1MDJA

High resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human nfkb (residues 56-68 of the p50 subunit of nfkb)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (electron transport/peptide)
molecule keywords THIOREDOXIN
publication title Solution structure of human thioredoxin in a mixed disulfide intermediate complex with its target peptide from the transcription factor NF kappa B.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1995-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1mdjA00
5F07A 2X99A 3IXRA 3D0ZA 2OBKA 4IQ1A 4KAEA 1XW6A 1JZDA 1YQ1A 4PQ1A 2VM2A 1J08A 1TOFA 4QL9A 1K3LA 1J0FA 1O8XA 1U87A 2WRTA 3UAPA 4RUVA 3F6FA 4ML6A 4IKHA 1LBKA 4WETA 1SU9A 1M99A 5D96A 2YWIA 3TB2A 1OYJA 3GKNA 3I6AA 4HQSA 2F8AA 1KNGA 3LJRA 4HDEA 3HJOA 4ZL9A 4EE0A 1IYIA 2FWFA 2KOKA 2PWJA 4I97A 1X5EA 4PURA 4JBBA 5IO2A 1XIYA 2R5GA 3DGQA 1R26A 3TJFA 3D22A 3ME8A 3VK9A 2B3SA 3O6TA 3TUEA 1WPIA 2K8SA 3KH9A 3GA4A 2CVBA 4OFTA 3EU4A 4GRFA 1MEKA 2ZNMA 2XPEA 4X43A 4ECJA 2YCDA 4KX4A 13GSA 3LYPA 4Q5FA 5ECKB 5ECSA 4MDCA 4FO5A 1SL0B 4V2MA 3L4NA 4FYBA 1GUHA 1TKDB 5F05A 1ZCPA 3EINA 1F9MA 2GQKA 1GRXA 1B48A 4HS1A 2FWGA 5IPHA 2CAIA 1NHOA 1SYRA 4KA0A 2OE0A 3FR9A 1KBNA 2DBCA 1N8JA 3IAM2 5ECLB 3TDGA 2B1KA 4KSOA 4ZL8A 4G9HA 1BEDA 5D73A 4YQMA 5JWOB 1HNAA 2VAFA 4CDOA 2O87A 1A0RP 1FG4A 1LU4A 4Q5NA 1PX6A 4GF0A 3F4RA 1G6WA 1QGVA 5HFGA 2C3TA 3C71A 3ZIVA 4IP1A 4NHWA 3FZ9A 4F03A 4EO3A 1QFNA 1M2DA 3HA9A 4RI6A 1KEBA 2QSIA 2P5QA 4N0VA 2RM6A 2LV3A 4JU5A 5G5FA 4L0WA 1R4WA 4TR4A 2H1DA 16GSA 4YH2A 2L6DA 5LCZA 2H1GA 1Z6NA 2VUPA 1XVQA 2AJQB 3GFKA 3QAWA 4EUYA 6GSWA 3GTUB 7GSSA 2MYGA 3F0IA 2IPAA 5ELGA 4MCUA 1EGRA 3IHQA 1BQ7A 4OCEA 1NM3A 1AUCA 2HI7A 4K8MA 5HR0A 3FY7A 1XXUA 1DBYA 2QGVA 4O92A 4Q5RA 4OWYA 3QOUA 4PUAA 5AIXA 3BBYA 2GT6A 2RM5A 1Q4JA 2XBQA 1HD2A 3D21A 4RI7A 2LRNA 4V1Ap 2GVPA 4ZXGA 4J56E 3CYNA 4YAVA 4OCFA 2ON7A 1B4PA 2C3NA 1GSYA 2K8VA 4DSSB 3EURA 2CAQA 1O73A 1G7EA 5DJLA 3MSZA 1WWJA 3VWVA 4KCAA 1THXA 2PVOC 3AY8A 5J3RA 4IQAA 4NV2A 4EF0A 5AIVA 3R2QA 3O76A 4MK3A 4E8EA 2AHEA 1T4YA 3KH7A 5B8BA 1PKWA 3M8NA 3M1GA 3QPMA 4P3YB 5AN1A 4IHUA 3M9JA 4IVFA 5ECOB 4GWRA 2REMA 2HLSA 4HQZA 3BCIA 4IELA 1CQGA 2LJAA 4TXVA 2BMXA 1E6BA 3GKMA 4KDYA 2AV4A 2RUEA 1G7OA 1TI1A 4NMUA 5IM9A 2MMZA 3DYRA 3TJJA 1K0OA 3LG6A 2VOCA 5GZZB 5G5EA 2FA8A 4ZL7A 4POLA 1BX9A 3E0UA 1GSEA 2L4CA 1K0MA 1ZYEA 1XOBA 19GSA 3WGXA 4IW9A 2M80A 4KSMA 2VCTA 5IMVA 3HD5A 2H6XA 2LJKA 6GSTA 3UBLA 2NDOA 2VIMA 3F3RA 3TKSE 1GSQA 3ERGA 3LORA 3HJMA 5G31A 1XZOA 1WE0A 1X5DA 2VD0A 2VL9A 4GLTA 2CX4A 3VI7A 4TN8A 1WOUA 3HYPA 1V58A 2DSAA 3HDCA 3KJYA 4CHSA 2VCQA 3QMXA 4ID0A 2VCWA 5C04A 1GL8A 2AAWA 1F37A 3FYGA 4L5LA 1T8EB 4ZIJA 2H71A 1XPVA 4BA7A 4XS6A 1FW1A 2DJ3A 1M7TA 1PQNA 3UL3A 5IMZA 4HZ4A 1PKZA 2VL2A 2YWMA 4N30A 3UIWA 1ST9A 1YKAA 3EMXA 1U3AA 5D9XA 5ECRB 2CV4A 1T3BA 1SL2B 4BWSA 3GH9A 2H01A 2GTUA 5HQPA 2MZCA 2ZUPA 1VF1A 3CTFA 1X0RA 4XS4B 3HJPA 5A4WA 3M3MA 4ZBBA 3J7Yb 5F8BA 6GSUA 1Y25A 2MBSA 1DSBA 3U5RE 1EEJA 3RDWA 1XW9A 5F0GA 1V98A 5ID2A 2F9SA 2FY6A 2FGXA 2L57A 3IK9A 5ECPB 3FZAA 2V32A 1SK0A 3APSA 1MD4A 5DQYA 3FW2A 3GKKA 3WT1A 2D2ZA 4KE3A 1ZGNA 3KEBA 2ES7A 3FK8A 3NOFA 1XWKA 2PMTA 4MJBA 2C0DA 1GUMA 4HU9A 4WKWA 1V57A 1WMJA 4MA9A 1M9AA 3L0HA 1BJXA 1SJIA 3F4TA 2IMIA 2YP6A 1RK4A 3MNGA 3GSTA 1TRSA 1A23A 1BG5A 5DCHA 2A4VA 1PX7A 4TXOB 4POMA 3WGEA 1FVKA 5GAPD 3N9JA 3CSJA 2DJ0A 3SBCA 5KN0A 3ZYWA 2JSZA 5H5SA 2JL4A 2KLXA 4GQFA 3UBKA 1AQVA 3P2AA 1JZOA 2QC7A 4ZBDA 1Z6MA 3PINA 2LEGA 4DVCA 3ZIJA 1XFLA 4POBA 2MBTA 1M0UA 2O89A 3TOTA 5EL8A 2KP2A 5GSTA 2K9FA 4MPGA 1TRUA 3LXZA 4PQHA 2VD1A 1GSDA 2VL3A 1I5GA 2G2QA 4OMVA 3TOUA 5FT3A 2HZEB 3A2VA 4V2LA 3GMFA 3H79A 3FRCA 4XRAA 4K1FA 3UVHA 3U6VA 1F3AA 5ECQB 4GTUA 4HJ2A 4MJAA 1JFUA 4PXOA 4NXIA 3GX0A 2X64A 4LL1B 3DKSA 2WB9A 1TP9A 4HZ2A 5F06A 5G1KA 3BCKA 4MF5A 5JCGA 4WXTA 1T00A 1V2AA 2YZHA 5COHA 1ERTA 2XHFA 4LMWA 3BD2A 4LMVA 1O6JA 3RHCA 1M2BA 2B5EA 3NIVA 3ERFA 2H76A 1MDKA 4KDUA 3ZLPA 2WS2A 3MDKA 1TU8A 5GAND 4NPBA 1OC9A 4GSTA 4N11A 1GNEA 4QQ7A 3ISOA 4X1UA 2JACA 2H74A 5HFKA 3TRPA 4GSSA 4GCIA 5DAKA 2DIYA 2MMAA 1PD21 2AYTA 2GQMA 4XHMA 5D9TA 4QL7A 2IN3A 4WF4A 5CO3A 3EYTA 4L8EA 5J41A 1GTBA 3A2WA 3DD3A 5CNWA 3GL3A 4X0XA 4OFMA 1ZYQB 1X9WB 3EE2A 4N0ZA 1TRVA 3E9JB 2OADA 4MJEA 3RPNA 5IOWA 2C1YA 2H30A 3ZTLA 3I69A 1YKCA 3L9UA 2FWEA 5DBQA 1THOA 2OE3A 3C1SA 4KCEA 4OFNA 2VLUA 1T4ZA 2GQLA 2HT9A 1K3YA 2YV9A 2VLVA 3Q74A 1TK0B 3EU3A 3HZ4A 2DLXA 5ELAA 3IDVA 1SKSB 3VFIA 5LNKe 4HJMA 4ML1A 2RLIA 3ERWA 2VLTA 3KTLA 2DJ1A 1A8LA 1PSQA 4G2EA 3C7MA 5IIZA 3CRUA 1E2YA 1XOAA 4J2FA 1W4VA 4XIHA 4POKA 5ECMB 4MH3A 2IMKA 3A3TA 4E8HA 3GV1A 5J9CA 3GSSA 3GIXA 2FLSA 5CP1A 3P90A 3TGZA 3KMOA 4Z7XA 2FWHA 3LYKA 4ECCA 4J57E 3UJ1A 1N2AA 3C73A 1XCCA 3JCML 5G30A 1H75A 2LQQA 1BYEA 2IL3A 1PGTA 1OAZA 2NPBA 4EDZA 3WYWA 4JR4A 1GNWA 3I9V2 2HRNA 2A2RA 2LUSA 4I6XA 5IOXA 1FAAA 1EGOA 2H73A 1JZRA 2YV7A 4AGSA 3FHKA 9GSSA 2MMNA 3VWUA 1F2EA 2H8LA 4O32A 4F0CA 5CAXA 4PNGA 2B5YA 2DJJA 1SK2A 4MZCA 3W8JA 4JEDA 2WJUA 2OACA 3LQ7A 1YEPA 2HXKA 4RQXA 5AISA 2F8FA 3M9KA 4TW5A 1BAYA 1KTEA 1K0CA 2I81A 4ILFA 1TI3A 3D5JA 2WDUA 1HQOA 2YOIA 5DALA 2OE1A 1SYXA 4LLRA 2YJHA 4I2TA 1TW9A 3DXBA 3EMPA 3CMIA 1SJ6A 4PUFC 2JZRA 2J9HA 2IFQA 2L6CA 1SKWB 1GP1A 4G19A 1XVWA 1YZXA 6GSSA 2DIZA 1IYHA 1GUKA 1XWCA 3ZMLA 1O7UA 4K7NA 1F6MC 1FO5A 2R2JA 3A5WA 4XCSA 4BWQA 2KHPA 4OD7A 3PR8A 1AQWA 1LJRA 2VL2C 1ZOFA 4TRXA 1UVZA 3HY2A 1SL1B 1VF4A 2CA8A 3HVVA 5LD0A 4JZQA 2YPMA 18GSA 2C0GA 4YAPA 3TCOA 2FA4A 4MZWA 1EP7A 1ZMAA 2B5XA 3WGDA 2BTOT 1VGLA 1H4OA 2CZ3A 2OKAA 2L4QA 4XRDA 2H1BA 5HR3A 3HXSA 3I43A 3ZFBA 2HSYA 3ZMKA 1EZKA 2K18A 2GSRA 3CBUA 3LGCA 3QAVA 2H1AA 4NWYA 2JZSA 3H93A 4WBRD 2PGTA 1XWBA 4K0GA 1OKDA 4I2UA 2LSTA 2CVDA 1B8XA 4MP4A 1EOHA 2JU5A 4NHZA 3OR5A 1A2MA 1QK8A 2LKUA 1EV4A 4YQVA 3H8QA 1CQHA 1MDJA 2CT6A 3TKSC 4ISDA 2H6ZA 1NW2A 2HRFA 5CRWA 2HZFA 1PL2A 5D8IA 1RQMA 5AGYA 5ECHB 4GSNA 3UEMA 3GHAA 2FD3A 1UA5A 5IMFA 2IMEA 5CREA 1U3IA 5JWRB 3APQA 4AJ7A 1B9XC 2HSHA 5CRDA 5J9BA 1GTUA 1O8WA 4F82A 1FHEA 2Z9SA 4BVXA 5DDLA 3ME7A 2H75A 3QFBC 6GSXA 1GULA 3TJGA 3F63A 1VF2A 5A4VA 2JZTA 3F3QA 4EL1A 2E2MA 4TVEA 2WCIA 5J4UA 1TU7A 5DQSA 4WR5A 4TOPA 2DJ2A 1JHBA 1UC7A 3FEUA 1SD9A 2M46A 4FIWA 3UOMA 2GLRA 1V9WA 4MZBA 4MPFA 2YZUA 2ZCTA 4KW6A 4NAXA 5E59A 1GSSA 1OVNA 3KCMA 2TRCP 3IC4A 4TKYA 4FH8A 3ZVJA 5CYYA 1MDIA 3F9UA 3IOSA 1OC8A 1TK5B 1YJ6A 2YANA 5ENUA 3QR6A 2R4VA 4NV5A 5CRHA 1Z7PA 3ZVJD 2C0FA 3Q19A 4PQIA 4MF7A 2LQOA 1PA3A 2GS3A 3H4KA 1U6TA 1Q98A 3MWHA 4ECIA 2IIYA 2GGTA 2PERA 3ED3A 1K0BA 3L9VA 3ZL5A 5ECNB 4GQCA 4ZB8A 3FKFA 2WULA 5KN2A 1MD3A 3TJBA 2P31A 5ABRA 2RUFA 3K8NA 3LFLA 1NHYA 2P0GA 4IN0A 1ACVA 4HEA2 3LWAA 1AAZA 3QFAC 2H6YA 3J7Yk 5ECIB 1AC1A 1QXHA 2WGRA 2C4JA 2MMOA 4AJ8A 3KTBA 5HR1A 3HVSA 4IBPA 3HZ8A 3VWWA 1GLQA 1GTIA 2OBIA 2NVLA 2FUG2 1JLWA 3QAGA 2NTOA 3DEXA 3DWVA 1F3BA 4O5RA 1A2LA 4TR3A 1SENA 3LEFA 4I8BA 2IWTA 2PU9C 1G6YA 3F4SA 5A5KA 2YJ7A 1SKRB 4WF5A 3O3TA 1JLVA 3CSIA 5HR2A 4K0NA 5ID2B 5EVOA 1AW9A 3DIEA 2CZ2A 2EC4A 2HFDA 2GZYA 1O85A 3IA1A 3LSZA 1X9SB 1TK8B 5DCGA 5H5RA 2K6VA 2R6KA 3F8UA 6GSYA 4O7HA 3VURA 3A2XA 2JADA 1EWXA 3WT2A 3QDNA 4LL4B 3H1NA 1TXXA 3KM6A 2H0IA 3FZ4A 4ZB6A 1GLPA 3L9SA 2ALBA 5DJMA 2V41A 1TRWA 2B7JA 5JCUA 5KN1A 1T7PB 1NSWA 2B1LA 4F2IA 2L59A 4GXZA 1USBA 2N5FA 4BVYA 1UN2A 14GSA 2VCXA 4HOJA 3PGTA 1U88A 5INYA 1DE2A 3LXTA 4JE1A 3Q6OA 4V1Ag 2V6KA 2J23A 5C00A 2AB6A 3DVXA 3EVIA 4IP6A 3N5OA 4K9ZA 1OE8A 2LNSA 1K0NA 1S3DA 3D4MA 4OO5A 3ZITA 2P5RA 4DEJA 3DVWA 4DSRA 2L5OA 3G7YA 1EEMA 2XC2A 3ZRDA 3CXGA 3TRQA 1DE1A 2GZPA 2V2GA 3KIJA 2LRCA 2V1MA 1OC3A 3GTUA 3TJKA 2O7KA 4WEYA 2IMFA 2LNTA 4BPYA 1YY7A 3HCZA 5G1LA 3VPQA 2I4AA 3F6DA 1MTCA 2VO4A 1HNCA 1T1VA 1RW1A 1Z5YE 5EPFA 3GX8A 2VCVA 3GH6A 1Z7RA 2WZ9A 4K2DA 1C72A 3RBTA 5IQYA 1X9MB 1WRYA 3IV4A 1AIUA 5H5QA 1B4QA 1R7HA 1J9BA 1S3AA 1FB0A 1SD8A 1GWCA 3V1WA 1GH2A 5B7CA 17GSA 5GSSA 2DMMA 4ZBAA 4IJ3A 3BJ5A 4DSSA 2PVQA 3DMLA 5L71A 1ERVA 1OC9B 3S9FA 2DJKA 4IGJA 3M0FA 1AQXA 5JWQB 5DAKB 2XPDA 5KN3A 5IPGA 4LA1A 3VPTA 5D9WA 4F9ZA 2H66A 2TIRA 4YQUA 1K3OA 1TDIA 3FZ5A 4AJ6A 1R5AA 2AUVA 4IS0A 8GSSA 2N5BA 3KZQA 4AF2A 1Z9HA 2E2GA 4PGTA 3ZFLA 4CW9A 3CTGA 1YEXA 2B6MA 1EP8A 3TKRA 3US3A 2XBIA 2V6OA 3RAZA 3IAS2 4L5OA 1XW5A 1SK1A 5EY6A 1GSFA 1G0TA 1YDKA 5A4UA 2L5LA 3QCPA 4L0UA 3IRAA 5CRGA 2I9HA 3RHBA 3TKPA 2GDRA 3GRXA 2OJLA 1JZWA 2X8CA 2R3XA 4KNDA 4ECBA 5FWGA 5B6NA 3E3EA 2N5AA 3UMAA 1ABAA 4ZB9A 2H70A 1FOVA 2LRTA 2H72A 4JRRA 2YWNA 3KXOA 2PN8A 4OO4A 1A8YA 1W89A 3GNJA 1K0AA 3C1RA 2RIIA 3KD0A 2C80A 1A24A 2G0FA 4MMMA 1ERWA 2KP1A 1Y6EA 3D6IA 2A2SA 1S3CA 4F0BA 1URMA 2YWOA 3FR3A 2FHEA 5IMDA 3GYKA 3APOA 2C3QA 2QKEA 2GSTA 3KP8A 4N10A 1VF3A 2GSQA 1EOGA 1HYUA 4FYCA 3QD9A 2GT5A 4K7IA 3G7IA 4KB3A 5IMCA 4Q5QA 1QMVA 1ON4A 2X8HA 5IMAA 11GSA 1V40A 1XWAA 5J5NA 1M9BA 2PUKC 1YF0A 6GSVA 12GSA 2CQ9A 4EDYA 3UARA 4HU7A 4RQRA 2ON5A 1OE7A 3DRNA 5DVBA 1X5CA 3VWXA 4ACSA 2FCHA 2VCZA 5D9VA 2WFCA 4PX1A 4ZILA 2IMDA 2IJYA 1K0DA 1ZL9A 2CVKA 4XS4A 3RPPA 4TR1A 1FB6A 5G2ZA 4MLYA 2F51A 3TRXA 2EIOA 3D4TA 1QQ2A 3KMNA 1I9DA 1GTAA 2H0HA 4BL7A 4TR0A 5DALB 4MH2A 1XBSA 1A2JA 2CX3A 3HVXA 2I1UA 2EIQA 5D93A 3CRTA 1PMTA 4V2NA 4G10A 4D73A 4MABA 2IFQB 2F3MA 2LS5A 3PH9A 3GURA 2GSSA 2KUCA 2LJRA 1WJKA 4HUAA 4K7OA 2HNLA 3HKRA 5KEJA 1ILOA 1XWGA 1DUGA 4EC0A 20GSA 3IE3A 2R37A 2NBSA 2HE3A 1Z3EA 2PPTA 2YNXA 3GKXA 2B7KA 2HYXA 3HHVA 1ML6A 1TJDA 4I5QA 3IPZA 2E0QA 3VLNA 3IBHA 1YF1A 1PL1A 3W8SA 1VRSD 2H0GA 1B9YC 4KH7A 2FNOA 4K6XA 5HFIA 2VM1A 3IR4A 2DMLA 2C8UA 4KUNA 1QUWA 4TXOA 2JSYA 4EXJA 2H19A 3GUSA 4FYUA 4WBJA 4WR4A 22GSA 4H86A 2YN1A 1WIKA 1ZZYA 3NZNA 3EC3A 2LTKA 2M72A 4TR1B 1SJZA 2O8VB 2GZZA 2O85A 3EWLA 4ULXA 2EIRA 3W6GA 4XTSA 4EVMA 1M2AA 3KGKA 3P7XA 3VI5A 2TRXA 5IO0A 1GSUA 3G7JA 2DC5A 3TKQA 5JCWA 3KP9A 4D73B 3MAKA 4PNFA 5FHIA 3TKSA 4KDXA 3CSHA 2OA7A 3SWLA 2PBJA 4XS1A 3IK7A 1R5PA 1AXDA 3Q18A 4HI7A 3GN3A 4KGIA 3FR6A 1O81A 3ZREA 2HZEA 4DSQA 1EV9A 4MJCA 3UVTA 1PRXA 2E7PA 3WD6A 1HNBA 1A0FA 2I3YA 3G9BA 2X8GA 4IJIA 4JR6A 5B6MA 3BOAA 1TTZA 3GL5A 3L78A 1WP0A 5B8AA 1FVJA 1ERUA 5E4WA 2C0EA 4EKZA 4MF6A 2BJXA 3P8WA 1OKTA 10GSA 1PN9A 3C8EA 3ZZXA
