4TR1A

Crystal structure of gsh-bound cgrx2/c15s
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
91
Chain Sequence
MKNITIYTKNYCPYSKKAVSLLSSKGVDFKEVDVTHDSKAFEDVMAKTGWDTVPQVFVDEEFLGGDDIHALDRQGILDKKLGLKLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin 3
publication title The GSH- and GSSG-bound structures of glutaredoxin from Clostridium oremlandii.
pubmed doi rcsb
source organism Alkaliphilus oremlandii
total genus 27
structure length 91
sequence length 92
ec nomenclature
pdb deposition date 2014-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tr1A00
1URMA 5G2ZA 1OKTA 5KN2A 2FA8A 4ML6A 3ZRDA 1GSQA 3EE2A 1ZGNA 2FNOA 1SL2B 4MF6A 4L0UA 4IJIA 3Q18A 3GH6A 3TRPA 3K8NA 4PGTA 5ECLB 2A2SA 2VAFA 1BYEA 4NPBA 5HR2A 4V1Ap 1THXA 5ECQB 3NZNA 1TRUA 4IS0A 3F4SA 3C1SA 4ECJA 2IN3A 3GTUB 4MCUA 2GVPA 2H8LA 5ECOB 2JSYA 4EDYA 2AB6A 2CX3A 2IJYA 5D9TA 1OE8A 1OC9B 4GCIA 4RQXA 2JZRA 4KE3A 4JBBA 2L6CA 4XRDA 5A4VA 1PGTA 2C3NA 11GSA 1QFNA 3LYPA 5KEJA 4KA0A 1PN9A 4EC0A 2QKEA 3VWVA 2CVBA 3TB2A 3MWHA 4EL1A 3CSHA 5DAKA 1EOHA 3VPTA 2VOCA 3WT2A 4V2MA 1ERWA 3CSJA 3ZREA 2H71A 2VCVA 4LA1A 4MZBA 5F0GA 1Z7PA 5J9BA 2VUPA 2VM2A 3MDKA 4PX1A 4WF4A 5ECHB 6GSYA 2QC7A 2I3YA 3ZZXA 3ZIVA 1ERUA 3A2XA 1PA3A 4MMMA 2LTKA 2NPBA 2GSRA 1GLPA 3FHKA 2EC4A 4Q5NA 3O76A 2HYXA 3LWAA 2H76A 2WGRA 5J9CA 2LJAA 1B8XA 4JZQA 4K2DA 1GLQA 3QAGA 4EKZA 2V6KA 1YF0A 2PGTA 3KTLA 1A2MA 5DJLA 4PQIA 1ZZYA 1FOVA 2OBIA 3MAKA 3DWVA 1SJ6A 1V98A 3QAWA 1TRVA 2KLXA 2VL3A 4XCSA 3HVXA 3Q6OA 3KM6A 2N5FA 3D4TA 3KP9A 2HI7A 3J7Yk 2B5EA 1U6TA 2P0GA 2NVLA 1TP9A 1JZOA 2WRTA 1SD9A 4MF7A 2EIRA 3GRXA 4GTUA 1M2AA 1TOFA 4RUVA 2DJ2A 2M80A 5HFGA 4XRAA 1MTCA 2CQ9A 1XXUA 3GKXA 2PN8A 2L59A 1Z7RA 2HRFA 3VLNA 1SU9A 2PVOC 4O32A 3F6FA 5H5QA 3WGXA 3QAVA 3ME8A 1ZYEA 2NDOA 2AV4A 4JEDA 4ZBDA 4K0NA 2I81A 4KDXA 3TDGA 3NIVA 4IELA 2FD3A 1DE1A 4Z7XA 3L9SA 2WULA 1NM3A 3CBUA 1GSDA 3GSTA 2FWFA 3UMAA 2GGTA 2CAIA 2GSTA 1TI3A 20GSA 2HSYA 1CQHA 2B6MA 3VPQA 3TJJA 2PUKC 3VWUA 1HQOA 5G5FA 1SYXA 5DALA 1AQXA 1X5DA 1YKCA 4GSNA 1R5AA 4KSOA 4X43A 5DAKB 1XOBA 2HNLA 1ILOA 4EVMA 4XS6A 3IRAA 2H75A 2B1LA 4FYCA 3IR4A 3D0ZA 2KP1A 3UEMA 1EV4A 2MMOA 2GQLA 1XVWA 3D22A 1F9MA 4WR4A 2HZEB 3WYWA 4KB3A 3DD3A 5CP1A 1ZYQB 5LCZA 3HDCA 2L4CA 3LYKA 5LD0A 1TU8A 4F0CA 6GSWA 3FZAA 1K0AA 3QR6A 1HNCA 2JU5A 2KUCA 1B4QA 1Z6NA 2FWEA 4E8HA 3M9KA 1HNAA 4I5QA 3EMPA 4KNDA 3ZVJD 3F4TA 2FLSA 5G5EA 2CX4A 4EUYA 1GTAA 3HZ8A 1O8WA 1VF1A 3QD9A 3TOUA 2N5AA 5D9XA 1EWXA 3MNGA 4NV5A 3CRUA 1XCCA 1TTZA 4F82A 5ABRA 3UJ1A 2MZCA 4ML1A 5CRDA 2J23A 1PSQA 3KTBA 3DYRA 5CRHA 2H70A 2P31A 3DRNA 2FHEA 4K0GA 5F05A 1PL2A 3HJOA 2GQMA 1SKSB 1SL0B 2WDUA 4NV2A 1A8YA 6GSSA 1F3AA 5EY6A 4TKYA 4IP6A 1Z9HA 3UOMA 1EP7A 4QQ7A 4ECIA 3HZ4A 2R5GA 2R3XA 3L9UA 3TUEA 4HQZA 13GSA 3LEFA 5G30A 5ECPB 4WF5A 2BTOT 5ECKB 4IBPA 10GSA 3H4KA 5ENUA 3HD5A 1GL8A 1JFUA 1DSBA 1YDKA 2M46A 2C0DA 1Z6MA 1M99A 4IGJA 4TW5A 2DC5A 2CAQA 1W4VA 4DSSA 2X8CA 1A0RP 4NWYA 3A2VA 2YNXA 1V2AA 4ECBA 2OE1A 2OJLA 1HNBA 3KGKA 3J7Yb 3EMXA 5GSSA 4ISDA 5E59A 4N30A 3G7IA 1A2JA 2VD0A 1SJIA 1QQ2A 1C72A 3KH9A 3RAZA 2B1KA 2V2GA 4MLYA 4BA7A 2H1GA 5CAXA 1K3LA 5B8AA 4EO3A 5AN1A 1XWBA 4H86A 3FKFA 4I2UA 4AJ8A 2YWOA 2HT9A 4BWQA 5B6NA 4HU7A 2OKAA 3L9VA 3ED3A 4NMUA 2LRCA 4Q5QA 3TJGA 1R4WA 2H6YA 4X0XA 3ZLPA 1YY7A 4MK3A 1RK4A 5ECSA 1YKAA 3MSZA 2E2MA 2V1MA 3TKQA 3DMLA 3HA9A 3IPZA 4MABA 3LG6A 4OCEA 2GZZA 5AISA 1KBNA 1TDIA 5INYA 3E3EA 4Q5FA 4IW9A 4V2LA 1PD21 5EPFA 3ZVJA 2GLRA 6GSXA 4EE0A 1K0CA 1XBSA 1PRXA 1QGVA 3IA1A 4HI7A 1XOAA 2FUG2 5IO0A 1B4PA 1M0UA 2LV3A 1XW6A 4MP4A 1YEXA 3TKSE 4ZBBA 5CRWA 1YJ6A 3IAS2 2MYGA 4YQVA 1XVQA 3F63A 2OBKA 3GUSA 1XPVA 4POKA 3CTFA 5J4UA 1N2AA 1GUMA 2K8VA 4FIWA 12GSA 2LNSA 1SK2A 4ZL8A 3LORA 1O85A 4OO5A 2DJKA 1VF4A 3D6IA 3ZIJA 4D73A 1B9XC 3CYNA 4WETA 2PMTA 1R7HA 5IMFA 3GKKA 3GL5A 1LBKA 2I4AA 5D8IA 1F2EA 3QFAC 1SK1A 2B5YA 1N8JA 2K9FA 3D21A 2YZUA 1EZKA 3GL3A 2E2GA 3ZTLA 1QK8A 3GKMA 2LJRA 4ACSA 2V41A 5HR0A 2LS5A 1O73A 3RHCA 3KH7A 3EYTA 3DIEA 4CHSA 2CVDA 5IMDA 1AQVA 3UARA 4OFNA 2IMFA 2OACA 5IM9A 1TKDB 5EVOA 4IN0A 2YZHA 1AC1A 1S3CA 2H73A 5IMZA 2ON5A 3LSZA 1XWGA 4EXJA 2H1AA 4IQAA 1TU7A 4G9HA 3FRCA 4YQMA 4TR0A 1SK0A 1AW9A 3KD0A 2NBSA 1AAZA 4ZL7A 1T7PB 1BQ7A 2LJKA 3L78A 1TK5B 2F8FA 3ZMKA 2JACA 4YAVA 2YANA 5DBQA 2YOIA 5B7CA 2LUSA 5IO2A 3ISOA 5AGYA 1HD2A 3M1GA 4TR4A 4KUNA 2AAWA 4PUAA 4IKHA 4EF0A 1X9MB 2Z9SA 5CREA 2YWIA 4XHMA 1JZWA 4TRXA 3LQ7A 2VO4A 4HZ4A 4JR6A 3IXRA 5HFKA 3GMFA 1GSUA 3EU4A 3UVTA 4F2IA 1IYIA 2J9HA 3FR6A 1GSSA 3I43A 5E4WA 2PWJA 3CXGA 3ME7A 1SKRB 2FCHA 1B9YC 3LXTA 6GSUA 4XS4B 5ID2A 4TXOB 5G1LA 4HEA2 3KP8A 3M9JA 4KH7A 4ULXA 3IBHA 2IPAA 1ZL9A 2TRCP 2HRNA 2JZSA 3HVVA 4MH2A 3EU3A 1ZOFA 2HZFA 3FY7A 2XBIA 2LRTA 1AXDA 3KEBA 5IMCA 3DKSA 1QXHA 2IMEA 3M8NA 4F03A 4AJ7A 2QSIA 3F4RA 4MA9A 1GULA 2R4VA 4I8BA 5F06A 1OKDA 2H6XA 1Q4JA 4ID0A 3GKNA 1LU4A 4G10A 2L57A 2GS3A 4TR1B 5IOWA 4MH3A 3RDWA 1G6YA 3I69A 1V9WA 2OE0A 3PINA 3ZMLA 4BVXA 5DDLA 1K3YA 3CMIA 3F0IA 2GSQA 2MBSA 1K0DA 1O6JA 3D4MA 3IAM2 2B5XA 5FWGA 1I5GA 5D93A 1GUHA 3FZ5A 3GX0A 2H19A 3E0UA 1KTEA 4FYBA 4KAEA 3EURA 1SD8A 2MMAA 3UBLA 3A5WA 4ZB8A 5DVBA 4TVEA 3VFIA 4PNFA 2FA4A 2GQKA 4J57E 2CT6A 2X8GA 3D5JA 5JCWA 5A5KA 4ILFA 2DJ1A 3QPMA 4F9ZA 2F9SA 2YP6A 3HKRA 1ST9A 2PBJA 4NHWA 2B7JA 1TI1A 2YJHA 5GSTA 1WWJA 5KN1A 1XWKA 2A4VA 2H1BA 1MEKA 3BJ5A 2ALBA 5FHIA 2F8AA 1PL1A 1MDJA 3RHBA 3FK8A 1ABAA 3VWXA 2LQOA 4K8MA 1QMVA 1XFLA 2L4QA 5DQYA 3TCOA 2VM1A 3FZ4A 3C71A 1W89A 1EP8A 1VF3A 4HU9A 2VL2A 3FR3A 2XC2A 1TJDA 3ZYWA 3KMOA 2GSSA 3G7YA 3NOFA 3KJYA 2WFCA 3TOTA 1Y6EA 1XZOA 2H0HA 3FYGA 4OO4A 2V6OA 2VL2C 1SKWB 3GA4A 4GRFA 3IE3A 2HXKA 3TJFA 5ECRB 4KCAA 4O5RA 2L5OA 4AJ6A 1R5PA 1FW1A 3FEUA 1PX6A 5ELAA 1M9AA 4ECCA 1GP1A 1ZMAA 2B7KA 2JZTA 4N10A 5DCHA 4HUAA 5HQPA 1TXXA 2XBQA 1T4ZA 3TRQA 2H66A 4OWYA 2CZ3A 1JZRA 2IFQA 2PPTA 3IHQA 3ZITA 3PR8A 1USBA 3FW2A 1UC7A 4J56E 5HR1A 3TKSC 2VL9A 4DVCA 4FYUA 4ZB9A 3EWLA 4HJ2A 1ERVA 5L71A 2FWGA 3APSA 3EINA 1GNEA 3SWLA 2RUFA 4MZCA 3KXOA 5CO3A 1MD3A 2I1UA 4HJMA 2IWTA 1GWCA 2YN1A 4MPGA 1JHBA 3HVSA 5CNWA 4X1UA 1TW9A 1LJRA 2VD1A 4DSQA 2R37A 3WD6A 4KGIA 4GLTA 1K0BA 4FO5A 1OAZA 2WJUA 4RI7A 3CRTA 1JLVA 2O89A 2HLSA 2O85A 3JCML 2YJ7A 1PKZA 5CRGA 2RM6A 1X0RA 4K7IA 4MJBA 2C3TA 4JE1A 5ECIB 1NHYA 2YPMA 3DVXA 1GUKA 3GTUA 5F8BA 1SYRA 1JLWA 3Q74A 1M7TA 2N5BA 4IQ1A 1V40A 3BOAA 4L0WA 1OC9A 2CZ2A 2AHEA 4MJEA 5JCUA 5D9WA 5C04A 3KZQA 5DALB 2DSAA 2EIQA 2VCTA 1FHEA 2YWNA 2LQQA 5HFIA 3UIWA 2P5RA 5B8BA 1OC3A 3DXBA 1ON4A 3FR9A 2O87A 5JWOB 2VLTA 4F0BA 4XTSA 1U88A 1OE7A 2IIYA 2VCWA 1GRXA 4TR3A 3GFKA 3QCPA 4TN8A 3C1RA 3S9FA 3TJBA 3TGZA 5D9VA 3I6AA 3DEXA 3H8QA 3RPNA 3US3A 2PU9C 2GZPA 2PERA 3HJPA 1XWAA 4ZXGA 2VCXA 5LNKe 5IQYA 1THOA 5DCGA 1Q98A 1A23A 6GSTA 1RQMA 4TOPA 5JWRB 4KX4A 2GDRA 4L8EA 3BCKA 2VLUA 4RQRA 2IL3A 2XPEA 3LJRA 4GXZA 2E7PA 1EOGA 4L5OA 5KN3A 1MDKA 1NHOA 3A2WA 2YCDA 3F3RA 1K0NA 1AIUA 4GF0A 3HJMA 16GSA 5H5SA 4TXVA 1J0FA 4NAXA 4ZBAA 4N11A 4BL7A 2ZUPA 1GSFA 4G2EA 4PXOA 2FY6A 3V1WA 1J08A 1EGOA 3GHAA 2DIYA 2CVKA 2MMNA 3O6TA 4N0ZA 5CYYA 4KSMA 2VIMA 2EIOA 9GSSA 4PQ1A 5AIXA 4YAPA 1GSEA 2YV7A 1U3AA 3PH9A 1A24A 4XS1A 1T00A 3F8UA 1WPIA 2C0GA 3GURA 5J3RA 1X5EA 3ZFLA 4BVYA 3EVIA 4POMA 5C00A 2OADA 3M0FA 1H4OA 5GZZB 1SL1B 1AQWA 4DSSB 2YWMA 1T4YA 1YQ1A 4GWRA 5DJMA 7GSSA 1UVZA 3E9JB 4MJAA 2H0GA 4WKWA 2ZNMA 4LL4B 4N0VA 2H6ZA 3KMNA 4YH2A 5IMAA 1ZCPA 3VK9A 2K6VA 2ES7A 4GQCA 1K0MA 2BJXA 4MPFA 1KNGA 5A4WA 3C8EA 2H1DA 4PNGA 2IMKA 4K1FA 1IYHA 1O81A 2H0IA 5D96A 3HHVA 3H93A 3L4NA 4IP1A 4DEJA 3IV4A 1T1VA 2AUVA 2RIIA 3F6DA 1YZXA 2DMMA 4HZ2A 5GAND 3BBYA 3CTGA 2GT5A 3P8WA 2MBTA 3HY2A 3VI5A 2O7KA 2IMDA 4OFTA 3IOSA 1X9SB 1GH2A 1FB6A 2REMA 2HZEA 3IK9A 1BG5A 2VLVA 3DVWA 4IHUA 5G1KA 3UVHA 4KCEA 3BCIA 2MMZA 1A8LA 2YV9A 1OYJA 5D73A 2R6KA 4PQHA 4NHZA 1DE2A 4BPYA 1K0OA 2GZYA 3F9UA 1GTUA 4KW6A 3W6GA 2F3MA 2ON7A 4D73B 4ZL9A 4OD7A 1DBYA 2KP2A 2X99A 1OC8A 3CSIA 2IMIA 2WS2A 1UN2A 4I6XA 3U5RE 1O7UA 1DUGA 1PMTA 3VURA 5ECNB 3ERFA 4XIHA 4MF5A 2OA7A 2X64A 4WXTA 1OVNA 2LNTA 4YQUA 2D2ZA 2XPDA 2XHFA 1GTIA 6GSVA 1MD4A 1NW2A 4NXIA 2L5LA 2VCQA 4KDUA 1HYUA 3WGDA 4I97A 1ML6A 4HDEA 1E2YA 1F6MC 4QL7A 4PUFC 3M3MA 1YF1A 2C80A 5JCGA 2HE3A 4HQSA 3TKPA 4K9ZA 1Z5YE 3C73A 3U6VA 1SJZA 18GSA 3IC4A 3P2AA 5G31A 3VWWA 3O3TA 1YEPA 1G0TA 2C4JA 3BD2A 2FWHA 5J41A 8GSSA 3UL3A 4POLA 3P90A 4HS1A 3Q19A 1WOUA 1M2DA 4AGSA 4LLRA 2G2QA 14GSA 2C0EA 5H5RA 4JU5A 3W8JA 3W8SA 3RPPA 1R26A 5J5NA 1WMJA 2A2RA 3KIJA 1RW1A 2LRNA 4HOJA 1K3OA 2BMXA 3GV1A 3QMXA 4Q5RA 1E6BA 1XWCA 3LXZA 1F3BA 3HXSA 2B3SA 4O92A 1TRWA 2V32A 5ID2B 22GSA 2DMLA 1BEDA 4WEYA 3TRXA 4CW9A 2AYTA 4GSTA 5IPHA 3OR5A 2DJ0A 17GSA 2RLIA 4WR5A 4OCFA 3TKSA 3PGTA 1WRYA 4MDCA 1ERTA 2P5QA 4CDOA 5IIZA 1EV9A 4JRRA 4GSSA 3VI7A 3N9JA 1A0FA 2TRXA 4POBA 3ZFBA 1KEBA 5F07A 4ZILA 1GTBA 1CQGA 4LMWA 1VRSD 1MDIA 3QFBC 1V58A 2HFDA 1FAAA 2O8VB 2JSZA 1M9BA 4V2NA 4AF2A 1S3AA 2WB9A 3IK7A 4LMVA 3GNJA 2LEGA 4FH8A 1Z3EA 4DSRA 4RI6A 1S3DA 1FO5A 1T3BA 2R2JA 3GIXA 3KCMA 1AUCA 1I9DA 2DBCA 4OFMA 1M2BA 3QOUA 1FVKA 5JWQB 2L6DA 3L0HA 1G7OA 3GYKA 2E0QA 3EC3A 1U87A 4MZWA 1O8XA 1TRSA 1WJKA 3LFLA 2C1YA 3ZL5A 3GN3A 5B6MA 2C0FA 2NTOA 4K6XA 4L5LA 1BX9A 3I9V2 3FZ9A 1G6WA 2M72A 3TJKA 3GX8A 1U3IA 5GAPD 4K7NA 4E8EA 1JZDA 2RUEA 1X5CA 1VGLA 5ELGA 2H72A 3TKRA 1FG4A 1EEJA 3WGEA 2DLXA 5DQSA 4JR4A 4ZIJA 2KHPA 3H79A 1WIKA 2GT6A 2WZ9A 3APQA 2GTUA 1TK0B 5EL8A 3G7JA 5IPGA 1G7EA 1A2LA 2FGXA 4J2FA 1NSWA 2CA8A 3IDVA 2RM5A 3GSSA 3LGCA 1BAYA 2H01A 2ZCTA 2H30A 2I9HA 4IJ3A 5KN0A 4I2TA 1PQNA 3DGQA 1WP0A 1SENA 3QDNA 3H1NA 1PX7A 1EEMA 2WCIA 1XIYA 1TK8B 4PURA 4KDYA 1ACVA 5AIVA 4BWSA 1GNWA 2JADA 1F37A 2H74A 4V1Ag 3WT1A 4GQFA 3ERGA 3UAPA 2DJ3A 5IMVA 3RBTA 1EGRA 4WBJA 4EDZA 2HSHA 2TIRA 1B48A 3G9BA 5COHA 1H75A 2PVQA 4QL9A 3R2QA 3AY8A 2X8HA 4P3YB 1VF2A 2JL4A 4O7HA 2QGVA 4K7OA 4XS4A 5FT3A 2G0FA 4TXOA 1J9BA 3SBCA 1X9WB 2CV4A 2IFQB 1XW5A 2VCZA 5HR3A 3P7XA 1QUWA 2DIZA 1Y25A 3APOA 1GSYA 3N5OA 3ERWA 5IOXA 4G19A 1UA5A 3HYPA 2F51A 19GSA 3C7MA 1FVJA 2KOKA 1WE0A 3A3TA 4OMVA 1T8EB 2OE3A 4LL1B 2LSTA 2C3QA 4WBRD 3F3QA 2DJJA 3UBKA 4MJCA 5ECMB 1PKWA 1V57A 2K8SA 4TR1A 3HCZA 1BJXA 2C8UA 2AJQB 2LKUA 3GH9A 1XW9A 5A4UA 1FB0A 4IVFA 4ZB6A 2K18A
