1NSWA

The crystal structure of the k18g mutant of the thioredoxin from alicyclobacillus acidocaldarius
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
ATMTLTDANFQQAIQGDGPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFKGGRPVKQLIGYQPKEQLEAQLADVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title An integrated structural and computational study of the thermostability of two thioredoxin mutants from Alicyclobacillus acidocaldarius
pubmed doi rcsb
source organism Alicyclobacillus acidocaldarius
total genus 31
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1nswA00
1SL2B 1BEDA 2RM5A 5IQYA 3QR6A 1PX6A 1EOGA 1KNGA 2LQQA 2YNXA 1VF3A 1S3CA 4XCSA 4XS1A 1EGRA 2E2MA 3CRTA 1X9SB 1B48A 3G7JA 5HQPA 1I5GA 3U5RE 4LL1B 4IS0A 4GTUA 4I2TA 1Q98A 1A2MA 4NHZA 3ZITA 4I97A 2CQ9A 4POKA 2PVOC 3QD9A 5D9XA 2LQOA 2EIOA 5ID2A 3LWAA 3ZZXA 3QPMA 4ECJA 4KCAA 2E0QA 3LJRA 4N10A 4TN8A 1QFNA 1EZKA 3ERFA 1M0UA 3RHCA 2QSIA 3EURA 6GSWA 4KX4A 4QL9A 4PX1A 4ZL8A 2Z9SA 3PR8A 5DDLA 1M7TA 2BJXA 2IJYA 1IYHA 2V6OA 2HRFA 1R4WA 1JLVA 2MYGA 1GSSA 1O81A 4N0VA 4X1UA 5J4UA 4MPFA 1FVJA 1HNAA 3US3A 3WGDA 4BVYA 2N5BA 3KTBA 2FA8A 3TOTA 4MF7A 3LG6A 3KEBA 4RI6A 2EIRA 2R2JA 4ZBBA 2XBIA 3WT1A 5ECHB 1GTBA 1TW9A 2ZNMA 5B8AA 1PGTA 4NMUA 4L0UA 1DE1A 1EEJA 4ZBAA 3FZ9A 2H1DA 2GSRA 5CO3A 5IPGA 4MJBA 3APOA 3W8JA 4ILFA 2JZTA 3EU4A 5L71A 3Q74A 2K6VA 3IOSA 2V1MA 4LMWA 2YCDA 3HD5A 4EC0A 3KJYA 4PNGA 1WE0A 1UA5A 4J2FA 4TOPA 5KN3A 1F9MA 3IE3A 3M0FA 1M99A 2YWOA 1HNCA 3HXSA 3ZVJD 3KGKA 2A4VA 4GXZA 1XWKA 2H19A 1UC7A 4CW9A 2FHEA 3Q6OA 2VCXA 3P8WA 2HE3A 5CREA 3KH9A 3KIJA 4D73B 3UMAA 4KDYA 3KM6A 1GUKA 4AJ6A 2B1LA 2YWMA 1K3OA 4WETA 5LNKe 3RPPA 3TKQA 1TOFA 1AQVA 3S9FA 3UEMA 5H5QA 2PU9C 5DALA 2AAWA 2HXKA 3O6TA 19GSA 3M1GA 5D9WA 3L9VA 1PRXA 4EF0A 3EMPA 1DBYA 2B6MA 3TKSC 3IHQA 4ZL7A 3TDGA 3F3RA 3GRXA 3ISOA 1XPVA 2KP2A 1URMA 1A8YA 5ECRB 5DJLA 2TRCP 1ZYEA 2MZCA 4XS4B 2B5XA 4DSSA 2G2QA 1GRXA 1M2DA 4G9HA 2JU5A 4DEJA 3WYWA 4J57E 3DKSA 1PKZA 5CAXA 2XHFA 4IJ3A 1Z6MA 1F3BA 3QAGA 3J7Yk 4GRFA 1ZMAA 3I6AA 4IHUA 16GSA 3HJOA 4FIWA 2I3YA 2PERA 5ECQB 2IMIA 2IL3A 1YQ1A 1O73A 3CXGA 4KB3A 5J9CA 1B8XA 5IPHA 3ERWA 3UOMA 5KN0A 2YP6A 1GSDA 3C73A 4ZXGA 4YAPA 4YAVA 3A2VA 1ON4A 1BX9A 2LUSA 4K7NA 3QAWA 1G0TA 5ECMB 4BPYA 2LRCA 2QKEA 1CQHA 1PKWA 1GLPA 5D96A 1T8EB 2C0FA 3CSHA 4CDOA 3GURA 5COHA 2C0GA 1ZYQB 2RLIA 1VF2A 3QFBC 5EPFA 4G10A 5C04A 3TRPA 4ML1A 5GSSA 4O5RA 2B5EA 2JACA 2CVBA 4MK3A 4V2LA 5A4UA 1QMVA 2ZUPA 2AV4A 2P5RA 6GSVA 2DJJA 2H6YA 4KUNA 3WT2A 3KD0A 1K0OA 1NHYA 2YV7A 3I69A 4MH2A 3G9BA 1KEBA 2F51A 4GQFA 3IBHA 1YEXA 5CP1A 1JZDA 1GNWA 4MP4A 2FD3A 2V41A 5D9TA 3GL5A 2VL3A 3M8NA 3MDKA 4KDXA 5J5NA 4HQSA 5JWOB 1BJXA 3DVXA 5ECNB 2VCZA 2HLSA 2I4AA 3LFLA 1WIKA 3HVVA 1A8LA 4NV5A 4OO4A 3IK9A 4AJ8A 1A23A 3UIWA 1XWCA 1NW2A 2VIMA 2CVDA 3VPTA 3ZYWA 1TP9A 1HD2A 2GT6A 2H1AA 4PQIA 3EMXA 2K8VA 2RM6A 1W89A 4K1FA 1O8WA 3VWWA 1GSFA 1AUCA 2FWHA 3VWVA 2YV9A 1F2EA 3GKMA 3IR4A 1JZWA 3ZIVA 2IFQB 1YF1A 4N30A 1U3IA 2HRNA 3EE2A 1M2BA 4LA1A 5CRHA 4IJIA 2LJKA 2P5QA 5LD0A 4EO3A 2IMEA 1ERWA 2CAQA 4NAXA 1U3AA 5CRDA 4F2IA 1KBNA 2WULA 1TRSA 1TRUA 3KZQA 4H86A 3EU3A 1PD21 1MEKA 2GSTA 4L0WA 3CTFA 20GSA 2C0DA 1HNBA 2LS5A 2OE0A 1H75A 2LNSA 4HJ2A 5D93A 2CX4A 2EIQA 1WRYA 2NTOA 3GTUA 3VWUA 3D22A 2CAIA 1XW9A 2X8GA 1SKSB 2CX3A 2VCWA 2KUCA 4DSQA 1R26A 2RUFA 4TR4A 3TJBA 1Z6NA 2C0EA 3QCPA 4YQUA 1O6JA 1OKTA 2MMNA 1G7OA 4WF4A 4PUAA 2HSYA 2CT6A 3HDCA 4GSSA 1XZOA 4KAEA 4NPBA 4KNDA 1XOAA 4AGSA 2FWGA 3VFIA 4OFNA 3L9SA 1VF1A 4F82A 2JADA 1OAZA 2O7KA 4KCEA 1VRSD 2B3SA 4WKWA 2O87A 2MBSA 4AJ7A 3BCIA 4PQHA 1G6YA 3GX0A 1MD4A 1XW6A 4XRAA 4K6XA 1TU8A 1XW5A 2OA7A 1N2AA 2CZ2A 2L6DA 5CNWA 4CHSA 1SKRB 5F05A 1GSQA 1G6WA 3DXBA 1FOVA 3IRAA 1X5CA 2M46A 4L5LA 3L78A 4O92A 5ABRA 3TKRA 4MZWA 2H0GA 4OCEA 5CRGA 2AHEA 2JL4A 5HR0A 1JZOA 2X8HA 3VPQA 3KMNA 1TJDA 1T4ZA 4MF5A 2VLVA 2DJ0A 2C3NA 4BA7A 3F6DA 3UBKA 2P31A 2JZSA 3R2QA 2R37A 1SD9A 1TRVA 2DBCA 1O7UA 4ZB6A 3HZ8A 2RIIA 4MMMA 2V6KA 4PXOA 4BWQA 3GV1A 1TTZA 3VK9A 1ERUA 1GSUA 3KH7A 4V1Ag 2LRTA 1Y6EA 4XRDA 1E6BA 4Z7XA 4X43A 3QAVA 4HQZA 3DGQA 1GP1A 2I1UA 1BQ7A 1ZCPA 4G2EA 2WS2A 4JR6A 2MMOA 3F9UA 1ST9A 3IDVA 12GSA 1GTUA 3Q18A 4YH2A 5HFKA 4IQAA 2XC2A 1K0MA 1OYJA 3E3EA 3HYPA 2YANA 2I9HA 2HZEB 5A5KA 3LYKA 1T4YA 4GLTA 4JU5A 4LMVA 2F8AA 3LSZA 1SD8A 1J0FA 3HZ4A 4MABA 2PUKC 1ZGNA 2H1GA 3RHBA 1V57A 4IELA 4K7IA 4ZL9A 3MWHA 2R6KA 3TB2A 4MZBA 2ON5A 4RI7A 2TRXA 3L9UA 1M2AA 4XHMA 4XIHA 3GKXA 4L5OA 2CZ3A 3G7IA 2GT5A 2ZCTA 1EEMA 2FUG2 3DIEA 1FO5A 2O85A 3KXOA 4DVCA 4O7HA 2HFDA 4XS6A 5D8IA 1V58A 2VM2A 