chains in the Genus database with same CATH superfamily
5F07A 2X99A 3IXRA 3D0ZA 2OBKA 4IQ1A 4KAEA 1XW6A 1JZDA 1YQ1A 4PQ1A 2VM2A 1J08A 1TOFA 4QL9A 1K3LA 1J0FA 1O8XA 1U87A 2WRTA 3UAPA 4RUVA 3IC8A 3F6FA 4ML6A 4IKHA 1LBKA 4WETA 1SU9A 1M99A 5D96A 2YWIA 4BIKA 3TB2A 1OYJA 3GKNA 3I6AA 4HQSA 2F8AA 1KNGA 3LJRA 4HDEA 3HJOA 4ZL9A 4EE0A 1IYIA 2FWFA 2KOKA 2PWJA 4I97A 1X5EA 4PURA 4JBBA 5IO2A 1XIYA 2R5GA 3DGQA 1R26A 3TJFA 3D22A 3ME8A 3VK9A 2B3SA 3O6TA 3TUEA 1WPIA 2K8SA 3KH9A 3GA4A 2CVBA 4OFTA 3EU4A 4GRFA 1MEKA 2ZNMA 2XPEA 5KOWA 4X43A 4ECJA 2YCDA 4KX4A 13GSA 3LYPA 5BMUA 4Q5FA 5ECKB 5ECSA 4MDCA 4FO5A 1SL0B 4V2MA 3L4NA 4FYBA 1ZYPA 1GUHA 1TKDB 5F05A 1ZCPA 3EINA 1F9MA 2GQKA 1GRXA 1B48A 4HS1A 2FWGA 5IPHA 2CAIA 1NHOA 1SYRA 4KA0A 2OE0A 3FR9A 1KBNA 2DBCA 1N8JA 3IAM2 5ECLB 3TDGA 2B1KA 4KSOA 4BVYB 4ZL8A 4G9HA 1BEDA 5D73A 4YQMA 5JWOB 1HNAA 2VAFA 4CDOA 2O87A 1A0RP 1FG4A 1LU4A 4Q5NA 1PX6A 4GF0A 3F4RA 1G6WA 1QGVA 5HFGA 2C3TA 2QA1A 3C71A 3ZIVA 4IP1A 4NHWA 3FZ9A 4F03A 4EO3A 1QFNA 1M2DA 3HA9A 4RI6A 1KEBA 2QSIA 2P5QA 4N0VA 2RM6A 2LV3A 4JU5A 5G5FA 4L0WA 1R4WA 4TR4A 2H1DA 16GSA 4YH2A 2L6DA 5LCZA 2H1GA 1Z6NA 2VUPA 1XVQA 2AJQB 3GFKA 3QAWA 4EUYA 6GSWA 3GTUB 7GSSA 2MYGA 3F0IA 2IPAA 5ELGA 4MCUA 1EGRA 3IHQA 1BQ7A 4OCEA 1NM3A 2X49A 1AUCA 2A4HA 2HI7A 4K8MA 5HR0A 3FY7A 1XXUA 1DBYA 2QGVA 4O92A 4Q5RA 4OWYA 3QOUA 4PUAA 5AIXA 3BBYA 2GT6A 2RM5A 1Q4JA 2XBQA 1HD2A 3D21A 4RI7A 2LRNA 4V1Ap 2GVPA 4ZXGA 4J56E 3CYNA 4YAVA 4OCFA 2ON7A 1B4PA 2C3NA 1GSYA 2K8VA 3MIXA 4DSSB 3EURA 2CAQA 1O73A 1G7EA 5DJLA 3MSZA 1WWJA 3VWVA 4KCAA 1THXA 2PVOC 3AY8A 5J3RA 4IQAA 4NV2A 4EF0A 5AIVA 3R2QA 3O76A 4MK3A 4E8EA 2AHEA 1T4YA 3KH7A 5B8BA 1PKWA 3M8NA 3M1GA 3QPMA 4P3YB 5AN1A 4IHUA 3M9JA 4IVFA 3LW9A 5ECOB 4GWRA 2REMA 4K5RA 2HLSA 4HQZA 3BCIA 4IELA 1CQGA 2LJAA 4TXVA 2BMXA 1E6BA 3GKMA 4KDYA 2AV4A 2RUEA 1G7OA 1TI1A 4NMUA 5IM9A 2MMZA 3DYRA 3TJJA 4ICYA 1K0OA 3LG6A 2VOCA 5GZZB 5G5EA 2FA8A 4ZL7A 4POLA 1BX9A 3E0UA 1GSEA 2L4CA 1K0MA 1ZYEA 1XOBA 19GSA 3A5IA 3WGXA 4IW9A 2M80A 4KSMA 2VCTA 5IMVA 3HD5A 2H6XA 2LJKA 6GSTA 3UBLA 2NDOA 2VIMA 3F3RA 3TKSE 1GSQA 3ERGA 3LORA 3HJMA 5G31A 1ZYNA 1XZOA 1WE0A 1X5DA 2VD0A 2VL9A 4GLTA 2CX4A 3VI7A 4TN8A 4K5SA 1WOUA 3HYPA 1V58A 2DSAA 3HDCA 3KJYA 4CHSA 2VCQA 3QMXA 4ID0A 2VCWA 5C04A 1GL8A 2AAWA 1F37A 3FYGA 4L5LA 1T8EB 4ZIJA 2H71A 1XPVA 4BA7A 4XS6A 1FW1A 2DJ3A 1M7TA 1PQNA 3UL3A 5IMZA 4HZ4A 1PKZA 2VL2A 2YWMA 4N30A 3UIWA 1ST9A 1YKAA 3EMXA 1U3AA 5D9XA 5ECRB 2CV4A 1T3BA 1SL2B 4BWSA 3GH9A 2H01A 2GTUA 5HQPA 2MZCA 2ZUPA 1VF1A 3CTFA 1X0RA 4XS4B 3HJPA 5A4WA 3EPTA 3M3MA 4ZBBA 3J7Yb 5F8BA 6GSUA 4BL7B 1Y25A 2MBSA 1DSBA 3U5RE 1EEJA 3RDWA 1XW9A 5F0GA 1V98A 5ID2A 2F9SA 2FY6A 2FGXA 2L57A 3IK9A 2R0CA 5ECPB 3FZAA 2V32A 1SK0A 3APSA 1MD4A 5DQYA 3FW2A 3GKKA 3WT1A 2D2ZA 4KE3A 1ZGNA 3KEBA 2ES7A 3FK8A 3NOFA 1XWKA 2PMTA 4MJBA 2C0DA 1GUMA 4HU9A 4WKWA 1V57A 1WMJA 4MA9A 1M9AA 3L0HA 1BJXA 1SJIA 3F4TA 2IMIA 2YP6A 1RK4A 3MNGA 3GSTA 1TRSA 1XG8A 1A23A 1BG5A 5DCHA 2A4VA 4HSCX 1PX7A 4TXOB 4POMA 2R0PA 4EIPA 3WGEA 1FVKA 5GAPD 3N9JA 3CSJA 2DJ0A 3SBCA 5KN0A 3ZYWA 2JSZA 5H5SA 2JL4A 2KLXA 4GQFA 3UBKA 1AQVA 3P2AA 1JZOA 4CY8A 2QC7A 4ZBDA 1Z6MA 3PINA 2LEGA 4DVCA 3ZIJA 1XFLA 2X4AA 4POBA 2MBTA 1M0UA 2O89A 3TOTA 5EL8A 2KP2A 5GSTA 2K9FA 4MPGA 1TRUA 3LXZA 4PQHA 2VD1A 1GSDA 2VL3A 1I5GA 2G2QA 4OMVA 3TOUA 5FT3A 2HZEB 3A2VA 4V2LA 3GMFA 3H79A 3FRCA 4XRAA 4K1FA 3UVHA 3U6VA 1F3AA 5ECQB 4GTUA 4HJ2A 4MJAA 1JFUA 4PXOA 4NXIA 3GX0A 1M3IA 2X64A 4LL1B 3DKSA 2WB9A 1TP9A 4HZ2A 5F06A 5G1KA 3BCKA 4MF5A 5JCGA 4WXTA 1T00A 1V2AA 2YZHA 5COHA 1ERTA 2XHFA 4LMWA 3BD2A 4LMVA 1O6JA 3RHCA 1M2BA 2B5EA 3NIVA 3ERFA 2H76A 1MDKA 4KDUA 3ZLPA 2WS2A 3MDKA 1TU8A 5GAND 4NPBA 1OC9A 1PFOA 4GSTA 4N11A 1GNEA 4QQ7A 3ISOA 4X1UA 2JACA 2H74A 5HFKA 3TRPA 4GSSA 4GCIA 5DAKA 2DIYA 2MMAA 1PD21 2AYTA 2GQMA 4XHMA 5D9TA 4QL7A 2IN3A 4WF4A 5CO3A 3EYTA 4L8EA 5J41A 1GTBA 3A2WA 3DD3A 5CNWA 3GL3A 4X0XA 4OFMA 1ZYQB 1X9WB 3EE2A 4N0ZA 1TRVA 3E9JB 2HRAA 2OADA 4MJEA 3RPNA 5IOWA 2C1YA 2H30A 3ZTLA 3I69A 1YKCA 3L9UA 2FWEA 5DBQA 1THOA 2OE3A 3C1SA 4KCEA 4OFNA 2VLUA 1T4ZA 2GQLA 2HT9A 1K3YA 2YV9A 2VLVA 3Q74A 1TK0B 3EU3A 4Z2RA 3HZ4A 2DLXA 5ELAA 3IDVA 1SKSB 3VFIA 5LNKe 4HJMA 4ML1A 2RLIA 3ERWA 5BRTA 2VLTA 3KTLA 2DJ1A 1A8LA 4FQUA 1PSQA 4G2EA 3C7MA 5IIZA 3CRUA 1E2YA 1XOAA 4J2FA 1W4VA 4XIHA 4POKA 5ECMB 4MH3A 2IMKA 3A3TA 4E8HA 3GV1A 5J9CA 3GSSA 3GIXA 2FLSA 5CP1A 3P90A 3TGZA 3KMOA 4Z7XA 2FWHA 1FOHA 3LYKA 4ECCA 4J57E 3UJ1A 1N2AA 3C73A 1XCCA 3JCML 5G30A 1H75A 2LQQA 1BYEA 2IL3A 1PGTA 1OAZA 2NPBA 4EDZA 3WYWA 4JR4A 1GNWA 3CQFA 3I9V2 2HRNA 2A2RA 4KF9A 2LUSA 4I6XA 5IOXA 1FAAA 1EGOA 2H73A 1JZRA 2YV7A 4AGSA 3FHKA 9GSSA 2MMNA 3VWUA 1F2EA 2H8LA 4O32A 4F0CA 5CAXA 4PNGA 2B5YA 2DJJA 1SK2A 4MZCA 3W8JA 4JEDA 2WJUA 2OACA 3LQ7A 1YEPA 2HXKA 4RQXA 5AISA 2F8FA 3M9KA 4K2XA 4TW5A 1BAYA 1KTEA 1K0CA 2I81A 4ILFA 1TI3A 3D5JA 2WDUA 1HQOA 2YOIA 5DALA 2OE1A 1SYXA 4LLRA 2YJHA 4I2TA 1TW9A 3DXBA 3EMPA 3CMIA 1SJ6A 4PUFC 2JZRA 2J9HA 2IFQA 2L6CA 1SKWB 1GP1A 4G19A 1XVWA 1YZXA 6GSSA 2DIZA 1IYHA 1GUKA 1XWCA 3ZMLA 1O7UA 4K7NA 1F6MC 4EIQA 1FO5A 2R2JA 3A5WA 4XCSA 4BWQA 2KHPA 4OD7A 3PR8A 1AQWA 1LJRA 2VL2C 1ZOFA 2A2PA 4TRXA 1UVZA 3HY2A 1SL1B 1VF4A 2CA8A 3HVVA 5LD0A 4JZQA 2YPMA 18GSA 2C0GA 4YAPA 3TCOA 2FA4A 4MZWA 1EP7A 1ZMAA 2B5XA 3WGDA 2BTOT 1VGLA 4A5PA 1H4OA 2CZ3A 2OKAA 2L4QA 4XRDA 2H1BA 5HR3A 3HXSA 3I43A 3ZFBA 2HSYA 3ZMKA 1EZKA 2K18A 2GSRA 3CBUA 3LGCA 3QAVA 2H1AA 4NWYA 2JZSA 3H93A 4WBRD 2PGTA 1XWBA 4K0GA 1OKDA 4I2UA 2LSTA 2CVDA 1B8XA 4MP4A 1EOHA 2JU5A 4NHZA 3OR5A 1A2MA 1QK8A 2LKUA 1EV4A 4YQVA 3H8QA 1CQHA 1MDJA 2CT6A 3TKSC 4ISDA 2H6ZA 1NW2A 2HRFA 5CRWA 2HZFA 1PL2A 1RQMA 5D8IA 5AGYA 5ECHB 4GSNA 3UEMA 3GHAA 2FD3A 1UA5A 2DKHA 5IMFA 2IMEA 5CREA 1U3IA 5JWRB 3APQA 4AJ7A 1B9XC 2HSHA 5CRDA 5J9BA 1GTUA 1O8WA 4F82A 1FHEA 2Z9SA 4BVXA 5DDLA 3ME7A 2H75A 3QFBC 6GSXA 1GULA 3TJGA 3F63A 1VF2A 5A4VA 2JZTA 2QA2A 3F3QA 4EL1A 2E2MA 4TVEA 2WCIA 5J4UA 1TU7A 5DQSA 4WR5A 4TOPA 2DJ2A 1JHBA 1UC7A 3FEUA 1SD9A 2M46A 4FIWA 3UOMA 2GLRA 1V9WA 4MZBA 4MPFA 2YZUA 2ZCTA 4KW6A 4NAXA 5E59A 1GSSA 1OVNA 3KCMA 2TRCP 4G0LA 3IC4A 4TKYA 4FH8A 3ZVJA 5CYYA 1MDIA 3F9UA 3IOSA 1OC8A 1TK5B 1YJ6A 2YANA 5ENUA 3QR6A 2R4VA 4NV5A 5CRHA 1Z7PA 3ZVJD 2C0FA 3Q19A 4PQIA 4MF7A 2LQOA 1PA3A 2GS3A 3H4KA 1U6TA 1Q98A 3MWHA 4ECIA 2IIYA 2GGTA 2PERA 3ED3A 1K0BA 3L9VA 3ZL5A 5ECNB 4GQCA 4ZB8A 3FKFA 2WULA 5KN2A 3R3EA 1MD3A 3TJBA 2P31A 5ABRA 2RUFA 3K8NA 3LFLA 1NHYA 2P0GA 4IN0A 1ACVA 4HEA2 3LWAA 1AAZA 3QFAC 2H6YA 3J7Yk 1AC1A 5ECIB 1QXHA 2WGRA 2C4JA 2MMOA 2DKIA 4AJ8A 3KTBA 5HR1A 3HVSA 4IBPA 3HZ8A 3VWWA 4BVXB 1GLQA 1GTIA 2OBIA 2NVLA 2FUG2 1JLWA 3QAGA 2NTOA 3DEXA 3DWVA 1F3BA 4O5RA 1A2LA 4TR3A 1SENA 3LEFA 4I8BA 2IWTA 2PU9C 1G6YA 3F4SA 5A5KA 2YJ7A 1SKRB 4WF5A 3O3TA 1JLVA 3CSIA 5HR2A 4K0NA 5ID2B 5EVOA 1AW9A 3DIEA 2CZ2A 2EC4A 2HFDA 2GZYA 1O85A 3IA1A 3LSZA 1X9SB 1TK8B 5DCGA 5H5RA 2K6VA 2R6KA 3F8UA 6GSYA 4O7HA 3VURA 3A2XA 2JADA 1EWXA 3WT2A 3QDNA 4LL4B 3H1NA 1TXXA 3KM6A 2H0IA 5KOXA 3FZ4A 4ZB6A 1GLPA 3L9SA 2ALBA 2V41A 1TRWA 2B7JA 5DJMA 5JCUA 5KN1A 1T7PB 1NSWA 2B1LA 4F2IA 2L59A 1S3RA 4GXZA 1USBA 2N5FA 4BVYA 1UN2A 14GSA 2VCXA 4HOJA 3PGTA 1U88A 5INYA 1DE2A 3LXTA 4JE1A 3Q6OA 4V1Ag 2V6KA 2J23A 5C00A 2AB6A 3DVXA 3EVIA 4IP6A 3N5OA 4K9ZA 1OE8A 2LNSA 1K0NA 1S3DA 3D4MA 4OO5A 3ZITA 2P5RA 1PN0A 4DEJA 3DVWA 4DSRA 2L5OA 3G7YA 1EEMA 2XC2A 3ZRDA 3CXGA 3TRQA 1DE1A 2GZPA 2V2GA 3KIJA 2LRCA 2V1MA 1OC3A 3GTUA 3TJKA 2O7KA 4WEYA 2IMFA 2LNTA 4BPYA 1YY7A 3HCZA 5G1LA 3VPQA 2I4AA 3F6DA 2HSMA 1MTCA 2VO4A 1HNCA 1T1VA 1RW1A 1Z5YE 5EPFA 3MYDA 3GX8A 2VCVA 3GH6A 1Z7RA 2WZ9A 4K2DA 1C72A 3RBTA 5IQYA 1X9MB 1WRYA 3IV4A 1AIUA 5H5QA 1B4QA 1R7HA 1J9BA 1S3AA 1FB0A 1SD8A 1GWCA 3V1WA 1GH2A 5B7CA 17GSA 5GSSA 2DMMA 4ZBAA 4IJ3A 3BJ5A 4DSSA 3PPUA 2PVQA 3DMLA 5L71A 1ERVA 1OC9B 3S9FA 2DJKA 4IGJA 3HVNA 3M0FA 1AQXA 5JWQB 5DAKB 2XPDA 5KN3A 5IPGA 4LA1A 3VPTA 5D9WA 4F9ZA 2H66A 2TIRA 4YQUA 1K3OA 1TDIA 3FZ5A 4AJ6A 1R5AA 2AUVA 4IS0A 1M3JA 8GSSA 2N5BA 3KZQA 4AF2A 2HRKA 1Z9HA 2E2GA 4PGTA 3ZFLA 4CW9A 3CTGA 1YEXA 2B6MA 1EP8A 3TKRA 3US3A 2XBIA 2V6OA 3RAZA 3IAS2 4L5OA 1XW5A 4PTSA 1SK1A 5EY6A 1GSFA 1G0TA 4Z2TA 1YDKA 5A4UA 2L5LA 3QCPA 4L0UA 3IRAA 5CRGA 2I9HA 3RHBA 4G0KA 2R0GA 3TKPA 2GDRA 3GRXA 2OJLA 1JZWA 2X8CA 2R3XA 4KNDA 4ECBA 5FWGA 5B6NA 3E3EA 2N5AA 3UMAA 1ABAA 4ZB9A 2H70A 1FOVA 2LRTA 2H72A 4JRRA 4G0IA 2YWNA 3KXOA 2PN8A 4OO4A 1A8YA 1W89A 3GNJA 1K0AA 3C1RA 2RIIA 3KD0A 2C80A 1A24A 2G0FA 4MMMA 1ERWA 2KP1A 1Y6EA 3D6IA 2A2SA 1S3CA 4F0BA 1URMA 2YWOA 3FR3A 2FHEA 5IMDA 3GYKA 3APOA 2C3QA 2QKEA 2GSTA 3KP8A 4N10A 1VF3A 2GSQA 1EOGA 1HYUA 