chains in the Genus database with same CATH superfamily
1URMA 5G2ZA 1OKTA 5KN2A 2FA8A 4ML6A 3ZRDA 1GSQA 3EE2A 1ZGNA 2FNOA 1SL2B 4MF6A 4L0UA 4IJIA 3Q18A 3GH6A 3TRPA 3K8NA 4PGTA 5ECLB 2A2SA 2VAFA 1BYEA 3EPTA 4NPBA 5HR2A 4V1Ap 1THXA 5ECQB 3NZNA 1TRUA 4IS0A 3F4SA 3C1SA 4ECJA 2IN3A 3GTUB 4MCUA 2GVPA 2H8LA 5ECOB 2JSYA 4EDYA 2AB6A 2CX3A 2IJYA 5D9TA 1OE8A 1OC9B 4GCIA 4RQXA 2JZRA 4KE3A 4JBBA 2L6CA 4XRDA 5A4VA 1PGTA 2C3NA 11GSA 1QFNA 3LYPA 5KEJA 4KA0A 1PN9A 4EC0A 2QKEA 3VWVA 2CVBA 3TB2A 3MWHA 4EL1A 3CSHA 5DAKA 1EOHA 3VPTA 2VOCA 3IHGA 3WT2A 4V2MA 1ERWA 3CSJA 3ZREA 2H71A 2VCVA 4LA1A 4MZBA 5F0GA 1Z7PA 5J9BA 2VUPA 2VM2A 3MDKA 4PX1A 4WF4A 5ECHB 6GSYA 2QC7A 2I3YA 4YKGA 3ZZXA 3ZIVA 1ERUA 3A2XA 1PA3A 4MMMA 2LTKA 2NPBA 2GSRA 1GLPA 3FHKA 2EC4A 4Q5NA 3O76A 2HYXA 3LWAA 2H76A 2WGRA 5J9CA 3A5IA 2LJAA 1B8XA 4JZQA 4K2DA 1GLQA 3QAGA 4EKZA 2V6KA 1YF0A 2PGTA 3KTLA 1A2MA 5DJLA 4PQIA 1ZZYA 1FOVA 3MYDA 2OBIA 4BL7B 3MAKA 3DWVA 1SJ6A 1V98A 3QAWA 1TRVA 2KLXA 2VL3A 4XCSA 3HVXA 3Q6OA 3KM6A 2N5FA 3D4TA 3KP9A 2HI7A 3J7Yk 2B5EA 1U6TA 2P0GA 2NVLA 1TP9A 2R0GA 4USSA 1JZOA 2WRTA 1SD9A 4MF7A 2EIRA 3GRXA 4GTUA 1M2AA 1TOFA 4RUVA 2DJ2A 4G0LA 2M80A 5HFGA 4XRAA 1MTCA 2CQ9A 1XXUA 3GKXA 2PN8A 2L59A 1Z7RA 4BVYB 2HRFA 3VLNA 1SU9A 2PVOC 4O32A 3F6FA 5H5QA 3WGXA 3QAVA 3ME8A 1ZYEA 2NDOA 2AV4A 4JEDA 4ZBDA 4K0NA 2I81A 4KDXA 3TDGA 3NIVA 4IELA 2FD3A 1DE1A 4EIQA 4Z7XA 1ZYPA 3L9SA 2WULA 2X49A 1NM3A 3CBUA 4K2XA 1GSDA 3GSTA 4MNNA 2FWFA 3UMAA 2GGTA 2CAIA 2DKHA 1M3JA 1TI3A 20GSA 2GSTA 2HSYA 1CQHA 2B6MA 3VPQA 3TJJA 2PUKC 3VWUA 4KF9A 1HQOA 3PPUA 5G5FA 1SYXA 5DALA 1AQXA 1X5DA 1YKCA 4GSNA 1R5AA 4KSOA 4X43A 5DAKB 1XOBA 2HNLA 1ILOA 4EVMA 4XS6A 3IRAA 2H75A 2B1LA 4FYCA 3IR4A 3D0ZA 2KP1A 3UEMA 1EV4A 2MMOA 2GQLA 1XVWA 3D22A 1F9MA 4WR4A 2HZEB 3WYWA 4KB3A 3DD3A 5CP1A 1ZYQB 5LCZA 3HDCA 2L4CA 3LYKA 5LD0A 1TU8A 4F0CA 6GSWA 3FZAA 1K0AA 3QR6A 1HNCA 2JU5A 2KUCA 1B4QA 1Z6NA 2FWEA 4E8HA 3M9KA 1HNAA 4I5QA 3EMPA 4KNDA 3ZVJD 3F4TA 2FLSA 5G5EA 2CX4A 4EUYA 1GTAA 3HZ8A 1O8WA 1VF1A 3QD9A 3TOUA 2N5AA 5D9XA 1EWXA 3MNGA 4NV5A 3CRUA 1XCCA 1TTZA 4F82A 5ABRA 3UJ1A 2MZCA 4ML1A 5CRDA 2J23A 1PSQA 3KTBA 3DYRA 5CRHA 2H70A 2P31A 3DRNA 2FHEA 4K0GA 5F05A 1PL2A 3HJOA 2GQMA 1SKSB 1SL0B 2WDUA 4NV2A 1A8YA 6GSSA 1F3AA 5EY6A 4TKYA 4IP6A 1Z9HA 3UOMA 1EP7A 4QQ7A 4ECIA 3HZ4A 2R5GA 2R3XA 3L9UA 3TUEA 4HQZA 13GSA 3LEFA 5G30A 5ECPB 4WF5A 2BTOT 5ECKB 4IBPA 10GSA 3H4KA 5ENUA 3HD5A 1GL8A 1JFUA 1DSBA 1YDKA 2M46A 2C0DA 3HVNA 1Z6MA 1M99A 4IGJA 4TW5A 3FMWA 2DC5A 4HSCX 2CAQA 1W4VA 4DSSA 2X8CA 1A0RP 4NWYA 3A2VA 2YNXA 1V2AA 4ECBA 2OE1A 2OJLA 1HNBA 3KGKA 3J7Yb 3EMXA 5GSSA 4ISDA 2QA1A 5E59A 4N30A 3G7IA 1A2JA 2VD0A 4FQUA 1SJIA 1QQ2A 1C72A 3KH9A 3RAZA 2B1KA 2V2GA 4MLYA 4BA7A 2H1GA 5CAXA 1K3LA 5B8AA 4EO3A 5AN1A 1XWBA 4H86A 3FKFA 4I2UA 4AJ8A 2YWOA 2HT9A 4BWQA 5B6NA 4HU7A 2OKAA 3L9VA 3ED3A 4NMUA 2LRCA 4Q5QA 3TJGA 1R4WA 2H6YA 4X0XA 3ZLPA 1YY7A 4MK3A 1RK4A 5ECSA 1YKAA 3MSZA 2E2MA 2V1MA 3TKQA 3DMLA 3HA9A 3IPZA 4MABA 3LG6A 4OCEA 2GZZA 5AISA 1KBNA 1TDIA 5INYA 3E3EA 4Q5FA 4IW9A 4V2LA 1PD21 5EPFA 3ZVJA 2GLRA 6GSXA 4EE0A 1K0CA 1XBSA 1PRXA 1QGVA 3IA1A 4HI7A 1XOAA 2FUG2 5IO0A 1B4PA 1M0UA 2LV3A 1XW6A 4MP4A 1YEXA 4CY6A 3TKSE 4ZBBA 5CRWA 1YJ6A 3IAS2 2MYGA 4YQVA 1XVQA 3F63A 2OBKA 3GUSA 1XPVA 4POKA 3CTFA 5J4UA 1N2AA 1GUMA 2K8VA 4FIWA 12GSA 2LNSA 1SK2A 4ZL8A 3LORA 1O85A 4OO5A 2DJKA 1VF4A 3D6IA 3ZIJA 4D73A 1B9XC 3CYNA 4WETA 2PMTA 1R7HA 5IMFA 3GKKA 3GL5A 1LBKA 2I4AA 5D8IA 1F2EA 3QFAC 1SK1A 2B5YA 1N8JA 2K9FA 3D21A 2YZUA 1EZKA 3GL3A 2E2GA 3ZTLA 1QK8A 3GKMA 2LJRA 4ACSA 2V41A 5HR0A 2LS5A 1O73A 3RHCA 3KH7A 3EYTA 3DIEA 4CHSA 2CVDA 5IMDA 1AQVA 3UARA 4OFNA 2IMFA 2OACA 5IM9A 1TKDB 5EVOA 4IN0A 2YZHA 2QA2A 1AC1A 1S3CA 2H73A 5IMZA 2ON5A 3LSZA 1XWGA 4EXJA 2H1AA 4IQAA 1TU7A 4G9HA 3FRCA 4YQMA 4TR0A 1SK0A 1AW9A 3KD0A 2NBSA 1AAZA 4ZL7A 1T7PB 1BQ7A 2LJKA 3L78A 1TK5B 2F8FA 3ZMKA 2JACA 4YAVA 2YANA 5DBQA 2YOIA 5B7CA 2LUSA 5IO2A 3ISOA 5AGYA 1HD2A 3M1GA 4TR4A 4KUNA 2AAWA 4PUAA 4IKHA 4EF0A 1X9MB 4CY8A 2Z9SA 5CREA 2YWIA 4XHMA 1JZWA 4TRXA 3LQ7A 2VO4A 4HZ4A 4JR6A 3IXRA 5HFKA 3GMFA 1GSUA 3EU4A 3UVTA 4F2IA 1IYIA 2J9HA 3FR6A 1GSSA 3I43A 5E4WA 2PWJA 3CXGA 3ME7A 1SKRB 2FCHA 1B9YC 3LXTA 6GSUA 4XS4B 5ID2A 4TXOB 5G1LA 4HEA2 3KP8A 3M9JA 4KH7A 4ULXA 3IBHA 2IPAA 1ZL9A 2TRCP 2HRNA 2JZSA 3HVVA 4MH2A 3EU3A 1ZOFA 2HZFA 3FY7A 2XBIA 2LRTA 1S3RA 1AXDA 3KEBA 5IMCA 3DKSA 1QXHA 2IMEA 3M8NA 4F03A 4AJ7A 2QSIA 3F4RA 4MA9A 1GULA 2R4VA 4I8BA 5F06A 1OKDA 2H6XA 1Q4JA 4ICYA 4ID0A 3GKNA 1LU4A 4G10A 2L57A 2GS3A 4TR1B 5IOWA 4MH3A 3RDWA 1G6YA 3I69A 1V9WA 2OE0A 3PINA 3ZMLA 4BVXA 5DDLA 1K3YA 3CMIA 3F0IA 2GSQA 2MBSA 1K0DA 1O6JA 3D4MA 3IAM2 2B5XA 5FWGA 1I5GA 5D93A 1GUHA 2A2PA 3FZ5A 3GX0A 2H19A 3E0UA 1KTEA 4FYBA 4KAEA 3EURA 1SD8A 2MMAA 3UBLA 3A5WA 4ZB8A 5DVBA 4TVEA 3VFIA 4PNFA 2FA4A 2GQKA 4J57E 4YKFA 2CT6A 2X8GA 3D5JA 5JCWA 5A5KA 4ILFA 2DJ1A 3QPMA 4F9ZA 2F9SA 2YP6A 3HKRA 4Z2RA 1ST9A 2PBJA 4NHWA 2B7JA 1TI1A 2YJHA 5GSTA 1WWJA 5KN1A 1XWKA 2A4VA 2H1BA 1MEKA 3BJ5A 2ALBA 5FHIA 2F8AA 1PL1A 1MDJA 3RHBA 3FK8A 1ABAA 3VWXA 2LQOA 4K8MA 1QMVA 1XFLA 2L4QA 5DQYA 3TCOA 2VM1A 3FZ4A 3C71A 1W89A 1EP8A 1VF3A 4HU9A 2VL2A 3FR3A 2XC2A 1TJDA 4G0KA 3ZYWA 3KMOA 2GSSA 3G7YA 3NOFA 3KJYA 2WFCA 3TOTA 1Y6EA 1XZOA 2H0HA 3FYGA 4OO4A 2V6OA 2VL2C 1SKWB 3GA4A 4GRFA 3IE3A 1XG8A 2HXKA 3TJFA 5ECRB 4BIKA 4KCAA 4O5RA 2L5OA 4AJ6A 1R5PA 1FW1A 3FEUA 1PX6A 5ELAA 1M9AA 4ECCA 1GP1A 5KOWA 1ZMAA 2B7KA 2JZTA 4N10A 5DCHA 4HUAA 5HQPA 1TXXA 2XBQA 1T4ZA 3TRQA 2H66A 4OWYA 2CZ3A 1JZRA 2IFQA 2PPTA 3IHQA 3ZITA 3PR8A 1USBA 3FW2A 1ZYNA 1UC7A 3LW9A 4J56E 5HR1A 3TKSC 2VL9A 4DVCA 4FYUA 4ZB9A 3EWLA 4HJ2A 1ERVA 5L71A 2FWGA 3APSA 3EINA 3IC8A 1GNEA 3SWLA 2RUFA 4MZCA 3KXOA 5CO3A 1MD3A 2I1UA 4HJMA 2IWTA 1PN0A 1GWCA 2YN1A 4MPGA 1JHBA 3HVSA 5CNWA 4X1UA 1TW9A 1LJRA 2VD1A 4DSQA 2R37A 3WD6A 4KGIA 4GLTA 1K0BA 4FO5A 1OAZA 2WJUA 4RI7A 3CRTA 1JLVA 2O89A 2HLSA 2O85A 3JCML 2YJ7A 1PKZA 5CRGA 2RM6A 1X0RA 4K7IA 1M3IA 4MJBA 2C3TA 4JE1A 2DKIA 5ECIB 1NHYA 2YPMA 3DVXA 1GUKA 3GTUA 5F8BA 1SYRA 1JLWA 3Q74A 1M7TA 2N5BA 4IQ1A 1V40A 3BOAA 1FOHA 4L0WA 1OC9A 2CZ2A 2AHEA 4MJEA 5JCUA 5D9WA 5C04A 3KZQA 5DALB 2DSAA 2EIQA 2VCTA 1FHEA 2YWNA 2LQQA 5HFIA 3UIWA 2P5RA 5B8BA 1OC3A 3DXBA 1ON4A 3FR9A 2O87A 5JWOB 2VLTA 4F0BA 4XTSA 1U88A 1OE7A 2IIYA 2VCWA 1GRXA 4TR3A 3GFKA 3QCPA 4TN8A 3C1RA 3S9FA 3TJBA 3TGZA 5D9VA 3I6AA 3DEXA 3H8QA 3RPNA 3US3A 2PU9C 2GZPA 2PERA 3HJPA 1XWAA 4ZXGA 2VCXA 5LNKe 5IQYA 1THOA 5DCGA 1Q98A 1A23A 6GSTA 1RQMA 4TOPA 5JWRB 4KX4A 2GDRA 4L8EA 3BCKA 2VLUA 2R0CA 4RQRA 4O5QA 2IL3A 2XPEA 3LJRA 4GXZA 2E7PA 1EOGA 4L5OA 5KN3A 1MDKA 1NHOA 3A2WA 2YCDA 3F3RA 1K0NA 1AIUA 4GF0A 3HJMA 16GSA 5H5SA 4TXVA 1J0FA 4NAXA 4ZBAA 4Z2UA 4N11A 4BL7A 2ZUPA 1GSFA 4G2EA 4EIPA 4PXOA 2FY6A 3V1WA 1J08A 1EGOA 3GHAA 2DIYA 2CVKA 2MMNA 3O6TA 4N0ZA 5CYYA 4KSMA 2VIMA 2EIOA 4X4JA 9GSSA 4PQ1A 5AIXA 4YAPA 1GSEA 2YV7A 1U3AA 3PH9A 1A24A 4XS1A 1T00A 3F8UA 1WPIA 2C0GA 3GURA 5J3RA 1X5EA 3ZFLA 4BVYA 3EVIA 4POMA 5C00A 2OADA 3M0FA 1H4OA 5GZZB 1SL1B 1AQWA 4DSSB 2YWMA 1T4YA 1YQ1A 4GWRA 5DJMA 7GSSA 1UVZA 3E9JB 4MJAA 2H0GA 4WKWA 2ZNMA 4LL4B 4N0VA 2H6ZA 3KMNA 4YH2A 5IMAA 1ZCPA 2HSMA 2X4AA 3VK9A 2K6VA 2ES7A 4GQCA 1K0MA 1PFOA 2BJXA 4MPFA 1KNGA 3R3EA 5A4WA 3C8EA 2H1DA 4PNGA 2IMKA 4K1FA 1IYHA 1O81A 2H0IA 5D96A 3HHVA 3H93A 3L4NA 4IP1A 4DEJA 3IV4A 1T1VA 4K5RA 2AUVA 2RIIA 3F6DA 1YZXA 2DMMA 4HZ2A 5GAND 3BBYA 3CTGA 2GT5A 3P8WA 2MBTA 3HY2A 3VI5A 2O7KA 2IMDA 4OFTA 3IOSA 1X9SB 1GH2A 1FB6A 2REMA 2HZEA 3IK9A 1BG5A 2VLVA 3DVWA 4IHUA 5G1KA 3UVHA 4KCEA 3BCIA 2MMZA 1A8LA 2YV9A 1OYJA 5D73A 2R6KA 4PQHA 4NHZA 1DE2A 4BPYA 1K0OA 2GZYA 3F9UA 1GTUA 4KW6A 3W6GA 2F3MA 2ON7A 4D73B 4ZL9A 4OD7A 1DBYA 2KP2A 2X99A 1OC8A 2A4HA 3CSIA 2IMIA 2WS2A 1UN2A 4I6XA 3U5RE 1O7UA 1DUGA 1PMTA 3VURA 5ECNB 3ERFA 4XIHA 4MF5A 2OA7A 2X64A 4WXTA 1OVNA 2LNTA 4YQUA 2D2ZA 2XPDA 2XHFA 1GTIA 6GSVA 1MD4A 1NW2A 4NXIA 3MIXA 2L5LA 2VCQA 4KDUA 1HYUA 3WGDA 4I97A 1ML6A 4HDEA 5KOXA 1E2YA 1F6MC 4QL7A 4PUFC 3M3MA 1YF1A 3CQFA 2C80A 5JCGA 2HE3A 4HQSA 3TKPA 4K9ZA 1Z5YE 3C73A 3U6VA 1SJZA 18GSA 3IC4A 3P2AA 5G31A 3VWWA 3O3TA 1YEPA 1G0TA 2C4JA 3BD2A 2FWHA 5J41A 4PTSA 8GSSA 3UL3A 4POLA 3P90A 4HS1A 3Q19A 1WOUA 1M2DA 4AGSA 4LLRA 2G2QA 14GSA 2C0EA 5H5RA 4JU5A 3W8JA 3W8SA 3RPPA 1R26A 5J5NA 1WMJA 2A2RA 3KIJA 1RW1A 2LRNA 4HOJA 1K3OA 2BMXA 3GV1A 3QMXA 4Q5RA 1E6BA 1XWCA 3LXZA 1F3BA 3HXSA 2B3SA 4O92A 1TRWA 2V32A 5ID2B 22GSA 2DMLA 1BEDA 4WEYA 3TRXA 4CW9A 2AYTA 4GSTA 5IPHA 3OR5A 2DJ0A 17GSA 2RLIA 4WR5A 4OCFA 3TKSA 3PGTA 1WRYA 2HRAA 4MDCA 1ERTA 2P5QA 