1GTAA 3A2XA 4D73A 5FHIA 2EC4A 2VUPA 3GX8A 2NPBA 3FHKA 1R5PA 4HEA2 2WRTA 4WR5A 3F8UA 3GIXA 1PMTA 1T1VA 3G7YA 2VL2A 3I43A 3FR6A 1XWAA 5FT3A 2B7JA 2C3QA 3UARA 1TI1A 3OR5A 3RDWA 4P3YB 4XS4A 4GWRA 5J41A 5HR2A 3GSTA 3CRUA 1NSWA 4FO5A 4MJCA 1V98A 3P2AA 3U6VA 3NZNA 3ZFBA 1V9WA 1BAYA 1K0BA 2C1YA 2AYTA 3GN3A 4PGTA 3CMIA 3NOFA 2VAFA 5AIXA 1K0DA 2N5FA 3ZMLA 5HR1A 4AF2A 5DALB 2DJ2A 3AY8A 3UVHA 4EE0A 1PA3A 2HI7A 3HJMA 2VO4A 2H0HA 4YQVA 1THOA 3LQ7A 1QGVA 1OC9B 2FWEA 3VI7A 3A5WA 1ZOFA 2I81A 1JFUA 5DAKB 4N0ZA 2GZPA 3F0IA 3FRCA 17GSA 5G1LA 3FZ4A 3GKNA 4ZILA 3TKPA 3IC4A 5ELGA 2KP1A 4OFTA 1MD3A 1USBA 2H73A 6GSUA 2VCTA 5IO0A 2IPAA 1EV9A 3ED3A 2C3TA 2VL9A 3H93A 1V40A 3HJPA 1Z7RA 3GA4A 1TRWA 1YF0A 4TR1B 5GSTA 2PGTA 1FB6A 2RUEA 3ZIJA 1CQGA 2HZFA 1QUWA 2H0IA 2R3XA 4MJEA 5HR3A 1OC8A 4WR4A 1Y25A 3F4TA 2IN3A 1EWXA 1YJ6A 3LXZA 1W4VA 5EY6A 5E4WA 1XWBA 2B7KA 2J9HA 1SJ6A 3UVTA 1SK2A 1EP8A 2WDUA 1A2JA 2WJUA 3WGXA 3KMOA 2ES7A 3LYPA 3IPZA 5IMAA 2FGXA 2H74A 2YN1A 2QC7A 3SWLA 5G5EA 3H1NA 1RK4A 4TXOB 9GSSA 1FAAA 1MTCA 4IP1A 3J7Yb 3KTLA 3HA9A 1SJIA 1OKDA 1Z7PA 2E7PA 4HOJA 4ISDA 1U88A 1HQOA 1K3LA 1E2YA 3QOUA 2G0FA 4TRXA 1GULA 4ECCA 4IBPA 1AXDA 4I5QA 4PQ1A 4KSOA 3HHVA 5INYA 3N5OA 1TK8B 5J9BA 4GSTA 4RQRA 1OC3A 2PMTA 2DJ1A 5G5FA 1ERTA 3F63A 1ERVA 2DIYA 2WGRA 5CYYA 2DC5A 3ERGA 3HCZA 3FW2A 4F9ZA 1TK0B 2X99A 3GKKA 2WZ9A 2IFQA 1ABAA 1GUMA 1GLQA 2YZHA 1A0FA 1TK5B 5IMDA 2H1BA 1B4PA 2WFCA 5HFIA 4ECIA 3GL3A 5ELAA 2YWNA 2YJ7A 4LL4B 3ZRDA 2BMXA 1K0AA 2H30A 4Q5FA 1XVWA 2AB6A 1J08A 4NHWA 5DJMA 1Q4JA 2X64A 2F9SA 4G19A 5IOWA 1YZXA 4KA0A 1AQWA 4RUVA 4X0XA 1TKDB 2GZZA 3KCMA 4JRRA 3F6FA 3K8NA 3VWXA 3GHAA 2V32A 4QL7A 4JR4A 4TR0A 4ZIJA 1QXHA 1TXXA 4BWSA 4KH7A 4F0CA 5D73A 2DJ3A 2FCHA 3TOUA 4EDYA 13GSA 4I2UA 1UVZA 3QDNA 3TJKA 2OBKA 2VOCA 3RPNA 3LEFA 2TIRA 1UN2A 3FYGA 3APQA 1J9BA 2L57A 1OE7A 3SBCA 3ZL5A 2H01A 4OMVA 3DYRA 3UBLA 4TW5A 4RQXA 2IIYA 3FZ5A 5GAPD 4DSRA 4K9ZA 3BCKA 1C72A 1FW1A 1U6TA 4GQCA 1XOBA 4IW9A 5ECLB 4IQ1A 1F3AA 5IIZA 2FY6A 2LJAA 4XTSA 4K7OA 4ACSA 3NIVA 2DIZA 5KN2A 5ENUA 4HS1A 4OO5A 4QQ7A 3EVIA 3IAS2 1N8JA 3H79A 2GDRA 3IA1A 4MF6A 2GS3A 4OWYA 1GSEA 2YJHA 5H5RA 3A3TA 5IMFA 4EUYA 2VM1A 5EL8A 5KEJA 3PH9A 3MAKA 2KLXA 2JZRA 6GSTA 4WF5A 2B1KA 2V2GA 5E59A 2NVLA 3C71A 1LJRA 1M9AA 1RW1A 1BG5A 3FKFA 2XPDA 4HZ2A 4MLYA 6GSYA 2AUVA 2C4JA 4KSMA 1GL8A 3GUSA 3C1SA 2L4CA 1XCCA 5ECOB 2LSTA 1M9BA 4POLA 2VLUA 4GSNA 3HVXA 1EV4A 2VCQA 4PUFC 1NHOA 3CYNA 2H6XA 2H8LA 2REMA 2LEGA 4ULXA 2ON7A 2H72A 1WMJA 2OE1A 4GF0A 1HYUA 2HZEA 1FVKA 4HJMA 4ZB8A 1DUGA 4EVMA 3VLNA 4Q5QA 2PN8A 3ZMKA 3TRXA 3FZAA 1XXUA 5G2ZA 5ID2B 1SL1B 1WJKA 3IXRA 5DCHA 3QMXA 5LCZA 3GMFA 4HI7A 1PX7A 4FYBA 4YQMA 2O8VB 3ME7A 1AAZA 2M72A 3TKSE 5B6MA 4POBA 5G31A 2H75A 1PL2A 3FY7A 3KP8A 1SL0B 2X8CA 2IWTA 2HYXA 4MZCA 11GSA 3C8EA 1B9XC 3DMLA 3EYTA 3TCOA 5G30A 2WCIA 1TDIA 1X5DA 4POMA 3JCML 4NV2A 2HNLA 1WWJA 5CRWA 2O89A 4V2NA 4TVEA 2QGVA 4BL7A 1MDJA 2VL2C 1GTIA 1GUHA 4WEYA 4J56E 3VURA 7GSSA 2LNTA 2IMDA 1AQXA 4IN0A 3CSJA 5HFGA 2GQKA 3O76A 2FNOA 1T3BA 5ECIB 1EGOA 5GZZB 1S3DA 1FG4A 5A4VA 1U87A 2VD1A 1X5EA 2L59A 1JHBA 2FA4A 4V2MA 2P0GA 3Q19A 1R7HA 2VCVA 1JZRA 4JEDA 4GCIA 1IYIA 3DWVA 1F37A 4OFMA 5ECKB 3FEUA 2R4VA 14GSA 3C7MA 3HKRA 3L4NA 2DMLA 4MDCA 2H70A 1PN9A 1VGLA 2KHPA 5JWQB 3H4KA 5FWGA 1I9DA 4E8EA 1OC9A 1YKAA 1QQ2A 4WBRD 4KGIA 3TKSA 1SYXA 2MMAA 1X0RA 4E8HA 2OADA 2K8SA 3CBUA 1PSQA 5DQYA 3WGEA 5DAKA 3RBTA 3M9KA 2GGTA 6GSSA 5AIVA 1GNEA 4MJAA 4DSSB 3DEXA 4TR3A 1TI3A 1O85A 2K18A 1ZZYA 3E9JB 1F6MC 2L5LA 2YOIA 4PNFA 1X9MB 5IMCA 3IV4A 2DMMA 1B4QA 1A2LA 3TUEA 3TRQA 3GFKA 4TR1A 3D21A 2L4QA 2R5GA 22GSA 1K0CA 5F07A 1OE8A 1GSYA 2YWIA 2L5OA 3D6IA 5B8BA 1X9WB 1ACVA 2LRNA 2CV4A 4K0GA 1AIUA 3GNJA 2BTOT 3C1RA 2L6CA 5IMZA 3QFAC 4LLRA 4WBJA 5B6NA 1WP0A 2WB9A 4F0BA 2J23A 3FR3A 1A24A 1K0NA 2K9FA 4OCFA 4MCUA 5JCGA 3W6GA 2IMFA 1LU4A 2MBTA 4OD7A 1SU9A 4PURA 4NXIA 2OE3A 3GH9A 3WD6A 1DSBA 2DLXA 2LKUA 5IO2A 2H66A 3BOAA 5ECPB 4EXJA 5DQSA 4ID0A 5DVBA 1WOUA 3W8SA 3FR9A 1SYRA 3ZFLA 3IK7A 4TXOA 3LORA 4ZB9A 1V2AA 4MA9A 2OKAA 3TJFA 1FB0A 1LBKA 2M80A 2HSHA 1MDKA 3HVSA 5IM9A 5AN1A 2PBJA 1QK8A 2PVQA 3KP9A 1A0RP 4EDZA 2D2ZA 1SJZA 1H4OA 4K8MA 4K0NA 1TU7A 3E0UA 3O3TA 2CA8A 2H6ZA 3RAZA 2JSYA 1YDKA 1KTEA 3TGZA 3D5JA 1XIYA 3D0ZA 4FH8A 4FYCA 1XFLA 4IP6A 3F4RA 2B5YA 2GZYA 3V1WA 2H71A 1FHEA 1JLWA 4I8BA 10GSA 6GSXA 3GYKA 2JSZA 5F06A 1Z9HA 2YZUA 3TJGA 1K3YA 1XBSA 3DD3A 2OBIA 1XWGA 2KOKA 1GH2A 2F8FA 3LXTA 1Z3EA 4F03A 1PQNA 4V1Ap 1EOHA 1RQMA 4ZBDA 1PL1A 3EINA 3P7XA 1SK0A 1XVQA 3PINA 5JCUA 5B7CA 2FWFA 4ECBA 4FYUA 5JWRB 3TJJA 1ZL9A 1Z5YE 