4FYCA 3QD9A 2GT5A 4K7IA 4YKGA 3G7IA 4KB3A 5IMCA 4Q5QA 1QMVA 1ON4A 2X8HA 5IMAA 11GSA 1V40A 1XWAA 5J5NA 1M9BA 2PUKC 1YF0A 6GSVA 12GSA 2CQ9A 4EDYA 3UARA 4HU7A 4RQRA 2ON5A 1OE7A 3IHGA 2UZ8A 3DRNA 5DVBA 1X5CA 3VWXA 4ACSA 4O5UA 2FCHA 2VCZA 5D9VA 2WFCA 4PX1A 4ZILA 2IMDA 2IJYA 1K0DA 1ZL9A 2CVKA 4XS4A 3RPPA 4TR1A 1FB6A 5G2ZA 4MLYA 2F51A 3TRXA 2EIOA 3D4TA 1QQ2A 3KMNA 1I9DA 1GTAA 2H0HA 4BL7A 4CY6A 4TR0A 5DALB 4MH2A 1XBSA 1A2JA 2CX3A 3HVXA 2I1UA 2EIQA 5D93A 3CRTA 1PMTA 4V2NA 4G10A 4D73A 4MABA 2IFQB 2F3MA 2LS5A 3PH9A 3GURA 2GSSA 2KUCA 2LJRA 1WJKA 4HUAA 4K7OA 2HNLA 3HKRA 5KEJA 1ILOA 1XWGA 1DUGA 4EC0A 20GSA 3IE3A 2R37A 2NBSA 2HE3A 1Z3EA 2PPTA 2YNXA 3GKXA 2B7KA 2HYXA 3HHVA 1ML6A 1TJDA 4I5QA 3IPZA 2E0QA 3VLNA 3IBHA 1YF1A 1PL1A 3W8SA 1VRSD 2H0GA 1B9YC 4KH7A 2FNOA 4K6XA 5HFIA 2VM1A 3IR4A 2DMLA 2C8UA 4KUNA 1QUWA 4TXOA 2JSYA 4EXJA 4YKFA 2H19A 3GUSA 4FYUA 4WBJA 4WR4A 22GSA 4H86A 2YN1A 1WIKA 1ZZYA 3NZNA 3EC3A 2LTKA 2M72A 4TR1B 1SJZA 2O8VB 2GZZA 2O85A 3EWLA 4ULXA 2EIRA 3W6GA 4XTSA 4EVMA 1M2AA 3KGKA 3P7XA 3VI5A 2TRXA 5IO0A 1GSUA 3G7JA 2DC5A 4USSA 3TKQA 5JCWA 3KP9A 4MNNA 4D73B 3MAKA 4PNFA 5FHIA 4O5QA 3TKSA 4KDXA 3CSHA 2OA7A 3SWLA 2PBJA 4XS1A 3IK7A 1R5PA 1AXDA 3Q18A 4HI7A 3GN3A 4KGIA 3FR6A 1O81A 3ZREA 2HZEA 4DSQA 1EV9A 4MJCA 3UVTA 1PRXA 2E7PA 3WD6A 1HNBA 1A0FA 2I3YA 3G9BA 4X4JA 4Z2UA 2X8GA 4IJIA 4JR6A 5B6MA 3BOAA 1TTZA 3GL5A 3L78A 1WP0A 5B8AA 1FVJA 1ERUA 5E4WA 2C0EA 4EKZA 4MF6A 2BJXA 3P8WA 1OKTA 10GSA 1PN9A 3FMWA 3C8EA 3ZZXA
chains in the Genus database with same CATH topology
5F07A 2X99A 3IXRA 3D0ZA 2OBKA 4IQ1A 4KAEA 1XW6A 1JZDA 1YQ1A 4PQ1A 2VM2A 1J08A 1TOFA 4QL9A 1K3LA 1J0FA 1O8XA 1U87A 2WRTA 3UAPA 4RUVA 3IC8A 3F6FA 4ML6A 4IKHA 1LBKA 4WETA 1SU9A 1M99A 5D96A 2YWIA 3TB2A 1OYJA 3GKNA 3I6AA 4HQSA 2F8AA 1KNGA 3LJRA 4HDEA 3HJOA 4ZL9A 4EE0A 1IYIA 2FWFA 2KOKA 2PWJA 4I97A 1X5EA 4PURA 4JBBA 5IO2A 1XIYA 2R5GA 3DGQA 1R26A 3TJFA 3D22A 3ME8A 3VK9A 2B3SA 3O6TA 3TUEA 1WPIA 2K8SA 3KH9A 3GA4A 2CVBA 4OFTA 3EU4A 4GRFA 1MEKA 2ZNMA 2XPEA 5KOWA 4X43A 4ECJA 2YCDA 4KX4A 13GSA 3LYPA 5BMUA 4Q5FA 5ECKB 5ECSA 4MDCA 4FO5A 1SL0B 4V2MA 3L4NA 4FYBA 1ZYPA 1GUHA 1TKDB 5F05A 1ZCPA 3EINA 1F9MA 2GQKA 1GRXA 1B48A 4HS1A 2FWGA 5IPHA 2CAIA 1NHOA 1SYRA 4KA0A 2OE0A 3FR9A 1KBNA 2DBCA 1N8JA 3IAM2 5ECLB 3TDGA 2B1KA 4KSOA 4BVYB 4ZL8A 4G9HA 1BEDA 5D73A 4YQMA 5JWOB 1HNAA 2VAFA 4CDOA 2O87A 1A0RP 1FG4A 1LU4A 4Q5NA 1PX6A 4GF0A 3F4RA 1G6WA 1QGVA 5HFGA 2C3TA 2QA1A 3C71A 3ZIVA 4IP1A 4NHWA 3FZ9A 4F03A 4EO3A 1QFNA 1M2DA 3HA9A 4RI6A 1KEBA 2QSIA 2P5QA 4N0VA 2RM6A 2LV3A 4JU5A 5G5FA 4L0WA 1R4WA 4TR4A 2H1DA 16GSA 4YH2A 2L6DA 5LCZA 2H1GA 1Z6NA 2VUPA 1XVQA 2AJQB 3GFKA 3QAWA 4EUYA 6GSWA 3GTUB 7GSSA 2MYGA 3F0IA 2IPAA 5ELGA 4MCUA 1EGRA 3IHQA 1BQ7A 4OCEA 1NM3A 2X49A 1AUCA 2A4HA 2HI7A 4K8MA 5HR0A 3FY7A 1XXUA 1DBYA 2QGVA 4O92A 4Q5RA 4OWYA 3QOUA 4PUAA 5AIXA 3BBYA 2GT6A 2RM5A 1Q4JA 2XBQA 1HD2A 3D21A 4RI7A 2LRNA 4V1Ap 2GVPA 4ZXGA 4J56E 3CYNA 4YAVA 4OCFA 2ON7A 1B4PA 2C3NA 1GSYA 2K8VA 3MIXA 4DSSB 3EURA 2CAQA 1O73A 1G7EA 5DJLA 3MSZA 1WWJA 3VWVA 4KCAA 1THXA 2PVOC 3AY8A 5J3RA 4IQAA 4NV2A 4EF0A 5AIVA 3R2QA 3O76A 4MK3A 4E8EA 2AHEA 1T4YA 3KH7A 5B8BA 1PKWA 3M8NA 3M1GA 3QPMA 4P3YB 5AN1A 4IHUA 3M9JA 4IVFA 3LW9A 5ECOB 4GWRA 2REMA 4K5RA 2HLSA 4HQZA 3BCIA 4IELA 1CQGA 2LJAA 4TXVA 2BMXA 1E6BA 3GKMA 4KDYA 2AV4A 2RUEA 1G7OA 1TI1A 4NMUA 5IM9A 2MMZA 3DYRA 3TJJA 4ICYA 1K0OA 3LG6A 2VOCA 5GZZB 5G5EA 2FA8A 4ZL7A 4POLA 1BX9A 3E0UA 1GSEA 2L4CA 1K0MA 1ZYEA 1XOBA 19GSA 3A5IA 3WGXA 4IW9A 2M80A 4KSMA 2VCTA 5IMVA 3HD5A 2H6XA 2LJKA 6GSTA 3UBLA 2NDOA 2VIMA 3F3RA 3TKSE 1GSQA 3ERGA 3LORA 3HJMA 5G31A 1ZYNA 1XZOA 1WE0A 1X5DA 2VD0A 2VL9A 4GLTA 2CX4A 3VI7A 4TN8A 4K5SA 1WOUA 3HYPA 1V58A 2DSAA 3HDCA 3KJYA 4CHSA 2VCQA 3QMXA 4ID0A 2VCWA 5C04A 1GL8A 2AAWA 1F37A 3FYGA 4L5LA 1T8EB 4ZIJA 2H71A 1XPVA 4BA7A 4XS6A 1FW1A 2DJ3A 1M7TA 1PQNA 3UL3A 5IMZA 4HZ4A 1PKZA 2VL2A 2YWMA 4N30A 3UIWA 1ST9A 1YKAA 3EMXA 1U3AA 5D9XA 5ECRB 2CV4A 1T3BA 1SL2B 4BWSA 3GH9A 2H01A 2GTUA 5HQPA 2MZCA 2ZUPA 1VF1A 3CTFA 1X0RA 4XS4B 3HJPA 5A4WA 3EPTA 3M3MA 4ZBBA 3J7Yb 5F8BA 6GSUA 4BL7B 1Y25A 2MBSA 1DSBA 3U5RE 1EEJA 3RDWA 1XW9A 5F0GA 1V98A 5ID2A 2F9SA 2FY6A 2FGXA 2L57A 3IK9A 2R0CA 5ECPB 3FZAA 2V32A 1SK0A 3APSA 1MD4A 5DQYA 3FW2A 3GKKA 3WT1A 2D2ZA 4KE3A 1ZGNA 3KEBA 2ES7A 3FK8A 3NOFA 1XWKA 2PMTA 4MJBA 2C0DA 1GUMA 4HU9A 4WKWA 1V57A 1WMJA 4MA9A 1M9AA 3L0HA 1BJXA 1SJIA 3F4TA 2IMIA 2YP6A 1RK4A 3MNGA 3GSTA 1TRSA 1A23A 1BG5A 5DCHA 2A4VA 1PX7A 4TXOB 4POMA 2R0PA 4EIPA 3WGEA 1FVKA 5GAPD 3N9JA 3CSJA 2DJ0A 3SBCA 5KN0A 3ZYWA 2JSZA 5H5SA 2JL4A 2KLXA 4GQFA 3UBKA 1AQVA 3P2AA 1JZOA 4CY8A 2QC7A 4ZBDA 1Z6MA 3PINA 2LEGA 4DVCA 3ZIJA 1XFLA 2X4AA 4POBA 2MBTA 1M0UA 2O89A 3TOTA 5EL8A 2KP2A 5GSTA 2K9FA 4MPGA 1TRUA 3LXZA 4PQHA 2VD1A 1GSDA 2VL3A 1I5GA 2G2QA 4OMVA 3TOUA 5FT3A 2HZEB 3A2VA 4V2LA 3GMFA 3H79A 3FRCA 4XRAA 4K1FA 3UVHA 3U6VA 1F3AA 5ECQB 4GTUA 4HJ2A 4MJAA 1JFUA 4PXOA 4NXIA 3GX0A 2X64A 4LL1B 3DKSA 2WB9A 1TP9A 4HZ2A 5F06A 5G1KA 3BCKA 4MF5A 5JCGA 4WXTA 1T00A 1V2AA 2YZHA 5COHA 1ERTA 2XHFA 4LMWA 3BD2A 4LMVA 1O6JA 3RHCA 1M2BA 2B5EA 3NIVA 3ERFA 2H76A 1MDKA 4KDUA 3ZLPA 2WS2A 3MDKA 1TU8A 5GAND 4NPBA 1OC9A 4GSTA 4N11A 1GNEA 4QQ7A 3ISOA 4X1UA 2JACA 2H74A 5HFKA 3TRPA 4GSSA 4GCIA 5DAKA 2DIYA 2MMAA 1PD21 2AYTA 2GQMA 4XHMA 5D9TA 4QL7A 2IN3A 4WF4A 5CO3A 3EYTA 4L8EA 5J41A 1GTBA 3A2WA 3DD3A 5CNWA 3GL3A 4X0XA 4OFMA 1ZYQB 1X9WB 3EE2A 4N0ZA 1TRVA 3E9JB 2HRAA 2OADA 4MJEA 3RPNA 5IOWA 2C1YA 2H30A 3ZTLA 3I69A 1YKCA 3L9UA 2FWEA 5DBQA 1THOA 2OE3A 3C1SA 4KCEA 4OFNA 2VLUA 1T4ZA 2GQLA 2HT9A 1K3YA 2YV9A 2VLVA 3Q74A 1TK0B 3EU3A 4Z2RA 3HZ4A 2DLXA 5ELAA 3IDVA 1SKSB 3VFIA 5LNKe 4HJMA 4ML1A 2RLIA 3ERWA 5BRTA 2VLTA 3KTLA 2DJ1A 1A8LA 4FQUA 1PSQA 4G2EA 3C7MA 5IIZA 3CRUA 1E2YA 1XOAA 4J2FA 1W4VA 4XIHA 4POKA 5ECMB 4MH3A 2IMKA 3A3TA 4E8HA 3GV1A 5J9CA 3GSSA 3GIXA 2FLSA 5CP1A 3P90A 3TGZA 3KMOA 4Z7XA 2FWHA 1FOHA 3LYKA 4ECCA 4J57E 3UJ1A 1N2AA 3C73A 1XCCA 3JCML 5G30A 1H75A 2LQQA 1BYEA 2IL3A 1PGTA 1OAZA 2NPBA 4EDZA 3WYWA 4JR4A 1GNWA 3I9V2 2HRNA 2A2RA 4KF9A 2LUSA 4I6XA 5IOXA 1FAAA 1EGOA 2H73A 1JZRA 2YV7A 4AGSA 3FHKA 9GSSA 2MMNA 3VWUA 1F2EA 2H8LA 4O32A 4F0CA 5CAXA 4PNGA 2B5YA 2DJJA 1SK2A 4MZCA 3W8JA 4JEDA 2WJUA 2OACA 3LQ7A 1YEPA 2HXKA 4RQXA 5AISA 2F8FA 3M9KA 4K2XA 4TW5A 1BAYA 1KTEA 1K0CA 2I81A 4ILFA 1TI3A 3D5JA 2WDUA 1HQOA 2YOIA 5DALA 2OE1A 1SYXA 4LLRA 2YJHA 4I2TA 1TW9A 3DXBA 3EMPA 3CMIA 1SJ6A 4PUFC 2JZRA 2J9HA 2IFQA 2L6CA 1SKWB 1GP1A 4G19A 1XVWA 1YZXA 6GSSA 2DIZA 1IYHA 1GUKA 1XWCA 3ZMLA 1O7UA 4K7NA 1F6MC 4EIQA 1FO5A 2R2JA 3A5WA 4XCSA 4BWQA 2KHPA 4OD7A 3PR8A 1AQWA 1LJRA 2VL2C 1ZOFA 2A2PA 4TRXA 1UVZA 3HY2A 1SL1B 1VF4A 2CA8A 3HVVA 5LD0A 4JZQA 2YPMA 18GSA 2C0GA 4YAPA 3TCOA 2FA4A 4MZWA 1EP7A 1ZMAA 2B5XA 3WGDA 2BTOT 1VGLA 4A5PA 1H4OA 2CZ3A 2OKAA 2L4QA 4XRDA 2H1BA 5HR3A 3HXSA 3I43A 3ZFBA 2HSYA 3ZMKA 1EZKA 2K18A 2GSRA 3CBUA 3LGCA 3QAVA 2H1AA 4NWYA 2JZSA 3H93A 4WBRD 2PGTA 1XWBA 4K0GA 1OKDA 4I2UA 2LSTA 2CVDA 1B8XA 4MP4A 1EOHA 2JU5A 4NHZA 3OR5A 1A2MA 1QK8A 2LKUA 1EV4A 4YQVA 3H8QA 1CQHA 1MDJA 2CT6A 3TKSC 4ISDA 2H6ZA 1NW2A 2HRFA 5CRWA 2HZFA 1PL2A 1RQMA 5D8IA 5AGYA 5ECHB 4GSNA 3UEMA 3GHAA 2FD3A 1UA5A 2DKHA 5IMFA 2IMEA 5CREA 1U3IA 5JWRB 3APQA 4AJ7A 1B9XC 2HSHA 5CRDA 5J9BA 1GTUA 1O8WA 4F82A 1FHEA 2Z9SA 4BVXA 5DDLA 3ME7A 2H75A 3QFBC 6GSXA 1GULA 3TJGA 3F63A 1VF2A 5A4VA 2JZTA 2QA2A 3F3QA 4EL1A 2E2MA 4TVEA 2WCIA 5J4UA 1TU7A 5DQSA 4WR5A 4TOPA 2DJ2A 1JHBA 1UC7A 3FEUA 1SD9A 2M46A 4FIWA 3UOMA 2GLRA 1V9WA 4MZBA 4MPFA 2YZUA 2ZCTA 4KW6A 4NAXA 5E59A 1GSSA 1OVNA 3KCMA 2TRCP 4G0LA 3IC4A 4TKYA 4FH8A 3ZVJA 5CYYA 1MDIA 3F9UA 3IOSA 1OC8A 1TK5B 1YJ6A 2YANA 5ENUA 3QR6A 2R4VA 4NV5A 5CRHA 1Z7PA 3ZVJD 2C0FA 3Q19A 4PQIA 4MF7A 2LQOA 1PA3A 2GS3A 3H4KA 1U6TA 1Q98A 3MWHA 4ECIA 2IIYA 2GGTA 2PERA 3ED3A 1K0BA 3L9VA 3ZL5A 5ECNB 4GQCA 4ZB8A 3FKFA 2WULA 5KN2A 3R3EA 1MD3A 3TJBA 2P31A 5ABRA 2RUFA 3K8NA 3LFLA 1NHYA 2P0GA 4IN0A 1ACVA 4HEA2 3LWAA 1AAZA 3QFAC 2H6YA 3J7Yk 1AC1A 5ECIB 1QXHA 2WGRA 2C4JA 2MMOA 2DKIA 4AJ8A 3KTBA 5HR1A 3HVSA 4IBPA 3HZ8A 3VWWA 4BVXB 1GLQA 1GTIA 2OBIA 2NVLA 2FUG2 1JLWA 3QAGA 2NTOA 3DEXA 3DWVA 1F3BA 4O5RA 1A2LA 4TR3A 1SENA 3LEFA 4I8BA 2IWTA 2PU9C 1G6YA 3F4SA 5A5KA 2YJ7A 1SKRB 4WF5A 3O3TA 1JLVA 3CSIA 5HR2A 4K0NA 5ID2B 5EVOA 1AW9A 3DIEA 2CZ2A 2EC4A 2HFDA 2GZYA 1O85A 3IA1A 3LSZA 1X9SB 1TK8B 5DCGA 5H5RA 2K6VA 2R6KA 3F8UA 6GSYA 4O7HA 3VURA 3A2XA 2JADA 1EWXA 3WT2A 3QDNA 4LL4B 3H1NA 1TXXA 3KM6A 2H0IA 5KOXA 3FZ4A 4ZB6A 1GLPA 3L9SA 2ALBA 2V41A 1TRWA 2B7JA 5DJMA 5JCUA 5KN1A 1T7PB 1NSWA 2B1LA 4F2IA 2L59A 4GXZA 1USBA 2N5FA 4BVYA 1UN2A 14GSA 2VCXA 4HOJA 3PGTA 1U88A 5INYA 1DE2A 3LXTA 4JE1A 3Q6OA 4V1Ag 2V6KA 2J23A 5C00A 2AB6A 3DVXA 3EVIA 4IP6A 3N5OA 4K9ZA 1OE8A 2LNSA 1K0NA 1S3DA 3D4MA 4OO5A 3ZITA 2P5RA 1PN0A 4DEJA 3DVWA 4DSRA 2L5OA 3G7YA 1EEMA 2XC2A 3ZRDA 3CXGA 3TRQA 1DE1A 2GZPA 2V2GA 3KIJA 2LRCA 2V1MA 1OC3A 3GTUA 3TJKA 2O7KA 4WEYA 2IMFA 2LNTA 4BPYA 1YY7A 3HCZA 5G1LA 3VPQA 2I4AA 3F6DA 2HSMA 1MTCA 2VO4A 1HNCA 1T1VA 1RW1A 1Z5YE 5EPFA 3MYDA 3GX8A 2VCVA 3GH6A 1Z7RA 2WZ9A 4K2DA 1C72A 3RBTA 5IQYA 1X9MB 1WRYA 3IV4A 1AIUA 5H5QA 1B4QA 1R7HA 1J9BA 1S3AA 1FB0A 1SD8A 1GWCA 3V1WA 1GH2A 5B7CA 17GSA 5GSSA 2DMMA 4ZBAA 4IJ3A 3BJ5A 4DSSA 3PPUA 2PVQA 3DMLA 5L71A 1ERVA 1OC9B 3S9FA 2DJKA 4IGJA 3M0FA 1AQXA 5JWQB 5DAKB 2XPDA 5KN3A 5IPGA 4LA1A 3VPTA 5D9WA 4F9ZA 2H66A 2TIRA 4YQUA 