4CDOA 5IIZA 1EV9A 4JRRA 4GSSA 3VI7A 3N9JA 1A0FA 2TRXA 4POBA 3ZFBA 1KEBA 5F07A 4ZILA 1GTBA 1CQGA 4LMWA 1VRSD 1MDIA 3QFBC 1V58A 2HFDA 1FAAA 2O8VB 2JSZA 1M9BA 4V2NA 4AF2A 1S3AA 2WB9A 3IK7A 4LMVA 3GNJA 2LEGA 4FH8A 1Z3EA 4DSRA 4RI6A 4BVXB 1S3DA 1FO5A 1T3BA 2R2JA 3GIXA 3KCMA 1AUCA 1I9DA 2DBCA 4OFMA 1M2BA 3QOUA 1FVKA 5JWQB 2L6DA 3L0HA 1G7OA 3GYKA 2E0QA 4Z2TA 3EC3A 1U87A 4MZWA 1O8XA 1TRSA 2UZ8A 1WJKA 3LFLA 2C1YA 3ZL5A 3GN3A 5B6MA 2C0FA 2NTOA 4K6XA 4L5LA 1BX9A 3I9V2 4K5SA 3FZ9A 1G6WA 2M72A 3TJKA 3GX8A 1U3IA 5GAPD 4K7NA 4E8EA 1JZDA 2RUEA 1X5CA 1VGLA 5ELGA 2H72A 3TKRA 1FG4A 1EEJA 3WGEA 2DLXA 5DQSA 4JR4A 4ZIJA 2KHPA 3H79A 1WIKA 2GT6A 2WZ9A 3APQA 5BRTA 2GTUA 1TK0B 5EL8A 3G7JA 5IPGA 1G7EA 1A2LA 2FGXA 4J2FA 1NSWA 2CA8A 3IDVA 2RM5A 3GSSA 3LGCA 1BAYA 2H01A 2ZCTA 2H30A 2I9HA 4IJ3A 5KN0A 4O5UA 4I2TA 1PQNA 3DGQA 1WP0A 1SENA 3QDNA 3H1NA 4G0IA 1PX7A 1EEMA 2WCIA 4A5PA 1XIYA 1TK8B 4PURA 4KDYA 1ACVA 5AIVA 4BWSA 1GNWA 2JADA 1F37A 2H74A 4V1Ag 3WT1A 4GQFA 3ERGA 3UAPA 2DJ3A 5IMVA 3RBTA 1EGRA 4WBJA 4EDZA 2HSHA 2TIRA 1B48A 3G9BA 5COHA 1H75A 2PVQA 4QL9A 3R2QA 3AY8A 2X8HA 4P3YB 1VF2A 2JL4A 4O7HA 2QGVA 4K7OA 4XS4A 5FT3A 2G0FA 4TXOA 1J9BA 3SBCA 1X9WB 2CV4A 2IFQB 1XW5A 2VCZA 5HR3A 3P7XA 1QUWA 2DIZA 1Y25A 3APOA 1GSYA 3N5OA 2HRKA 3ERWA 5IOXA 4G19A 1UA5A 3HYPA 2F51A 19GSA 3C7MA 1FVJA 2KOKA 1WE0A 3A3TA 4OMVA 1T8EB 5BMUA 2OE3A 4LL1B 2LSTA 2C3QA 4WBRD 3F3QA 2DJJA 3UBKA 4MJCA 5ECMB 2R0PA 1PKWA 1V57A 2K8SA 4TR1A 3HCZA 1BJXA 2C8UA 2AJQB 2LKUA 3GH9A 1XW9A 5A4UA 1FB0A 4IVFA 4ZB6A 2K18A
chains in the Genus database with same CATH topology
1URMA 5G2ZA 1OKTA 5KN2A 2FA8A 4ML6A 3ZRDA 1GSQA 3EE2A 1ZGNA 2FNOA 1SL2B 4MF6A 4L0UA 4IJIA 3Q18A 3GH6A 3TRPA 3K8NA 4PGTA 5ECLB 2A2SA 2VAFA 1BYEA 3EPTA 4NPBA 5HR2A 4V1Ap 1THXA 5ECQB 3NZNA 1TRUA 4IS0A 3F4SA 3C1SA 4ECJA 2IN3A 3GTUB 4MCUA 2GVPA 2H8LA 5ECOB 2JSYA 4EDYA 2AB6A 2CX3A 2IJYA 5D9TA 1OE8A 1OC9B 4GCIA 4RQXA 2JZRA 4KE3A 4JBBA 2L6CA 4XRDA 5A4VA 1PGTA 2C3NA 11GSA 1QFNA 3LYPA 5KEJA 4KA0A 1PN9A 4EC0A 2QKEA 3VWVA 2CVBA 3TB2A 3MWHA 4EL1A 3CSHA 5DAKA 1EOHA 3VPTA 2VOCA 3IHGA 3WT2A 4V2MA 1ERWA 3CSJA 3ZREA 2H71A 2VCVA 4LA1A 4MZBA 5F0GA 1Z7PA 5J9BA 2VUPA 2VM2A 3MDKA 4PX1A 4WF4A 5ECHB 6GSYA 2QC7A 2I3YA 4YKGA 3ZZXA 3ZIVA 1ERUA 3A2XA 1PA3A 4MMMA 2LTKA 2NPBA 2GSRA 1GLPA 3FHKA 2EC4A 4Q5NA 3O76A 2HYXA 3LWAA 2H76A 2WGRA 5J9CA 3A5IA 2LJAA 1B8XA 4JZQA 4K2DA 1GLQA 3QAGA 4EKZA 2V6KA 1YF0A 2PGTA 3KTLA 1A2MA 5DJLA 4PQIA 1ZZYA 1FOVA 3MYDA 2OBIA 4BL7B 3MAKA 3DWVA 1SJ6A 1V98A 3QAWA 1TRVA 2KLXA 2VL3A 4XCSA 3HVXA 3Q6OA 3KM6A 2N5FA 3D4TA 3KP9A 2HI7A 3J7Yk 2B5EA 1U6TA 2P0GA 2NVLA 1TP9A 2R0GA 4USSA 1JZOA 2WRTA 1SD9A 4MF7A 2EIRA 3GRXA 4GTUA 1M2AA 1TOFA 4RUVA 2DJ2A 4G0LA 2M80A 5HFGA 4XRAA 1MTCA 2CQ9A 1XXUA 3GKXA 2PN8A 2L59A 1Z7RA 4BVYB 2HRFA 3VLNA 1SU9A 2PVOC 4O32A 3F6FA 5H5QA 3WGXA 3QAVA 3ME8A 1ZYEA 2NDOA 2AV4A 4JEDA 4ZBDA 4K0NA 2I81A 4KDXA 3TDGA 3NIVA 4IELA 2FD3A 1DE1A 4EIQA 4Z7XA 1ZYPA 3L9SA 2WULA 2X49A 1NM3A 3CBUA 4K2XA 1GSDA 3GSTA 4MNNA 2FWFA 3UMAA 2GGTA 2CAIA 2DKHA 2GSTA 1TI3A 20GSA 2HSYA 1CQHA 2B6MA 3VPQA 3TJJA 2PUKC 3VWUA 4KF9A 1HQOA 3PPUA 5G5FA 1SYXA 5DALA 1AQXA 1X5DA 1YKCA 4GSNA 1R5AA 4KSOA 4X43A 5DAKB 1XOBA 2HNLA 1ILOA 4EVMA 4XS6A 3IRAA 2H75A 2B1LA 4FYCA 3IR4A 3D0ZA 2KP1A 3UEMA 1EV4A 2MMOA 2GQLA 1XVWA 3D22A 1F9MA 4WR4A 2HZEB 3WYWA 4KB3A 3DD3A 5CP1A 1ZYQB 5LCZA 3HDCA 2L4CA 3LYKA 5LD0A 1TU8A 4F0CA 6GSWA 3FZAA 1K0AA 3QR6A 1HNCA 2JU5A 2KUCA 1B4QA 1Z6NA 2FWEA 4E8HA 3M9KA 1HNAA 4I5QA 3EMPA 4KNDA 3ZVJD 3F4TA 2FLSA 5G5EA 2CX4A 4EUYA 1GTAA 3HZ8A 1O8WA 1VF1A 3QD9A 3TOUA 2N5AA 5D9XA 1EWXA 3MNGA 4NV5A 3CRUA 1XCCA 1TTZA 4F82A 5ABRA 3UJ1A 2MZCA 4ML1A 5CRDA 2J23A 1PSQA 3KTBA 3DYRA 5CRHA 2H70A 2P31A 3DRNA 2FHEA 4K0GA 5F05A 1PL2A 3HJOA 2GQMA 1SKSB 1SL0B 2WDUA 4NV2A 1A8YA 6GSSA 1F3AA 5EY6A 4TKYA 4IP6A 1Z9HA 3UOMA 1EP7A 4QQ7A 4ECIA 3HZ4A 2R5GA 2R3XA 3L9UA 3TUEA 4HQZA 13GSA 3LEFA 5G30A 5ECPB 4WF5A 2BTOT 5ECKB 4IBPA 10GSA 3H4KA 5ENUA 3HD5A 1GL8A 1JFUA 1DSBA 1YDKA 2M46A 2C0DA 1Z6MA 1M99A 4IGJA 4TW5A 3FMWA 2DC5A 2CAQA 1W4VA 4DSSA 2X8CA 1A0RP 4NWYA 3A2VA 2YNXA 1V2AA 4ECBA 2OE1A 2OJLA 1HNBA 3KGKA 3J7Yb 3EMXA 5GSSA 4ISDA 2QA1A 5E59A 4N30A 3G7IA 1A2JA 2VD0A 4FQUA 1SJIA 1QQ2A 1C72A 3KH9A 3RAZA 2B1KA 2V2GA 4MLYA 4BA7A 2H1GA 5CAXA 1K3LA 5B8AA 4EO3A 5AN1A 1XWBA 4H86A 3FKFA 4I2UA 4AJ8A 2YWOA 2HT9A 4BWQA 5B6NA 4HU7A 2OKAA 3L9VA 3ED3A 4NMUA 2LRCA 4Q5QA 3TJGA 1R4WA 2H6YA 4X0XA 3ZLPA 1YY7A 4MK3A 1RK4A 5ECSA 1YKAA 3MSZA 2E2MA 2V1MA 3TKQA 3DMLA 3HA9A 3IPZA 4MABA 3LG6A 4OCEA 2GZZA 5AISA 1KBNA 1TDIA 5INYA 3E3EA 4Q5FA 4IW9A 4V2LA 1PD21 5EPFA 3ZVJA 2GLRA 6GSXA 4EE0A 1K0CA 1XBSA 1PRXA 1QGVA 3IA1A 4HI7A 1XOAA 2FUG2 5IO0A 1B4PA 1M0UA 2LV3A 1XW6A 4MP4A 1YEXA 4CY6A 3TKSE 4ZBBA 5CRWA 1YJ6A 3IAS2 2MYGA 4YQVA 1XVQA 3F63A 2OBKA 3GUSA 1XPVA 4POKA 3CTFA 5J4UA 1N2AA 1GUMA 2K8VA 4FIWA 12GSA 2LNSA 1SK2A 4ZL8A 3LORA 1O85A 4OO5A 2DJKA 1VF4A 3D6IA 3ZIJA 4D73A 1B9XC 3CYNA 4WETA 2PMTA 1R7HA 5IMFA 3GKKA 3GL5A 1LBKA 2I4AA 5D8IA 1F2EA 3QFAC 1SK1A 2B5YA 1N8JA 2K9FA 3D21A 2YZUA 1EZKA 3GL3A 2E2GA 3ZTLA 1QK8A 3GKMA 2LJRA 4ACSA 2V41A 5HR0A 2LS5A 1O73A 3RHCA 3KH7A 3EYTA 3DIEA 4CHSA 2CVDA 5IMDA 1AQVA 3UARA 4OFNA 2IMFA 2OACA 5IM9A 1TKDB 5EVOA 4IN0A 2YZHA 2QA2A 1AC1A 1S3CA 2H73A 5IMZA 2ON5A 3LSZA 1XWGA 4EXJA 2H1AA 4IQAA 1TU7A 4G9HA 3FRCA 4YQMA 4TR0A 1SK0A 1AW9A 3KD0A 2NBSA 1AAZA 4ZL7A 1T7PB 1BQ7A 2LJKA 3L78A 1TK5B 2F8FA 3ZMKA 2JACA 4YAVA 2YANA 5DBQA 2YOIA 5B7CA 2LUSA 5IO2A 3ISOA 5AGYA 1HD2A 3M1GA 4TR4A 4KUNA 2AAWA 4PUAA 4IKHA 4EF0A 1X9MB 4CY8A 2Z9SA 5CREA 2YWIA 4XHMA 1JZWA 4TRXA 3LQ7A 2VO4A 4HZ4A 4JR6A 3IXRA 5HFKA 3GMFA 1GSUA 3EU4A 3UVTA 4F2IA 1IYIA 2J9HA 3FR6A 1GSSA 3I43A 5E4WA 2PWJA 3CXGA 3ME7A 1SKRB 2FCHA 1B9YC 3LXTA 6GSUA 4XS4B 5ID2A 4TXOB 5G1LA 4HEA2 3KP8A 3M9JA 4KH7A 4ULXA 3IBHA 2IPAA 1ZL9A 2TRCP 2HRNA 2JZSA 3HVVA 4MH2A 3EU3A 1ZOFA 2HZFA 3FY7A 2XBIA 2LRTA 1AXDA 3KEBA 5IMCA 3DKSA 1QXHA 2IMEA 3M8NA 4F03A 4AJ7A 2QSIA 3F4RA 4MA9A 1GULA 2R4VA 4I8BA 5F06A 1OKDA 2H6XA 1Q4JA 4ICYA 4ID0A 3GKNA 1LU4A 4G10A 2L57A 2GS3A 4TR1B 5IOWA 4MH3A 3RDWA 1G6YA 3I69A 1V9WA 2OE0A 3PINA 3ZMLA 4BVXA 5DDLA 1K3YA 3CMIA 3F0IA 2GSQA 2MBSA 1K0DA 1O6JA 3D4MA 3IAM2 2B5XA 5FWGA 1I5GA 5D93A 1GUHA 2A2PA 3FZ5A 3GX0A 2H19A 3E0UA 1KTEA 4FYBA 4KAEA 3EURA 1SD8A 2MMAA 3UBLA 3A5WA 4ZB8A 5DVBA 4TVEA 3VFIA 4PNFA 2FA4A 2GQKA 4J57E 4YKFA 2CT6A 2X8GA 3D5JA 5JCWA 5A5KA 4ILFA 2DJ1A 3QPMA 4F9ZA 2F9SA 2YP6A 3HKRA 4Z2RA 1ST9A 2PBJA 4NHWA 2B7JA 1TI1A 2YJHA 5GSTA 1WWJA 5KN1A 1XWKA 2A4VA 2H1BA 1MEKA 3BJ5A 2ALBA 5FHIA 2F8AA 1PL1A 1MDJA 3RHBA 3FK8A 1ABAA 3VWXA 2LQOA 4K8MA 1QMVA 1XFLA 2L4QA 5DQYA 3TCOA 2VM1A 3FZ4A 3C71A 1W89A 1EP8A 1VF3A 4HU9A 2VL2A 3FR3A 2XC2A 1TJDA 4G0KA 3ZYWA 3KMOA 2GSSA 3G7YA 3NOFA 3KJYA 2WFCA 3TOTA 1Y6EA 1XZOA 2H0HA 3FYGA 4OO4A 2V6OA 2VL2C 1SKWB 3GA4A 4GRFA 3IE3A 2HXKA 3TJFA 5ECRB 4KCAA 4O5RA 2L5OA 4AJ6A 1R5PA 1FW1A 3FEUA 1PX6A 5ELAA 1M9AA 4ECCA 1GP1A 5KOWA 1ZMAA 2B7KA 2JZTA 4N10A 5DCHA 4HUAA 5HQPA 1TXXA 2XBQA 1T4ZA 3TRQA 2H66A 4OWYA 2CZ3A 1JZRA 2IFQA 2PPTA 3IHQA 3ZITA 3PR8A 1USBA 3FW2A 1ZYNA 1UC7A 3LW9A 4J56E 5HR1A 3TKSC 2VL9A 4DVCA 4FYUA 4ZB9A 3EWLA 4HJ2A 1ERVA 5L71A 2FWGA 3APSA 3EINA 3IC8A 1GNEA 3SWLA 2RUFA 4MZCA 3KXOA 5CO3A 1MD3A 2I1UA 4HJMA 2IWTA 1PN0A 1GWCA 2YN1A 4MPGA 1JHBA 3HVSA 5CNWA 4X1UA 1TW9A 1LJRA 2VD1A 4DSQA 2R37A 3WD6A 4KGIA 4GLTA 1K0BA 4FO5A 1OAZA 2WJUA 4RI7A 3CRTA 1JLVA 2O89A 2HLSA 2O85A 3JCML 2YJ7A 1PKZA 5CRGA 2RM6A 1X0RA 4K7IA 4MJBA 2C3TA 4JE1A 2DKIA 5ECIB 1NHYA 2YPMA 3DVXA 1GUKA 3GTUA 5F8BA 1SYRA 1JLWA 3Q74A 1M7TA 2N5BA 4IQ1A 1V40A 3BOAA 1FOHA 4L0WA 1OC9A 2CZ2A 2AHEA 4MJEA 5JCUA 5D9WA 5C04A 3KZQA 5DALB 2DSAA 2EIQA 2VCTA 1FHEA 2YWNA 2LQQA 5HFIA 3UIWA 2P5RA 5B8BA 1OC3A 3DXBA 1ON4A 3FR9A 2O87A 5JWOB 2VLTA 4F0BA 4XTSA 1U88A 1OE7A 2IIYA 2VCWA 1GRXA 4TR3A 3GFKA 3QCPA 4TN8A 3C1RA 3S9FA 3TJBA 3TGZA 5D9VA 3I6AA 3DEXA 3H8QA 3RPNA 3US3A 2PU9C 2GZPA 2PERA 3HJPA 1XWAA 4ZXGA 2VCXA 5LNKe 5IQYA 1THOA 5DCGA 1Q98A 1A23A 6GSTA 1RQMA 4TOPA 5JWRB 4KX4A 2GDRA 4L8EA 3BCKA 2VLUA 2R0CA 4RQRA 4O5QA 2IL3A 2XPEA 3LJRA 4GXZA 2E7PA 1EOGA 4L5OA 5KN3A 1MDKA 1NHOA 3A2WA 2YCDA 3F3RA 1K0NA 1AIUA 4GF0A 3HJMA 16GSA 5H5SA 4TXVA 1J0FA 4NAXA 4ZBAA 4Z2UA 4N11A 4BL7A 2ZUPA 1GSFA 4G2EA 4EIPA 4PXOA 2FY6A 3V1WA 1J08A 1EGOA 3GHAA 2DIYA 2CVKA 2MMNA 3O6TA 4N0ZA 5CYYA 4KSMA 2VIMA 2EIOA 4X4JA 9GSSA 4PQ1A 5AIXA 4YAPA 1GSEA 2YV7A 1U3AA 3PH9A 1A24A 4XS1A 1T00A 3F8UA 1WPIA 2C0GA 3GURA 5J3RA 1X5EA 3ZFLA 4BVYA 3EVIA 4POMA 5C00A 2OADA 3M0FA 1H4OA 5GZZB 1SL1B 1AQWA 4DSSB 2YWMA 1T4YA 1YQ1A 4GWRA 5DJMA 7GSSA 1UVZA 3E9JB 4MJAA 2H0GA 4WKWA 2ZNMA 4LL4B 4N0VA 2H6ZA 3KMNA 4YH2A 5IMAA 1ZCPA 2HSMA 2X4AA 3VK9A 2K6VA 2ES7A 4GQCA 1K0MA 2BJXA 4MPFA 1KNGA 3R3EA 5A4WA 3C8EA 2H1DA 4PNGA 2IMKA 4K1FA 1IYHA 1O81A 2H0IA 5D96A 3HHVA 3H93A 3L4NA 4IP1A 4DEJA 3IV4A 1T1VA 4K5RA 2AUVA 2RIIA 3F6DA 1YZXA 2DMMA 4HZ2A 5GAND 3BBYA 3CTGA 2GT5A 3P8WA 2MBTA 3HY2A 3VI5A 2O7KA 2IMDA 4OFTA 3IOSA 1X9SB 1GH2A 1FB6A 2REMA 2HZEA 3IK9A 1BG5A 2VLVA 3DVWA 4IHUA 5G1KA 3UVHA 4KCEA 3BCIA 2MMZA 1A8LA 2YV9A 1OYJA 5D73A 2R6KA 4PQHA 4NHZA 1DE2A 4BPYA 1K0OA 2GZYA 3F9UA 1GTUA 4KW6A 3W6GA 2F3MA 2ON7A 4D73B 4ZL9A 4OD7A 1DBYA 2KP2A 2X99A 1OC8A 2A4HA 3CSIA 2IMIA 2WS2A 1UN2A 4I6XA 3U5RE 1O7UA 1DUGA 1PMTA 3VURA 5ECNB 3ERFA 4XIHA 4MF5A 2OA7A 2X64A 4WXTA 1OVNA 2LNTA 4YQUA 2D2ZA 2XPDA 2XHFA 1GTIA 6GSVA 