4IKHA 3CSIA 4N11A 2FLSA 2N5AA 2C80A 3DRNA 3M3MA 4KW6A 2GLRA 4I6XA 4Q5RA 1DE2A 5IMVA 4IGJA 3H8QA 4MH3A 4O32A 3UAPA 4L8EA 2PWJA 5DCGA 3ZLPA 1ML6A 5AGYA 1SK1A 3CTGA 1AC1A 2LJRA 2LTKA 4JZQA 2A2RA 1B9YC 5F0GA 1S3AA 2YPMA 5F8BA 2GQLA 4HZ4A 4HU7A 4WXTA 2ALBA 2A2SA 3ZREA 2GVPA 5G1KA 3BJ5A 1ILOA 3HY2A 1T7PB 2MMZA 3PGTA 3BD2A 4TKYA 1O8XA 2GSQA 1SKWB 2VD0A 18GSA 4BVXA 5H5SA 2E2GA 2VLTA 2F3MA 2GQMA 3I9V2 4KE3A 2OJLA 3MSZA 1GWCA 3L0HA 1AW9A 3EWLA 3EC3A 5A4WA 1MDIA 1VF4A 4JBBA 2C8UA 2DJKA 3IAM2 5GAND 3FK8A 3BBYA 4KDUA 2HT9A 4MPGA 3ZTLA 4HDEA 3UJ1A 4HUAA 2XPEA 2NDOA 2DSAA 2H76A 4K2DA 3DVWA 4EL1A 4IVFA 3GTUB 1BYEA 2LV3A 3GSSA 4HU9A 2PPTA 1THXA 3ME8A 5J3RA 4NWYA 3P90A 5D9VA 5IOXA 5KN1A 4JE1A 1NM3A 2XBQA 8GSSA 2NBSA 2AJQB 3GH6A 1YKCA 3N9JA 5ECSA 1G7EA 4Q5NA 5C00A 5DBQA 1WPIA 3D4MA 1T00A 2OACA 3MNGA 3UL3A 5EVOA 3A2WA 3VI5A 1OVNA 1YY7A 2IMKA 3D4TA 3ZVJA 5AISA 1R5AA 3APSA 1SENA 3F4SA 4EKZA 4ML6A 5JCWA 3M9JA 1YEPA 3F3QA 2GTUA 2GSSA 1EP7A 2CVKA 3LGCA 4TXVA
chains in the Genus database with same CATH superfamily
1SL2B 1BEDA 2RM5A 5IQYA 3QR6A 1PX6A 1EOGA 1KNGA 2LQQA 2YNXA 1VF3A 1S3CA 4XCSA 4XS1A 1EGRA 2E2MA 3CRTA 1X9SB 1B48A 3G7JA 5HQPA 1I5GA 3U5RE 4LL1B 4IS0A 4GTUA 4I2TA 1Q98A 1A2MA 4NHZA 3ZITA 4I97A 2CQ9A 4POKA 2PVOC 3QD9A 5D9XA 2LQOA 1PFOA 2EIOA 5ID2A 3LWAA 3ZZXA 3QPMA 4ECJA 4KCAA 2E0QA 3LJRA 4N10A 4TN8A 1QFNA 1EZKA 3ERFA 1M0UA 3RHCA 2QSIA 3EURA 6GSWA 4KX4A 4QL9A 4PX1A 4ZL8A 2Z9SA 3PR8A 5DDLA 1M7TA 2BJXA 2IJYA 1IYHA 2V6OA 2HRFA 1R4WA 1JLVA 2MYGA 1GSSA 1O81A 4N0VA 4X1UA 5J4UA 4MPFA 1FVJA 1HNAA 2R0PA 3US3A 3WGDA 4BVYA 2N5BA 3KTBA 4HSCX 2FA8A 3TOTA 4MF7A 3LG6A 3KEBA 4RI6A 2EIRA 2R2JA 4ZBBA 2XBIA 3WT1A 5ECHB 1GTBA 1TW9A 2ZNMA 4K5SA 5B8AA 1PGTA 4NMUA 4L0UA 1DE1A 1EEJA 4ZBAA 3FZ9A 2H1DA 2GSRA 5CO3A 5IPGA 4MJBA 3APOA 3W8JA 4ILFA 2JZTA 2HRAA 3EU4A 5L71A 3Q74A 2K6VA 3IOSA 2V1MA 4LMWA 2YCDA 3HD5A 4EC0A 4PTSA 2DKHA 3KJYA 1WE0A 1UA5A 4PNGA 4J2FA 4TOPA 5KN3A 1F9MA 3IE3A 3M0FA 1M99A 2YWOA 1HNCA 3HXSA 3ZVJD 3KGKA 2A4VA 1M3IA 4GXZA 1XWKA 2H19A 1UC7A 4CW9A 2FHEA 3Q6OA 2VCXA 3P8WA 2HE3A 5CREA 3KH9A 3KIJA 4D73B 3UMAA 4KDYA 3KM6A 1GUKA 4AJ6A 2B1LA 2YWMA 1K3OA 4WETA 5LNKe 3RPPA 3TKQA 1TOFA 1AQVA 3S9FA 3UEMA 5H5QA 2PU9C 5DALA 2AAWA 2HXKA 3O6TA 19GSA 3M1GA 5D9WA 3L9VA 1PRXA 4EF0A 3EMPA 1DBYA 2B6MA 3TKSC 3IHQA 4ZL7A 3TDGA 3F3RA 3GRXA 3ISOA 1XPVA 2KP2A 1URMA 1A8YA 5ECRB 5DJLA 2TRCP 1ZYEA 2MZCA 4XS4B 2B5XA 4DSSA 5KOXA 2G2QA 1GRXA 1M2DA 4G9HA 2JU5A 4DEJA 3WYWA 4J57E 3DKSA 1PKZA 5CAXA 2XHFA 4IJ3A 1Z6MA 1F3BA 3QAGA 3J7Yk 4GRFA 1ZMAA 3I6AA 4IHUA 16GSA 3HJOA 4FIWA 2I3YA 2PERA 5ECQB 2IMIA 2IL3A 1YQ1A 1O73A 3CXGA 4KB3A 5J9CA 1B8XA 4YKGA 5IPHA 3ERWA 3UOMA 5KN0A 2YP6A 1GSDA 3C73A 4ZXGA 4YAPA 4YAVA 3A2VA 1ON4A 1BX9A 2LUSA 4K7NA 3QAWA 1G0TA 5ECMB 4BPYA 2LRCA 2QKEA 1CQHA 1PKWA 1GLPA 5D96A 1T8EB 2C0FA 3CSHA 4CDOA 3GURA 5COHA 2C0GA 1ZYQB 2RLIA 1VF2A 3QFBC 5EPFA 4G10A 5C04A 3TRPA 4ML1A 5GSSA 4O5RA 2B5EA 2JACA 2CVBA 4MK3A 4V2LA 2R0GA 5A4UA 1QMVA 2ZUPA 2AV4A 2P5RA 6GSVA 5BMUA 2DJJA 2H6YA 2QA1A 4KUNA 3WT2A 3KD0A 1K0OA 1NHYA 2YV7A 3I69A 4MH2A 3G9BA 1KEBA 2F51A 4GQFA 3IBHA 1YEXA 5CP1A 1JZDA 4G0IA 1GNWA 4MP4A 2FD3A 2V41A 5D9TA 3GL5A 2VL3A 3M8NA 3MDKA 4KDXA 5J5NA 4YKFA 4HQSA 5JWOB 1BJXA 3DVXA 5ECNB 2VCZA 2HLSA 2I4AA 3LFLA 1WIKA 3HVVA 1A8LA 4NV5A 4OO4A 3IK9A 4AJ8A 1A23A 3UIWA 1XWCA 1NW2A 2VIMA 2CVDA 3VPTA 3ZYWA 1TP9A 1HD2A 2GT6A 2H1AA 4PQIA 3EMXA 2K8VA 2RM6A 1W89A 4K1FA 1O8WA 1ZYNA 3VWWA 1GSFA 3CQFA 1AUCA 2FWHA 3VWVA 2YV9A 4KF9A 1F2EA 3GKMA 3IR4A 1JZWA 3ZIVA 2IFQB 1YF1A 4N30A 1U3IA 2HRNA 3EE2A 1M2BA 4LA1A 5CRHA 4IJIA 2LJKA 2P5QA 5LD0A 4EO3A 2IMEA 1ERWA 2CAQA 4NAXA 1U3AA 5CRDA 4F2IA 1KBNA 2WULA 1TRSA 1TRUA 3KZQA 4H86A 4A5PA 3EU3A 1PD21 1MEKA 2GSTA 4L0WA 3CTFA 20GSA 2C0DA 1HNBA 2LS5A 2OE0A 1H75A 2LNSA 4HJ2A 5D93A 2CX4A 2EIQA 1WRYA 2NTOA 3GTUA 3VWUA 3D22A 2CAIA 1XW9A 2X8GA 2X4AA 1SKSB 2CX3A 2VCWA 2KUCA 4DSQA 2DKIA 1R26A 2RUFA 4TR4A 3TJBA 1Z6NA 2C0EA 4BVXB 3QCPA 4YQUA 1O6JA 1OKTA 2MMNA 1G7OA 4O5UA 4WF4A 4PUAA 2HSYA 2CT6A 3HDCA 4GSSA 1XZOA 4KAEA 4NPBA 4KNDA 1XOAA 4AGSA 2FWGA 3VFIA 4OFNA 3L9SA 4USSA 1VF1A 4F82A 2JADA 1OAZA 2O7KA 4KCEA 1VRSD 2B3SA 4WKWA 2O87A 2MBSA 4AJ7A 3BCIA 4PQHA 1G6YA 3GX0A 1MD4A 1XW6A 4XRAA 4K6XA 1TU8A 1XW5A 2OA7A 1N2AA 2CZ2A 2L6DA 5CNWA 4CHSA 1SKRB 5F05A 1GSQA 1G6WA 3DXBA 1FOVA 3IRAA 1X5CA 2M46A 4L5LA 3L78A 4O92A 5ABRA 3TKRA 2UZ8A 3MYDA 4MZWA 2H0GA 4OCEA 5CRGA 2AHEA 2JL4A 5HR0A 2R0CA 1JZOA 3IC8A 2X8HA 2A4HA 3VPQA 3KMNA 1TJDA 1T4ZA 4MF5A 2VLVA 2DJ0A 2C3NA 4BA7A 3F6DA 3UBKA 2P31A 2JZSA 3R2QA 2R37A 1SD9A 1TRVA 2DBCA 1O7UA 4ZB6A 