1K3OA 1TDIA 3FZ5A 4AJ6A 1R5AA 2AUVA 4IS0A 8GSSA 2N5BA 3KZQA 4AF2A 2HRKA 1Z9HA 2E2GA 4PGTA 3ZFLA 4CW9A 3CTGA 1YEXA 2B6MA 1EP8A 3TKRA 3US3A 2XBIA 2V6OA 3RAZA 3IAS2 4L5OA 1XW5A 4PTSA 1SK1A 5EY6A 1GSFA 1G0TA 4Z2TA 1YDKA 5A4UA 2L5LA 3QCPA 4L0UA 3IRAA 5CRGA 2I9HA 3RHBA 4G0KA 2R0GA 3TKPA 2GDRA 3GRXA 2OJLA 1JZWA 2X8CA 2R3XA 4KNDA 4ECBA 5FWGA 5B6NA 3E3EA 2N5AA 3UMAA 1ABAA 4ZB9A 2H70A 1FOVA 2LRTA 2H72A 4JRRA 4G0IA 2YWNA 3KXOA 2PN8A 4OO4A 1A8YA 1W89A 3GNJA 1K0AA 3C1RA 2RIIA 3KD0A 2C80A 1A24A 2G0FA 4MMMA 1ERWA 2KP1A 1Y6EA 3D6IA 2A2SA 1S3CA 4F0BA 1URMA 2YWOA 3FR3A 2FHEA 5IMDA 3GYKA 3APOA 2C3QA 2QKEA 2GSTA 3KP8A 4N10A 1VF3A 2GSQA 1EOGA 1HYUA 4FYCA 3QD9A 2GT5A 4K7IA 4YKGA 3G7IA 4KB3A 5IMCA 4Q5QA 1QMVA 1ON4A 2X8HA 5IMAA 11GSA 1V40A 1XWAA 5J5NA 1M9BA 2PUKC 1YF0A 6GSVA 12GSA 2CQ9A 4EDYA 3UARA 4HU7A 4RQRA 2ON5A 1OE7A 3IHGA 2UZ8A 3DRNA 5DVBA 1X5CA 3VWXA 4ACSA 4O5UA 2FCHA 2VCZA 5D9VA 2WFCA 4PX1A 4ZILA 2IMDA 2IJYA 1K0DA 1ZL9A 2CVKA 4XS4A 3RPPA 4TR1A 1FB6A 5G2ZA 4MLYA 2F51A 3TRXA 2EIOA 3D4TA 1QQ2A 3KMNA 1I9DA 1GTAA 2H0HA 4BL7A 4CY6A 4TR0A 5DALB 4MH2A 1XBSA 1A2JA 2CX3A 3HVXA 2I1UA 2EIQA 5D93A 3CRTA 1PMTA 4V2NA 4G10A 4D73A 4MABA 2IFQB 2F3MA 2LS5A 3PH9A 3GURA 2GSSA 2KUCA 2LJRA 1WJKA 4HUAA 4K7OA 2HNLA 3HKRA 5KEJA 1ILOA 1XWGA 1DUGA 4EC0A 20GSA 3IE3A 2R37A 2NBSA 2HE3A 1Z3EA 2PPTA 2YNXA 3GKXA 2B7KA 2HYXA 3HHVA 1ML6A 1TJDA 4I5QA 3IPZA 2E0QA 3VLNA 3IBHA 1YF1A 1PL1A 3W8SA 1VRSD 2H0GA 1B9YC 4KH7A 2FNOA 4K6XA 5HFIA 2VM1A 3IR4A 2DMLA 2C8UA 4KUNA 1QUWA 4TXOA 2JSYA 4EXJA 4YKFA 2H19A 3GUSA 4FYUA 4WBJA 4WR4A 22GSA 4H86A 2YN1A 1WIKA 1ZZYA 3NZNA 3EC3A 2LTKA 2M72A 4TR1B 1SJZA 2O8VB 2GZZA 2O85A 3EWLA 4ULXA 2EIRA 3W6GA 4XTSA 4EVMA 1M2AA 3KGKA 3P7XA 3VI5A 2TRXA 5IO0A 1GSUA 3G7JA 2DC5A 4USSA 3TKQA 5JCWA 3KP9A 4MNNA 4D73B 3MAKA 4PNFA 5FHIA 4O5QA 3TKSA 4KDXA 3CSHA 2OA7A 3SWLA 2PBJA 4XS1A 3IK7A 1R5PA 1AXDA 3Q18A 4HI7A 3GN3A 4KGIA 3FR6A 1O81A 3ZREA 2HZEA 4DSQA 1EV9A 4MJCA 3UVTA 1PRXA 2E7PA 3WD6A 1HNBA 1A0FA 2I3YA 3G9BA 4X4JA 4Z2UA 2X8GA 4IJIA 4JR6A 5B6MA 3BOAA 1TTZA 3GL5A 3L78A 1WP0A 5B8AA 1FVJA 1ERUA 5E4WA 2C0EA 4EKZA 4MF6A 2BJXA 3P8WA 1OKTA 10GSA 1PN9A 3FMWA 3C8EA 3ZZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F07 A;  2X99 A;  3IXR A;  3D0Z A;  2OBK A;  4IQ1 A;  4KAE A;  1XW6 A;  1JZD A;  1YQ1 A;  4PQ1 A;  2VM2 A;  1J08 A;  1TOF A;  4QL9 A;  1K3L A;  1J0F A;  1O8X A;  1U87 A;  2WRT A;  3UAP A;  4RUV A;  3F6F A;  4ML6 A;  4IKH A;  1LBK A;  4WET A;  1SU9 A;  1M99 A;  5D96 A;  2YWI A;  3TB2 A;  1OYJ A;  3GKN A;  3I6A A;  4HQS A;  2F8A A;  1KNG A;  3LJR A;  4HDE A;  3HJO A;  4ZL9 A;  4EE0 A;  1IYI A;  2FWF A;  2KOK A;  2PWJ A;  4I97 A;  1X5E A;  4PUR A;  4JBB A;  5IO2 A;  1XIY A;  2R5G A;  3DGQ A;  1R26 A;  3TJF A;  3D22 A;  3ME8 A;  3VK9 A;  2B3S A;  3O6T A;  3TUE A;  1WPI A;  2K8S A;  3KH9 A;  3GA4 A;  2CVB A;  4OFT A;  3EU4 A;  4GRF A;  1MEK A;  2ZNM A;  2XPE A;  4X43 A;  4ECJ A;  2YCD A;  4KX4 A;  13GS A;  3LYP A;  4Q5F A;  5ECK B;  5ECS A;  4MDC A;  4FO5 A;  1SL0 B;  4V2M A;  3L4N A;  4FYB A;  1GUH A;  1TKD B;  5F05 A;  1ZCP A;  3EIN A;  1F9M A;  2GQK A;  1GRX A;  1B48 A;  4HS1 A;  2FWG A;  5IPH A;  2CAI A;  1NHO A;  1SYR A;  4KA0 A;  2OE0 A;  3FR9 A;  1KBN A;  2DBC A;  1N8J A;  3IAM 2;  5ECL B;  3TDG A;  2B1K A;  4KSO A;  4ZL8 A;  4G9H A;  1BED A;  5D73 A;  4YQM A;  5JWO B;  1HNA A;  2VAF A;  4CDO A;  2O87 A;  1A0R P;  1FG4 A;  1LU4 A;  4Q5N A;  1PX6 A;  4GF0 A;  3F4R A;  1G6W A;  1QGV A;  5HFG A;  2C3T A;  3C71 A;  3ZIV A;  4IP1 A;  4NHW A;  3FZ9 A;  4F03 A;  4EO3 A;  1QFN A;  1M2D A;  3HA9 A;  4RI6 A;  1KEB A;  2QSI A;  2P5Q A;  4N0V A;  2RM6 A;  2LV3 A;  4JU5 A;  5G5F A;  4L0W A;  1R4W A;  4TR4 A;  2H1D A;  16GS A;  4YH2 A;  2L6D A;  5LCZ A;  2H1G A;  1Z6N A;  2VUP A;  1XVQ A;  2AJQ B;  3GFK A;  3QAW A;  4EUY A;  6GSW A;  3GTU B;  7GSS A;  2MYG A;  3F0I A;  2IPA A;  5ELG A;  4MCU A;  1EGR A;  3IHQ A;  1BQ7 A;  4OCE A;  1NM3 A;  1AUC A;  2HI7 A;  4K8M A;  5HR0 A;  3FY7 A;  1XXU A;  1DBY A;  2QGV A;  4O92 A;  4Q5R A;  4OWY A;  3QOU A;  4PUA A;  5AIX A;  3BBY A;  2GT6 A;  2RM5 A;  1Q4J A;  2XBQ A;  1HD2 A;  3D21 A;  4RI7 A;  2LRN A;  4V1A p;  2GVP A;  4ZXG A;  4J56 E;  3CYN A;  4YAV A;  4OCF A;  2ON7 A;  1B4P A;  2C3N A;  1GSY A;  2K8V A;  4DSS B;  3EUR A;  2CAQ A;  1O73 A;  1G7E A;  5DJL A;  3MSZ A;  1WWJ A;  3VWV A;  4KCA A;  1THX A;  2PVO C;  3AY8 A;  5J3R A;  4IQA A;  4NV2 A;  4EF0 A;  5AIV A;  3R2Q A;  3O76 A;  4MK3 A;  4E8E A;  2AHE A;  1T4Y A;  3KH7 A;  5B8B A;  1PKW A;  3M8N A;  3M1G A;  3QPM A;  4P3Y B;  5AN1 A;  4IHU A;  3M9J A;  4IVF A;  5ECO B;  4GWR A;  2REM A;  2HLS A;  4HQZ A;  3BCI A;  4IEL A;  1CQG A;  2LJA A;  4TXV A;  2BMX A;  1E6B A;  3GKM A;  4KDY A;  2AV4 A;  2RUE A;  1G7O A;  1TI1 A;  4NMU A;  5IM9 A;  2MMZ A;  3DYR A;  3TJJ A;  1K0O A;  3LG6 A;  2VOC A;  5GZZ B;  5G5E A;  2FA8 A;  4ZL7 A;  4POL A;  1BX9 A;  3E0U A;  1GSE A;  2L4C A;  1K0M A;  1ZYE A;  1XOB A;  19GS A;  3WGX A;  4IW9 A;  2M80 A;  4KSM A;  2VCT A;  5IMV A;  3HD5 A;  2H6X A;  2LJK A;  6GST A;  3UBL A;  2NDO A;  2VIM A;  3F3R A;  3TKS E;  1GSQ A;  3ERG A;  3LOR A;  3HJM A;  5G31 A;  1XZO A;  1WE0 A;  1X5D A;  2VD0 A;  2VL9 A;  4GLT A;  2CX4 A;  3VI7 A;  4TN8 A;  1WOU A;  3HYP A;  1V58 A;  2DSA A;  3HDC A;  3KJY A;  4CHS A;  2VCQ A;  3QMX A;  4ID0 A;  2VCW A;  5C04 A;  1GL8 A;  2AAW A;  1F37 A;  3FYG A;  4L5L A;  1T8E B;  4ZIJ A;  2H71 A;  1XPV A;  4BA7 A;  4XS6 A;  1FW1 A;  2DJ3 A;  1M7T A;  1PQN A;  3UL3 A;  5IMZ A;  4HZ4 A;  1PKZ A;  2VL2 A;  2YWM A;  4N30 A;  3UIW A;  1ST9 A;  1YKA A;  3EMX A;  1U3A A;  5D9X A;  5ECR B;  2CV4 A;  1T3B A;  1SL2 B;  4BWS A;  3GH9 A;  2H01 A;  2GTU A;  5HQP A;  2MZC A;  2ZUP A;  1VF1 A;  3CTF A;  1X0R A;  4XS4 B;  3HJP A;  5A4W A;  3M3M A;  4ZBB A;  3J7Y b;  5F8B A;  6GSU A;  1Y25 A;  2MBS A;  1DSB A;  3U5R E;  1EEJ A;  3RDW A;  1XW9 A;  5F0G A;  1V98 A;  5ID2 A;  2F9S A;  2FY6 A;  2FGX A;  2L57 A;  3IK9 A;  5ECP B;  3FZA A;  2V32 A;  1SK0 A;  3APS A;  1MD4 A;  5DQY A;  3FW2 A;  3GKK A;  3WT1 A;  2D2Z A;  4KE3 A;  1ZGN A;  3KEB A;  2ES7 A;  3FK8 A;  3NOF A;  1XWK A;  2PMT A;  4MJB A;  2C0D A;  1GUM A;  4HU9 A;  4WKW A;  1V57 A;  1WMJ A;  4MA9 A;  1M9A A;  3L0H A;  1BJX A;  1SJI A;  3F4T A;  2IMI A;  2YP6 A;  1RK4 A;  3MNG A;  3GST A;  1TRS A;  1A23 A;  1BG5 A;  5DCH A;  2A4V A;  1PX7 A;  4TXO B;  4POM A;  3WGE A;  1FVK A;  5GAP D;  3N9J A;  3CSJ A;  2DJ0 A;  3SBC A;  5KN0 A;  3ZYW A;  2JSZ A;  5H5S A;  2JL4 A;  2KLX A;  4GQF A;  3UBK A;  1AQV A;  3P2A A;  1JZO A;  2QC7 A;  4ZBD A;  1Z6M A;  3PIN A;  2LEG A;  4DVC A;  3ZIJ A;  1XFL A;  4POB A;  2MBT A;  1M0U A;  2O89 A;  3TOT A;  5EL8 A;  2KP2 A;  5GST A;  2K9F A;  4MPG A;  1TRU A;  3LXZ A;  4PQH A;  2VD1 A;  1GSD A;  2VL3 A;  1I5G A;  2G2Q A;  4OMV A;  3TOU A;  5FT3 A;  2HZE B;  3A2V A;  4V2L A;  3GMF A;  3H79 A;  3FRC A;  4XRA A;  4K1F A;  3UVH A;  3U6V A;  1F3A A;  5ECQ B;  4GTU A;  4HJ2 A;  4MJA A;  1JFU A;  4PXO A;  4NXI A;  3GX0 A;  2X64 A;  4LL1 B;  3DKS A;  2WB9 A;  1TP9 A;  4HZ2 A;  5F06 A;  5G1K A;  3BCK A;  4MF5 A;  5JCG A;  4WXT A;  1T00 A;  1V2A A;  2YZH A;  5COH A;  1ERT A;  2XHF A;  4LMW A;  3BD2 A;  4LMV A;  1O6J A;  3RHC A;  1M2B A;  2B5E A;  3NIV A;  3ERF A;  2H76 A;  1MDK A;  4KDU A;  3ZLP A;  2WS2 A;  3MDK A;  1TU8 A;  5GAN D;  4NPB A;  1OC9 A;  4GST A;  4N11 A;  1GNE A;  4QQ7 A;  3ISO A;  4X1U A;  2JAC A;  2H74 A;  5HFK A;  3TRP A;  4GSS A;  4GCI A;  5DAK A;  2DIY A;  2MMA A;  1PD2 1;  2AYT A;  2GQM A;  4XHM A;  5D9T A;  4QL7 A;  2IN3 A;  4WF4 A;  5CO3 A;  3EYT A;  4L8E A;  5J41 A;  1GTB A;  3A2W A;  3DD3 A;  5CNW A;  3GL3 A;  4X0X A;  4OFM A;  1ZYQ B;  1X9W B;  3EE2 A;  4N0Z A;  1TRV A;  3E9J B;  2OAD A;  4MJE A;  3RPN A;  5IOW A;  2C1Y A;  2H30 A;  3ZTL A;  3I69 A;  1YKC A;  3L9U A;  2FWE A;  5DBQ A;  1THO A;  2OE3 A;  3C1S A;  4KCE A;  4OFN A;  2VLU A;  1T4Z A;  2GQL A;  2HT9 A;  1K3Y A;  2YV9 A;  2VLV A;  3Q74 A;  1TK0 B;  3EU3 A;  3HZ4 A;  2DLX A;  5ELA A;  3IDV A;  1SKS B;  3VFI A;  5LNK e;  4HJM A;  4ML1 A;  2RLI A;  3ERW A;  2VLT A;  3KTL A;  2DJ1 A;  1A8L A;  1PSQ A;  4G2E A;  3C7M A;  5IIZ A;  3CRU A;  1E2Y A;  1XOA A;  4J2F A;  1W4V A;  4XIH A;  4POK A;  5ECM B;  4MH3 A;  2IMK A;  3A3T A;  4E8H A;  3GV1 A;  5J9C A;  3GSS A;  3GIX A;  2FLS A;  5CP1 A;  3P90 A;  3TGZ A;  3KMO A;  4Z7X A;  2FWH A;  3LYK A;  4ECC A;  4J57 E;  3UJ1 A;  1N2A A;  3C73 A;  1XCC A;  3JCM L;  5G30 A;  1H75 A;  2LQQ A;  1BYE A;  2IL3 A;  1PGT A;  1OAZ A;  2NPB A;  4EDZ A;  3WYW A;  4JR4 A;  1GNW A;  3I9V 2;  2HRN A;  2A2R A;  2LUS A;  4I6X A;  5IOX A;  1FAA A;  1EGO A;  2H73 A;  1JZR A;  2YV7 A;  4AGS A;  3FHK A;  9GSS A;  2MMN A;  3VWU A;  1F2E A;  2H8L A;  4O32 A;  4F0C A;  5CAX A;  4PNG A;  2B5Y A;  2DJJ A;  1SK2 A;  4MZC A;  3W8J A;  4JED A;  2WJU A;  2OAC A;  3LQ7 A;  1YEP A;  2HXK A;  4RQX A;  5AIS A;  2F8F A;  3M9K A;  4TW5 A;  1BAY A;  1KTE A;  1K0C A;  2I81 A;  4ILF A;  1TI3 A;  3D5J A;  2WDU A;  1HQO A;  2YOI A;  5DAL A;  2OE1 A;  1SYX A;  4LLR A;  2YJH A;  4I2T A;  1TW9 A;  3DXB A;  3EMP A;  3CMI A;  1SJ6 A;  4PUF C;  2JZR A;  2J9H A;  2IFQ A;  2L6C A;  1SKW B;  1GP1 A;  4G19 A;  1XVW A;  1YZX A;  6GSS A;  2DIZ A;  