1MD4A 1NW2A 4NXIA 3MIXA 2L5LA 2VCQA 4KDUA 1HYUA 3WGDA 4I97A 1ML6A 4HDEA 5KOXA 1E2YA 1F6MC 4QL7A 4PUFC 3M3MA 1YF1A 2C80A 5JCGA 2HE3A 4HQSA 3TKPA 4K9ZA 1Z5YE 3C73A 3U6VA 1SJZA 18GSA 3IC4A 3P2AA 5G31A 3VWWA 3O3TA 1YEPA 1G0TA 2C4JA 3BD2A 2FWHA 5J41A 4PTSA 8GSSA 3UL3A 4POLA 3P90A 4HS1A 3Q19A 1WOUA 1M2DA 4AGSA 4LLRA 2G2QA 14GSA 2C0EA 5H5RA 4JU5A 3W8JA 3W8SA 3RPPA 1R26A 5J5NA 1WMJA 2A2RA 3KIJA 1RW1A 2LRNA 4HOJA 1K3OA 2BMXA 3GV1A 3QMXA 4Q5RA 1E6BA 1XWCA 3LXZA 1F3BA 3HXSA 2B3SA 4O92A 1TRWA 2V32A 5ID2B 22GSA 2DMLA 1BEDA 4WEYA 3TRXA 4CW9A 2AYTA 4GSTA 5IPHA 3OR5A 2DJ0A 17GSA 2RLIA 4WR5A 4OCFA 3TKSA 3PGTA 1WRYA 2HRAA 4MDCA 1ERTA 2P5QA 4CDOA 5IIZA 1EV9A 4JRRA 4GSSA 3VI7A 3N9JA 1A0FA 2TRXA 4POBA 3ZFBA 1KEBA 5F07A 4ZILA 1GTBA 1CQGA 4LMWA 1VRSD 1MDIA 3QFBC 1V58A 2HFDA 1FAAA 2O8VB 2JSZA 1M9BA 4V2NA 4AF2A 1S3AA 2WB9A 3IK7A 4LMVA 3GNJA 2LEGA 4FH8A 1Z3EA 4DSRA 4RI6A 4BVXB 1S3DA 1FO5A 1T3BA 2R2JA 3GIXA 3KCMA 1AUCA 1I9DA 2DBCA 4OFMA 1M2BA 3QOUA 1FVKA 5JWQB 2L6DA 3L0HA 1G7OA 3GYKA 2E0QA 4Z2TA 3EC3A 1U87A 4MZWA 1O8XA 1TRSA 2UZ8A 1WJKA 3LFLA 2C1YA 3ZL5A 3GN3A 5B6MA 2C0FA 2NTOA 4K6XA 4L5LA 1BX9A 3I9V2 4K5SA 3FZ9A 1G6WA 2M72A 3TJKA 3GX8A 1U3IA 5GAPD 4K7NA 4E8EA 1JZDA 2RUEA 1X5CA 1VGLA 5ELGA 2H72A 3TKRA 1FG4A 1EEJA 3WGEA 2DLXA 5DQSA 4JR4A 4ZIJA 2KHPA 3H79A 1WIKA 2GT6A 2WZ9A 3APQA 5BRTA 2GTUA 1TK0B 5EL8A 3G7JA 5IPGA 1G7EA 1A2LA 2FGXA 4J2FA 1NSWA 2CA8A 3IDVA 2RM5A 3GSSA 3LGCA 1BAYA 2H01A 2ZCTA 2H30A 2I9HA 4IJ3A 5KN0A 4O5UA 4I2TA 1PQNA 3DGQA 1WP0A 1SENA 3QDNA 3H1NA 4G0IA 1PX7A 1EEMA 2WCIA 4A5PA 1XIYA 1TK8B 4PURA 4KDYA 1ACVA 5AIVA 4BWSA 1GNWA 2JADA 1F37A 2H74A 4V1Ag 3WT1A 4GQFA 3ERGA 3UAPA 2DJ3A 5IMVA 3RBTA 1EGRA 4WBJA 4EDZA 2HSHA 2TIRA 1B48A 3G9BA 5COHA 1H75A 2PVQA 4QL9A 3R2QA 3AY8A 2X8HA 4P3YB 1VF2A 2JL4A 4O7HA 2QGVA 4K7OA 4XS4A 5FT3A 2G0FA 4TXOA 1J9BA 3SBCA 1X9WB 2CV4A 2IFQB 1XW5A 2VCZA 5HR3A 3P7XA 1QUWA 2DIZA 1Y25A 3APOA 1GSYA 3N5OA 2HRKA 3ERWA 5IOXA 4G19A 1UA5A 3HYPA 2F51A 19GSA 3C7MA 1FVJA 2KOKA 1WE0A 3A3TA 4OMVA 1T8EB 5BMUA 2OE3A 4LL1B 2LSTA 2C3QA 4WBRD 3F3QA 2DJJA 3UBKA 4MJCA 5ECMB 2R0PA 1PKWA 1V57A 2K8SA 4TR1A 3HCZA 1BJXA 2C8UA 2AJQB 2LKUA 3GH9A 1XW9A 5A4UA 1FB0A 4IVFA 4ZB6A 2K18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URM A;  5G2Z A;  1OKT A;  5KN2 A;  2FA8 A;  4ML6 A;  3ZRD A;  1GSQ A;  3EE2 A;  1ZGN A;  2FNO A;  1SL2 B;  4MF6 A;  4L0U A;  4IJI A;  3Q18 A;  3GH6 A;  3TRP A;  3K8N A;  4PGT A;  5ECL B;  2A2S A;  2VAF A;  1BYE A;  4NPB A;  5HR2 A;  4V1A p;  1THX A;  5ECQ B;  3NZN A;  1TRU A;  4IS0 A;  3F4S A;  3C1S A;  4ECJ A;  2IN3 A;  3GTU B;  4MCU A;  2GVP A;  2H8L A;  5ECO B;  2JSY A;  4EDY A;  2AB6 A;  2CX3 A;  2IJY A;  5D9T A;  1OE8 A;  1OC9 B;  4GCI A;  4RQX A;  2JZR A;  4KE3 A;  4JBB A;  2L6C A;  4XRD A;  5A4V A;  1PGT A;  2C3N A;  11GS A;  1QFN A;  3LYP A;  5KEJ A;  4KA0 A;  1PN9 A;  4EC0 A;  2QKE A;  3VWV A;  2CVB A;  3TB2 A;  3MWH A;  4EL1 A;  3CSH A;  5DAK A;  1EOH A;  3VPT A;  2VOC A;  3WT2 A;  4V2M A;  1ERW A;  3CSJ A;  3ZRE A;  2H71 A;  2VCV A;  4LA1 A;  4MZB A;  5F0G A;  1Z7P A;  5J9B A;  2VUP A;  2VM2 A;  3MDK A;  4PX1 A;  4WF4 A;  5ECH B;  6GSY A;  2QC7 A;  2I3Y A;  3ZZX A;  3ZIV A;  1ERU A;  3A2X A;  1PA3 A;  4MMM A;  2LTK A;  2NPB A;  2GSR A;  1GLP A;  3FHK A;  2EC4 A;  4Q5N A;  3O76 A;  2HYX A;  3LWA A;  2H76 A;  2WGR A;  5J9C A;  2LJA A;  1B8X A;  4JZQ A;  4K2D A;  1GLQ A;  3QAG A;  4EKZ A;  2V6K A;  1YF0 A;  2PGT A;  3KTL A;  1A2M A;  5DJL A;  4PQI A;  1ZZY A;  1FOV A;  2OBI A;  3MAK A;  3DWV A;  1SJ6 A;  1V98 A;  3QAW A;  1TRV A;  2KLX A;  2VL3 A;  4XCS A;  3HVX A;  3Q6O A;  3KM6 A;  2N5F A;  3D4T A;  3KP9 A;  2HI7 A;  3J7Y k;  2B5E A;  1U6T A;  2P0G A;  2NVL A;  1TP9 A;  1JZO A;  2WRT A;  1SD9 A;  4MF7 A;  2EIR A;  3GRX A;  4GTU A;  1M2A A;  1TOF A;  4RUV A;  2DJ2 A;  2M80 A;  5HFG A;  4XRA A;  1MTC A;  2CQ9 A;  1XXU A;  3GKX A;  2PN8 A;  2L59 A;  1Z7R A;  2HRF A;  3VLN A;  1SU9 A;  2PVO C;  4O32 A;  3F6F A;  5H5Q A;  3WGX A;  3QAV A;  3ME8 A;  1ZYE A;  2NDO A;  2AV4 A;  4JED A;  4ZBD A;  4K0N A;  2I81 A;  4KDX A;  3TDG A;  3NIV A;  4IEL A;  2FD3 A;  1DE1 A;  4Z7X A;  3L9S A;  2WUL A;  1NM3 A;  3CBU A;  1GSD A;  3GST A;  2FWF A;  3UMA A;  2GGT A;  2CAI A;  2GST A;  1TI3 A;  20GS A;  2HSY A;  1CQH A;  2B6M A;  3VPQ A;  3TJJ A;  2PUK C;  3VWU A;  1HQO A;  5G5F A;  1SYX A;  5DAL A;  1AQX A;  1X5D A;  1YKC A;  4GSN A;  1R5A A;  4KSO A;  4X43 A;  5DAK B;  1XOB A;  2HNL A;  1ILO A;  4EVM A;  4XS6 A;  3IRA A;  2H75 A;  2B1L A;  4FYC A;  3IR4 A;  3D0Z A;  2KP1 A;  3UEM A;  1EV4 A;  2MMO A;  2GQL A;  1XVW A;  3D22 A;  1F9M A;  4WR4 A;  2HZE B;  3WYW A;  4KB3 A;  3DD3 A;  5CP1 A;  1ZYQ B;  5LCZ A;  3HDC A;  2L4C A;  3LYK A;  5LD0 A;  1TU8 A;  4F0C A;  6GSW A;  3FZA A;  1K0A A;  3QR6 A;  1HNC A;  2JU5 A;  2KUC A;  1B4Q A;  1Z6N A;  2FWE A;  4E8H A;  3M9K A;  1HNA A;  4I5Q A;  3EMP A;  4KND A;  3ZVJ D;  3F4T A;  2FLS A;  5G5E A;  2CX4 A;  4EUY A;  1GTA A;  3HZ8 A;  1O8W A;  1VF1 A;  3QD9 A;  3TOU A;  2N5A A;  5D9X A;  1EWX A;  3MNG A;  4NV5 A;  3CRU A;  1XCC A;  1TTZ A;  4F82 A;  5ABR A;  3UJ1 A;  2MZC A;  4ML1 A;  5CRD A;  2J23 A;  1PSQ A;  3KTB A;  3DYR A;  5CRH A;  2H70 A;  2P31 A;  3DRN A;  2FHE A;  4K0G A;  5F05 A;  1PL2 A;  3HJO A;  2GQM A;  1SKS B;  1SL0 B;  2WDU A;  4NV2 A;  1A8Y A;  6GSS A;  1F3A A;  5EY6 A;  4TKY A;  4IP6 A;  1Z9H A;  3UOM A;  1EP7 A;  4QQ7 A;  4ECI A;  3HZ4 A;  2R5G A;  2R3X A;  3L9U A;  3TUE A;  4HQZ A;  13GS A;  3LEF A;  5G30 A;  5ECP B;  4WF5 A;  2BTO T;  5ECK B;  4IBP A;  10GS A;  3H4K A;  5ENU A;  3HD5 A;  1GL8 A;  1JFU A;  1DSB A;  1YDK A;  2M46 A;  2C0D A;  1Z6M A;  1M99 A;  4IGJ A;  4TW5 A;  2DC5 A;  2CAQ A;  1W4V A;  4DSS A;  2X8C A;  1A0R P;  4NWY A;  3A2V A;  2YNX A;  1V2A A;  4ECB A;  2OE1 A;  2OJL A;  1HNB A;  3KGK A;  3J7Y b;  3EMX A;  5GSS A;  4ISD A;  5E59 A;  4N30 A;  3G7I A;  1A2J A;  2VD0 A;  1SJI A;  1QQ2 A;  1C72 A;  3KH9 A;  3RAZ A;  2B1K A;  2V2G A;  4MLY A;  4BA7 A;  2H1G A;  5CAX A;  1K3L A;  5B8A A;  4EO3 A;  5AN1 A;  1XWB A;  4H86 A;  3FKF A;  4I2U A;  4AJ8 A;  2YWO A;  2HT9 A;  4BWQ A;  5B6N A;  4HU7 A;  2OKA A;  3L9V A;  3ED3 A;  4NMU A;  2LRC A;  4Q5Q A;  3TJG A;  1R4W A;  2H6Y A;  4X0X A;  3ZLP A;  1YY7 A;  4MK3 A;  1RK4 A;  5ECS A;  1YKA A;  3MSZ A;  2E2M A;  2V1M A;  3TKQ A;  3DML A;  3HA9 A;  3IPZ A;  4MAB A;  3LG6 A;  4OCE A;  2GZZ A;  5AIS A;  1KBN A;  1TDI A;  5INY A;  3E3E A;  4Q5F A;  4IW9 A;  4V2L A;  1PD2 1;  5EPF A;  3ZVJ A;  2GLR A;  6GSX A;  4EE0 A;  1K0C A;  1XBS A;  1PRX A;  1QGV A;  3IA1 A;  4HI7 A;  1XOA A;  2FUG 2;  5IO0 A;  1B4P A;  1M0U A;  2LV3 A;  1XW6 A;  4MP4 A;  1YEX A;  3TKS E;  4ZBB A;  5CRW A;  1YJ6 A;  3IAS 2;  2MYG A;  4YQV A;  1XVQ A;  3F63 A;  2OBK A;  3GUS A;  1XPV A;  4POK A;  3CTF A;  5J4U A;  1N2A A;  1GUM A;  2K8V A;  4FIW A;  12GS A;  2LNS A;  1SK2 A;  4ZL8 A;  3LOR A;  1O85 A;  4OO5 A;  2DJK A;  1VF4 A;  3D6I A;  3ZIJ A;  4D73 A;  1B9X C;  3CYN A;  4WET A;  2PMT A;  1R7H A;  5IMF A;  3GKK A;  3GL5 A;  1LBK A;  2I4A A;  5D8I A;  1F2E A;  3QFA C;  1SK1 A;  2B5Y A;  1N8J A;  2K9F A;  3D21 A;  2YZU A;  1EZK A;  3GL3 A;  2E2G A;  3ZTL A;  1QK8 A;  3GKM A;  2LJR A;  4ACS A;  2V41 A;  5HR0 A;  2LS5 A;  1O73 A;  3RHC A;  3KH7 A;  3EYT A;  3DIE A;  4CHS A;  2CVD A;  5IMD A;  1AQV A;  3UAR A;  4OFN A;  2IMF A;  2OAC A;  5IM9 A;  1TKD B;  5EVO A;  4IN0 A;  2YZH A;  1AC1 A;  1S3C A;  2H73 A;  5IMZ A;  2ON5 A;  3LSZ A;  1XWG A;  4EXJ A;  2H1A A;  4IQA A;  1TU7 A;  4G9H A;  3FRC A;  4YQM A;  4TR0 A;  1SK0 A;  1AW9 A;  3KD0 A;  2NBS A;  1AAZ A;  4ZL7 A;  1T7P B;  1BQ7 A;  2LJK A;  3L78 A;  1TK5 B;  2F8F A;  3ZMK A;  2JAC A;  4YAV A;  2YAN A;  5DBQ A;  2YOI A;  5B7C A;  2LUS A;  5IO2 A;  3ISO A;  5AGY A;  1HD2 A;  3M1G A;  4TR4 A;  4KUN A;  2AAW A;  4PUA A;  4IKH A;  4EF0 A;  1X9M B;  2Z9S A;  5CRE A;  2YWI A;  4XHM A;  1JZW A;  4TRX A;  3LQ7 A;  2VO4 A;  4HZ4 A;  4JR6 A;  3IXR A;  5HFK A;  3GMF A;  1GSU A;  3EU4 A;  3UVT A;  4F2I A;  1IYI A;  2J9H A;  3FR6 A;  1GSS A;  3I43 A;  5E4W A;  2PWJ A;  3CXG A;  3ME7 A;  1SKR B;  2FCH A;  1B9Y C;  3LXT A;  6GSU A;  4XS4 B;  5ID2 A;  4TXO B;  5G1L A;  4HEA 2;  3KP8 A;  3M9J A;  4KH7 A;  4ULX A;  3IBH A;  2IPA A;  1ZL9 A;  2TRC P;  2HRN A;  2JZS A;  3HVV A;  4MH2 A;  3EU3 A;  1ZOF A;  2HZF A;  3FY7 A;  2XBI A;  2LRT A;  1AXD A;  3KEB A;  5IMC A;  3DKS A;  1QXH A;  2IME A;  3M8N A;  4F03 A;  4AJ7 A;  2QSI A;  3F4R A;  4MA9 A;  1GUL A;  2R4V A;  4I8B A;  5F06 A;  1OKD A;  2H6X A;  1Q4J A;  4ID0 A;  3GKN A;  1LU4 A;  4G10 A;  2L57 A;  2GS3 A;  4TR1 B;  5IOW A;  4MH3 A;  3RDW A;  1G6Y A;  3I69 A;  1V9W A;  2OE0 A;  3PIN A;  3ZML A;  4BVX A;  5DDL A;  1K3Y A;  3CMI A;  3F0I A;  2GSQ A;  2MBS A;  1K0D A;  1O6J A;  3D4M A;  3IAM 2;  2B5X A;  5FWG A;  1I5G A;  5D93 A;  1GUH A;  3FZ5 A;  3GX0 A;  2H19 A;  3E0U A;  1KTE A;  4FYB A;  4KAE A;  3EUR A;  1SD8 A;  2MMA A;  3UBL A;  3A5W A;  4ZB8 A;  5DVB A;  4TVE A;  3VFI A;  4PNF A;  2FA4 A;  2GQK A;  4J57 E;  2CT6 A;  2X8G A;  3D5J A;  5JCW A;  5A5K A;  4ILF A;  2DJ1 A;  3QPM A;  4F9Z A;  2F9S A;  2YP6 A;  3HKR A;  1ST9 A;  2PBJ A;  4NHW A;  2B7J A;  1TI1 A;  2YJH A;  5GST A;  1WWJ A;  5KN1 A;  1XWK A;  2A4V A;  