3HZ8A 2RIIA 4MMMA 2V6KA 4PXOA 4BWQA 3GV1A 1TTZA 3VK9A 1ERUA 1GSUA 3KH7A 4V1Ag 2LRTA 1Y6EA 4XRDA 1E6BA 4Z7XA 4X43A 3QAVA 4HQZA 3DGQA 1GP1A 2I1UA 1BQ7A 1ZCPA 4G2EA 2WS2A 4JR6A 2MMOA 3F9UA 1ST9A 3IDVA 12GSA 1GTUA 3Q18A 4YH2A 5HFKA 4IQAA 2XC2A 1K0MA 1OYJA 3E3EA 3HYPA 2YANA 2I9HA 2HZEB 5A5KA 3LYKA 1T4YA 4GLTA 4JU5A 4LMVA 2F8AA 3LSZA 1SD8A 1J0FA 3HZ4A 4MABA 2PUKC 1ZGNA 2H1GA 3RHBA 1V57A 4IELA 4K7IA 4ZL9A 3MWHA 2R6KA 3TB2A 4MZBA 2ON5A 4RI7A 2TRXA 3L9UA 1M2AA 4XHMA 4XIHA 3GKXA 4L5OA 2CZ3A 3G7IA 2GT5A 2ZCTA 1EEMA 2FUG2 3DIEA 1FO5A 2O85A 3KXOA 5KOWA 4DVCA 4O7HA 2HFDA 4XS6A 5D8IA 1V58A 2VM2A 1GTAA 3A2XA 4ICYA 4D73A 5FHIA 2EC4A 2VUPA 3GX8A 2NPBA 3FHKA 1R5PA 4HEA2 2WRTA 4WR5A 3F8UA 3GIXA 1PMTA 1T1VA 3G7YA 2VL2A 3I43A 3FR6A 1XWAA 5FT3A 2B7JA 2C3QA 4BL7B 3UARA 1TI1A 3OR5A 3RDWA 4P3YB 4XS4A 4GWRA 5J41A 5HR2A 3GSTA 3CRUA 1NSWA 4FO5A 4MJCA 1V98A 3P2AA 3U6VA 3NZNA 3ZFBA 1V9WA 1BAYA 1K0BA 2C1YA 2AYTA 3GN3A 4PGTA 3CMIA 3A5IA 3NOFA 2VAFA 5AIXA 1K0DA 2N5FA 3ZMLA 5HR1A 4AF2A 5DALB 2DJ2A 3AY8A 3UVHA 4EE0A 1PA3A 2HI7A 3HJMA 2VO4A 2H0HA 4YQVA 1THOA 3LQ7A 1QGVA 1OC9B 2FWEA 3VI7A 3A5WA 1ZOFA 2I81A 1JFUA 4N0ZA 5DAKB 2GZPA 3F0IA 3FRCA 17GSA 5G1LA 3FZ4A 3GKNA 4ZILA 3TKPA 3IC4A 5ELGA 2KP1A 4OFTA 1MD3A 1USBA 2H73A 6GSUA 2VCTA 5IO0A 2IPAA 1EV9A 3ED3A 2C3TA 2VL9A 3H93A 1V40A 3HJPA 1Z7RA 3GA4A 1TRWA 1YF0A 4TR1B 5GSTA 2PGTA 1FB6A 2RUEA 3ZIJA 1CQGA 2HZFA 1QUWA 2H0IA 2R3XA 4MJEA 5HR3A 1OC8A 4WR4A 1Y25A 3F4TA 2IN3A 1EWXA 1YJ6A 3LXZA 1W4VA 5EY6A 5E4WA 1XWBA 2B7KA 2J9HA 1SJ6A 3UVTA 1SK2A 1EP8A 2WDUA 1A2JA 2WJUA 3WGXA 3KMOA 2ES7A 3LYPA 3IPZA 5IMAA 2FGXA 2H74A 2YN1A 2QC7A 3SWLA 5G5EA 3H1NA 1RK4A 4TXOB 9GSSA 1FAAA 3FMWA 1MTCA 4IP1A 3J7Yb 4CY8A 3KTLA 3HA9A 1SJIA 1OKDA 1Z7PA 2E7PA 4HOJA 4ISDA 1U88A 1HQOA 1K3LA 1E2YA 3QOUA 2G0FA 4TRXA 1GULA 4ECCA 4IBPA 1AXDA 4I5QA 4PQ1A 4KSOA 3HHVA 5INYA 3N5OA 1TK8B 5J9BA 4GSTA 4RQRA 1OC3A 2PMTA 2DJ1A 5G5FA 1ERTA 3F63A 1ERVA 2DIYA 2WGRA 5CYYA 2DC5A 4EIQA 3ERGA 3HCZA 3FW2A 4F9ZA 1TK0B 2X99A 3GKKA 2WZ9A 2IFQA 1ABAA 1GUMA 1GLQA 2YZHA 1A0FA 1TK5B 5IMDA 2H1BA 1B4PA 2WFCA 5HFIA 4ECIA 3GL3A 5ELAA 2YWNA 2YJ7A 4LL4B 3ZRDA 2BMXA 1K0AA 2H30A 4Q5FA 1XVWA 2AB6A 1J08A 4NHWA 5DJMA 1Q4JA 2X64A 2F9SA 4G19A 5IOWA 4Z2TA 1YZXA 2A2PA 4KA0A 1AQWA 4RUVA 4X0XA 1TKDB 2GZZA 3KCMA 4JRRA 3F6FA 3K8NA 3VWXA 3GHAA 2V32A 4QL7A 4JR4A 4TR0A 4ZIJA 1QXHA 1TXXA 4BWSA 4KH7A 4F0CA 5D73A 2DJ3A 2FCHA 3TOUA 4EDYA 13GSA 4I2UA 4Z2RA 1UVZA 3QDNA 3TJKA 2OBKA 2VOCA 3RPNA 3LEFA 2TIRA 1UN2A 3FYGA 3APQA 1J9BA 2L57A 1OE7A 3SBCA 3ZL5A 4Z2UA 2H01A 4OMVA 3DYRA 3UBLA 4TW5A 4RQXA 2IIYA 3FZ5A 5GAPD 4DSRA 4K9ZA 3BCKA 1C72A 1FW1A 1U6TA 4GQCA 1XOBA 4IW9A 5ECLB 4IQ1A 1F3AA 5IIZA 2FY6A 2LJAA 4XTSA 4K7OA 4ACSA 2X49A 3NIVA 2DIZA 5KN2A 5ENUA 4HS1A 4OO5A 4QQ7A 3EVIA 3IAS2 1N8JA 3H79A 4G0LA 2GDRA 3IA1A 3MIXA 4MF6A 2GS3A 4OWYA 1GSEA 2YJHA 5H5RA 3A3TA 5IMFA 4EUYA 2VM1A 1XG8A 5EL8A 5KEJA 3PH9A 3MAKA 2KLXA 2JZRA 6GSTA 4WF5A 2B1KA 2V2GA 5E59A 2NVLA 3C71A 1LJRA 1M9AA 1RW1A 1BG5A 5BRTA 3FKFA 2XPDA 4HZ2A 4MLYA 4O5QA 6GSYA 2AUVA 2C4JA 4KSMA 1GL8A 3GUSA 3C1SA 2L4CA 1XCCA 5ECOB 2LSTA 1M9BA 4POLA 2VLUA 4GSNA 3HVXA 1EV4A 2VCQA 4PUFC 1NHOA 3CYNA 2H6XA 3EPTA 4EIPA 2H8LA 2REMA 2LEGA 4ULXA 2ON7A 2H72A 1WMJA 2OE1A 4GF0A 1HYUA 2HZEA 1FVKA 4FQUA 4HJMA 4ZB8A 1DUGA 4EVMA 3VLNA 4Q5QA 2PN8A 3ZMKA 3TRXA 3FZAA 1XXUA 5G2ZA 5ID2B 1SL1B 1WJKA 3IXRA 5DCHA 3QMXA 5LCZA 3GMFA 4HI7A 1PX7A 4FYBA 4YQMA 2O8VB 3ME7A 1AAZA 2M72A 4MNNA 3TKSE 5B6MA 4POBA 5G31A 2H75A 1PL2A 3FY7A 3KP8A 1SL0B 2X8CA 2IWTA 2HYXA 3LW9A 4MZCA 11GSA 3C8EA 4BVYB 1B9XC 3DMLA 3EYTA 3TCOA 5G30A 2WCIA 1TDIA 1X5DA 4POMA 3JCML 4NV2A 2HNLA 1WWJA 5CRWA 2O89A 4V2NA 4TVEA 2QGVA 4BL7A 1MDJA 2VL2C 1GTIA 1GUHA 4WEYA 4J56E 3VURA 7GSSA 2LNTA 2IMDA 1AQXA 4IN0A 3CSJA 5HFGA 2GQKA 3O76A 2FNOA 1T3BA 5ECIB 1EGOA 5GZZB 1S3DA 1FG4A 5A4VA 1U87A 2VD1A 1X5EA 2L59A 1JHBA 2FA4A 4V2MA 2P0GA 3Q19A 1R7HA 2VCVA 3IHGA 1JZRA 4JEDA 4GCIA 4K2XA 1IYIA 3DWVA 1F37A 4OFMA 5ECKB 3FEUA 2R4VA 14GSA 3C7MA 3HKRA 3L4NA 2DMLA 4MDCA 2H70A 1PN9A 1VGLA 2KHPA 5JWQB 3H4KA 5FWGA 1I9DA 3R3EA 4E8EA 1OC9A 1YKAA 1QQ2A 4WBRD 4KGIA 3TKSA 1SYXA 2MMAA 1X0RA 4E8HA 2OADA 2K8SA 3CBUA 1PSQA 5DQYA 3WGEA 5DAKA 3HVNA 3RBTA 3M9KA 2GGTA 6GSSA 5AIVA 1GNEA 4CY6A 4MJAA 4DSSB 3DEXA 4TR3A 1TI3A 1O85A 2K18A 1ZZYA 3E9JB 1F6MC 2L5LA 2YOIA 4PNFA 1X9MB 5IMCA 3IV4A 2DMMA 1B4QA 1A2LA 3TUEA 3TRQA 3GFKA 4TR1A 3D21A 2L4QA 2R5GA 22GSA 1K0CA 5F07A 1OE8A 1GSYA 2YWIA 2L5OA 3D6IA 5B8BA 1X9WB 1ACVA 2LRNA 2CV4A 4K0GA 1AIUA 3GNJA 2BTOT 1PN0A 3C1RA 2L6CA 5IMZA 3QFAC 4LLRA 4WBJA 5B6NA 1WP0A 2WB9A 4F0BA 