1IYH A;  1GUK A;  1XWC A;  3ZML A;  1O7U A;  4K7N A;  1F6M C;  1FO5 A;  2R2J A;  3A5W A;  4XCS A;  4BWQ A;  2KHP A;  4OD7 A;  3PR8 A;  1AQW A;  1LJR A;  2VL2 C;  1ZOF A;  4TRX A;  1UVZ A;  3HY2 A;  1SL1 B;  1VF4 A;  2CA8 A;  3HVV A;  5LD0 A;  4JZQ A;  2YPM A;  18GS A;  2C0G A;  4YAP A;  3TCO A;  2FA4 A;  4MZW A;  1EP7 A;  1ZMA A;  2B5X A;  3WGD A;  2BTO T;  1VGL A;  1H4O A;  2CZ3 A;  2OKA A;  2L4Q A;  4XRD A;  2H1B A;  5HR3 A;  3HXS A;  3I43 A;  3ZFB A;  2HSY A;  3ZMK A;  1EZK A;  2K18 A;  2GSR A;  3CBU A;  3LGC A;  3QAV A;  2H1A A;  4NWY A;  2JZS A;  3H93 A;  4WBR D;  2PGT A;  1XWB A;  4K0G A;  1OKD A;  4I2U A;  2LST A;  2CVD A;  1B8X A;  4MP4 A;  1EOH A;  2JU5 A;  4NHZ A;  3OR5 A;  1A2M A;  1QK8 A;  2LKU A;  1EV4 A;  4YQV A;  3H8Q A;  1CQH A;  1MDJ A;  2CT6 A;  3TKS C;  4ISD A;  2H6Z A;  1NW2 A;  2HRF A;  5CRW A;  2HZF A;  1PL2 A;  5D8I A;  1RQM A;  5AGY A;  5ECH B;  4GSN A;  3UEM A;  3GHA A;  2FD3 A;  1UA5 A;  5IMF A;  2IME A;  5CRE A;  1U3I A;  5JWR B;  3APQ A;  4AJ7 A;  1B9X C;  2HSH A;  5CRD A;  5J9B A;  1GTU A;  1O8W A;  4F82 A;  1FHE A;  2Z9S A;  4BVX A;  5DDL A;  3ME7 A;  2H75 A;  3QFB C;  6GSX A;  1GUL A;  3TJG A;  3F63 A;  1VF2 A;  5A4V A;  2JZT A;  3F3Q A;  4EL1 A;  2E2M A;  4TVE A;  2WCI A;  5J4U A;  1TU7 A;  5DQS A;  4WR5 A;  4TOP A;  2DJ2 A;  1JHB A;  1UC7 A;  3FEU A;  1SD9 A;  2M46 A;  4FIW A;  3UOM A;  2GLR A;  1V9W A;  4MZB A;  4MPF A;  2YZU A;  2ZCT A;  4KW6 A;  4NAX A;  5E59 A;  1GSS A;  1OVN A;  3KCM A;  2TRC P;  3IC4 A;  4TKY A;  4FH8 A;  3ZVJ A;  5CYY A;  1MDI A;  3F9U A;  3IOS A;  1OC8 A;  1TK5 B;  1YJ6 A;  2YAN A;  5ENU A;  3QR6 A;  2R4V A;  4NV5 A;  5CRH A;  1Z7P A;  3ZVJ D;  2C0F A;  3Q19 A;  4PQI A;  4MF7 A;  2LQO A;  1PA3 A;  2GS3 A;  3H4K A;  1U6T A;  1Q98 A;  3MWH A;  4ECI A;  2IIY A;  2GGT A;  2PER A;  3ED3 A;  1K0B A;  3L9V A;  3ZL5 A;  5ECN B;  4GQC A;  4ZB8 A;  3FKF A;  2WUL A;  5KN2 A;  1MD3 A;  3TJB A;  2P31 A;  5ABR A;  2RUF A;  3K8N A;  3LFL A;  1NHY A;  2P0G A;  4IN0 A;  1ACV A;  4HEA 2;  3LWA A;  1AAZ A;  3QFA C;  2H6Y A;  3J7Y k;  5ECI B;  1AC1 A;  1QXH A;  2WGR A;  2C4J A;  2MMO A;  4AJ8 A;  3KTB A;  5HR1 A;  3HVS A;  4IBP A;  3HZ8 A;  3VWW A;  1GLQ A;  1GTI A;  2OBI A;  2NVL A;  2FUG 2;  1JLW A;  3QAG A;  2NTO A;  3DEX A;  3DWV A;  1F3B A;  4O5R A;  1A2L A;  4TR3 A;  1SEN A;  3LEF A;  4I8B A;  2IWT A;  2PU9 C;  1G6Y A;  3F4S A;  5A5K A;  2YJ7 A;  1SKR B;  4WF5 A;  3O3T A;  1JLV A;  3CSI A;  5HR2 A;  4K0N A;  5ID2 B;  5EVO A;  1AW9 A;  3DIE A;  2CZ2 A;  2EC4 A;  2HFD A;  2GZY A;  1O85 A;  3IA1 A;  3LSZ A;  1X9S B;  1TK8 B;  5DCG A;  5H5R A;  2K6V A;  2R6K A;  3F8U A;  6GSY A;  4O7H A;  3VUR A;  3A2X A;  2JAD A;  1EWX A;  3WT2 A;  3QDN A;  4LL4 B;  3H1N A;  1TXX A;  3KM6 A;  2H0I A;  3FZ4 A;  4ZB6 A;  1GLP A;  3L9S A;  2ALB A;  5DJM A;  2V41 A;  1TRW A;  2B7J A;  5JCU A;  5KN1 A;  1T7P B;  1NSW A;  2B1L A;  4F2I A;  2L59 A;  4GXZ A;  1USB A;  2N5F A;  4BVY A;  1UN2 A;  14GS A;  2VCX A;  4HOJ A;  3PGT A;  1U88 A;  5INY A;  1DE2 A;  3LXT A;  4JE1 A;  3Q6O A;  4V1A g;  2V6K A;  2J23 A;  5C00 A;  2AB6 A;  3DVX A;  3EVI A;  4IP6 A;  3N5O A;  4K9Z A;  1OE8 A;  2LNS A;  1K0N A;  1S3D A;  3D4M A;  4OO5 A;  3ZIT A;  2P5R A;  4DEJ A;  3DVW A;  4DSR A;  2L5O A;  3G7Y A;  1EEM A;  2XC2 A;  3ZRD A;  3CXG A;  3TRQ A;  1DE1 A;  2GZP A;  2V2G A;  3KIJ A;  2LRC A;  2V1M A;  1OC3 A;  3GTU A;  3TJK A;  2O7K A;  4WEY A;  2IMF A;  2LNT A;  4BPY A;  1YY7 A;  3HCZ A;  5G1L A;  3VPQ A;  2I4A A;  3F6D A;  1MTC A;  2VO4 A;  1HNC A;  1T1V A;  1RW1 A;  1Z5Y E;  5EPF A;  3GX8 A;  2VCV A;  3GH6 A;  1Z7R A;  2WZ9 A;  4K2D A;  1C72 A;  3RBT A;  5IQY A;  1X9M B;  1WRY A;  3IV4 A;  1AIU A;  5H5Q A;  1B4Q A;  1R7H A;  1J9B A;  1S3A A;  1FB0 A;  1SD8 A;  1GWC A;  3V1W A;  1GH2 A;  5B7C A;  17GS A;  5GSS A;  2DMM A;  4ZBA A;  4IJ3 A;  3BJ5 A;  4DSS A;  2PVQ A;  3DML A;  5L71 A;  1ERV A;  1OC9 B;  3S9F A;  2DJK A;  4IGJ A;  3M0F A;  1AQX A;  5JWQ B;  5DAK B;  2XPD A;  5KN3 A;  5IPG A;  4LA1 A;  3VPT A;  5D9W A;  4F9Z A;  2H66 A;  2TIR A;  4YQU A;  1K3O A;  1TDI A;  3FZ5 A;  4AJ6 A;  1R5A A;  2AUV A;  4IS0 A;  8GSS A;  2N5B A;  3KZQ A;  4AF2 A;  1Z9H A;  2E2G A;  4PGT A;  3ZFL A;  4CW9 A;  3CTG A;  1YEX A;  2B6M A;  1EP8 A;  3TKR A;  3US3 A;  2XBI A;  2V6O A;  3RAZ A;  3IAS 2;  4L5O A;  1XW5 A;  1SK1 A;  5EY6 A;  1GSF A;  1G0T A;  1YDK A;  5A4U A;  2L5L A;  3QCP A;  4L0U A;  3IRA A;  5CRG A;  2I9H A;  3RHB A;  3TKP A;  2GDR A;  3GRX A;  2OJL A;  1JZW A;  2X8C A;  2R3X A;  4KND A;  4ECB A;  5FWG A;  5B6N A;  3E3E A;  2N5A A;  3UMA A;  1ABA A;  4ZB9 A;  2H70 A;  1FOV A;  2LRT A;  2H72 A;  4JRR A;  2YWN A;  3KXO A;  2PN8 A;  4OO4 A;  1A8Y A;  1W89 A;  3GNJ A;  1K0A A;  3C1R A;  2RII A;  3KD0 A;  2C80 A;  1A24 A;  2G0F A;  4MMM A;  1ERW A;  2KP1 A;  1Y6E A;  3D6I A;  2A2S A;  1S3C A;  4F0B A;  1URM A;  2YWO A;  3FR3 A;  2FHE A;  5IMD A;  3GYK A;  3APO A;  2C3Q A;  2QKE A;  2GST A;  3KP8 A;  4N10 A;  1VF3 A;  2GSQ A;  1EOG A;  1HYU A;  4FYC A;  3QD9 A;  2GT5 A;  4K7I A;  3G7I A;  4KB3 A;  5IMC A;  4Q5Q A;  1QMV A;  1ON4 A;  2X8H A;  5IMA A;  11GS A;  1V40 A;  1XWA A;  5J5N A;  1M9B A;  2PUK C;  1YF0 A;  6GSV A;  12GS A;  2CQ9 A;  4EDY A;  3UAR A;  4HU7 A;  4RQR A;  2ON5 A;  1OE7 A;  3DRN A;  5DVB A;  1X5C A;  3VWX A;  4ACS A;  2FCH A;  2VCZ A;  5D9V A;  2WFC A;  4PX1 A;  4ZIL A;  2IMD A;  2IJY A;  1K0D A;  1ZL9 A;  2CVK A;  4XS4 A;  3RPP A;  4TR1 A;  1FB6 A;  5G2Z A;  4MLY A;  2F51 A;  3TRX A;  2EIO A;  3D4T A;  1QQ2 A;  3KMN A;  1I9D A;  1GTA A;  2H0H A;  4BL7 A;  4TR0 A;  5DAL B;  4MH2 A;  1XBS A;  1A2J A;  2CX3 A;  3HVX A;  2I1U A;  2EIQ A;  5D93 A;  3CRT A;  1PMT A;  4V2N A;  4G10 A;  4D73 A;  4MAB A;  2IFQ B;  2F3M A;  2LS5 A;  3PH9 A;  3GUR A;  2GSS A;  2KUC A;  2LJR A;  1WJK A;  4HUA A;  4K7O A;  2HNL A;  3HKR A;  5KEJ A;  1ILO A;  1XWG A;  1DUG A;  4EC0 A;  20GS A;  3IE3 A;  2R37 A;  2NBS A;  2HE3 A;  1Z3E A;  2PPT A;  2YNX A;  3GKX A;  2B7K A;  2HYX A;  3HHV A;  1ML6 A;  1TJD A;  4I5Q A;  3IPZ A;  2E0Q A;  3VLN A;  3IBH A;  1YF1 A;  1PL1 A;  3W8S A;  1VRS D;  2H0G A;  1B9Y C;  4KH7 A;  2FNO A;  4K6X A;  5HFI A;  2VM1 A;  3IR4 A;  2DML A;  2C8U A;  4KUN A;  1QUW A;  4TXO A;  2JSY A;  4EXJ A;  2H19 A;  3GUS A;  4FYU A;  4WBJ A;  4WR4 A;  22GS A;  4H86 A;  2YN1 A;  1WIK A;  1ZZY A;  3NZN A;  3EC3 A;  2LTK A;  2M72 A;  4TR1 B;  1SJZ A;  2O8V B;  2GZZ A;  2O85 A;  3EWL A;  4ULX A;  2EIR A;  3W6G A;  4XTS A;  4EVM A;  1M2A A;  3KGK A;  3P7X A;  3VI5 A;  2TRX A;  5IO0 A;  1GSU A;  3G7J A;  2DC5 A;  3TKQ A;  5JCW A;  3KP9 A;  4D73 B;  3MAK A;  4PNF A;  5FHI A;  3TKS A;  4KDX A;  3CSH A;  2OA7 A;  3SWL A;  2PBJ A;  4XS1 A;  3IK7 A;  1R5P A;  1AXD A;  3Q18 A;  4HI7 A;  3GN3 A;  4KGI A;  3FR6 A;  1O81 A;  3ZRE A;  2HZE A;  4DSQ A;  1EV9 A;  4MJC A;  3UVT A;  1PRX A;  2E7P A;  3WD6 A;  1HNB A;  1A0F A;  2I3Y A;  3G9B A;  2X8G A;  4IJI A;  4JR6 A;  5B6M A;  3BOA A;  1TTZ A;  3GL5 A;  3L78 A;  1WP0 A;  5B8A A;  1FVJ A;  1ERU A;  5E4W A;  2C0E A;  4EKZ A;  4MF6 A;  2BJX A;  3P8W A;  1OKT A;  10GS A;  1PN9 A;  3C8E A;  3ZZX A; 
#chains in the Genus database with same CATH topology
 5F07 A;  2X99 A;  3IXR A;  3D0Z A;  2OBK A;  4IQ1 A;  4KAE A;  1XW6 A;  1JZD A;  1YQ1 A;  4PQ1 A;  2VM2 A;  1J08 A;  1TOF A;  4QL9 A;  1K3L A;  1J0F A;  1O8X A;  1U87 A;  2WRT A;  3UAP A;  4RUV A;  3IC8 A;  3F6F A;  4ML6 A;  4IKH A;  1LBK A;  4WET A;  1SU9 A;  1M99 A;  5D96 A;  2YWI A;  4BIK A;  3TB2 A;  1OYJ A;  3GKN A;  3I6A A;  4HQS A;  2F8A A;  1KNG A;  3LJR A;  4HDE A;  3HJO A;  4ZL9 A;  4EE0 A;  1IYI A;  2FWF A;  2KOK A;  2PWJ A;  4I97 A;  1X5E A;  4PUR A;  4JBB A;  5IO2 A;  1XIY A;  2R5G A;  3DGQ A;  1R26 A;  3TJF A;  3D22 A;  3ME8 A;  3VK9 A;  2B3S A;  3O6T A;  3TUE A;  1WPI A;  2K8S A;  3KH9 A;  3GA4 A;  2CVB A;  4OFT A;  3EU4 A;  4GRF A;  1MEK A;  2ZNM A;  2XPE A;  5KOW A;  4X43 A;  4ECJ A;  2YCD A;  4KX4 A;  13GS A;  3LYP A;  5BMU A;  4Q5F A;  5ECK B;  5ECS A;  4MDC A;  4FO5 A;  1SL0 B;  4V2M A;  3L4N A;  4FYB A;  1ZYP A;  1GUH A;  1TKD B;  5F05 A;  1ZCP A;  3EIN A;  1F9M A;  2GQK A;  1GRX A;  1B48 A;  4HS1 A;  2FWG A;  5IPH A;  2CAI A;  1NHO A;  1SYR A;  4KA0 A;  2OE0 A;  3FR9 A;  1KBN A;  2DBC A;  1N8J A;  3IAM 2;  5ECL B;  3TDG A;  2B1K A;  4KSO A;  4BVY B;  4ZL8 A;  4G9H A;  1BED A;  5D73 A;  4YQM A;  5JWO B;  1HNA A;  2VAF A;  4CDO A;  2O87 A;  1A0R P;  1FG4 A;  1LU4 A;  4Q5N A;  1PX6 A;  4GF0 A;  3F4R A;  1G6W A;  1QGV A;  5HFG A;  2C3T A;  2QA1 A;  3C71 A;  3ZIV A;  4IP1 A;  4NHW A;  3FZ9 A;  4F03 A;  4EO3 A;  1QFN A;  1M2D A;  3HA9 A;  4RI6 A;  1KEB A;  2QSI A;  2P5Q A;  4N0V A;  2RM6 A;  2LV3 A;  4JU5 A;  5G5F A;  4L0W A;  1R4W A;  4TR4 A;  2H1D A;  16GS A;  4YH2 A;  2L6D A;  5LCZ A;  2H1G A;  1Z6N A;  2VUP A;  1XVQ A;  2AJQ B;  3GFK A;  3QAW A;  4EUY A;  6GSW A;  3GTU B;  7GSS A;  2MYG A;  3F0I A;  2IPA A;  5ELG A;  4MCU A;  1EGR A;  3IHQ A;  1BQ7 A;  4OCE A;  1NM3 A;  2X49 A;  1AUC A;  2A4H A;  2HI7 A;  4K8M A;  5HR0 A;  3FY7 A;  1XXU A;  1DBY A;  2QGV A;  4O92 A;  4Q5R A;  4OWY A;  3QOU A;  4PUA A;  5AIX A;  3BBY A;  2GT6 A;  2RM5 A;  1Q4J A;  2XBQ A;  1HD2 A;  3D21 A;  4RI7 