2H1B A;  1MEK A;  3BJ5 A;  2ALB A;  5FHI A;  2F8A A;  1PL1 A;  1MDJ A;  3RHB A;  3FK8 A;  1ABA A;  3VWX A;  2LQO A;  4K8M A;  1QMV A;  1XFL A;  2L4Q A;  5DQY A;  3TCO A;  2VM1 A;  3FZ4 A;  3C71 A;  1W89 A;  1EP8 A;  1VF3 A;  4HU9 A;  2VL2 A;  3FR3 A;  2XC2 A;  1TJD A;  3ZYW A;  3KMO A;  2GSS A;  3G7Y A;  3NOF A;  3KJY A;  2WFC A;  3TOT A;  1Y6E A;  1XZO A;  2H0H A;  3FYG A;  4OO4 A;  2V6O A;  2VL2 C;  1SKW B;  3GA4 A;  4GRF A;  3IE3 A;  2HXK A;  3TJF A;  5ECR B;  4KCA A;  4O5R A;  2L5O A;  4AJ6 A;  1R5P A;  1FW1 A;  3FEU A;  1PX6 A;  5ELA A;  1M9A A;  4ECC A;  1GP1 A;  1ZMA A;  2B7K A;  2JZT A;  4N10 A;  5DCH A;  4HUA A;  5HQP A;  1TXX A;  2XBQ A;  1T4Z A;  3TRQ A;  2H66 A;  4OWY A;  2CZ3 A;  1JZR A;  2IFQ A;  2PPT A;  3IHQ A;  3ZIT A;  3PR8 A;  1USB A;  3FW2 A;  1UC7 A;  4J56 E;  5HR1 A;  3TKS C;  2VL9 A;  4DVC A;  4FYU A;  4ZB9 A;  3EWL A;  4HJ2 A;  1ERV A;  5L71 A;  2FWG A;  3APS A;  3EIN A;  1GNE A;  3SWL A;  2RUF A;  4MZC A;  3KXO A;  5CO3 A;  1MD3 A;  2I1U A;  4HJM A;  2IWT A;  1GWC A;  2YN1 A;  4MPG A;  1JHB A;  3HVS A;  5CNW A;  4X1U A;  1TW9 A;  1LJR A;  2VD1 A;  4DSQ A;  2R37 A;  3WD6 A;  4KGI A;  4GLT A;  1K0B A;  4FO5 A;  1OAZ A;  2WJU A;  4RI7 A;  3CRT A;  1JLV A;  2O89 A;  2HLS A;  2O85 A;  3JCM L;  2YJ7 A;  1PKZ A;  5CRG A;  2RM6 A;  1X0R A;  4K7I A;  4MJB A;  2C3T A;  4JE1 A;  5ECI B;  1NHY A;  2YPM A;  3DVX A;  1GUK A;  3GTU A;  5F8B A;  1SYR A;  1JLW A;  3Q74 A;  1M7T A;  2N5B A;  4IQ1 A;  1V40 A;  3BOA A;  4L0W A;  1OC9 A;  2CZ2 A;  2AHE A;  4MJE A;  5JCU A;  5D9W A;  5C04 A;  3KZQ A;  5DAL B;  2DSA A;  2EIQ A;  2VCT A;  1FHE A;  2YWN A;  2LQQ A;  5HFI A;  3UIW A;  2P5R A;  5B8B A;  1OC3 A;  3DXB A;  1ON4 A;  3FR9 A;  2O87 A;  5JWO B;  2VLT A;  4F0B A;  4XTS A;  1U88 A;  1OE7 A;  2IIY A;  2VCW A;  1GRX A;  4TR3 A;  3GFK A;  3QCP A;  4TN8 A;  3C1R A;  3S9F A;  3TJB A;  3TGZ A;  5D9V A;  3I6A A;  3DEX A;  3H8Q A;  3RPN A;  3US3 A;  2PU9 C;  2GZP A;  2PER A;  3HJP A;  1XWA A;  4ZXG A;  2VCX A;  5LNK e;  5IQY A;  1THO A;  5DCG A;  1Q98 A;  1A23 A;  6GST A;  1RQM A;  4TOP A;  5JWR B;  4KX4 A;  2GDR A;  4L8E A;  3BCK A;  2VLU A;  4RQR A;  2IL3 A;  2XPE A;  3LJR A;  4GXZ A;  2E7P A;  1EOG A;  4L5O A;  5KN3 A;  1MDK A;  1NHO A;  3A2W A;  2YCD A;  3F3R A;  1K0N A;  1AIU A;  4GF0 A;  3HJM A;  16GS A;  5H5S A;  4TXV A;  1J0F A;  4NAX A;  4ZBA A;  4N11 A;  4BL7 A;  2ZUP A;  1GSF A;  4G2E A;  4PXO A;  2FY6 A;  3V1W A;  1J08 A;  1EGO A;  3GHA A;  2DIY A;  2CVK A;  2MMN A;  3O6T A;  4N0Z A;  5CYY A;  4KSM A;  2VIM A;  2EIO A;  9GSS A;  4PQ1 A;  5AIX A;  4YAP A;  1GSE A;  2YV7 A;  1U3A A;  3PH9 A;  1A24 A;  4XS1 A;  1T00 A;  3F8U A;  1WPI A;  2C0G A;  3GUR A;  5J3R A;  1X5E A;  3ZFL A;  4BVY A;  3EVI A;  4POM A;  5C00 A;  2OAD A;  3M0F A;  1H4O A;  5GZZ B;  1SL1 B;  1AQW A;  4DSS B;  2YWM A;  1T4Y A;  1YQ1 A;  4GWR A;  5DJM A;  7GSS A;  1UVZ A;  3E9J B;  4MJA A;  2H0G A;  4WKW A;  2ZNM A;  4LL4 B;  4N0V A;  2H6Z A;  3KMN A;  4YH2 A;  5IMA A;  1ZCP A;  3VK9 A;  2K6V A;  2ES7 A;  4GQC A;  1K0M A;  2BJX A;  4MPF A;  1KNG A;  5A4W A;  3C8E A;  2H1D A;  4PNG A;  2IMK A;  4K1F A;  1IYH A;  1O81 A;  2H0I A;  5D96 A;  3HHV A;  3H93 A;  3L4N A;  4IP1 A;  4DEJ A;  3IV4 A;  1T1V A;  2AUV A;  2RII A;  3F6D A;  1YZX A;  2DMM A;  4HZ2 A;  5GAN D;  3BBY A;  3CTG A;  2GT5 A;  3P8W A;  2MBT A;  3HY2 A;  3VI5 A;  2O7K A;  2IMD A;  4OFT A;  3IOS A;  1X9S B;  1GH2 A;  1FB6 A;  2REM A;  2HZE A;  3IK9 A;  1BG5 A;  2VLV A;  3DVW A;  4IHU A;  5G1K A;  3UVH A;  4KCE A;  3BCI A;  2MMZ A;  1A8L A;  2YV9 A;  1OYJ A;  5D73 A;  2R6K A;  4PQH A;  4NHZ A;  1DE2 A;  4BPY A;  1K0O A;  2GZY A;  3F9U A;  1GTU A;  4KW6 A;  3W6G A;  2F3M A;  2ON7 A;  4D73 B;  4ZL9 A;  4OD7 A;  1DBY A;  2KP2 A;  2X99 A;  1OC8 A;  3CSI A;  2IMI A;  2WS2 A;  1UN2 A;  4I6X A;  3U5R E;  1O7U A;  1DUG A;  1PMT A;  3VUR A;  5ECN B;  3ERF A;  4XIH A;  4MF5 A;  2OA7 A;  2X64 A;  4WXT A;  1OVN A;  2LNT A;  4YQU A;  2D2Z A;  2XPD A;  2XHF A;  1GTI A;  6GSV A;  1MD4 A;  1NW2 A;  4NXI A;  2L5L A;  2VCQ A;  4KDU A;  1HYU A;  3WGD A;  4I97 A;  1ML6 A;  4HDE A;  1E2Y A;  1F6M C;  4QL7 A;  4PUF C;  3M3M A;  1YF1 A;  2C80 A;  5JCG A;  2HE3 A;  4HQS A;  3TKP A;  4K9Z A;  1Z5Y E;  3C73 A;  3U6V A;  1SJZ A;  18GS A;  3IC4 A;  3P2A A;  5G31 A;  3VWW A;  3O3T A;  1YEP A;  1G0T A;  2C4J A;  3BD2 A;  2FWH A;  5J41 A;  8GSS A;  3UL3 A;  4POL A;  3P90 A;  4HS1 A;  3Q19 A;  1WOU A;  1M2D A;  4AGS A;  4LLR A;  2G2Q A;  14GS A;  2C0E A;  5H5R A;  4JU5 A;  3W8J A;  3W8S A;  3RPP A;  1R26 A;  5J5N A;  1WMJ A;  2A2R A;  3KIJ A;  1RW1 A;  2LRN A;  4HOJ A;  1K3O A;  2BMX A;  3GV1 A;  3QMX A;  4Q5R A;  1E6B A;  1XWC A;  3LXZ A;  1F3B A;  3HXS A;  2B3S A;  4O92 A;  1TRW A;  2V32 A;  5ID2 B;  22GS A;  2DML A;  1BED A;  4WEY A;  3TRX A;  4CW9 A;  2AYT A;  4GST A;  5IPH A;  3OR5 A;  2DJ0 A;  17GS A;  2RLI A;  4WR5 A;  4OCF A;  3TKS A;  3PGT A;  1WRY A;  4MDC A;  1ERT A;  2P5Q A;  4CDO A;  5IIZ A;  1EV9 A;  4JRR A;  4GSS A;  3VI7 A;  3N9J A;  1A0F A;  2TRX A;  4POB A;  3ZFB A;  1KEB A;  5F07 A;  4ZIL A;  1GTB A;  1CQG A;  4LMW A;  1VRS D;  1MDI A;  3QFB C;  1V58 A;  2HFD A;  1FAA A;  2O8V B;  2JSZ A;  1M9B A;  4V2N A;  4AF2 A;  1S3A A;  2WB9 A;  3IK7 A;  4LMV A;  3GNJ A;  2LEG A;  4FH8 A;  1Z3E A;  4DSR A;  4RI6 A;  1S3D A;  1FO5 A;  1T3B A;  2R2J A;  3GIX A;  3KCM A;  1AUC A;  1I9D A;  2DBC A;  4OFM A;  1M2B A;  3QOU A;  1FVK A;  5JWQ B;  2L6D A;  3L0H A;  1G7O A;  3GYK A;  2E0Q A;  3EC3 A;  1U87 A;  4MZW A;  1O8X A;  1TRS A;  1WJK A;  3LFL A;  2C1Y A;  3ZL5 A;  3GN3 A;  5B6M A;  2C0F A;  2NTO A;  4K6X A;  4L5L A;  1BX9 A;  3I9V 2;  3FZ9 A;  1G6W A;  2M72 A;  3TJK A;  3GX8 A;  1U3I A;  5GAP D;  4K7N A;  4E8E A;  1JZD A;  2RUE A;  1X5C A;  1VGL A;  5ELG A;  2H72 A;  3TKR A;  1FG4 A;  1EEJ A;  3WGE A;  2DLX A;  5DQS A;  4JR4 A;  4ZIJ A;  2KHP A;  3H79 A;  1WIK A;  2GT6 A;  2WZ9 A;  3APQ A;  2GTU A;  1TK0 B;  5EL8 A;  3G7J A;  5IPG A;  1G7E A;  1A2L A;  2FGX A;  4J2F A;  1NSW A;  2CA8 A;  3IDV A;  2RM5 A;  3GSS A;  3LGC A;  1BAY A;  2H01 A;  2ZCT A;  2H30 A;  2I9H A;  4IJ3 A;  5KN0 A;  4I2T A;  1PQN A;  3DGQ A;  1WP0 A;  1SEN A;  3QDN A;  3H1N A;  1PX7 A;  1EEM A;  2WCI A;  1XIY A;  1TK8 B;  4PUR A;  4KDY A;  1ACV A;  5AIV A;  4BWS A;  1GNW A;  2JAD A;  1F37 A;  2H74 A;  4V1A g;  3WT1 A;  4GQF A;  3ERG A;  3UAP A;  2DJ3 A;  5IMV A;  3RBT A;  1EGR A;  4WBJ A;  4EDZ A;  2HSH A;  2TIR A;  1B48 A;  3G9B A;  5COH A;  1H75 A;  2PVQ A;  4QL9 A;  3R2Q A;  3AY8 A;  2X8H A;  4P3Y B;  1VF2 A;  2JL4 A;  4O7H A;  2QGV A;  4K7O A;  4XS4 A;  5FT3 A;  2G0F A;  4TXO A;  1J9B A;  3SBC A;  1X9W B;  2CV4 A;  2IFQ B;  1XW5 A;  2VCZ A;  5HR3 A;  3P7X A;  1QUW A;  2DIZ A;  1Y25 A;  3APO A;  1GSY A;  3N5O A;  3ERW A;  5IOX A;  4G19 A;  1UA5 A;  3HYP A;  2F51 A;  19GS A;  3C7M A;  1FVJ A;  2KOK A;  1WE0 A;  3A3T A;  4OMV A;  1T8E B;  2OE3 A;  4LL1 B;  2LST A;  2C3Q A;  4WBR D;  3F3Q A;  2DJJ A;  3UBK A;  4MJC A;  5ECM B;  1PKW A;  1V57 A;  2K8S A;  4TR1 A;  3HCZ A;  1BJX A;  2C8U A;  2AJQ B;  2LKU A;  3GH9 A;  1XW9 A;  5A4U A;  1FB0 A;  4IVF A;  4ZB6 A;  2K18 A; 
#chains in the Genus database with same CATH topology
 1URM A;  5G2Z A;  1OKT A;  5KN2 A;  2FA8 A;  4ML6 A;  3ZRD A;  1GSQ A;  3EE2 A;  1ZGN A;  2FNO A;  1SL2 B;  4MF6 A;  4L0U A;  4IJI A;  3Q18 A;  3GH6 A;  3TRP A;  3K8N A;  4PGT A;  5ECL B;  2A2S A;  2VAF A;  1BYE A;  3EPT A;  4NPB A;  5HR2 A;  4V1A p;  1THX A;  5ECQ B;  3NZN A;  1TRU A;  4IS0 A;  3F4S A;  3C1S A;  4ECJ A;  2IN3 A;  3GTU B;  4MCU A;  2GVP A;  2H8L A;  5ECO B;  2JSY A;  4EDY A;  2AB6 A;  2CX3 A;  2IJY A;  5D9T A;  1OE8 A;  1OC9 B;  4GCI A;  4RQX A;  2JZR A;  4KE3 A;  4JBB A;  2L6C A;  4XRD A;  5A4V A;  1PGT A;  2C3N A;  11GS A;  1QFN A;  3LYP A;  5KEJ A;  4KA0 A;  1PN9 A;  4EC0 A;  2QKE A;  3VWV A;  2CVB A;  3TB2 A;  3MWH A;  4EL1 A;  3CSH A;  5DAK A;  1EOH A;  3VPT A;  2VOC A;  3IHG A;  3WT2 A;  4V2M A;  1ERW A;  3CSJ A;  3ZRE A;  2H71 A;  2VCV A;  4LA1 A;  4MZB A;  5F0G A;  1Z7P A;  5J9B A;  2VUP A;  2VM2 A;  3MDK A;  4PX1 A;  4WF4 A;  5ECH B;  6GSY A;  2QC7 A;  2I3Y A;  4YKG A;  3ZZX A;  3ZIV A;  1ERU A;  3A2X A;  1PA3 A;  4MMM A;  2LTK A;  2NPB A;  2GSR A;  1GLP A;  3FHK A;  2EC4 A;  4Q5N A;  3O76 A;  2HYX A;  3LWA A;  2H76 A;  2WGR A;  5J9C A;  3A5I A;  2LJA A;  1B8X A;  4JZQ A;  4K2D A;  1GLQ A;  3QAG A;  4EKZ A;  2V6K A;  1YF0 A;  2PGT A;  3KTL A;  1A2M A;  5DJL A;  4PQI A;  1ZZY A;  1FOV A;  3MYD A;  2OBI A;  4BL7 B;  3MAK A;  3DWV A;  1SJ6 A;  1V98 A;  3QAW A;  1TRV A;  2KLX A;  2VL3 A;  4XCS A;  3HVX A;  3Q6O A;  3KM6 A;  2N5F A;  3D4T A;  3KP9 A;  2HI7 A;  3J7Y k;  2B5E A;  1U6T A;  2P0G A;  2NVL A;  1TP9 A;  2R0G A;  4USS A;  1JZO A;  2WRT A;  1SD9 A;  4MF7 A;  2EIR A;  3GRX A;  4GTU A;  1M2A A;  1TOF A;  4RUV A;  2DJ2 A;  4G0L A;  2M80 A;  5HFG A;  4XRA A;  1MTC A;  2CQ9 A;  1XXU A;  3GKX A;  2PN8 A;  2L59 A;  1Z7R A;  4BVY B;  2HRF A;  3VLN A;  1SU9 A;  2PVO C;  4O32 A;  3F6F A;  5H5Q A;  3WGX A;  3QAV A;  3ME8 A;  1ZYE A;  2NDO A;  2AV4 A;  4JED A;  4ZBD A;  4K0N A;  2I81 A;  4KDX A;  3TDG A;  3NIV A;  4IEL A;  2FD3 A;  1DE1 A;  4EIQ A;  4Z7X A;  