2J23A 3FR3A 1A24A 1K0NA 2K9FA 4OCFA 4MCUA 5JCGA 3W6GA 2IMFA 1LU4A 1ZYPA 2MBTA 4OD7A 1SU9A 4PURA 2HRKA 4NXIA 2OE3A 3GH9A 3WD6A 1DSBA 2DLXA 2LKUA 5IO2A 2H66A 3BOAA 5ECPB 2QA2A 4EXJA 5DQSA 4ID0A 5DVBA 1WOUA 3W8SA 3FR9A 1SYRA 3ZFLA 3IK7A 4TXOA 3LORA 4ZB9A 1V2AA 4MA9A 2OKAA 3TJFA 1FB0A 1LBKA 2M80A 2HSHA 1MDKA 3HVSA 5IM9A 4BIKA 5AN1A 2PBJA 1QK8A 2PVQA 3KP9A 1A0RP 4EDZA 2D2ZA 1SJZA 1H4OA 4K8MA 4K0NA 1TU7A 3E0UA 3O3TA 2CA8A 2H6ZA 3RAZA 2JSYA 1YDKA 1FOHA 1KTEA 3TGZA 3D5JA 1XIYA 3D0ZA 4FH8A 4FYCA 1XFLA 4IP6A 3F4RA 2B5YA 2GZYA 3V1WA 2H71A 1FHEA 1JLWA 4I8BA 10GSA 6GSXA 3GYKA 2JSZA 5F06A 1Z9HA 2YZUA 3TJGA 1K3YA 1XBSA 3DD3A 2OBIA 1XWGA 2KOKA 1GH2A 2F8FA 3LXTA 1Z3EA 4F03A 1PQNA 4V1Ap 1EOHA 1RQMA 4ZBDA 1PL1A 3EINA 3P7XA 1SK0A 1XVQA 3PINA 5JCUA 5B7CA 2FWFA 4G0KA 4ECBA 4FYUA 5JWRB 3TJJA 1ZL9A 1Z5YE 4IKHA 2HSMA 3CSIA 4N11A 2FLSA 2N5AA 2C80A 3DRNA 3M3MA 4KW6A 2GLRA 4I6XA 4Q5RA 1DE2A 5IMVA 4IGJA 3H8QA 4MH3A 4O32A 3UAPA 4L8EA 1M3JA 2PWJA 5DCGA 3ZLPA 1ML6A 5AGYA 1SK1A 3CTGA 1AC1A 2LJRA 2LTKA 4JZQA 2A2RA 1B9YC 5F0GA 1S3AA 2YPMA 5F8BA 2GQLA 4HZ4A 4HU7A 4WXTA 2ALBA 2A2SA 3ZREA 2GVPA 5G1KA 3BJ5A 1ILOA 3HY2A 1T7PB 3PPUA 2MMZA 3PGTA 3BD2A 4TKYA 1O8XA 2GSQA 1SKWB 2VD0A 18GSA 4BVXA 5H5SA 2E2GA 2VLTA 2F3MA 2GQMA 3I9V2 4KE3A 2OJLA 3MSZA 1GWCA 3L0HA 1AW9A 3EWLA 3EC3A 5A4WA 1MDIA 1VF4A 4JBBA 2C8UA 2DJKA 3IAM2 5GAND 3FK8A 3BBYA 4K5RA 4KDUA 2HT9A 4MPGA 3ZTLA 4HDEA 3UJ1A 4HUAA 2XPEA 2NDOA 2DSAA 2H76A 4K2DA 3DVWA 4EL1A 4IVFA 3GTUB 1BYEA 2LV3A 3GSSA 4HU9A 2PPTA 1THXA 3ME8A 5J3RA 4NWYA 3P90A 5D9VA 5IOXA 5KN1A 4JE1A 1NM3A 2XBQA 8GSSA 2NBSA 2AJQB 3GH6A 1YKCA 3N9JA 5ECSA 1G7EA 4Q5NA 5C00A 5DBQA 1WPIA 3D4MA 1T00A 2OACA 3MNGA 3UL3A 5EVOA 3A2WA 1S3RA 3VI5A 1OVNA 1YY7A 2IMKA 3D4TA 3ZVJA 5AISA 1R5AA 3APSA 1SENA 3F4SA 4EKZA 4ML6A 5JCWA 3M9JA 4X4JA 1YEPA 3F3QA 2GTUA 2GSSA 1EP7A 2CVKA 3LGCA 4TXVA
chains in the Genus database with same CATH topology
1SL2B 1BEDA 2RM5A 5IQYA 3QR6A 1PX6A 1EOGA 1KNGA 2LQQA 2YNXA 1VF3A 1S3CA 4XCSA 4XS1A 1EGRA 2E2MA 3CRTA 1X9SB 1B48A 3G7JA 5HQPA 1I5GA 3U5RE 4LL1B 4IS0A 4GTUA 4I2TA 1Q98A 1A2MA 4NHZA 3ZITA 4I97A 2CQ9A 4POKA 2PVOC 3QD9A 5D9XA 2LQOA 2EIOA 5ID2A 3LWAA 3ZZXA 3QPMA 4ECJA 4KCAA 2E0QA 3LJRA 4N10A 4TN8A 1QFNA 1EZKA 3ERFA 1M0UA 3RHCA 2QSIA 3EURA 6GSWA 4KX4A 4QL9A 4PX1A 4ZL8A 2Z9SA 3PR8A 5DDLA 1M7TA 2BJXA 2IJYA 1IYHA 2V6OA 2HRFA 1R4WA 1JLVA 2MYGA 1GSSA 1O81A 4N0VA 4X1UA 5J4UA 4MPFA 1FVJA 1HNAA 2R0PA 3US3A 3WGDA 4BVYA 2N5BA 3KTBA 2FA8A 3TOTA 4MF7A 3LG6A 3KEBA 4RI6A 2EIRA 2R2JA 4ZBBA 2XBIA 3WT1A 5ECHB 1GTBA 1TW9A 2ZNMA 4K5SA 5B8AA 1PGTA 4NMUA 4L0UA 1DE1A 1EEJA 4ZBAA 3FZ9A 2H1DA 2GSRA 5CO3A 5IPGA 4MJBA 3APOA 3W8JA 4ILFA 2JZTA 2HRAA 3EU4A 5L71A 3Q74A 2K6VA 3IOSA 2V1MA 4LMWA 2YCDA 3HD5A 4EC0A 4PTSA 2DKHA 3KJYA 1WE0A 1UA5A 4PNGA 4J2FA 4TOPA 5KN3A 1F9MA 3IE3A 3M0FA 1M99A 2YWOA 1HNCA 3HXSA 3ZVJD 3KGKA 2A4VA 4GXZA 1XWKA 2H19A 1UC7A 4CW9A 2FHEA 3Q6OA 2VCXA 3P8WA 2HE3A 5CREA 3KH9A 3KIJA 4D73B 3UMAA 4KDYA 3KM6A 1GUKA 4AJ6A 2B1LA 2YWMA 1K3OA 4WETA 5LNKe 3RPPA 3TKQA 1TOFA 1AQVA 3S9FA 3UEMA 5H5QA 2PU9C 5DALA 2AAWA 2HXKA 3O6TA 19GSA 3M1GA 5D9WA 3L9VA 1PRXA 4EF0A 3EMPA 1DBYA 2B6MA 3TKSC 3IHQA 4ZL7A 3TDGA 3F3RA 3GRXA 3ISOA 1XPVA 2KP2A 1URMA 1A8YA 5ECRB 5DJLA 2TRCP 1ZYEA 2MZCA 4XS4B 2B5XA 4DSSA 5KOXA 2G2QA 1GRXA 1M2DA 4G9HA 2JU5A 4DEJA 3WYWA 4J57E 3DKSA 1PKZA 5CAXA 2XHFA 4IJ3A 1Z6MA 1F3BA 3QAGA 3J7Yk 4GRFA 1ZMAA 3I6AA 4IHUA 16GSA 3HJOA 4FIWA 2I3YA 2PERA 5ECQB 2IMIA 2IL3A 1YQ1A 1O73A 3CXGA 4KB3A 5J9CA 1B8XA 4YKGA 5IPHA 3ERWA 3UOMA 5KN0A 2YP6A 1GSDA 3C73A 4ZXGA 4YAPA 4YAVA 3A2VA 1ON4A 1BX9A 2LUSA 4K7NA 3QAWA 1G0TA 5ECMB 4BPYA 2LRCA 2QKEA 1CQHA 1PKWA 1GLPA 5D96A 1T8EB 2C0FA 3CSHA 4CDOA 3GURA 5COHA 2C0GA 1ZYQB 2RLIA 1VF2A 3QFBC 5EPFA 4G10A 5C04A 3TRPA 4ML1A 5GSSA 4O5RA 2B5EA 2JACA 2CVBA 4MK3A 4V2LA 2R0GA 5A4UA 1QMVA 2ZUPA 2AV4A 2P5RA 6GSVA 5BMUA 2DJJA 2H6YA 2QA1A 4KUNA 3WT2A 3KD0A 1K0OA 1NHYA 2YV7A 3I69A 4MH2A 3G9BA 1KEBA 2F51A 4GQFA 3IBHA 1YEXA 5CP1A 1JZDA 4G0IA 1GNWA 4MP4A 2FD3A 2V41A 5D9TA 3GL5A 2VL3A 3M8NA 3MDKA 4KDXA 5J5NA 4YKFA 4HQSA 5JWOB 1BJXA 3DVXA 5ECNB 2VCZA 2HLSA 2I4AA 3LFLA 1WIKA 3HVVA 1A8LA 4NV5A 4OO4A 3IK9A 4AJ8A 1A23A 3UIWA 1XWCA 1NW2A 2VIMA 2CVDA 3VPTA 3ZYWA 1TP9A 1HD2A 2GT6A 2H1AA 4PQIA 3EMXA 2K8VA 2RM6A 1W89A 4K1FA 1O8WA 1ZYNA 3VWWA 1GSFA 1AUCA 2FWHA 3VWVA 2YV9A 4KF9A 1F2EA 3GKMA 3IR4A 1JZWA 3ZIVA 2IFQB 1YF1A 4N30A 1U3IA 2HRNA 3EE2A 1M2BA 4LA1A 5CRHA 4IJIA 2LJKA 2P5QA 5LD0A 4EO3A 2IMEA 1ERWA 2CAQA 4NAXA 1U3AA 5CRDA 4F2IA 1KBNA 2WULA 1TRSA 1TRUA 3KZQA 4H86A 4A5PA 3EU3A 1PD21 1MEKA 2GSTA 4L0WA 