A;  2LRN A;  4V1A p;  2GVP A;  4ZXG A;  4J56 E;  3CYN A;  4YAV A;  4OCF A;  2ON7 A;  1B4P A;  2C3N A;  1GSY A;  2K8V A;  3MIX A;  4DSS B;  3EUR A;  2CAQ A;  1O73 A;  1G7E A;  5DJL A;  3MSZ A;  1WWJ A;  3VWV A;  4KCA A;  1THX A;  2PVO C;  3AY8 A;  5J3R A;  4IQA A;  4NV2 A;  4EF0 A;  5AIV A;  3R2Q A;  3O76 A;  4MK3 A;  4E8E A;  2AHE A;  1T4Y A;  3KH7 A;  5B8B A;  1PKW A;  3M8N A;  3M1G A;  3QPM A;  4P3Y B;  5AN1 A;  4IHU A;  3M9J A;  4IVF A;  3LW9 A;  5ECO B;  4GWR A;  2REM A;  4K5R A;  2HLS A;  4HQZ A;  3BCI A;  4IEL A;  1CQG A;  2LJA A;  4TXV A;  2BMX A;  1E6B A;  3GKM A;  4KDY A;  2AV4 A;  2RUE A;  1G7O A;  1TI1 A;  4NMU A;  5IM9 A;  2MMZ A;  3DYR A;  3TJJ A;  4ICY A;  1K0O A;  3LG6 A;  2VOC A;  5GZZ B;  5G5E A;  2FA8 A;  4ZL7 A;  4POL A;  1BX9 A;  3E0U A;  1GSE A;  2L4C A;  1K0M A;  1ZYE A;  1XOB A;  19GS A;  3A5I A;  3WGX A;  4IW9 A;  2M80 A;  4KSM A;  2VCT A;  5IMV A;  3HD5 A;  2H6X A;  2LJK A;  6GST A;  3UBL A;  2NDO A;  2VIM A;  3F3R A;  3TKS E;  1GSQ A;  3ERG A;  3LOR A;  3HJM A;  5G31 A;  1ZYN A;  1XZO A;  1WE0 A;  1X5D A;  2VD0 A;  2VL9 A;  4GLT A;  2CX4 A;  3VI7 A;  4TN8 A;  4K5S A;  1WOU A;  3HYP A;  1V58 A;  2DSA A;  3HDC A;  3KJY A;  4CHS A;  2VCQ A;  3QMX A;  4ID0 A;  2VCW A;  5C04 A;  1GL8 A;  2AAW A;  1F37 A;  3FYG A;  4L5L A;  1T8E B;  4ZIJ A;  2H71 A;  1XPV A;  4BA7 A;  4XS6 A;  1FW1 A;  2DJ3 A;  1M7T A;  1PQN A;  3UL3 A;  5IMZ A;  4HZ4 A;  1PKZ A;  2VL2 A;  2YWM A;  4N30 A;  3UIW A;  1ST9 A;  1YKA A;  3EMX A;  1U3A A;  5D9X A;  5ECR B;  2CV4 A;  1T3B A;  1SL2 B;  4BWS A;  3GH9 A;  2H01 A;  2GTU A;  5HQP A;  2MZC A;  2ZUP A;  1VF1 A;  3CTF A;  1X0R A;  4XS4 B;  3HJP A;  5A4W A;  3EPT A;  3M3M A;  4ZBB A;  3J7Y b;  5F8B A;  6GSU A;  4BL7 B;  1Y25 A;  2MBS A;  1DSB A;  3U5R E;  1EEJ A;  3RDW A;  1XW9 A;  5F0G A;  1V98 A;  5ID2 A;  2F9S A;  2FY6 A;  2FGX A;  2L57 A;  3IK9 A;  2R0C A;  5ECP B;  3FZA A;  2V32 A;  1SK0 A;  3APS A;  1MD4 A;  5DQY A;  3FW2 A;  3GKK A;  3WT1 A;  2D2Z A;  4KE3 A;  1ZGN A;  3KEB A;  2ES7 A;  3FK8 A;  3NOF A;  1XWK A;  2PMT A;  4MJB A;  2C0D A;  1GUM A;  4HU9 A;  4WKW A;  1V57 A;  1WMJ A;  4MA9 A;  1M9A A;  3L0H A;  1BJX A;  1SJI A;  3F4T A;  2IMI A;  2YP6 A;  1RK4 A;  3MNG A;  3GST A;  1TRS A;  1XG8 A;  1A23 A;  1BG5 A;  5DCH A;  2A4V A;  4HSC X;  1PX7 A;  4TXO B;  4POM A;  2R0P A;  4EIP A;  3WGE A;  1FVK A;  5GAP D;  3N9J A;  3CSJ A;  2DJ0 A;  3SBC A;  5KN0 A;  3ZYW A;  2JSZ A;  5H5S A;  2JL4 A;  2KLX A;  4GQF A;  3UBK A;  1AQV A;  3P2A A;  1JZO A;  4CY8 A;  2QC7 A;  4ZBD A;  1Z6M A;  3PIN A;  2LEG A;  4DVC A;  3ZIJ A;  1XFL A;  2X4A A;  4POB A;  2MBT A;  1M0U A;  2O89 A;  3TOT A;  5EL8 A;  2KP2 A;  5GST A;  2K9F A;  4MPG A;  1TRU A;  3LXZ A;  4PQH A;  2VD1 A;  1GSD A;  2VL3 A;  1I5G A;  2G2Q A;  4OMV A;  3TOU A;  5FT3 A;  2HZE B;  3A2V A;  4V2L A;  3GMF A;  3H79 A;  3FRC A;  4XRA A;  4K1F A;  3UVH A;  3U6V A;  1F3A A;  5ECQ B;  4GTU A;  4HJ2 A;  4MJA A;  1JFU A;  4PXO A;  4NXI A;  3GX0 A;  1M3I A;  2X64 A;  4LL1 B;  3DKS A;  2WB9 A;  1TP9 A;  4HZ2 A;  5F06 A;  5G1K A;  3BCK A;  4MF5 A;  5JCG A;  4WXT A;  1T00 A;  1V2A A;  2YZH A;  5COH A;  1ERT A;  2XHF A;  4LMW A;  3BD2 A;  4LMV A;  1O6J A;  3RHC A;  1M2B A;  2B5E A;  3NIV A;  3ERF A;  2H76 A;  1MDK A;  4KDU A;  3ZLP A;  2WS2 A;  3MDK A;  1TU8 A;  5GAN D;  4NPB A;  1OC9 A;  1PFO A;  4GST A;  4N11 A;  1GNE A;  4QQ7 A;  3ISO A;  4X1U A;  2JAC A;  2H74 A;  5HFK A;  3TRP A;  4GSS A;  4GCI A;  5DAK A;  2DIY A;  2MMA A;  1PD2 1;  2AYT A;  2GQM A;  4XHM A;  5D9T A;  4QL7 A;  2IN3 A;  4WF4 A;  5CO3 A;  3EYT A;  4L8E A;  5J41 A;  1GTB A;  3A2W A;  3DD3 A;  5CNW A;  3GL3 A;  4X0X A;  4OFM A;  1ZYQ B;  1X9W B;  3EE2 A;  4N0Z A;  1TRV A;  3E9J B;  2HRA A;  2OAD A;  4MJE A;  3RPN A;  5IOW A;  2C1Y A;  2H30 A;  3ZTL A;  3I69 A;  1YKC A;  3L9U A;  2FWE A;  5DBQ A;  1THO A;  2OE3 A;  3C1S A;  4KCE A;  4OFN A;  2VLU A;  1T4Z A;  2GQL A;  2HT9 A;  1K3Y A;  2YV9 A;  2VLV A;  3Q74 A;  1TK0 B;  3EU3 A;  4Z2R A;  3HZ4 A;  2DLX A;  5ELA A;  3IDV A;  1SKS B;  3VFI A;  5LNK e;  4HJM A;  4ML1 A;  2RLI A;  3ERW A;  5BRT A;  2VLT A;  3KTL A;  2DJ1 A;  1A8L A;  4FQU A;  1PSQ A;  4G2E A;  3C7M A;  5IIZ A;  3CRU A;  1E2Y A;  1XOA A;  4J2F A;  1W4V A;  4XIH A;  4POK A;  5ECM B;  4MH3 A;  2IMK A;  3A3T A;  4E8H A;  3GV1 A;  5J9C A;  3GSS A;  3GIX A;  2FLS A;  5CP1 A;  3P90 A;  3TGZ A;  3KMO A;  4Z7X A;  2FWH A;  1FOH A;  3LYK A;  4ECC A;  4J57 E;  3UJ1 A;  1N2A A;  3C73 A;  1XCC A;  3JCM L;  5G30 A;  1H75 A;  2LQQ A;  1BYE A;  2IL3 A;  1PGT A;  1OAZ A;  2NPB A;  4EDZ A;  3WYW A;  4JR4 A;  1GNW A;  3CQF A;  3I9V 2;  2HRN A;  2A2R A;  4KF9 A;  2LUS A;  4I6X A;  5IOX A;  1FAA A;  1EGO A;  2H73 A;  1JZR A;  2YV7 A;  4AGS A;  3FHK A;  9GSS A;  2MMN A;  3VWU A;  1F2E A;  2H8L A;  4O32 A;  4F0C A;  5CAX A;  4PNG A;  2B5Y A;  2DJJ A;  1SK2 A;  4MZC A;  3W8J A;  4JED A;  2WJU A;  2OAC A;  3LQ7 A;  1YEP A;  2HXK A;  4RQX A;  5AIS A;  2F8F A;  3M9K A;  4K2X A;  4TW5 A;  1BAY A;  1KTE A;  1K0C A;  2I81 A;  4ILF A;  1TI3 A;  3D5J A;  2WDU A;  1HQO A;  2YOI A;  5DAL A;  2OE1 A;  1SYX A;  4LLR A;  2YJH A;  4I2T A;  1TW9 A;  3DXB A;  3EMP A;  3CMI A;  1SJ6 A;  4PUF C;  2JZR A;  2J9H A;  2IFQ A;  2L6C A;  1SKW B;  1GP1 A;  4G19 A;  1XVW A;  1YZX A;  6GSS A;  2DIZ A;  1IYH A;  1GUK A;  1XWC A;  3ZML A;  1O7U A;  4K7N A;  1F6M C;  4EIQ A;  1FO5 A;  2R2J A;  3A5W A;  4XCS A;  4BWQ A;  2KHP A;  4OD7 A;  3PR8 A;  1AQW A;  1LJR A;  2VL2 C;  1ZOF A;  2A2P A;  4TRX A;  1UVZ A;  3HY2 A;  1SL1 B;  1VF4 A;  2CA8 A;  3HVV A;  5LD0 A;  4JZQ A;  2YPM A;  18GS A;  2C0G A;  4YAP A;  3TCO A;  2FA4 A;  4MZW A;  1EP7 A;  1ZMA A;  2B5X A;  3WGD A;  2BTO T;  1VGL A;  4A5P A;  1H4O A;  2CZ3 A;  2OKA A;  2L4Q A;  4XRD A;  2H1B A;  5HR3 A;  3HXS A;  3I43 A;  3ZFB A;  2HSY A;  3ZMK A;  1EZK A;  2K18 A;  2GSR A;  3CBU A;  3LGC A;  3QAV A;  2H1A A;  4NWY A;  2JZS A;  3H93 A;  4WBR D;  2PGT A;  1XWB A;  4K0G A;  1OKD A;  4I2U A;  2LST A;  2CVD A;  1B8X A;  4MP4 A;  1EOH A;  2JU5 A;  4NHZ A;  3OR5 A;  1A2M A;  1QK8 A;  2LKU A;  1EV4 A;  4YQV A;  3H8Q A;  1CQH A;  1MDJ A;  2CT6 A;  3TKS C;  4ISD A;  2H6Z A;  1NW2 A;  2HRF A;  5CRW A;  2HZF A;  1PL2 A;  1RQM A;  5D8I A;  5AGY A;  5ECH B;  4GSN A;  3UEM A;  3GHA A;  2FD3 A;  1UA5 A;  2DKH A;  5IMF A;  2IME A;  5CRE A;  1U3I A;  5JWR B;  3APQ A;  4AJ7 A;  1B9X C;  2HSH A;  5CRD A;  5J9B A;  1GTU A;  1O8W A;  4F82 A;  1FHE A;  2Z9S A;  4BVX A;  5DDL A;  3ME7 A;  2H75 A;  3QFB C;  6GSX A;  1GUL A;  3TJG A;  3F63 A;  1VF2 A;  5A4V A;  2JZT A;  2QA2 A;  3F3Q A;  4EL1 A;  2E2M A;  4TVE A;  2WCI A;  5J4U A;  1TU7 A;  5DQS A;  4WR5 A;  4TOP A;  2DJ2 A;  1JHB A;  1UC7 A;  3FEU A;  1SD9 A;  2M46 A;  4FIW A;  3UOM A;  2GLR A;  1V9W A;  4MZB A;  4MPF A;  2YZU A;  2ZCT A;  4KW6 A;  4NAX A;  5E59 A;  1GSS A;  1OVN A;  3KCM A;  2TRC P;  4G0L A;  3IC4 A;  4TKY A;  4FH8 A;  3ZVJ A;  5CYY A;  1MDI A;  3F9U A;  3IOS A;  1OC8 A;  1TK5 B;  1YJ6 A;  2YAN A;  5ENU A;  3QR6 A;  2R4V A;  4NV5 A;  5CRH A;  1Z7P A;  3ZVJ D;  2C0F A;  3Q19 A;  4PQI A;  4MF7 A;  2LQO A;  1PA3 A;  2GS3 A;  3H4K A;  1U6T A;  1Q98 A;  3MWH A;  4ECI A;  2IIY A;  2GGT A;  2PER A;  3ED3 A;  1K0B A;  3L9V A;  3ZL5 A;  5ECN B;  4GQC A;  4ZB8 A;  3FKF A;  2WUL A;  5KN2 A;  3R3E A;  1MD3 A;  3TJB A;  2P31 A;  5ABR A;  2RUF A;  3K8N A;  3LFL A;  1NHY A;  2P0G A;  4IN0 A;  1ACV A;  4HEA 2;  3LWA A;  1AAZ A;  3QFA C;  2H6Y A;  3J7Y k;  1AC1 A;  5ECI B;  1QXH A;  2WGR A;  2C4J A;  2MMO A;  2DKI A;  4AJ8 A;  3KTB A;  5HR1 A;  3HVS A;  4IBP A;  3HZ8 A;  3VWW A;  4BVX B;  1GLQ A;  1GTI A;  2OBI A;  2NVL A;  2FUG 2;  1JLW A;  3QAG A;  2NTO A;  3DEX A;  3DWV A;  1F3B A;  4O5R A;  1A2L A;  4TR3 A;  1SEN A;  3LEF A;  4I8B A;  2IWT A;  2PU9 C;  1G6Y A;  3F4S A;  5A5K A;  2YJ7 A;  1SKR B;  4WF5 A;  3O3T A;  1JLV A;  3CSI A;  5HR2 A;  4K0N A;  5ID2 B;  5EVO A;  1AW9 A;  3DIE A;  2CZ2 A;  2EC4 A;  2HFD A;  2GZY A;  1O85 A;  3IA1 A;  3LSZ A;  1X9S B;  1TK8 B;  5DCG A;  5H5R A;  2K6V A;  2R6K A;  3F8U A;  6GSY A;  4O7H A;  3VUR A;  3A2X A;  2JAD A;  1EWX A;  3WT2 A;  3QDN A;  4LL4 B;  3H1N A;  1TXX A;  3KM6 A;  2H0I A;  5KOX A;  3FZ4 A;  4ZB6 A;  1GLP A;  3L9S A;  2ALB A;  2V41 A;  1TRW A;  2B7J A;  5DJM A;  5JCU A;  5KN1 A;  1T7P B;  1NSW A;  2B1L A;  4F2I A;  2L59 A;  1S3R A;  4GXZ A;  1USB A;  2N5F A;  4BVY A;  1UN2 A;  14GS A;  2VCX A;  4HOJ A;  3PGT A;  1U88 A;  5INY A;  1DE2 A;  3LXT A;  4JE1 A;  3Q6O A;  4V1A g;  2V6K A;  2J23 A;  5C00 A;  2AB6 A;  3DVX A;  3EVI A;  4IP6 A;  3N5O A;  4K9Z A;  1OE8 A;  2LNS A;  1K0N A;  1S3D A;  3D4M A;  4OO5 A;  3ZIT A;  2P5R A;  1PN0 A;  4DEJ A;  3DVW A;  4DSR A;  2L5O A;  3G7Y A;  1EEM A;  2XC2 A;  3ZRD A;  3CXG A;  3TRQ A;  1DE1 A;  2GZP A;  2V2G A;  3KIJ A;  2LRC A;  2V1M A;  1OC3 A;  3GTU A;  3TJK A;  2O7K A;  4WEY A;  2IMF A;  2LNT A;  4BPY A;  1YY7 A;  3HCZ A;  5G1L A;  3VPQ A;  2I4A A;  3F6D A;  2HSM A;  1MTC A;  2VO4 A;  1HNC A;  1T1V A;  1RW1 A;  1Z5Y E;  5EPF A;  3MYD A;  3GX8 A;  2VCV A;  3GH6 A;  1Z7R A;  2WZ9 A;  4K2D A;  1C72 A;  3RBT A;  5IQY A;  1X9M B;  1WRY A;  3IV4 A;  1AIU A;  5H5Q A;  1B4Q A;  1R7H A;  1J9B A;  