1ZYP A;  3L9S A;  2WUL A;  2X49 A;  1NM3 A;  3CBU A;  4K2X A;  1GSD A;  3GST A;  4MNN A;  2FWF A;  3UMA A;  2GGT A;  2CAI A;  2DKH A;  1M3J A;  1TI3 A;  20GS A;  2GST A;  2HSY A;  1CQH A;  2B6M A;  3VPQ A;  3TJJ A;  2PUK C;  3VWU A;  4KF9 A;  1HQO A;  3PPU A;  5G5F A;  1SYX A;  5DAL A;  1AQX A;  1X5D A;  1YKC A;  4GSN A;  1R5A A;  4KSO A;  4X43 A;  5DAK B;  1XOB A;  2HNL A;  1ILO A;  4EVM A;  4XS6 A;  3IRA A;  2H75 A;  2B1L A;  4FYC A;  3IR4 A;  3D0Z A;  2KP1 A;  3UEM A;  1EV4 A;  2MMO A;  2GQL A;  1XVW A;  3D22 A;  1F9M A;  4WR4 A;  2HZE B;  3WYW A;  4KB3 A;  3DD3 A;  5CP1 A;  1ZYQ B;  5LCZ A;  3HDC A;  2L4C A;  3LYK A;  5LD0 A;  1TU8 A;  4F0C A;  6GSW A;  3FZA A;  1K0A A;  3QR6 A;  1HNC A;  2JU5 A;  2KUC A;  1B4Q A;  1Z6N A;  2FWE A;  4E8H A;  3M9K A;  1HNA A;  4I5Q A;  3EMP A;  4KND A;  3ZVJ D;  3F4T A;  2FLS A;  5G5E A;  2CX4 A;  4EUY A;  1GTA A;  3HZ8 A;  1O8W A;  1VF1 A;  3QD9 A;  3TOU A;  2N5A A;  5D9X A;  1EWX A;  3MNG A;  4NV5 A;  3CRU A;  1XCC A;  1TTZ A;  4F82 A;  5ABR A;  3UJ1 A;  2MZC A;  4ML1 A;  5CRD A;  2J23 A;  1PSQ A;  3KTB A;  3DYR A;  5CRH A;  2H70 A;  2P31 A;  3DRN A;  2FHE A;  4K0G A;  5F05 A;  1PL2 A;  3HJO A;  2GQM A;  1SKS B;  1SL0 B;  2WDU A;  4NV2 A;  1A8Y A;  6GSS A;  1F3A A;  5EY6 A;  4TKY A;  4IP6 A;  1Z9H A;  3UOM A;  1EP7 A;  4QQ7 A;  4ECI A;  3HZ4 A;  2R5G A;  2R3X A;  3L9U A;  3TUE A;  4HQZ A;  13GS A;  3LEF A;  5G30 A;  5ECP B;  4WF5 A;  2BTO T;  5ECK B;  4IBP A;  10GS A;  3H4K A;  5ENU A;  3HD5 A;  1GL8 A;  1JFU A;  1DSB A;  1YDK A;  2M46 A;  2C0D A;  3HVN A;  1Z6M A;  1M99 A;  4IGJ A;  4TW5 A;  3FMW A;  2DC5 A;  4HSC X;  2CAQ A;  1W4V A;  4DSS A;  2X8C A;  1A0R P;  4NWY A;  3A2V A;  2YNX A;  1V2A A;  4ECB A;  2OE1 A;  2OJL A;  1HNB A;  3KGK A;  3J7Y b;  3EMX A;  5GSS A;  4ISD A;  2QA1 A;  5E59 A;  4N30 A;  3G7I A;  1A2J A;  2VD0 A;  4FQU A;  1SJI A;  1QQ2 A;  1C72 A;  3KH9 A;  3RAZ A;  2B1K A;  2V2G A;  4MLY A;  4BA7 A;  2H1G A;  5CAX A;  1K3L A;  5B8A A;  4EO3 A;  5AN1 A;  1XWB A;  4H86 A;  3FKF A;  4I2U A;  4AJ8 A;  2YWO A;  2HT9 A;  4BWQ A;  5B6N A;  4HU7 A;  2OKA A;  3L9V A;  3ED3 A;  4NMU A;  2LRC A;  4Q5Q A;  3TJG A;  1R4W A;  2H6Y A;  4X0X A;  3ZLP A;  1YY7 A;  4MK3 A;  1RK4 A;  5ECS A;  1YKA A;  3MSZ A;  2E2M A;  2V1M A;  3TKQ A;  3DML A;  3HA9 A;  3IPZ A;  4MAB A;  3LG6 A;  4OCE A;  2GZZ A;  5AIS A;  1KBN A;  1TDI A;  5INY A;  3E3E A;  4Q5F A;  4IW9 A;  4V2L A;  1PD2 1;  5EPF A;  3ZVJ A;  2GLR A;  6GSX A;  4EE0 A;  1K0C A;  1XBS A;  1PRX A;  1QGV A;  3IA1 A;  4HI7 A;  1XOA A;  2FUG 2;  5IO0 A;  1B4P A;  1M0U A;  2LV3 A;  1XW6 A;  4MP4 A;  1YEX A;  4CY6 A;  3TKS E;  4ZBB A;  5CRW A;  1YJ6 A;  3IAS 2;  2MYG A;  4YQV A;  1XVQ A;  3F63 A;  2OBK A;  3GUS A;  1XPV A;  4POK A;  3CTF A;  5J4U A;  1N2A A;  1GUM A;  2K8V A;  4FIW A;  12GS A;  2LNS A;  1SK2 A;  4ZL8 A;  3LOR A;  1O85 A;  4OO5 A;  2DJK A;  1VF4 A;  3D6I A;  3ZIJ A;  4D73 A;  1B9X C;  3CYN A;  4WET A;  2PMT A;  1R7H A;  5IMF A;  3GKK A;  3GL5 A;  1LBK A;  2I4A A;  5D8I A;  1F2E A;  3QFA C;  1SK1 A;  2B5Y A;  1N8J A;  2K9F A;  3D21 A;  2YZU A;  1EZK A;  3GL3 A;  2E2G A;  3ZTL A;  1QK8 A;  3GKM A;  2LJR A;  4ACS A;  2V41 A;  5HR0 A;  2LS5 A;  1O73 A;  3RHC A;  3KH7 A;  3EYT A;  3DIE A;  4CHS A;  2CVD A;  5IMD A;  1AQV A;  3UAR A;  4OFN A;  2IMF A;  2OAC A;  5IM9 A;  1TKD B;  5EVO A;  4IN0 A;  2YZH A;  2QA2 A;  1AC1 A;  1S3C A;  2H73 A;  5IMZ A;  2ON5 A;  3LSZ A;  1XWG A;  4EXJ A;  2H1A A;  4IQA A;  1TU7 A;  4G9H A;  3FRC A;  4YQM A;  4TR0 A;  1SK0 A;  1AW9 A;  3KD0 A;  2NBS A;  1AAZ A;  4ZL7 A;  1T7P B;  1BQ7 A;  2LJK A;  3L78 A;  1TK5 B;  2F8F A;  3ZMK A;  2JAC A;  4YAV A;  2YAN A;  5DBQ A;  2YOI A;  5B7C A;  2LUS A;  5IO2 A;  3ISO A;  5AGY A;  1HD2 A;  3M1G A;  4TR4 A;  4KUN A;  2AAW A;  4PUA A;  4IKH A;  4EF0 A;  1X9M B;  4CY8 A;  2Z9S A;  5CRE A;  2YWI A;  4XHM A;  1JZW A;  4TRX A;  3LQ7 A;  2VO4 A;  4HZ4 A;  4JR6 A;  3IXR A;  5HFK A;  3GMF A;  1GSU A;  3EU4 A;  3UVT A;  4F2I A;  1IYI A;  2J9H A;  3FR6 A;  1GSS A;  3I43 A;  5E4W A;  2PWJ A;  3CXG A;  3ME7 A;  1SKR B;  2FCH A;  1B9Y C;  3LXT A;  6GSU A;  4XS4 B;  5ID2 A;  4TXO B;  5G1L A;  4HEA 2;  3KP8 A;  3M9J A;  4KH7 A;  4ULX A;  3IBH A;  2IPA A;  1ZL9 A;  2TRC P;  2HRN A;  2JZS A;  3HVV A;  4MH2 A;  3EU3 A;  1ZOF A;  2HZF A;  3FY7 A;  2XBI A;  2LRT A;  1S3R A;  1AXD A;  3KEB A;  5IMC A;  3DKS A;  1QXH A;  2IME A;  3M8N A;  4F03 A;  4AJ7 A;  2QSI A;  3F4R A;  4MA9 A;  1GUL A;  2R4V A;  4I8B A;  5F06 A;  1OKD A;  2H6X A;  1Q4J A;  4ICY A;  4ID0 A;  3GKN A;  1LU4 A;  4G10 A;  2L57 A;  2GS3 A;  4TR1 B;  5IOW A;  4MH3 A;  3RDW A;  1G6Y A;  3I69 A;  1V9W A;  2OE0 A;  3PIN A;  3ZML A;  4BVX A;  5DDL A;  1K3Y A;  3CMI A;  3F0I A;  2GSQ A;  2MBS A;  1K0D A;  1O6J A;  3D4M A;  3IAM 2;  2B5X A;  5FWG A;  1I5G A;  5D93 A;  1GUH A;  2A2P A;  3FZ5 A;  3GX0 A;  2H19 A;  3E0U A;  1KTE A;  4FYB A;  4KAE A;  3EUR A;  1SD8 A;  2MMA A;  3UBL A;  3A5W A;  4ZB8 A;  5DVB A;  4TVE A;  3VFI A;  4PNF A;  2FA4 A;  2GQK A;  4J57 E;  4YKF A;  2CT6 A;  2X8G A;  3D5J A;  5JCW A;  5A5K A;  4ILF A;  2DJ1 A;  3QPM A;  4F9Z A;  2F9S A;  2YP6 A;  3HKR A;  4Z2R A;  1ST9 A;  2PBJ A;  4NHW A;  2B7J A;  1TI1 A;  2YJH A;  5GST A;  1WWJ A;  5KN1 A;  1XWK A;  2A4V A;  2H1B A;  1MEK A;  3BJ5 A;  2ALB A;  5FHI A;  2F8A A;  1PL1 A;  1MDJ A;  3RHB A;  3FK8 A;  1ABA A;  3VWX A;  2LQO A;  4K8M A;  1QMV A;  1XFL A;  2L4Q A;  5DQY A;  3TCO A;  2VM1 A;  3FZ4 A;  3C71 A;  1W89 A;  1EP8 A;  1VF3 A;  4HU9 A;  2VL2 A;  3FR3 A;  2XC2 A;  1TJD A;  4G0K A;  3ZYW A;  3KMO A;  2GSS A;  3G7Y A;  3NOF A;  3KJY A;  2WFC A;  3TOT A;  1Y6E A;  1XZO A;  2H0H A;  3FYG A;  4OO4 A;  2V6O A;  2VL2 C;  1SKW B;  3GA4 A;  4GRF A;  3IE3 A;  1XG8 A;  2HXK A;  3TJF A;  5ECR B;  4BIK A;  4KCA A;  4O5R A;  2L5O A;  4AJ6 A;  1R5P A;  1FW1 A;  3FEU A;  1PX6 A;  5ELA A;  1M9A A;  4ECC A;  1GP1 A;  5KOW A;  1ZMA A;  2B7K A;  2JZT A;  4N10 A;  5DCH A;  4HUA A;  5HQP A;  1TXX A;  2XBQ A;  1T4Z A;  3TRQ A;  2H66 A;  4OWY A;  2CZ3 A;  1JZR A;  2IFQ A;  2PPT A;  3IHQ A;  3ZIT A;  3PR8 A;  1USB A;  3FW2 A;  1ZYN A;  1UC7 A;  3LW9 A;  4J56 E;  5HR1 A;  3TKS C;  2VL9 A;  4DVC A;  4FYU A;  4ZB9 A;  3EWL A;  4HJ2 A;  1ERV A;  5L71 A;  2FWG A;  3APS A;  3EIN A;  3IC8 A;  1GNE A;  3SWL A;  2RUF A;  4MZC A;  3KXO A;  5CO3 A;  1MD3 A;  2I1U A;  4HJM A;  2IWT A;  1PN0 A;  1GWC A;  2YN1 A;  4MPG A;  1JHB A;  3HVS A;  5CNW A;  4X1U A;  1TW9 A;  1LJR A;  2VD1 A;  4DSQ A;  2R37 A;  3WD6 A;  4KGI A;  4GLT A;  1K0B A;  4FO5 A;  1OAZ A;  2WJU A;  4RI7 A;  3CRT A;  1JLV A;  2O89 A;  2HLS A;  2O85 A;  3JCM L;  2YJ7 A;  1PKZ A;  5CRG A;  2RM6 A;  1X0R A;  4K7I A;  1M3I A;  4MJB A;  2C3T A;  4JE1 A;  2DKI A;  5ECI B;  1NHY A;  2YPM A;  3DVX A;  1GUK A;  3GTU A;  5F8B A;  1SYR A;  1JLW A;  3Q74 A;  1M7T A;  2N5B A;  4IQ1 A;  1V40 A;  3BOA A;  1FOH A;  4L0W A;  1OC9 A;  2CZ2 A;  2AHE A;  4MJE A;  5JCU A;  5D9W A;  5C04 A;  3KZQ A;  5DAL B;  2DSA A;  2EIQ A;  2VCT A;  1FHE A;  2YWN A;  2LQQ A;  5HFI A;  3UIW A;  2P5R A;  5B8B A;  1OC3 A;  3DXB A;  1ON4 A;  3FR9 A;  2O87 A;  5JWO B;  2VLT A;  4F0B A;  4XTS A;  1U88 A;  1OE7 A;  2IIY A;  2VCW A;  1GRX A;  4TR3 A;  3GFK A;  3QCP A;  4TN8 A;  3C1R A;  3S9F A;  3TJB A;  3TGZ A;  5D9V A;  3I6A A;  3DEX A;  3H8Q A;  3RPN A;  3US3 A;  2PU9 C;  2GZP A;  2PER A;  3HJP A;  1XWA A;  4ZXG A;  2VCX A;  5LNK e;  5IQY A;  1THO A;  5DCG A;  1Q98 A;  1A23 A;  6GST A;  1RQM A;  4TOP A;  5JWR B;  4KX4 A;  2GDR A;  4L8E A;  3BCK A;  2VLU A;  2R0C A;  4RQR A;  4O5Q A;  2IL3 A;  2XPE A;  3LJR A;  4GXZ A;  2E7P A;  1EOG A;  4L5O A;  5KN3 A;  1MDK A;  1NHO A;  3A2W A;  2YCD A;  3F3R A;  1K0N A;  1AIU A;  4GF0 A;  3HJM A;  16GS A;  5H5S A;  4TXV A;  1J0F A;  4NAX A;  4ZBA A;  4Z2U A;  4N11 A;  4BL7 A;  2ZUP A;  1GSF A;  4G2E A;  4EIP A;  4PXO A;  2FY6 A;  3V1W A;  1J08 A;  1EGO A;  3GHA A;  2DIY A;  2CVK A;  2MMN A;  3O6T A;  4N0Z A;  5CYY A;  4KSM A;  2VIM A;  2EIO A;  4X4J A;  9GSS A;  4PQ1 A;  5AIX A;  4YAP A;  1GSE A;  2YV7 A;  1U3A A;  3PH9 A;  1A24 A;  4XS1 A;  1T00 A;  3F8U A;  1WPI A;  2C0G A;  3GUR A;  5J3R A;  1X5E A;  3ZFL A;  4BVY A;  3EVI A;  4POM A;  5C00 A;  2OAD A;  3M0F A;  1H4O A;  5GZZ B;  1SL1 B;  1AQW A;  4DSS B;  2YWM A;  1T4Y A;  1YQ1 A;  4GWR A;  5DJM A;  7GSS A;  1UVZ A;  3E9J B;  4MJA A;  2H0G A;  4WKW A;  2ZNM A;  4LL4 B;  4N0V A;  2H6Z A;  3KMN A;  4YH2 A;  5IMA A;  1ZCP A;  2HSM A;  2X4A A;  3VK9 A;  2K6V A;  2ES7 A;  4GQC A;  1K0M A;  1PFO A;  2BJX A;  4MPF A;  1KNG A;  3R3E A;  5A4W A;  3C8E A;  2H1D A;  4PNG A;  2IMK A;  4K1F A;  1IYH A;  1O81 A;  2H0I A;  5D96 A;  3HHV A;  3H93 A;  3L4N A;  4IP1 A;  4DEJ A;  3IV4 A;  1T1V A;  4K5R A;  2AUV A;  2RII A;  3F6D A;  1YZX A;  2DMM A;  4HZ2 A;  5GAN D;  3BBY A;  3CTG A;  2GT5 A;  3P8W A;  2MBT A;  3HY2 A;  3VI5 A;  2O7K A;  2IMD A;  4OFT A;  3IOS A;  1X9S B;  1GH2 A;  1FB6 A;  2REM A;  2HZE A;  3IK9 A;  1BG5 A;  2VLV A;  3DVW A;  4IHU A;  5G1K A;  3UVH A;  4KCE A;  3BCI A;  2MMZ A;  1A8L A;  2YV9 A;  1OYJ A;  5D73 A;  2R6K A;  4PQH A;  4NHZ A;  1DE2 A;  4BPY A;  1K0O A;  2GZY A;  3F9U A;  1GTU A;  4KW6 A;  3W6G A;  2F3M A;  2ON7 