3CTFA 20GSA 2C0DA 1HNBA 2LS5A 2OE0A 1H75A 2LNSA 4HJ2A 5D93A 2CX4A 2EIQA 1WRYA 2NTOA 3GTUA 3VWUA 3D22A 2CAIA 1XW9A 2X8GA 2X4AA 1SKSB 2CX3A 2VCWA 2KUCA 4DSQA 2DKIA 1R26A 2RUFA 4TR4A 3TJBA 1Z6NA 2C0EA 4BVXB 3QCPA 4YQUA 1O6JA 1OKTA 2MMNA 1G7OA 4O5UA 4WF4A 4PUAA 2HSYA 2CT6A 3HDCA 4GSSA 1XZOA 4KAEA 4NPBA 4KNDA 1XOAA 4AGSA 2FWGA 3VFIA 4OFNA 3L9SA 4USSA 1VF1A 4F82A 2JADA 1OAZA 2O7KA 4KCEA 1VRSD 2B3SA 4WKWA 2O87A 2MBSA 4AJ7A 3BCIA 4PQHA 1G6YA 3GX0A 1MD4A 1XW6A 4XRAA 4K6XA 1TU8A 1XW5A 2OA7A 1N2AA 2CZ2A 2L6DA 5CNWA 4CHSA 1SKRB 5F05A 1GSQA 1G6WA 3DXBA 1FOVA 3IRAA 1X5CA 2M46A 4L5LA 3L78A 4O92A 5ABRA 3TKRA 2UZ8A 3MYDA 4MZWA 2H0GA 4OCEA 5CRGA 2AHEA 2JL4A 5HR0A 2R0CA 1JZOA 3IC8A 2X8HA 2A4HA 3VPQA 3KMNA 1TJDA 1T4ZA 4MF5A 2VLVA 2DJ0A 2C3NA 4BA7A 3F6DA 3UBKA 2P31A 2JZSA 3R2QA 2R37A 1SD9A 1TRVA 2DBCA 1O7UA 4ZB6A 3HZ8A 2RIIA 4MMMA 2V6KA 4PXOA 4BWQA 3GV1A 1TTZA 3VK9A 1ERUA 1GSUA 3KH7A 4V1Ag 2LRTA 1Y6EA 4XRDA 1E6BA 4Z7XA 4X43A 3QAVA 4HQZA 3DGQA 1GP1A 2I1UA 1BQ7A 1ZCPA 4G2EA 2WS2A 4JR6A 2MMOA 3F9UA 1ST9A 3IDVA 12GSA 1GTUA 3Q18A 4YH2A 5HFKA 4IQAA 2XC2A 1K0MA 1OYJA 3E3EA 3HYPA 2YANA 2I9HA 2HZEB 5A5KA 3LYKA 1T4YA 4GLTA 4JU5A 4LMVA 2F8AA 3LSZA 1SD8A 1J0FA 3HZ4A 4MABA 2PUKC 1ZGNA 2H1GA 3RHBA 1V57A 4IELA 4K7IA 4ZL9A 3MWHA 2R6KA 3TB2A 4MZBA 2ON5A 4RI7A 2TRXA 3L9UA 1M2AA 4XHMA 4XIHA 3GKXA 4L5OA 2CZ3A 3G7IA 2GT5A 2ZCTA 1EEMA 2FUG2 3DIEA 1FO5A 2O85A 3KXOA 5KOWA 4DVCA 4O7HA 2HFDA 4XS6A 5D8IA 1V58A 2VM2A 1GTAA 3A2XA 4ICYA 4D73A 5FHIA 2EC4A 2VUPA 3GX8A 2NPBA 3FHKA 1R5PA 4HEA2 2WRTA 4WR5A 3F8UA 3GIXA 1PMTA 1T1VA 3G7YA 2VL2A 3I43A 3FR6A 1XWAA 5FT3A 2B7JA 2C3QA 4BL7B 3UARA 1TI1A 3OR5A 3RDWA 4P3YB 4XS4A 4GWRA 5J41A 5HR2A 3GSTA 3CRUA 1NSWA 4FO5A 4MJCA 1V98A 3P2AA 3U6VA 3NZNA 3ZFBA 1V9WA 1BAYA 1K0BA 2C1YA 2AYTA 3GN3A 4PGTA 3CMIA 3A5IA 3NOFA 2VAFA 5AIXA 1K0DA 2N5FA 3ZMLA 5HR1A 4AF2A 5DALB 2DJ2A 3AY8A 3UVHA 4EE0A 1PA3A 2HI7A 3HJMA 2VO4A 2H0HA 4YQVA 1THOA 3LQ7A 1QGVA 1OC9B 2FWEA 3VI7A 3A5WA 1ZOFA 2I81A 1JFUA 4N0ZA 5DAKB 2GZPA 3F0IA 3FRCA 17GSA 5G1LA 3FZ4A 3GKNA 4ZILA 3TKPA 3IC4A 5ELGA 2KP1A 4OFTA 1MD3A 1USBA 2H73A 6GSUA 2VCTA 5IO0A 2IPAA 1EV9A 3ED3A 2C3TA 2VL9A 3H93A 1V40A 3HJPA 1Z7RA 3GA4A 1TRWA 1YF0A 4TR1B 5GSTA 2PGTA 1FB6A 2RUEA 3ZIJA 1CQGA 2HZFA 1QUWA 2H0IA 2R3XA 4MJEA 5HR3A 1OC8A 4WR4A 1Y25A 3F4TA 2IN3A 1EWXA 1YJ6A 3LXZA 1W4VA 5EY6A 5E4WA 1XWBA 2B7KA 2J9HA 1SJ6A 3UVTA 1SK2A 1EP8A 2WDUA 1A2JA 2WJUA 3WGXA 3KMOA 2ES7A 3LYPA 3IPZA 5IMAA 2FGXA 2H74A 2YN1A 2QC7A 3SWLA 5G5EA 3H1NA 1RK4A 4TXOB 9GSSA 1FAAA 3FMWA 1MTCA 4IP1A 3J7Yb 4CY8A 3KTLA 3HA9A 1SJIA 1OKDA 1Z7PA 2E7PA 4HOJA 4ISDA 1U88A 1HQOA 1K3LA 1E2YA 3QOUA 2G0FA 4TRXA 1GULA 4ECCA 4IBPA 1AXDA 4I5QA 4PQ1A 4KSOA 3HHVA 5INYA 3N5OA 1TK8B 5J9BA 4GSTA 4RQRA 1OC3A 2PMTA 2DJ1A 5G5FA 1ERTA 3F63A 1ERVA 2DIYA 2WGRA 5CYYA 2DC5A 4EIQA 3ERGA 3HCZA 3FW2A 4F9ZA 1TK0B 2X99A 3GKKA 2WZ9A 2IFQA 1ABAA 1GUMA 1GLQA 2YZHA 1A0FA 1TK5B 5IMDA 2H1BA 1B4PA 2WFCA 5HFIA 4ECIA 3GL3A 5ELAA 2YWNA 2YJ7A 4LL4B 3ZRDA 2BMXA 1K0AA 2H30A 4Q5FA 1XVWA 2AB6A 1J08A 4NHWA 5DJMA 1Q4JA 2X64A 2F9SA 4G19A 5IOWA 4Z2TA 1YZXA 2A2PA 4KA0A 1AQWA 4RUVA 4X0XA 1TKDB 2GZZA 3KCMA 4JRRA 3F6FA 3K8NA 3VWXA 3GHAA 2V32A 4QL7A 4JR4A 4TR0A 4ZIJA 1QXHA 1TXXA 4BWSA 4KH7A 4F0CA 5D73A 2DJ3A 2FCHA 3TOUA 4EDYA 13GSA 4I2UA 4Z2RA 1UVZA 3QDNA 3TJKA 2OBKA 2VOCA 3RPNA 3LEFA 2TIRA 1UN2A 3FYGA 3APQA 1J9BA 2L57A 1OE7A 3SBCA 3ZL5A 4Z2UA 2H01A 4OMVA 3DYRA 3UBLA 4TW5A 4RQXA 2IIYA 3FZ5A 5GAPD 4DSRA 4K9ZA 3BCKA 1C72A 1FW1A 1U6TA 4GQCA 1XOBA 4IW9A 5ECLB 4IQ1A 1F3AA 5IIZA 2FY6A 2LJAA 4XTSA 4K7OA 4ACSA 2X49A 3NIVA 2DIZA 5KN2A 5ENUA 4HS1A 4OO5A 4QQ7A 3EVIA 3IAS2 1N8JA 3H79A 4G0LA 2GDRA 3IA1A 3MIXA 4MF6A 2GS3A 4OWYA 1GSEA 2YJHA 5H5RA 3A3TA 5IMFA 4EUYA 2VM1A 5EL8A 5KEJA 3PH9A 3MAKA 2KLXA 2JZRA 6GSTA 4WF5A 2B1KA 2V2GA 5E59A 2NVLA 3C71A 1LJRA 1M9AA 1RW1A 1BG5A 5BRTA 3FKFA 2XPDA 4HZ2A 4MLYA 4O5QA 6GSYA 2AUVA 2C4JA 4KSMA 1GL8A 3GUSA 3C1SA 2L4CA 1XCCA 5ECOB 2LSTA 1M9BA 4POLA 2VLUA 4GSNA 3HVXA 1EV4A 2VCQA 4PUFC 1NHOA 3CYNA 2H6XA 3EPTA 4EIPA 2H8LA 2REMA 2LEGA 4ULXA 2ON7A 2H72A 1WMJA 2OE1A 4GF0A 1HYUA 2HZEA 1FVKA 4FQUA 4HJMA 4ZB8A 1DUGA 4EVMA 3VLNA 4Q5QA 2PN8A 3ZMKA 3TRXA 3FZAA 1XXUA 5G2ZA 5ID2B 1SL1B 1WJKA 3IXRA 5DCHA 3QMXA 5LCZA 3GMFA 4HI7A 1PX7A 4FYBA 4YQMA 2O8VB 3ME7A 1AAZA 2M72A 4MNNA 3TKSE 5B6MA 4POBA 5G31A 2H75A 1PL2A 3FY7A 3KP8A 1SL0B 2X8CA 2IWTA 2HYXA 3LW9A 4MZCA 11GSA 3C8EA 4BVYB 1B9XC 3DMLA 3EYTA 3TCOA 5G30A 2WCIA 1TDIA 1X5DA 4POMA 3JCML 4NV2A 2HNLA 1WWJA 5CRWA 2O89A 4V2NA 4TVEA 2QGVA 4BL7A 1MDJA 2VL2C 1GTIA 1GUHA 4WEYA 4J56E 3VURA 7GSSA 2LNTA 