A;  5G31 A;  4JR4 A;  1O7U A;  1F2E A;  2HYX A;  4ECC A;  1Y25 A;  5D73 A;  3GH9 A;  4MJE A;  5EL8 A;  4YQV A;  12GS A;  1A2J A;  1S3A A;  4G0K A;  4TOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...