A;  4D73 B;  4ZL9 A;  4OD7 A;  1DBY A;  2KP2 A;  2X99 A;  1OC8 A;  2A4H A;  3CSI A;  2IMI A;  2WS2 A;  1UN2 A;  4I6X A;  3U5R E;  1O7U A;  1DUG A;  1PMT A;  3VUR A;  5ECN B;  3ERF A;  4XIH A;  4MF5 A;  2OA7 A;  2X64 A;  4WXT A;  1OVN A;  2LNT A;  4YQU A;  2D2Z A;  2XPD A;  2XHF A;  1GTI A;  6GSV A;  1MD4 A;  1NW2 A;  4NXI A;  3MIX A;  2L5L A;  2VCQ A;  4KDU A;  1HYU A;  3WGD A;  4I97 A;  1ML6 A;  4HDE A;  5KOX A;  1E2Y A;  1F6M C;  4QL7 A;  4PUF C;  3M3M A;  1YF1 A;  3CQF A;  2C80 A;  5JCG A;  2HE3 A;  4HQS A;  3TKP A;  4K9Z A;  1Z5Y E;  3C73 A;  3U6V A;  1SJZ A;  18GS A;  3IC4 A;  3P2A A;  5G31 A;  3VWW A;  3O3T A;  1YEP A;  1G0T A;  2C4J A;  3BD2 A;  2FWH A;  5J41 A;  4PTS A;  8GSS A;  3UL3 A;  4POL A;  3P90 A;  4HS1 A;  3Q19 A;  1WOU A;  1M2D A;  4AGS A;  4LLR A;  2G2Q A;  14GS A;  2C0E A;  5H5R A;  4JU5 A;  3W8J A;  3W8S A;  3RPP A;  1R26 A;  5J5N A;  1WMJ A;  2A2R A;  3KIJ A;  1RW1 A;  2LRN A;  4HOJ A;  1K3O A;  2BMX A;  3GV1 A;  3QMX A;  4Q5R A;  1E6B A;  1XWC A;  3LXZ A;  1F3B A;  3HXS A;  2B3S A;  4O92 A;  1TRW A;  2V32 A;  5ID2 B;  22GS A;  2DML A;  1BED A;  4WEY A;  3TRX A;  4CW9 A;  2AYT A;  4GST A;  5IPH A;  3OR5 A;  2DJ0 A;  17GS A;  2RLI A;  4WR5 A;  4OCF A;  3TKS A;  3PGT A;  1WRY A;  2HRA A;  4MDC A;  1ERT A;  2P5Q A;  4CDO A;  5IIZ A;  1EV9 A;  4JRR A;  4GSS A;  3VI7 A;  3N9J A;  1A0F A;  2TRX A;  4POB A;  3ZFB A;  1KEB A;  5F07 A;  4ZIL A;  1GTB A;  1CQG A;  4LMW A;  1VRS D;  1MDI A;  3QFB C;  1V58 A;  2HFD A;  1FAA A;  2O8V B;  2JSZ A;  1M9B A;  4V2N A;  4AF2 A;  1S3A A;  2WB9 A;  3IK7 A;  4LMV A;  3GNJ A;  2LEG A;  4FH8 A;  1Z3E A;  4DSR A;  4RI6 A;  4BVX B;  1S3D A;  1FO5 A;  1T3B A;  2R2J A;  3GIX A;  3KCM A;  1AUC A;  1I9D A;  2DBC A;  4OFM A;  1M2B A;  3QOU A;  1FVK A;  5JWQ B;  2L6D A;  3L0H A;  1G7O A;  3GYK A;  2E0Q A;  4Z2T A;  3EC3 A;  1U87 A;  4MZW A;  1O8X A;  1TRS A;  2UZ8 A;  1WJK A;  3LFL A;  2C1Y A;  3ZL5 A;  3GN3 A;  5B6M A;  2C0F A;  2NTO A;  4K6X A;  4L5L A;  1BX9 A;  3I9V 2;  4K5S A;  3FZ9 A;  1G6W A;  2M72 A;  3TJK A;  3GX8 A;  1U3I A;  5GAP D;  4K7N A;  4E8E A;  1JZD A;  2RUE A;  1X5C A;  1VGL A;  5ELG A;  2H72 A;  3TKR A;  1FG4 A;  1EEJ A;  3WGE A;  2DLX A;  5DQS A;  4JR4 A;  4ZIJ A;  2KHP A;  3H79 A;  1WIK A;  2GT6 A;  2WZ9 A;  3APQ A;  5BRT A;  2GTU A;  1TK0 B;  5EL8 A;  3G7J A;  5IPG A;  1G7E A;  1A2L A;  2FGX A;  4J2F A;  1NSW A;  2CA8 A;  3IDV A;  2RM5 A;  3GSS A;  3LGC A;  1BAY A;  2H01 A;  2ZCT A;  2H30 A;  2I9H A;  4IJ3 A;  5KN0 A;  4O5U A;  4I2T A;  1PQN A;  3DGQ A;  1WP0 A;  1SEN A;  3QDN A;  3H1N A;  4G0I A;  1PX7 A;  1EEM A;  2WCI A;  4A5P A;  1XIY A;  1TK8 B;  4PUR A;  4KDY A;  1ACV A;  5AIV A;  4BWS A;  1GNW A;  2JAD A;  1F37 A;  2H74 A;  4V1A g;  3WT1 A;  4GQF A;  3ERG A;  3UAP A;  2DJ3 A;  5IMV A;  3RBT A;  1EGR A;  4WBJ A;  4EDZ A;  2HSH A;  2TIR A;  1B48 A;  3G9B A;  5COH A;  1H75 A;  2PVQ A;  4QL9 A;  3R2Q A;  3AY8 A;  2X8H A;  4P3Y B;  1VF2 A;  2JL4 A;  4O7H A;  2QGV A;  4K7O A;  4XS4 A;  5FT3 A;  2G0F A;  4TXO A;  1J9B A;  3SBC A;  1X9W B;  2CV4 A;  2IFQ B;  1XW5 A;  2VCZ A;  5HR3 A;  3P7X A;  1QUW A;  2DIZ A;  1Y25 A;  3APO A;  1GSY A;  3N5O A;  2HRK A;  3ERW A;  5IOX A;  4G19 A;  1UA5 A;  3HYP A;  2F51 A;  19GS A;  3C7M A;  1FVJ A;  2KOK A;  1WE0 A;  3A3T A;  4OMV A;  1T8E B;  5BMU A;  2OE3 A;  4LL1 B;  2LST A;  2C3Q A;  4WBR D;  3F3Q A;  2DJJ A;  3UBK A;  4MJC A;  5ECM B;  2R0P A;  1PKW A;  1V57 A;  2K8S A;  4TR1 A;  3HCZ A;  1BJX A;  2C8U A;  2AJQ B;  2LKU A;  3GH9 A;  1XW9 A;  5A4U A;  1FB0 A;  4IVF A;  4ZB6 A;  2K18 A; 
#chains in the Genus database with same CATH homology
 1URM A;  5G2Z A;  1OKT A;  5KN2 A;  2FA8 A;  4ML6 A;  3ZRD A;  1GSQ A;  3EE2 A;  1ZGN A;  2FNO A;  1SL2 B;  4MF6 A;  4L0U A;  4IJI A;  3Q18 A;  3GH6 A;  3TRP A;  3K8N A;  4PGT A;  5ECL B;  2A2S A;  2VAF A;  1BYE A;  3EPT A;  4NPB A;  5HR2 A;  4V1A p;  1THX A;  5ECQ B;  3NZN A;  1TRU A;  4IS0 A;  3F4S A;  3C1S A;  4ECJ A;  2IN3 A;  3GTU B;  4MCU A;  2GVP A;  2H8L A;  5ECO B;  2JSY A;  4EDY A;  2AB6 A;  2CX3 A;  2IJY A;  5D9T A;  1OE8 A;  1OC9 B;  4GCI A;  4RQX A;  2JZR A;  4KE3 A;  4JBB A;  2L6C A;  4XRD A;  5A4V A;  1PGT A;  2C3N A;  11GS A;  1QFN A;  3LYP A;  5KEJ A;  4KA0 A;  1PN9 A;  4EC0 A;  2QKE A;  3VWV A;  2CVB A;  3TB2 A;  3MWH A;  4EL1 A;  3CSH A;  5DAK A;  1EOH A;  3VPT A;  2VOC A;  3IHG A;  3WT2 A;  4V2M A;  1ERW A;  3CSJ A;  3ZRE A;  2H71 A;  2VCV A;  4LA1 A;  4MZB A;  5F0G A;  1Z7P A;  5J9B A;  2VUP A;  2VM2 A;  3MDK A;  4PX1 A;  4WF4 A;  5ECH B;  6GSY A;  2QC7 A;  2I3Y A;  4YKG A;  3ZZX A;  3ZIV A;  1ERU A;  3A2X A;  1PA3 A;  4MMM A;  2LTK A;  2NPB A;  2GSR A;  1GLP A;  3FHK A;  2EC4 A;  4Q5N A;  3O76 A;  2HYX A;  3LWA A;  2H76 A;  2WGR A;  5J9C A;  3A5I A;  2LJA A;  1B8X A;  4JZQ A;  4K2D A;  1GLQ A;  3QAG A;  4EKZ A;  2V6K A;  1YF0 A;  2PGT A;  3KTL A;  1A2M A;  5DJL A;  4PQI A;  1ZZY A;  1FOV A;  3MYD A;  2OBI A;  4BL7 B;  3MAK A;  3DWV A;  1SJ6 A;  1V98 A;  3QAW A;  1TRV A;  2KLX A;  2VL3 A;  4XCS A;  3HVX A;  3Q6O A;  3KM6 A;  2N5F A;  3D4T A;  3KP9 A;  2HI7 A;  3J7Y k;  2B5E A;  1U6T A;  2P0G A;  2NVL A;  1TP9 A;  2R0G A;  4USS A;  1JZO A;  2WRT A;  1SD9 A;  4MF7 A;  2EIR A;  3GRX A;  4GTU A;  1M2A A;  1TOF A;  4RUV A;  2DJ2 A;  4G0L A;  2M80 A;  5HFG A;  4XRA A;  1MTC A;  2CQ9 A;  1XXU A;  3GKX A;  2PN8 A;  2L59 A;  1Z7R A;  4BVY B;  2HRF A;  3VLN A;  1SU9 A;  2PVO C;  4O32 A;  3F6F A;  5H5Q A;  3WGX A;  3QAV A;  3ME8 A;  1ZYE A;  2NDO A;  2AV4 A;  4JED A;  4ZBD A;  4K0N A;  2I81 A;  4KDX A;  3TDG A;  3NIV A;  4IEL A;  2FD3 A;  1DE1 A;  4EIQ A;  4Z7X A;  1ZYP A;  3L9S A;  2WUL A;  2X49 A;  1NM3 A;  3CBU A;  4K2X A;  1GSD A;  3GST A;  4MNN A;  2FWF A;  3UMA A;  2GGT A;  2CAI A;  2DKH A;  2GST A;  1TI3 A;  20GS A;  2HSY A;  1CQH A;  2B6M A;  3VPQ A;  3TJJ A;  2PUK C;  3VWU A;  4KF9 A;  1HQO A;  3PPU A;  5G5F A;  1SYX A;  5DAL A;  1AQX A;  1X5D A;  1YKC A;  4GSN A;  1R5A A;  4KSO A;  4X43 A;  5DAK B;  1XOB A;  2HNL A;  1ILO A;  4EVM A;  4XS6 A;  3IRA A;  2H75 A;  2B1L A;  4FYC A;  3IR4 A;  3D0Z A;  2KP1 A;  3UEM A;  1EV4 A;  2MMO A;  2GQL A;  1XVW A;  3D22 A;  1F9M A;  4WR4 A;  2HZE B;  3WYW A;  4KB3 A;  3DD3 A;  5CP1 A;  1ZYQ B;  5LCZ A;  3HDC A;  2L4C A;  3LYK A;  5LD0 A;  1TU8 A;  4F0C A;  6GSW A;  3FZA A;  1K0A A;  3QR6 A;  1HNC A;  2JU5 A;  2KUC A;  1B4Q A;  1Z6N A;  2FWE A;  4E8H A;  3M9K A;  1HNA A;  4I5Q A;  3EMP A;  4KND A;  3ZVJ D;  3F4T A;  2FLS A;  5G5E A;  2CX4 A;  4EUY A;  1GTA A;  3HZ8 A;  1O8W A;  1VF1 A;  3QD9 A;  3TOU A;  2N5A A;  5D9X A;  1EWX A;  3MNG A;  4NV5 A;  3CRU A;  1XCC A;  1TTZ A;  4F82 A;  5ABR A;  3UJ1 A;  2MZC A;  4ML1 A;  5CRD A;  2J23 A;  1PSQ A;  3KTB A;  3DYR A;  5CRH A;  2H70 A;  2P31 A;  3DRN A;  2FHE A;  4K0G A;  5F05 A;  1PL2 A;  3HJO A;  2GQM A;  1SKS B;  1SL0 B;  2WDU A;  4NV2 A;  1A8Y A;  6GSS A;  1F3A A;  5EY6 A;  4TKY A;  4IP6 A;  1Z9H A;  3UOM A;  1EP7 A;  4QQ7 A;  4ECI A;  3HZ4 A;  2R5G A;  2R3X A;  3L9U A;  3TUE A;  4HQZ A;  13GS A;  3LEF A;  5G30 A;  5ECP B;  4WF5 A;  2BTO T;  5ECK B;  4IBP A;  10GS A;  3H4K A;  5ENU A;  3HD5 A;  1GL8 A;  1JFU A;  1DSB A;  1YDK A;  2M46 A;  2C0D A;  1Z6M A;  1M99 A;  4IGJ A;  4TW5 A;  3FMW A;  2DC5 A;  2CAQ A;  1W4V A;  4DSS A;  2X8C A;  1A0R P;  4NWY A;  3A2V A;  2YNX A;  1V2A A;  4ECB A;  2OE1 A;  2OJL A;  1HNB A;  3KGK A;  3J7Y b;  3EMX A;  5GSS A;  4ISD A;  2QA1 A;  5E59 A;  4N30 A;  3G7I A;  1A2J A;  2VD0 A;  4FQU A;  1SJI A;  1QQ2 A;  1C72 A;  3KH9 A;  3RAZ A;  2B1K A;  2V2G A;  4MLY A;  4BA7 A;  2H1G A;  5CAX A;  1K3L A;  5B8A A;  4EO3 A;  5AN1 A;  1XWB A;  4H86 A;  3FKF A;  4I2U A;  4AJ8 A;  2YWO A;  2HT9 A;  4BWQ A;  5B6N A;  4HU7 A;  2OKA A;  3L9V A;  3ED3 A;  4NMU A;  2LRC A;  4Q5Q A;  3TJG A;  1R4W A;  2H6Y A;  4X0X A;  3ZLP A;  1YY7 A;  4MK3 A;  1RK4 A;  5ECS A;  1YKA A;  3MSZ A;  2E2M A;  2V1M A;  3TKQ A;  3DML A;  3HA9 A;  3IPZ A;  4MAB A;  3LG6 A;  4OCE A;  2GZZ A;  5AIS A;  1KBN A;  1TDI A;  5INY A;  3E3E A;  4Q5F A;  4IW9 A;  4V2L A;  1PD2 1;  5EPF A;  3ZVJ A;  2GLR A;  6GSX A;  4EE0 A;  1K0C A;  1XBS A;  1PRX A;  1QGV A;  3IA1 A;  4HI7 A;  1XOA A;  2FUG 2;  5IO0 A;  1B4P A;  1M0U A;  2LV3 A;  1XW6 A;  4MP4 A;  1YEX A;  4CY6 A;  3TKS E;  4ZBB A;  5CRW A;  1YJ6 A;  3IAS 2;  2MYG A;  4YQV A;  1XVQ A;  3F63 A;  2OBK A;  3GUS A;  1XPV A;  4POK A;  3CTF A;  5J4U A;  1N2A A;  1GUM A;  2K8V A;  4FIW A;  12GS A;  2LNS A;  1SK2 A;  4ZL8 A;  3LOR A;  1O85 A;  4OO5 A;  2DJK A;  1VF4 A;  3D6I A;  3ZIJ A;  4D73 A;  1B9X C;  3CYN A;  4WET A;  2PMT A;  1R7H A;  5IMF A;  3GKK A;  3GL5 A;  1LBK A;  2I4A A;  5D8I A;  1F2E A;  3QFA C;  1SK1 A;  2B5Y A;  1N8J A;  2K9F A;  3D21 A;  2YZU A;  1EZK A;  3GL3 A;  2E2G A;  3ZTL A;  1QK8 A;  3GKM A;  2LJR A;  4ACS A;  2V41 A;  5HR0 A;  2LS5 A;  1O73 A;  3RHC A;  3KH7 A;  3EYT A;  3DIE A;  4CHS A;  2CVD A;  5IMD A;  1AQV A;  3UAR A;  4OFN A;  2IMF A;  2OAC A;  5IM9 A;  1TKD B;  5EVO A;  4IN0 A;  2YZH A;  2QA2 A;  1AC1 A;  1S3C A;  2H73 A;  5IMZ A;  2ON5 A;  3LSZ A;  1XWG A;  4EXJ A;  2H1A A;  4IQA A;  1TU7 A;  4G9H A;  3FRC A;  4YQM A;  4TR0 A;  1SK0 A;  1AW9 A;  3KD0 A;  2NBS A;  1AAZ A;  4ZL7 