2IMDA 1AQXA 4IN0A 3CSJA 5HFGA 2GQKA 3O76A 2FNOA 1T3BA 5ECIB 1EGOA 5GZZB 1S3DA 1FG4A 5A4VA 1U87A 2VD1A 1X5EA 2L59A 1JHBA 2FA4A 4V2MA 2P0GA 3Q19A 1R7HA 2VCVA 3IHGA 1JZRA 4JEDA 4GCIA 4K2XA 1IYIA 3DWVA 1F37A 4OFMA 5ECKB 3FEUA 2R4VA 14GSA 3C7MA 3HKRA 3L4NA 2DMLA 4MDCA 2H70A 1PN9A 1VGLA 2KHPA 5JWQB 3H4KA 5FWGA 1I9DA 3R3EA 4E8EA 1OC9A 1YKAA 1QQ2A 4WBRD 4KGIA 3TKSA 1SYXA 2MMAA 1X0RA 4E8HA 2OADA 2K8SA 3CBUA 1PSQA 5DQYA 3WGEA 5DAKA 3RBTA 3M9KA 2GGTA 6GSSA 5AIVA 1GNEA 4CY6A 4MJAA 4DSSB 3DEXA 4TR3A 1TI3A 1O85A 2K18A 1ZZYA 3E9JB 1F6MC 2L5LA 2YOIA 4PNFA 1X9MB 5IMCA 3IV4A 2DMMA 1B4QA 1A2LA 3TUEA 3TRQA 3GFKA 4TR1A 3D21A 2L4QA 2R5GA 22GSA 1K0CA 5F07A 1OE8A 1GSYA 2YWIA 2L5OA 3D6IA 5B8BA 1X9WB 1ACVA 2LRNA 2CV4A 4K0GA 1AIUA 3GNJA 2BTOT 1PN0A 3C1RA 2L6CA 5IMZA 3QFAC 4LLRA 4WBJA 5B6NA 1WP0A 2WB9A 4F0BA 2J23A 3FR3A 1A24A 1K0NA 2K9FA 4OCFA 4MCUA 5JCGA 3W6GA 2IMFA 1LU4A 1ZYPA 2MBTA 4OD7A 1SU9A 4PURA 2HRKA 4NXIA 2OE3A 3GH9A 3WD6A 1DSBA 2DLXA 2LKUA 5IO2A 2H66A 3BOAA 5ECPB 2QA2A 4EXJA 5DQSA 4ID0A 5DVBA 1WOUA 3W8SA 3FR9A 1SYRA 3ZFLA 3IK7A 4TXOA 3LORA 4ZB9A 1V2AA 4MA9A 2OKAA 3TJFA 1FB0A 1LBKA 2M80A 2HSHA 1MDKA 3HVSA 5IM9A 5AN1A 2PBJA 1QK8A 2PVQA 3KP9A 1A0RP 4EDZA 2D2ZA 1SJZA 1H4OA 4K8MA 4K0NA 1TU7A 3E0UA 3O3TA 2CA8A 2H6ZA 3RAZA 2JSYA 1YDKA 1FOHA 1KTEA 3TGZA 3D5JA 1XIYA 3D0ZA 4FH8A 4FYCA 1XFLA 4IP6A 3F4RA 2B5YA 2GZYA 3V1WA 2H71A 1FHEA 1JLWA 4I8BA 10GSA 6GSXA 3GYKA 2JSZA 5F06A 1Z9HA 2YZUA 3TJGA 1K3YA 1XBSA 3DD3A 2OBIA 1XWGA 2KOKA 1GH2A 2F8FA 3LXTA 1Z3EA 4F03A 1PQNA 4V1Ap 1EOHA 1RQMA 4ZBDA 1PL1A 3EINA 3P7XA 1SK0A 1XVQA 3PINA 5JCUA 5B7CA 2FWFA 4G0KA 4ECBA 4FYUA 5JWRB 3TJJA 1ZL9A 1Z5YE 4IKHA 2HSMA 3CSIA 4N11A 2FLSA 2N5AA 2C80A 3DRNA 3M3MA 4KW6A 2GLRA 4I6XA 4Q5RA 1DE2A 5IMVA 4IGJA 3H8QA 4MH3A 4O32A 3UAPA 4L8EA 2PWJA 5DCGA 3ZLPA 1ML6A 5AGYA 1SK1A 3CTGA 1AC1A 2LJRA 2LTKA 4JZQA 2A2RA 1B9YC 5F0GA 1S3AA 2YPMA 5F8BA 2GQLA 4HZ4A 4HU7A 4WXTA 2ALBA 2A2SA 3ZREA 2GVPA 5G1KA 3BJ5A 1ILOA 3HY2A 1T7PB 3PPUA 2MMZA 3PGTA 3BD2A 4TKYA 1O8XA 2GSQA 1SKWB 2VD0A 18GSA 4BVXA 5H5SA 2E2GA 2VLTA 2F3MA 2GQMA 3I9V2 4KE3A 2OJLA 3MSZA 1GWCA 3L0HA 1AW9A 3EWLA 3EC3A 5A4WA 1MDIA 1VF4A 4JBBA 2C8UA 2DJKA 3IAM2 5GAND 3FK8A 3BBYA 4K5RA 4KDUA 2HT9A 4MPGA 3ZTLA 4HDEA 3UJ1A 4HUAA 2XPEA 2NDOA 2DSAA 2H76A 4K2DA 3DVWA 4EL1A 4IVFA 3GTUB 1BYEA 2LV3A 3GSSA 4HU9A 2PPTA 1THXA 3ME8A 5J3RA 4NWYA 3P90A 5D9VA 5IOXA 5KN1A 4JE1A 1NM3A 2XBQA 8GSSA 2NBSA 2AJQB 3GH6A 1YKCA 3N9JA 5ECSA 1G7EA 4Q5NA 5C00A 5DBQA 1WPIA 3D4MA 1T00A 2OACA 3MNGA 3UL3A 5EVOA 3A2WA 3VI5A 1OVNA 1YY7A 2IMKA 3D4TA 3ZVJA 5AISA 1R5AA 3APSA 1SENA 3F4SA 4EKZA 4ML6A 5JCWA 3M9JA 4X4JA 1YEPA 3F3QA 2GTUA 2GSSA 1EP7A 2CVKA 3LGCA 4TXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL2 B;  1BED A;  2RM5 A;  5IQY A;  3QR6 A;  1PX6 A;  1EOG A;  1KNG A;  2LQQ A;  2YNX A;  1VF3 A;  1S3C A;  4XCS A;  4XS1 A;  1EGR A;  2E2M A;  3CRT A;  1X9S B;  1B48 A;  3G7J A;  5HQP A;  1I5G A;  3U5R E;  4LL1 B;  4IS0 A;  4GTU A;  4I2T A;  1Q98 A;  1A2M A;  4NHZ A;  3ZIT A;  4I97 A;  2CQ9 A;  4POK A;  2PVO C;  3QD9 A;  5D9X A;  2LQO A;  2EIO A;  5ID2 A;  3LWA A;  3ZZX A;  3QPM A;  4ECJ A;  4KCA A;  2E0Q A;  3LJR A;  4N10 A;  4TN8 A;  1QFN A;  1EZK A;  3ERF A;  1M0U A;  3RHC A;  2QSI A;  3EUR A;  6GSW A;  4KX4 A;  4QL9 A;  4PX1 A;  4ZL8 A;  2Z9S A;  3PR8 A;  5DDL A;  1M7T A;  2BJX A;  2IJY A;  1IYH A;  2V6O A;  2HRF A;  1R4W A;  1JLV A;  2MYG A;  1GSS A;  1O81 A;  4N0V A;  4X1U A;  5J4U A;  4MPF A;  1FVJ A;  1HNA A;  3US3 A;  3WGD A;  4BVY A;  2N5B A;  3KTB A;  2FA8 A;  3TOT A;  4MF7 A;  3LG6 A;  3KEB A;  4RI6 A;  2EIR A;  2R2J A;  4ZBB A;  2XBI A;  3WT1 A;  5ECH B;  1GTB A;  1TW9 A;  2ZNM A;  5B8A A;  1PGT A;  4NMU A;  4L0U A;  1DE1 A;  1EEJ A;  4ZBA A;  3FZ9 A;  2H1D A;  2GSR A;  5CO3 A;  5IPG A;  4MJB A;  3APO A;  3W8J A;  4ILF A;  2JZT A;  3EU4 A;  5L71 A;  3Q74 A;  2K6V A;  3IOS A;  2V1M A;  4LMW A;  2YCD A;  3HD5 A;  4EC0 A;  3KJY A;  4PNG A;  1WE0 A;  1UA5 A;  4J2F A;  4TOP A;  5KN3 A;  1F9M A;  3IE3 A;  3M0F A;  1M99 A;  2YWO A;  1HNC A;  3HXS A;  3ZVJ D;  3KGK A;  2A4V A;  4GXZ A;  1XWK A;  2H19 A;  1UC7 A;  4CW9 A;  2FHE A;  3Q6O A;  2VCX A;  3P8W A;  2HE3 A;  5CRE A;  3KH9 A;  3KIJ A;  4D73 B;  3UMA A;  4KDY A;  3KM6 A;  1GUK A;  4AJ6 A;  2B1L A;  2YWM A;  1K3O A;  4WET A;  5LNK e;  3RPP A;  3TKQ A;  1TOF A;  1AQV A;  3S9F A;  3UEM A;  5H5Q A;  2PU9 C;  5DAL A;  2AAW A;  2HXK A;  3O6T A;  19GS A;  3M1G A;  5D9W A;  3L9V A;  1PRX A;  4EF0 A;  3EMP A;  1DBY A;  2B6M A;  3TKS C;  3IHQ A;  4ZL7 A;  3TDG A;  3F3R