1S3A A;  1FB0 A;  1SD8 A;  1GWC A;  3V1W A;  1GH2 A;  5B7C A;  17GS A;  5GSS A;  2DMM A;  4ZBA A;  4IJ3 A;  3BJ5 A;  4DSS A;  3PPU A;  2PVQ A;  3DML A;  5L71 A;  1ERV A;  1OC9 B;  3S9F A;  2DJK A;  4IGJ A;  3HVN A;  3M0F A;  1AQX A;  5JWQ B;  5DAK B;  2XPD A;  5KN3 A;  5IPG A;  4LA1 A;  3VPT A;  5D9W A;  4F9Z A;  2H66 A;  2TIR A;  4YQU A;  1K3O A;  1TDI A;  3FZ5 A;  4AJ6 A;  1R5A A;  2AUV A;  4IS0 A;  1M3J A;  8GSS A;  2N5B A;  3KZQ A;  4AF2 A;  2HRK A;  1Z9H A;  2E2G A;  4PGT A;  3ZFL A;  4CW9 A;  3CTG A;  1YEX A;  2B6M A;  1EP8 A;  3TKR A;  3US3 A;  2XBI A;  2V6O A;  3RAZ A;  3IAS 2;  4L5O A;  1XW5 A;  4PTS A;  1SK1 A;  5EY6 A;  1GSF A;  1G0T A;  4Z2T A;  1YDK A;  5A4U A;  2L5L A;  3QCP A;  4L0U A;  3IRA A;  5CRG A;  2I9H A;  3RHB A;  4G0K A;  2R0G A;  3TKP A;  2GDR A;  3GRX A;  2OJL A;  1JZW A;  2X8C A;  2R3X A;  4KND A;  4ECB A;  5FWG A;  5B6N A;  3E3E A;  2N5A A;  3UMA A;  1ABA A;  4ZB9 A;  2H70 A;  1FOV A;  2LRT A;  2H72 A;  4JRR A;  4G0I A;  2YWN A;  3KXO A;  2PN8 A;  4OO4 A;  1A8Y A;  1W89 A;  3GNJ A;  1K0A A;  3C1R A;  2RII A;  3KD0 A;  2C80 A;  1A24 A;  2G0F A;  4MMM A;  1ERW A;  2KP1 A;  1Y6E A;  3D6I A;  2A2S A;  1S3C A;  4F0B A;  1URM A;  2YWO A;  3FR3 A;  2FHE A;  5IMD A;  3GYK A;  3APO A;  2C3Q A;  2QKE A;  2GST A;  3KP8 A;  4N10 A;  1VF3 A;  2GSQ A;  1EOG A;  1HYU A;  4FYC A;  3QD9 A;  2GT5 A;  4K7I A;  4YKG A;  3G7I A;  4KB3 A;  5IMC A;  4Q5Q A;  1QMV A;  1ON4 A;  2X8H A;  5IMA A;  11GS A;  1V40 A;  1XWA A;  5J5N A;  1M9B A;  2PUK C;  1YF0 A;  6GSV A;  12GS A;  2CQ9 A;  4EDY A;  3UAR A;  4HU7 A;  4RQR A;  2ON5 A;  1OE7 A;  3IHG A;  2UZ8 A;  3DRN A;  5DVB A;  1X5C A;  3VWX A;  4ACS A;  4O5U A;  2FCH A;  2VCZ A;  5D9V A;  2WFC A;  4PX1 A;  4ZIL A;  2IMD A;  2IJY A;  1K0D A;  1ZL9 A;  2CVK A;  4XS4 A;  3RPP A;  4TR1 A;  1FB6 A;  5G2Z A;  4MLY A;  2F51 A;  3TRX A;  2EIO A;  3D4T A;  1QQ2 A;  3KMN A;  1I9D A;  1GTA A;  2H0H A;  4BL7 A;  4CY6 A;  4TR0 A;  5DAL B;  4MH2 A;  1XBS A;  1A2J A;  2CX3 A;  3HVX A;  2I1U A;  2EIQ A;  5D93 A;  3CRT A;  1PMT A;  4V2N A;  4G10 A;  4D73 A;  4MAB A;  2IFQ B;  2F3M A;  2LS5 A;  3PH9 A;  3GUR A;  2GSS A;  2KUC A;  2LJR A;  1WJK A;  4HUA A;  4K7O A;  2HNL A;  3HKR A;  5KEJ A;  1ILO A;  1XWG A;  1DUG A;  4EC0 A;  20GS A;  3IE3 A;  2R37 A;  2NBS A;  2HE3 A;  1Z3E A;  2PPT A;  2YNX A;  3GKX A;  2B7K A;  2HYX A;  3HHV A;  1ML6 A;  1TJD A;  4I5Q A;  3IPZ A;  2E0Q A;  3VLN A;  3IBH A;  1YF1 A;  1PL1 A;  3W8S A;  1VRS D;  2H0G A;  1B9Y C;  4KH7 A;  2FNO A;  4K6X A;  5HFI A;  2VM1 A;  3IR4 A;  2DML A;  2C8U A;  4KUN A;  1QUW A;  4TXO A;  2JSY A;  4EXJ A;  4YKF A;  2H19 A;  3GUS A;  4FYU A;  4WBJ A;  4WR4 A;  22GS A;  4H86 A;  2YN1 A;  1WIK A;  1ZZY A;  3NZN A;  3EC3 A;  2LTK A;  2M72 A;  4TR1 B;  1SJZ A;  2O8V B;  2GZZ A;  2O85 A;  3EWL A;  4ULX A;  2EIR A;  3W6G A;  4XTS A;  4EVM A;  1M2A A;  3KGK A;  3P7X A;  3VI5 A;  2TRX A;  5IO0 A;  1GSU A;  3G7J A;  2DC5 A;  4USS A;  3TKQ A;  5JCW A;  3KP9 A;  4MNN A;  4D73 B;  3MAK A;  4PNF A;  5FHI A;  4O5Q A;  3TKS A;  4KDX A;  3CSH A;  2OA7 A;  3SWL A;  2PBJ A;  4XS1 A;  3IK7 A;  1R5P A;  1AXD A;  3Q18 A;  4HI7 A;  3GN3 A;  4KGI A;  3FR6 A;  1O81 A;  3ZRE A;  2HZE A;  4DSQ A;  1EV9 A;  4MJC A;  3UVT A;  1PRX A;  2E7P A;  3WD6 A;  1HNB A;  1A0F A;  2I3Y A;  3G9B A;  4X4J A;  4Z2U A;  2X8G A;  4IJI A;  4JR6 A;  5B6M A;  3BOA A;  1TTZ A;  3GL5 A;  3L78 A;  1WP0 A;  5B8A A;  1FVJ A;  1ERU A;  5E4W A;  2C0E A;  4EKZ A;  4MF6 A;  2BJX A;  3P8W A;  1OKT A;  10GS A;  1PN9 A;  3FMW A;  3C8E A;  3ZZX A; 
#chains in the Genus database with same CATH homology
 5F07 A;  2X99 A;  3IXR A;  3D0Z A;  2OBK A;  4IQ1 A;  4KAE A;  1XW6 A;  1JZD A;  1YQ1 A;  4PQ1 A;  2VM2 A;  1J08 A;  1TOF A;  4QL9 A;  1K3L A;  1J0F A;  1O8X A;  1U87 A;  2WRT A;  3UAP A;  4RUV A;  3IC8 A;  3F6F A;  4ML6 A;  4IKH A;  1LBK A;  4WET A;  1SU9 A;  1M99 A;  5D96 A;  2YWI A;  3TB2 A;  1OYJ A;  3GKN A;  3I6A A;  4HQS A;  2F8A A;  1KNG A;  3LJR A;  4HDE A;  3HJO A;  4ZL9 A;  4EE0 A;  1IYI A;  2FWF A;  2KOK A;  2PWJ A;  4I97 A;  1X5E A;  4PUR A;  4JBB A;  5IO2 A;  1XIY A;  2R5G A;  3DGQ A;  1R26 A;  3TJF A;  3D22 A;  3ME8 A;  3VK9 A;  2B3S A;  3O6T A;  3TUE A;  1WPI A;  2K8S A;  3KH9 A;  3GA4 A;  2CVB A;  4OFT A;  3EU4 A;  4GRF A;  1MEK A;  2ZNM A;  2XPE A;  5KOW A;  4X43 A;  4ECJ A;  2YCD A;  4KX4 A;  13GS A;  3LYP A;  5BMU A;  4Q5F A;  5ECK B;  5ECS A;  4MDC A;  4FO5 A;  1SL0 B;  4V2M A;  3L4N A;  4FYB A;  1ZYP A;  1GUH A;  1TKD B;  5F05 A;  1ZCP A;  3EIN A;  1F9M A;  2GQK A;  1GRX A;  1B48 A;  4HS1 A;  2FWG A;  5IPH A;  2CAI A;  1NHO A;  1SYR A;  4KA0 A;  2OE0 A;  3FR9 A;  1KBN A;  2DBC A;  1N8J A;  3IAM 2;  5ECL B;  3TDG A;  2B1K A;  4KSO A;  4BVY B;  4ZL8 A;  4G9H A;  1BED A;  5D73 A;  4YQM A;  5JWO B;  1HNA A;  2VAF A;  4CDO A;  2O87 A;  1A0R P;  1FG4 A;  1LU4 A;  4Q5N A;  1PX6 A;  4GF0 A;  3F4R A;  1G6W A;  1QGV A;  5HFG A;  2C3T A;  2QA1 A;  3C71 A;  3ZIV A;  4IP1 A;  4NHW A;  3FZ9 A;  4F03 A;  4EO3 A;  1QFN A;  1M2D A;  3HA9 A;  4RI6 A;  1KEB A;  2QSI A;  2P5Q A;  4N0V A;  2RM6 A;  2LV3 A;  4JU5 A;  5G5F A;  4L0W A;  1R4W A;  4TR4 A;  2H1D A;  16GS A;  4YH2 A;  2L6D A;  5LCZ A;  2H1G A;  1Z6N A;  2VUP A;  1XVQ A;  2AJQ B;  3GFK A;  3QAW A;  4EUY A;  6GSW A;  3GTU B;  7GSS A;  2MYG A;  3F0I A;  2IPA A;  5ELG A;  4MCU A;  1EGR A;  3IHQ A;  1BQ7 A;  4OCE A;  1NM3 A;  2X49 A;  1AUC A;  2A4H A;  2HI7 A;  4K8M A;  5HR0 A;  3FY7 A;  1XXU A;  1DBY A;  2QGV A;  4O92 A;  4Q5R A;  4OWY A;  3QOU A;  4PUA A;  5AIX A;  3BBY A;  2GT6 A;  2RM5 A;  1Q4J A;  2XBQ A;  1HD2 A;  3D21 A;  4RI7 A;  2LRN A;  4V1A p;  2GVP A;  4ZXG A;  4J56 E;  3CYN A;  4YAV A;  4OCF A;  2ON7 A;  1B4P A;  2C3N A;  1GSY A;  2K8V A;  3MIX A;  4DSS B;  3EUR A;  2CAQ A;  1O73 A;  1G7E A;  5DJL A;  3MSZ A;  1WWJ A;  3VWV A;  4KCA A;  1THX A;  2PVO C;  3AY8 A;  5J3R A;  4IQA A;  4NV2 A;  4EF0 A;  5AIV A;  3R2Q A;  3O76 A;  4MK3 A;  4E8E A;  2AHE A;  1T4Y A;  3KH7 A;  5B8B A;  1PKW A;  3M8N A;  3M1G A;  3QPM A;  4P3Y B;  5AN1 A;  4IHU A;  3M9J A;  4IVF A;  3LW9 A;  5ECO B;  4GWR A;  2REM A;  4K5R A;  2HLS A;  4HQZ A;  3BCI A;  4IEL A;  1CQG A;  2LJA A;  4TXV A;  2BMX A;  1E6B A;  3GKM A;  4KDY A;  2AV4 A;  2RUE A;  1G7O A;  1TI1 A;  4NMU A;  5IM9 A;  2MMZ A;  3DYR A;  3TJJ A;  4ICY A;  1K0O A;  3LG6 A;  2VOC A;  5GZZ B;  5G5E A;  2FA8 A;  4ZL7 A;  4POL A;  1BX9 A;  3E0U A;  1GSE A;  2L4C A;  1K0M A;  1ZYE A;  1XOB A;  19GS A;  3A5I A;  3WGX A;  4IW9 A;  2M80 A;  4KSM A;  2VCT A;  5IMV A;  3HD5 A;  2H6X A;  2LJK A;  6GST A;  3UBL A;  2NDO A;  2VIM A;  3F3R A;  3TKS E;  1GSQ A;  3ERG A;  3LOR A;  3HJM A;  5G31 A;  1ZYN A;  1XZO A;  1WE0 A;  1X5D A;  2VD0 A;  2VL9 A;  4GLT A;  2CX4 A;  3VI7 A;  4TN8 A;  4K5S A;  1WOU A;  3HYP A;  1V58 A;  2DSA A;  3HDC A;  3KJY A;  4CHS A;  2VCQ A;  3QMX A;  4ID0 A;  2VCW A;  5C04 A;  1GL8 A;  2AAW A;  1F37 A;  3FYG A;  4L5L A;  1T8E B;  4ZIJ A;  2H71 A;  1XPV A;  4BA7 A;  4XS6 A;  1FW1 A;  2DJ3 A;  1M7T A;  1PQN A;  3UL3 A;  5IMZ A;  4HZ4 A;  1PKZ A;  2VL2 A;  2YWM A;  4N30 A;  3UIW A;  1ST9 A;  1YKA A;  3EMX A;  1U3A A;  5D9X A;  5ECR B;  2CV4 A;  1T3B A;  1SL2 B;  4BWS A;  3GH9 A;  2H01 A;  2GTU A;  5HQP A;  2MZC A;  2ZUP A;  1VF1 A;  3CTF A;  1X0R A;  4XS4 B;  3HJP A;  5A4W A;  3EPT A;  3M3M A;  4ZBB A;  3J7Y b;  5F8B A;  6GSU A;  4BL7 B;  1Y25 A;  2MBS A;  1DSB A;  3U5R E;  1EEJ A;  3RDW A;  1XW9 A;  5F0G A;  1V98 A;  5ID2 A;  2F9S A;  2FY6 A;  2FGX A;  2L57 A;  3IK9 A;  2R0C A;  5ECP B;  3FZA A;  2V32 A;  1SK0 A;  3APS A;  1MD4 A;  5DQY A;  3FW2 A;  3GKK A;  3WT1 A;  2D2Z A;  4KE3 A;  1ZGN A;  3KEB A;  2ES7 A;  3FK8 A;  3NOF A;  1XWK A;  2PMT A;  4MJB A;  2C0D A;  1GUM A;  4HU9 A;  4WKW A;  1V57 A;  1WMJ A;  4MA9 A;  1M9A A;  3L0H A;  1BJX A;  1SJI A;  3F4T A;  2IMI A;  2YP6 A;  1RK4 A;  3MNG A;  3GST A;  1TRS A;  1A23 A;  1BG5 A;  5DCH A;  2A4V A;  1PX7 A;  4TXO B;  4POM A;  2R0P A;  4EIP A;  3WGE A;  1FVK A;  5GAP D;  3N9J A;  3CSJ A;  2DJ0 A;  3SBC A;  5KN0 A;  3ZYW A;  2JSZ A;  5H5S A;  2JL4 A;  2KLX A;  4GQF A;  3UBK A;  1AQV A;  3P2A A;  1JZO A;  4CY8 A;  2QC7 A;  4ZBD A;  1Z6M A;  3PIN A;  2LEG A;  4DVC A;  3ZIJ A;  1XFL A;  2X4A A;  4POB A;  2MBT A;  1M0U A;  2O89 A;  3TOT A;  5EL8 A;  2KP2 A;  5GST A;  2K9F A;  4MPG A;  1TRU A;  3LXZ A;  4PQH A;  2VD1 A;  1GSD A;  2VL3 A;  1I5G A;  2G2Q A;  4OMV A;  3TOU A;  5FT3 A;  2HZE B;  3A2V A;  4V2L A;  3GMF A;  3H79 A;  3FRC A;  4XRA A;  4K1F A;  3UVH A;  3U6V A;  1F3A A;  5ECQ B;  4GTU A;  4HJ2 A;  4MJA A;  1JFU A;  4PXO A;  4NXI A;  3GX0 A;  2X64 A;  4LL1 B;  3DKS A;  2WB9 A;  1TP9 A;  4HZ2 A;  5F06 A;  5G1K A;  3BCK A;  4MF5 A;  5JCG A;  4WXT A;  1T00 A;  1V2A A;  2YZH A;  5COH A;  1ERT A;  2XHF A;  4LMW A;  3BD2 A;  4LMV A;  1O6J A;  3RHC A;  1M2B A;  2B5E A;  3NIV A;  3ERF A;  2H76 A;  1MDK A;  4KDU A;  3ZLP A;  2WS2 A;  3MDK A;  1TU8 A;  5GAN D;  4NPB A;  1OC9 A;  4GST A;  4N11 A;  1GNE A;  4QQ7 A;  3ISO A;  4X1U A;  2JAC A;  2H74 A;  5HFK A;  3TRP A;  4GSS A;  4GCI A;  5DAK A;  2DIY A;  2MMA A;  1PD2 1;  2AYT A;  2GQM A;  4XHM A;  5D9T A;  4QL7 A;  2IN3 A;  4WF4 A;  5CO3 A;  