A;  1T7P B;  1BQ7 A;  2LJK A;  3L78 A;  1TK5 B;  2F8F A;  3ZMK A;  2JAC A;  4YAV A;  2YAN A;  5DBQ A;  2YOI A;  5B7C A;  2LUS A;  5IO2 A;  3ISO A;  5AGY A;  1HD2 A;  3M1G A;  4TR4 A;  4KUN A;  2AAW A;  4PUA A;  4IKH A;  4EF0 A;  1X9M B;  4CY8 A;  2Z9S A;  5CRE A;  2YWI A;  4XHM A;  1JZW A;  4TRX A;  3LQ7 A;  2VO4 A;  4HZ4 A;  4JR6 A;  3IXR A;  5HFK A;  3GMF A;  1GSU A;  3EU4 A;  3UVT A;  4F2I A;  1IYI A;  2J9H A;  3FR6 A;  1GSS A;  3I43 A;  5E4W A;  2PWJ A;  3CXG A;  3ME7 A;  1SKR B;  2FCH A;  1B9Y C;  3LXT A;  6GSU A;  4XS4 B;  5ID2 A;  4TXO B;  5G1L A;  4HEA 2;  3KP8 A;  3M9J A;  4KH7 A;  4ULX A;  3IBH A;  2IPA A;  1ZL9 A;  2TRC P;  2HRN A;  2JZS A;  3HVV A;  4MH2 A;  3EU3 A;  1ZOF A;  2HZF A;  3FY7 A;  2XBI A;  2LRT A;  1AXD A;  3KEB A;  5IMC A;  3DKS A;  1QXH A;  2IME A;  3M8N A;  4F03 A;  4AJ7 A;  2QSI A;  3F4R A;  4MA9 A;  1GUL A;  2R4V A;  4I8B A;  5F06 A;  1OKD A;  2H6X A;  1Q4J A;  4ICY A;  4ID0 A;  3GKN A;  1LU4 A;  4G10 A;  2L57 A;  2GS3 A;  4TR1 B;  5IOW A;  4MH3 A;  3RDW A;  1G6Y A;  3I69 A;  1V9W A;  2OE0 A;  3PIN A;  3ZML A;  4BVX A;  5DDL A;  1K3Y A;  3CMI A;  3F0I A;  2GSQ A;  2MBS A;  1K0D A;  1O6J A;  3D4M A;  3IAM 2;  2B5X A;  5FWG A;  1I5G A;  5D93 A;  1GUH A;  2A2P A;  3FZ5 A;  3GX0 A;  2H19 A;  3E0U A;  1KTE A;  4FYB A;  4KAE A;  3EUR A;  1SD8 A;  2MMA A;  3UBL A;  3A5W A;  4ZB8 A;  5DVB A;  4TVE A;  3VFI A;  4PNF A;  2FA4 A;  2GQK A;  4J57 E;  4YKF A;  2CT6 A;  2X8G A;  3D5J A;  5JCW A;  5A5K A;  4ILF A;  2DJ1 A;  3QPM A;  4F9Z A;  2F9S A;  2YP6 A;  3HKR A;  4Z2R A;  1ST9 A;  2PBJ A;  4NHW A;  2B7J A;  1TI1 A;  2YJH A;  5GST A;  1WWJ A;  5KN1 A;  1XWK A;  2A4V A;  2H1B A;  1MEK A;  3BJ5 A;  2ALB A;  5FHI A;  2F8A A;  1PL1 A;  1MDJ A;  3RHB A;  3FK8 A;  1ABA A;  3VWX A;  2LQO A;  4K8M A;  1QMV A;  1XFL A;  2L4Q A;  5DQY A;  3TCO A;  2VM1 A;  3FZ4 A;  3C71 A;  1W89 A;  1EP8 A;  1VF3 A;  4HU9 A;  2VL2 A;  3FR3 A;  2XC2 A;  1TJD A;  4G0K A;  3ZYW A;  3KMO A;  2GSS A;  3G7Y A;  3NOF A;  3KJY A;  2WFC A;  3TOT A;  1Y6E A;  1XZO A;  2H0H A;  3FYG A;  4OO4 A;  2V6O A;  2VL2 C;  1SKW B;  3GA4 A;  4GRF A;  3IE3 A;  2HXK A;  3TJF A;  5ECR B;  4KCA A;  4O5R A;  2L5O A;  4AJ6 A;  1R5P A;  1FW1 A;  3FEU A;  1PX6 A;  5ELA A;  1M9A A;  4ECC A;  1GP1 A;  5KOW A;  1ZMA A;  2B7K A;  2JZT A;  4N10 A;  5DCH A;  4HUA A;  5HQP A;  1TXX A;  2XBQ A;  1T4Z A;  3TRQ A;  2H66 A;  4OWY A;  2CZ3 A;  1JZR A;  2IFQ A;  2PPT A;  3IHQ A;  3ZIT A;  3PR8 A;  1USB A;  3FW2 A;  1ZYN A;  1UC7 A;  3LW9 A;  4J56 E;  5HR1 A;  3TKS C;  2VL9 A;  4DVC A;  4FYU A;  4ZB9 A;  3EWL A;  4HJ2 A;  1ERV A;  5L71 A;  2FWG A;  3APS A;  3EIN A;  3IC8 A;  1GNE A;  3SWL A;  2RUF A;  4MZC A;  3KXO A;  5CO3 A;  1MD3 A;  2I1U A;  4HJM A;  2IWT A;  1PN0 A;  1GWC A;  2YN1 A;  4MPG A;  1JHB A;  3HVS A;  5CNW A;  4X1U A;  1TW9 A;  1LJR A;  2VD1 A;  4DSQ A;  2R37 A;  3WD6 A;  4KGI A;  4GLT A;  1K0B A;  4FO5 A;  1OAZ A;  2WJU A;  4RI7 A;  3CRT A;  1JLV A;  2O89 A;  2HLS A;  2O85 A;  3JCM L;  2YJ7 A;  1PKZ A;  5CRG A;  2RM6 A;  1X0R A;  4K7I A;  4MJB A;  2C3T A;  4JE1 A;  2DKI A;  5ECI B;  1NHY A;  2YPM A;  3DVX A;  1GUK A;  3GTU A;  5F8B A;  1SYR A;  1JLW A;  3Q74 A;  1M7T A;  2N5B A;  4IQ1 A;  1V40 A;  3BOA A;  1FOH A;  4L0W A;  1OC9 A;  2CZ2 A;  2AHE A;  4MJE A;  5JCU A;  5D9W A;  5C04 A;  3KZQ A;  5DAL B;  2DSA A;  2EIQ A;  2VCT A;  1FHE A;  2YWN A;  2LQQ A;  5HFI A;  3UIW A;  2P5R A;  5B8B A;  1OC3 A;  3DXB A;  1ON4 A;  3FR9 A;  2O87 A;  5JWO B;  2VLT A;  4F0B A;  4XTS A;  1U88 A;  1OE7 A;  2IIY A;  2VCW A;  1GRX A;  4TR3 A;  3GFK A;  3QCP A;  4TN8 A;  3C1R A;  3S9F A;  3TJB A;  3TGZ A;  5D9V A;  3I6A A;  3DEX A;  3H8Q A;  3RPN A;  3US3 A;  2PU9 C;  2GZP A;  2PER A;  3HJP A;  1XWA A;  4ZXG A;  2VCX A;  5LNK e;  5IQY A;  1THO A;  5DCG A;  1Q98 A;  1A23 A;  6GST A;  1RQM A;  4TOP A;  5JWR B;  4KX4 A;  2GDR A;  4L8E A;  3BCK A;  2VLU A;  2R0C A;  4RQR A;  4O5Q A;  2IL3 A;  2XPE A;  3LJR A;  4GXZ A;  2E7P A;  1EOG A;  4L5O A;  5KN3 A;  1MDK A;  1NHO A;  3A2W A;  2YCD A;  3F3R A;  1K0N A;  1AIU A;  4GF0 A;  3HJM A;  16GS A;  5H5S A;  4TXV A;  1J0F A;  4NAX A;  4ZBA A;  4Z2U A;  4N11 A;  4BL7 A;  2ZUP A;  1GSF A;  4G2E A;  4EIP A;  4PXO A;  2FY6 A;  3V1W A;  1J08 A;  1EGO A;  3GHA A;  2DIY A;  2CVK A;  2MMN A;  3O6T A;  4N0Z A;  5CYY A;  4KSM A;  2VIM A;  2EIO A;  4X4J A;  9GSS A;  4PQ1 A;  5AIX A;  4YAP A;  1GSE A;  2YV7 A;  1U3A A;  3PH9 A;  1A24 A;  4XS1 A;  1T00 A;  3F8U A;  1WPI A;  2C0G A;  3GUR A;  5J3R A;  1X5E A;  3ZFL A;  4BVY A;  3EVI A;  4POM A;  5C00 A;  2OAD A;  3M0F A;  1H4O A;  5GZZ B;  1SL1 B;  1AQW A;  4DSS B;  2YWM A;  1T4Y A;  1YQ1 A;  4GWR A;  5DJM A;  7GSS A;  1UVZ A;  3E9J B;  4MJA A;  2H0G A;  4WKW A;  2ZNM A;  4LL4 B;  4N0V A;  2H6Z A;  3KMN A;  4YH2 A;  5IMA A;  1ZCP A;  2HSM A;  2X4A A;  3VK9 A;  2K6V A;  2ES7 A;  4GQC A;  1K0M A;  2BJX A;  4MPF A;  1KNG A;  3R3E A;  5A4W A;  3C8E A;  2H1D A;  4PNG A;  2IMK A;  4K1F A;  1IYH A;  1O81 A;  2H0I A;  5D96 A;  3HHV A;  3H93 A;  3L4N A;  4IP1 A;  4DEJ A;  3IV4 A;  1T1V A;  4K5R A;  2AUV A;  2RII A;  3F6D A;  1YZX A;  2DMM A;  4HZ2 A;  5GAN D;  3BBY A;  3CTG A;  2GT5 A;  3P8W A;  2MBT A;  3HY2 A;  3VI5 A;  2O7K A;  2IMD A;  4OFT A;  3IOS A;  1X9S B;  1GH2 A;  1FB6 A;  2REM A;  2HZE A;  3IK9 A;  1BG5 A;  2VLV A;  3DVW A;  4IHU A;  5G1K A;  3UVH A;  4KCE A;  3BCI A;  2MMZ A;  1A8L A;  2YV9 A;  1OYJ A;  5D73 A;  2R6K A;  4PQH A;  4NHZ A;  1DE2 A;  4BPY A;  1K0O A;  2GZY A;  3F9U A;  1GTU A;  4KW6 A;  3W6G A;  2F3M A;  2ON7 A;  4D73 B;  4ZL9 A;  4OD7 A;  1DBY A;  2KP2 A;  2X99 A;  1OC8 A;  2A4H A;  3CSI A;  2IMI A;  2WS2 A;  1UN2 A;  4I6X A;  3U5R E;  1O7U A;  1DUG A;  1PMT A;  3VUR A;  5ECN B;  3ERF A;  4XIH A;  4MF5 A;  2OA7 A;  2X64 A;  4WXT A;  1OVN A;  2LNT A;  4YQU A;  2D2Z A;  2XPD A;  2XHF A;  1GTI A;  6GSV A;  1MD4 A;  1NW2 A;  4NXI A;  3MIX A;  2L5L A;  2VCQ A;  4KDU A;  1HYU A;  3WGD A;  4I97 A;  1ML6 A;  4HDE A;  5KOX A;  1E2Y A;  1F6M C;  4QL7 A;  4PUF C;  3M3M A;  1YF1 A;  2C80 A;  5JCG A;  2HE3 A;  4HQS A;  3TKP A;  4K9Z A;  1Z5Y E;  3C73 A;  3U6V A;  1SJZ A;  18GS A;  3IC4 A;  3P2A A;  5G31 A;  3VWW A;  3O3T A;  1YEP A;  1G0T A;  2C4J A;  3BD2 A;  2FWH A;  5J41 A;  4PTS A;  8GSS A;  3UL3 A;  4POL A;  3P90 A;  4HS1 A;  3Q19 A;  1WOU A;  1M2D A;  4AGS A;  4LLR A;  2G2Q A;  14GS A;  2C0E A;  5H5R A;  4JU5 A;  3W8J A;  3W8S A;  3RPP A;  1R26 A;  5J5N A;  1WMJ A;  2A2R A;  3KIJ A;  1RW1 A;  2LRN A;  4HOJ A;  1K3O A;  2BMX A;  3GV1 A;  3QMX A;  4Q5R A;  1E6B A;  1XWC A;  3LXZ A;  1F3B A;  3HXS A;  2B3S A;  4O92 A;  1TRW A;  2V32 A;  5ID2 B;  22GS A;  2DML A;  1BED A;  4WEY A;  3TRX A;  4CW9 A;  2AYT A;  4GST A;  5IPH A;  3OR5 A;  2DJ0 A;  17GS A;  2RLI A;  4WR5 A;  4OCF A;  3TKS A;  3PGT A;  1WRY A;  2HRA A;  4MDC A;  1ERT A;  2P5Q A;  4CDO A;  5IIZ A;  1EV9 A;  4JRR A;  4GSS A;  3VI7 A;  3N9J A;  1A0F A;  2TRX A;  4POB A;  3ZFB A;  1KEB A;  5F07 A;  4ZIL A;  1GTB A;  1CQG A;  4LMW A;  1VRS D;  1MDI A;  3QFB C;  1V58 A;  2HFD A;  1FAA A;  2O8V B;  2JSZ A;  1M9B A;  4V2N A;  4AF2 A;  1S3A A;  2WB9 A;  3IK7 A;  4LMV A;  3GNJ A;  2LEG A;  4FH8 A;  1Z3E A;  4DSR A;  4RI6 A;  4BVX B;  1S3D A;  1FO5 A;  1T3B A;  2R2J A;  3GIX A;  3KCM A;  1AUC A;  1I9D A;  2DBC A;  4OFM A;  1M2B A;  3QOU A;  1FVK A;  5JWQ B;  2L6D A;  3L0H A;  1G7O A;  3GYK A;  2E0Q A;  4Z2T A;  3EC3 A;  1U87 A;  4MZW A;  1O8X A;  1TRS A;  2UZ8 A;  1WJK A;  3LFL A;  2C1Y A;  3ZL5 A;  3GN3 A;  5B6M A;  2C0F A;  2NTO A;  4K6X A;  4L5L A;  1BX9 A;  3I9V 2;  4K5S A;  3FZ9 A;  1G6W A;  2M72 A;  3TJK A;  3GX8 A;  1U3I A;  5GAP D;  4K7N A;  4E8E A;  1JZD A;  2RUE A;  1X5C A;  1VGL A;  5ELG A;  2H72 A;  3TKR A;  1FG4 A;  1EEJ A;  3WGE A;  2DLX A;  5DQS A;  4JR4 A;  4ZIJ A;  2KHP A;  3H79 A;  1WIK A;  2GT6 A;  2WZ9 A;  3APQ A;  5BRT A;  2GTU A;  1TK0 B;  5EL8 A;  3G7J A;  5IPG A;  1G7E A;  1A2L A;  2FGX A;  4J2F A;  1NSW A;  2CA8 A;  3IDV A;  2RM5 A;  3GSS A;  3LGC A;  1BAY A;  2H01 A;  2ZCT A;  2H30 A;  2I9H A;  4IJ3 A;  5KN0 A;  4O5U A;  4I2T A;  1PQN A;  3DGQ A;  1WP0 A;  1SEN A;  3QDN A;  3H1N A;  4G0I A;  1PX7 A;  1EEM A;  2WCI A;  4A5P A;  1XIY A;  1TK8 B;  4PUR A;  4KDY A;  1ACV A;  5AIV A;  4BWS A;  1GNW A;  2JAD A;  1F37 A;  2H74 A;  4V1A g;  3WT1 A;  4GQF A;  3ERG A;  3UAP A;  2DJ3 A;  5IMV A;  3RBT A;  1EGR A;  4WBJ A;  4EDZ A;  2HSH A;  2TIR A;  1B48 A;  3G9B A;  5COH A;  1H75 A;  2PVQ A;  4QL9 A;  3R2Q A;  3AY8 A;  2X8H A;  4P3Y B;  1VF2 A;  2JL4 A;  4O7H A;  2QGV A;  4K7O A;  4XS4 A;  5FT3 A;  2G0F A;  4TXO A;  1J9B A;  3SBC A;  1X9W B;  2CV4 A;  2IFQ B;  1XW5 A;  2VCZ A;  5HR3 A;  3P7X A;  1QUW A;  2DIZ A;  1Y25 A;  3APO A;  1GSY A;  3N5O A;  2HRK A;  3ERW A;  5IOX A;  4G19 A;  1UA5 A;  3HYP A;  2F51 A;  19GS A;  3C7M A;  1FVJ A;  2KOK A;  1WE0 A;  3A3T A;  4OMV A;  1T8E B;  5BMU A;  2OE3 A;  4LL1 B;  2LST A;  2C3Q A;  4WBR D;  3F3Q A;  2DJJ A;  3UBK A;  4MJC A;  5ECM B;  2R0P A;  1PKW A;  1V57 A;  2K8S A;  4TR1 A;  3HCZ A;  1BJX A;  2C8U A;  2AJQ B;  2LKU A;  3GH9 A;  1XW9 A;  5A4U A;  1FB0 A;  4IVF A;  4ZB6 A;  2K18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...