3EYT A;  4L8E A;  5J41 A;  1GTB A;  3A2W A;  3DD3 A;  5CNW A;  3GL3 A;  4X0X A;  4OFM A;  1ZYQ B;  1X9W B;  3EE2 A;  4N0Z A;  1TRV A;  3E9J B;  2HRA A;  2OAD A;  4MJE A;  3RPN A;  5IOW A;  2C1Y A;  2H30 A;  3ZTL A;  3I69 A;  1YKC A;  3L9U A;  2FWE A;  5DBQ A;  1THO A;  2OE3 A;  3C1S A;  4KCE A;  4OFN A;  2VLU A;  1T4Z A;  2GQL A;  2HT9 A;  1K3Y A;  2YV9 A;  2VLV A;  3Q74 A;  1TK0 B;  3EU3 A;  4Z2R A;  3HZ4 A;  2DLX A;  5ELA A;  3IDV A;  1SKS B;  3VFI A;  5LNK e;  4HJM A;  4ML1 A;  2RLI A;  3ERW A;  5BRT A;  2VLT A;  3KTL A;  2DJ1 A;  1A8L A;  4FQU A;  1PSQ A;  4G2E A;  3C7M A;  5IIZ A;  3CRU A;  1E2Y A;  1XOA A;  4J2F A;  1W4V A;  4XIH A;  4POK A;  5ECM B;  4MH3 A;  2IMK A;  3A3T A;  4E8H A;  3GV1 A;  5J9C A;  3GSS A;  3GIX A;  2FLS A;  5CP1 A;  3P90 A;  3TGZ A;  3KMO A;  4Z7X A;  2FWH A;  1FOH A;  3LYK A;  4ECC A;  4J57 E;  3UJ1 A;  1N2A A;  3C73 A;  1XCC A;  3JCM L;  5G30 A;  1H75 A;  2LQQ A;  1BYE A;  2IL3 A;  1PGT A;  1OAZ A;  2NPB A;  4EDZ A;  3WYW A;  4JR4 A;  1GNW A;  3I9V 2;  2HRN A;  2A2R A;  4KF9 A;  2LUS A;  4I6X A;  5IOX A;  1FAA A;  1EGO A;  2H73 A;  1JZR A;  2YV7 A;  4AGS A;  3FHK A;  9GSS A;  2MMN A;  3VWU A;  1F2E A;  2H8L A;  4O32 A;  4F0C A;  5CAX A;  4PNG A;  2B5Y A;  2DJJ A;  1SK2 A;  4MZC A;  3W8J A;  4JED A;  2WJU A;  2OAC A;  3LQ7 A;  1YEP A;  2HXK A;  4RQX A;  5AIS A;  2F8F A;  3M9K A;  4K2X A;  4TW5 A;  1BAY A;  1KTE A;  1K0C A;  2I81 A;  4ILF A;  1TI3 A;  3D5J A;  2WDU A;  1HQO A;  2YOI A;  5DAL A;  2OE1 A;  1SYX A;  4LLR A;  2YJH A;  4I2T A;  1TW9 A;  3DXB A;  3EMP A;  3CMI A;  1SJ6 A;  4PUF C;  2JZR A;  2J9H A;  2IFQ A;  2L6C A;  1SKW B;  1GP1 A;  4G19 A;  1XVW A;  1YZX A;  6GSS A;  2DIZ A;  1IYH A;  1GUK A;  1XWC A;  3ZML A;  1O7U A;  4K7N A;  1F6M C;  4EIQ A;  1FO5 A;  2R2J A;  3A5W A;  4XCS A;  4BWQ A;  2KHP A;  4OD7 A;  3PR8 A;  1AQW A;  1LJR A;  2VL2 C;  1ZOF A;  2A2P A;  4TRX A;  1UVZ A;  3HY2 A;  1SL1 B;  1VF4 A;  2CA8 A;  3HVV A;  5LD0 A;  4JZQ A;  2YPM A;  18GS A;  2C0G A;  4YAP A;  3TCO A;  2FA4 A;  4MZW A;  1EP7 A;  1ZMA A;  2B5X A;  3WGD A;  2BTO T;  1VGL A;  4A5P A;  1H4O A;  2CZ3 A;  2OKA A;  2L4Q A;  4XRD A;  2H1B A;  5HR3 A;  3HXS A;  3I43 A;  3ZFB A;  2HSY A;  3ZMK A;  1EZK A;  2K18 A;  2GSR A;  3CBU A;  3LGC A;  3QAV A;  2H1A A;  4NWY A;  2JZS A;  3H93 A;  4WBR D;  2PGT A;  1XWB A;  4K0G A;  1OKD A;  4I2U A;  2LST A;  2CVD A;  1B8X A;  4MP4 A;  1EOH A;  2JU5 A;  4NHZ A;  3OR5 A;  1A2M A;  1QK8 A;  2LKU A;  1EV4 A;  4YQV A;  3H8Q A;  1CQH A;  1MDJ A;  2CT6 A;  3TKS C;  4ISD A;  2H6Z A;  1NW2 A;  2HRF A;  5CRW A;  2HZF A;  1PL2 A;  1RQM A;  5D8I A;  5AGY A;  5ECH B;  4GSN A;  3UEM A;  3GHA A;  2FD3 A;  1UA5 A;  2DKH A;  5IMF A;  2IME A;  5CRE A;  1U3I A;  5JWR B;  3APQ A;  4AJ7 A;  1B9X C;  2HSH A;  5CRD A;  5J9B A;  1GTU A;  1O8W A;  4F82 A;  1FHE A;  2Z9S A;  4BVX A;  5DDL A;  3ME7 A;  2H75 A;  3QFB C;  6GSX A;  1GUL A;  3TJG A;  3F63 A;  1VF2 A;  5A4V A;  2JZT A;  2QA2 A;  3F3Q A;  4EL1 A;  2E2M A;  4TVE A;  2WCI A;  5J4U A;  1TU7 A;  5DQS A;  4WR5 A;  4TOP A;  2DJ2 A;  1JHB A;  1UC7 A;  3FEU A;  1SD9 A;  2M46 A;  4FIW A;  3UOM A;  2GLR A;  1V9W A;  4MZB A;  4MPF A;  2YZU A;  2ZCT A;  4KW6 A;  4NAX A;  5E59 A;  1GSS A;  1OVN A;  3KCM A;  2TRC P;  4G0L A;  3IC4 A;  4TKY A;  4FH8 A;  3ZVJ A;  5CYY A;  1MDI A;  3F9U A;  3IOS A;  1OC8 A;  1TK5 B;  1YJ6 A;  2YAN A;  5ENU A;  3QR6 A;  2R4V A;  4NV5 A;  5CRH A;  1Z7P A;  3ZVJ D;  2C0F A;  3Q19 A;  4PQI A;  4MF7 A;  2LQO A;  1PA3 A;  2GS3 A;  3H4K A;  1U6T A;  1Q98 A;  3MWH A;  4ECI A;  2IIY A;  2GGT A;  2PER A;  3ED3 A;  1K0B A;  3L9V A;  3ZL5 A;  5ECN B;  4GQC A;  4ZB8 A;  3FKF A;  2WUL A;  5KN2 A;  3R3E A;  1MD3 A;  3TJB A;  2P31 A;  5ABR A;  2RUF A;  3K8N A;  3LFL A;  1NHY A;  2P0G A;  4IN0 A;  1ACV A;  4HEA 2;  3LWA A;  1AAZ A;  3QFA C;  2H6Y A;  3J7Y k;  1AC1 A;  5ECI B;  1QXH A;  2WGR A;  2C4J A;  2MMO A;  2DKI A;  4AJ8 A;  3KTB A;  5HR1 A;  3HVS A;  4IBP A;  3HZ8 A;  3VWW A;  4BVX B;  1GLQ A;  1GTI A;  2OBI A;  2NVL A;  2FUG 2;  1JLW A;  3QAG A;  2NTO A;  3DEX A;  3DWV A;  1F3B A;  4O5R A;  1A2L A;  4TR3 A;  1SEN A;  3LEF A;  4I8B A;  2IWT A;  2PU9 C;  1G6Y A;  3F4S A;  5A5K A;  2YJ7 A;  1SKR B;  4WF5 A;  3O3T A;  1JLV A;  3CSI A;  5HR2 A;  4K0N A;  5ID2 B;  5EVO A;  1AW9 A;  3DIE A;  2CZ2 A;  2EC4 A;  2HFD A;  2GZY A;  1O85 A;  3IA1 A;  3LSZ A;  1X9S B;  1TK8 B;  5DCG A;  5H5R A;  2K6V A;  2R6K A;  3F8U A;  6GSY A;  4O7H A;  3VUR A;  3A2X A;  2JAD A;  1EWX A;  3WT2 A;  3QDN A;  4LL4 B;  3H1N A;  1TXX A;  3KM6 A;  2H0I A;  5KOX A;  3FZ4 A;  4ZB6 A;  1GLP A;  3L9S A;  2ALB A;  2V41 A;  1TRW A;  2B7J A;  5DJM A;  5JCU A;  5KN1 A;  1T7P B;  1NSW A;  2B1L A;  4F2I A;  2L59 A;  4GXZ A;  1USB A;  2N5F A;  4BVY A;  1UN2 A;  14GS A;  2VCX A;  4HOJ A;  3PGT A;  1U88 A;  5INY A;  1DE2 A;  3LXT A;  4JE1 A;  3Q6O A;  4V1A g;  2V6K A;  2J23 A;  5C00 A;  2AB6 A;  3DVX A;  3EVI A;  4IP6 A;  3N5O A;  4K9Z A;  1OE8 A;  2LNS A;  1K0N A;  1S3D A;  3D4M A;  4OO5 A;  3ZIT A;  2P5R A;  1PN0 A;  4DEJ A;  3DVW A;  4DSR A;  2L5O A;  3G7Y A;  1EEM A;  2XC2 A;  3ZRD A;  3CXG A;  3TRQ A;  1DE1 A;  2GZP A;  2V2G A;  3KIJ A;  2LRC A;  2V1M A;  1OC3 A;  3GTU A;  3TJK A;  2O7K A;  4WEY A;  2IMF A;  2LNT A;  4BPY A;  1YY7 A;  3HCZ A;  5G1L A;  3VPQ A;  2I4A A;  3F6D A;  2HSM A;  1MTC A;  2VO4 A;  1HNC A;  1T1V A;  1RW1 A;  1Z5Y E;  5EPF A;  3MYD A;  3GX8 A;  2VCV A;  3GH6 A;  1Z7R A;  2WZ9 A;  4K2D A;  1C72 A;  3RBT A;  5IQY A;  1X9M B;  1WRY A;  3IV4 A;  1AIU A;  5H5Q A;  1B4Q A;  1R7H A;  1J9B A;  1S3A A;  1FB0 A;  1SD8 A;  1GWC A;  3V1W A;  1GH2 A;  5B7C A;  17GS A;  5GSS A;  2DMM A;  4ZBA A;  4IJ3 A;  3BJ5 A;  4DSS A;  3PPU A;  2PVQ A;  3DML A;  5L71 A;  1ERV A;  1OC9 B;  3S9F A;  2DJK A;  4IGJ A;  3M0F A;  1AQX A;  5JWQ B;  5DAK B;  2XPD A;  5KN3 A;  5IPG A;  4LA1 A;  3VPT A;  5D9W A;  4F9Z A;  2H66 A;  2TIR A;  4YQU A;  1K3O A;  1TDI A;  3FZ5 A;  4AJ6 A;  1R5A A;  2AUV A;  4IS0 A;  8GSS A;  2N5B A;  3KZQ A;  4AF2 A;  2HRK A;  1Z9H A;  2E2G A;  4PGT A;  3ZFL A;  4CW9 A;  3CTG A;  1YEX A;  2B6M A;  1EP8 A;  3TKR A;  3US3 A;  2XBI A;  2V6O A;  3RAZ A;  3IAS 2;  4L5O A;  1XW5 A;  4PTS A;  1SK1 A;  5EY6 A;  1GSF A;  1G0T A;  4Z2T A;  1YDK A;  5A4U A;  2L5L A;  3QCP A;  4L0U A;  3IRA A;  5CRG A;  2I9H A;  3RHB A;  4G0K A;  2R0G A;  3TKP A;  2GDR A;  3GRX A;  2OJL A;  1JZW A;  2X8C A;  2R3X A;  4KND A;  4ECB A;  5FWG A;  5B6N A;  3E3E A;  2N5A A;  3UMA A;  1ABA A;  4ZB9 A;  2H70 A;  1FOV A;  2LRT A;  2H72 A;  4JRR A;  4G0I A;  2YWN A;  3KXO A;  2PN8 A;  4OO4 A;  1A8Y A;  1W89 A;  3GNJ A;  1K0A A;  3C1R A;  2RII A;  3KD0 A;  2C80 A;  1A24 A;  2G0F A;  4MMM A;  1ERW A;  2KP1 A;  1Y6E A;  3D6I A;  2A2S A;  1S3C A;  4F0B A;  1URM A;  2YWO A;  3FR3 A;  2FHE A;  5IMD A;  3GYK A;  3APO A;  2C3Q A;  2QKE A;  2GST A;  3KP8 A;  4N10 A;  1VF3 A;  2GSQ A;  1EOG A;  1HYU A;  4FYC A;  3QD9 A;  2GT5 A;  4K7I A;  4YKG A;  3G7I A;  4KB3 A;  5IMC A;  4Q5Q A;  1QMV A;  1ON4 A;  2X8H A;  5IMA A;  11GS A;  1V40 A;  1XWA A;  5J5N A;  1M9B A;  2PUK C;  1YF0 A;  6GSV A;  12GS A;  2CQ9 A;  4EDY A;  3UAR A;  4HU7 A;  4RQR A;  2ON5 A;  1OE7 A;  3IHG A;  2UZ8 A;  3DRN A;  5DVB A;  1X5C A;  3VWX A;  4ACS A;  4O5U A;  2FCH A;  2VCZ A;  5D9V A;  2WFC A;  4PX1 A;  4ZIL A;  2IMD A;  2IJY A;  1K0D A;  1ZL9 A;  2CVK A;  4XS4 A;  3RPP A;  4TR1 A;  1FB6 A;  5G2Z A;  4MLY A;  2F51 A;  3TRX A;  2EIO A;  3D4T A;  1QQ2 A;  3KMN A;  1I9D A;  1GTA A;  2H0H A;  4BL7 A;  4CY6 A;  4TR0 A;  5DAL B;  4MH2 A;  1XBS A;  1A2J A;  2CX3 A;  3HVX A;  2I1U A;  2EIQ A;  5D93 A;  3CRT A;  1PMT A;  4V2N A;  4G10 A;  4D73 A;  4MAB A;  2IFQ B;  2F3M A;  2LS5 A;  3PH9 A;  3GUR A;  2GSS A;  2KUC A;  2LJR A;  1WJK A;  4HUA A;  4K7O A;  2HNL A;  3HKR A;  5KEJ A;  1ILO A;  1XWG A;  1DUG A;  4EC0 A;  20GS A;  3IE3 A;  2R37 A;  2NBS A;  2HE3 A;  1Z3E A;  2PPT A;  2YNX A;  3GKX A;  2B7K A;  2HYX A;  3HHV A;  1ML6 A;  1TJD A;  4I5Q A;  3IPZ A;  2E0Q A;  3VLN A;  3IBH A;  1YF1 A;  1PL1 A;  3W8S A;  1VRS D;  2H0G A;  1B9Y C;  4KH7 A;  2FNO A;  4K6X A;  5HFI A;  2VM1 A;  3IR4 A;  2DML A;  2C8U A;  4KUN A;  1QUW A;  4TXO A;  2JSY A;  4EXJ A;  4YKF A;  2H19 A;  3GUS A;  4FYU A;  4WBJ A;  4WR4 A;  22GS A;  4H86 A;  2YN1 A;  1WIK A;  1ZZY A;  3NZN A;  3EC3 A;  2LTK A;  2M72 A;  4TR1 B;  1SJZ A;  2O8V B;  2GZZ A;  2O85 A;  3EWL A;  4ULX A;  2EIR A;  3W6G A;  4XTS A;  4EVM A;  1M2A A;  3KGK A;  3P7X A;  3VI5 A;  2TRX A;  5IO0 A;  1GSU A;  3G7J A;  2DC5 A;  4USS A;  3TKQ A;  5JCW A;  3KP9 A;  4MNN A;  4D73 B;  3MAK A;  4PNF A;  5FHI A;  4O5Q A;  3TKS A;  4KDX A;  3CSH A;  2OA7 A;  3SWL A;  2PBJ A;  4XS1 A;  3IK7 A;  1R5P A;  1AXD A;  3Q18 A;  4HI7 A;  3GN3 A;  4KGI A;  3FR6 A;  1O81 A;  3ZRE A;  2HZE A;  4DSQ A;  1EV9 A;  4MJC A;  3UVT A;  1PRX A;  2E7P A;  3WD6 A;  1HNB A;  1A0F A;  2I3Y A;  3G9B A;  4X4J A;  4Z2U A;  2X8G A;  4IJI A;  4JR6 A;  5B6M A;  3BOA A;  1TTZ A;  3GL5 A;  3L78 A;  1WP0 A;  5B8A A;  1FVJ A;  1ERU A;  5E4W A;  2C0E A;  4EKZ A;  4MF6 A;  2BJX A;  3P8W A;  1OKT A;  10GS A;  1PN9 A;  3FMW A;  3C8E A;  3ZZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...