A;  3GRX A;  3ISO A;  1XPV A;  2KP2 A;  1URM A;  1A8Y A;  5ECR B;  5DJL A;  2TRC P;  1ZYE A;  2MZC A;  4XS4 B;  2B5X A;  4DSS A;  2G2Q A;  1GRX A;  1M2D A;  4G9H A;  2JU5 A;  4DEJ A;  3WYW A;  4J57 E;  3DKS A;  1PKZ A;  5CAX A;  2XHF A;  4IJ3 A;  1Z6M A;  1F3B A;  3QAG A;  3J7Y k;  4GRF A;  1ZMA A;  3I6A A;  4IHU A;  16GS A;  3HJO A;  4FIW A;  2I3Y A;  2PER A;  5ECQ B;  2IMI A;  2IL3 A;  1YQ1 A;  1O73 A;  3CXG A;  4KB3 A;  5J9C A;  1B8X A;  5IPH A;  3ERW A;  3UOM A;  5KN0 A;  2YP6 A;  1GSD A;  3C73 A;  4ZXG A;  4YAP A;  4YAV A;  3A2V A;  1ON4 A;  1BX9 A;  2LUS A;  4K7N A;  3QAW A;  1G0T A;  5ECM B;  4BPY A;  2LRC A;  2QKE A;  1CQH A;  1PKW A;  1GLP A;  5D96 A;  1T8E B;  2C0F A;  3CSH A;  4CDO A;  3GUR A;  5COH A;  2C0G A;  1ZYQ B;  2RLI A;  1VF2 A;  3QFB C;  5EPF A;  4G10 A;  5C04 A;  3TRP A;  4ML1 A;  5GSS A;  4O5R A;  2B5E A;  2JAC A;  2CVB A;  4MK3 A;  4V2L A;  5A4U A;  1QMV A;  2ZUP A;  2AV4 A;  2P5R A;  6GSV A;  2DJJ A;  2H6Y A;  4KUN A;  3WT2 A;  3KD0 A;  1K0O A;  1NHY A;  2YV7 A;  3I69 A;  4MH2 A;  3G9B A;  1KEB A;  2F51 A;  4GQF A;  3IBH A;  1YEX A;  5CP1 A;  1JZD A;  1GNW A;  4MP4 A;  2FD3 A;  2V41 A;  5D9T A;  3GL5 A;  2VL3 A;  3M8N A;  3MDK A;  4KDX A;  5J5N A;  4HQS A;  5JWO B;  1BJX A;  3DVX A;  5ECN B;  2VCZ A;  2HLS A;  2I4A A;  3LFL A;  1WIK A;  3HVV A;  1A8L A;  4NV5 A;  4OO4 A;  3IK9 A;  4AJ8 A;  1A23 A;  3UIW A;  1XWC A;  1NW2 A;  2VIM A;  2CVD A;  3VPT A;  3ZYW A;  1TP9 A;  1HD2 A;  2GT6 A;  2H1A A;  4PQI A;  3EMX A;  2K8V A;  2RM6 A;  1W89 A;  4K1F A;  1O8W A;  3VWW A;  1GSF A;  1AUC A;  2FWH A;  3VWV A;  2YV9 A;  1F2E A;  3GKM A;  3IR4 A;  1JZW A;  3ZIV A;  2IFQ B;  1YF1 A;  4N30 A;  1U3I A;  2HRN A;  3EE2 A;  1M2B A;  4LA1 A;  5CRH A;  4IJI A;  2LJK A;  2P5Q A;  5LD0 A;  4EO3 A;  2IME A;  1ERW A;  2CAQ A;  4NAX A;  1U3A A;  5CRD A;  4F2I A;  1KBN A;  2WUL A;  1TRS A;  1TRU A;  3KZQ A;  4H86 A;  3EU3 A;  1PD2 1;  1MEK A;  2GST A;  4L0W A;  3CTF A;  20GS A;  2C0D A;  1HNB A;  2LS5 A;  2OE0 A;  1H75 A;  2LNS A;  4HJ2 A;  5D93 A;  2CX4 A;  2EIQ A;  1WRY A;  2NTO A;  3GTU A;  3VWU A;  3D22 A;  2CAI A;  1XW9 A;  2X8G A;  1SKS B;  2CX3 A;  2VCW A;  2KUC A;  4DSQ A;  1R26 A;  2RUF A;  4TR4 A;  3TJB A;  1Z6N A;  2C0E A;  3QCP A;  4YQU A;  1O6J A;  1OKT A;  2MMN A;  1G7O A;  4WF4 A;  4PUA A;  2HSY A;  2CT6 A;  3HDC A;  4GSS A;  1XZO A;  4KAE A;  4NPB A;  4KND A;  1XOA A;  4AGS A;  2FWG A;  3VFI A;  4OFN A;  3L9S A;  1VF1 A;  4F82 A;  2JAD A;  1OAZ A;  2O7K A;  4KCE A;  1VRS D;  2B3S A;  4WKW A;  2O87 A;  2MBS A;  4AJ7 A;  3BCI A;  4PQH A;  1G6Y A;  3GX0 A;  1MD4 A;  1XW6 A;  4XRA A;  4K6X A;  1TU8 A;  1XW5 A;  2OA7 A;  1N2A A;  2CZ2 A;  2L6D A;  5CNW A;  4CHS A;  1SKR B;  5F05 A;  1GSQ A;  1G6W A;  3DXB A;  1FOV A;  3IRA A;  1X5C A;  2M46 A;  4L5L A;  3L78 A;  4O92 A;  5ABR A;  3TKR A;  4MZW A;  2H0G A;  4OCE A;  5CRG A;  2AHE A;  2JL4 A;  5HR0 A;  1JZO A;  2X8H A;  3VPQ A;  3KMN A;  1TJD A;  1T4Z A;  4MF5 A;  2VLV A;  2DJ0 A;  2C3N A;  4BA7 A;  3F6D A;  3UBK A;  2P31 A;  2JZS A;  3R2Q A;  2R37 A;  1SD9 A;  1TRV A;  2DBC A;  1O7U A;  4ZB6 A;  3HZ8 A;  2RII A;  4MMM A;  2V6K A;  4PXO A;  4BWQ A;  3GV1 A;  1TTZ A;  3VK9 A;  1ERU A;  1GSU A;  3KH7 A;  4V1A g;  2LRT A;  1Y6E A;  4XRD A;  1E6B A;  4Z7X A;  4X43 A;  3QAV A;  4HQZ A;  3DGQ A;  1GP1 A;  2I1U A;  1BQ7 A;  1ZCP A;  4G2E A;  2WS2 A;  4JR6 A;  2MMO A;  3F9U A;  1ST9 A;  3IDV A;  12GS A;  1GTU A;  3Q18 A;  4YH2 A;  5HFK A;  4IQA A;  2XC2 A;  1K0M A;  1OYJ A;  3E3E A;  3HYP A;  2YAN A;  2I9H A;  2HZE B;  5A5K A;  3LYK A;  1T4Y A;  4GLT A;  4JU5 A;  4LMV A;  2F8A A;  3LSZ A;  1SD8 A;  1J0F A;  3HZ4 A;  4MAB A;  2PUK C;  1ZGN A;  2H1G A;  3RHB A;  1V57 A;  4IEL A;  4K7I A;  4ZL9 A;  3MWH A;  2R6K A;  3TB2 A;  4MZB A;  2ON5 A;  4RI7 A;  2TRX A;  3L9U A;  1M2A A;  4XHM A;  4XIH A;  3GKX A;  4L5O A;  2CZ3 A;  3G7I A;  2GT5 A;  2ZCT A;  1EEM A;  2FUG 2;  3DIE A;  1FO5 A;  2O85 A;  3KXO A;  4DVC A;  4O7H A;  2HFD A;  4XS6 A;  5D8I A;  1V58 A;  2VM2 A;  1GTA A;  3A2X A;  4D73 A;  5FHI A;  2EC4 A;  2VUP A;  3GX8 A;  2NPB A;  3FHK A;  1R5P A;  4HEA 2;  2WRT A;  4WR5 A;  3F8U A;  3GIX A;  1PMT A;  1T1V A;  3G7Y A;  2VL2 A;  3I43 A;  3FR6 A;  1XWA A;  5FT3 A;  2B7J A;  2C3Q A;  3UAR A;  1TI1 A;  3OR5 A;  3RDW A;  4P3Y B;  4XS4 A;  4GWR A;  5J41 A;  5HR2 A;  3GST A;  3CRU A;  1NSW A;  4FO5 A;  4MJC A;  1V98 A;  3P2A A;  3U6V A;  3NZN A;  3ZFB A;  1V9W A;  1BAY A;  1K0B A;  2C1Y A;  2AYT A;  3GN3 A;  4PGT A;  3CMI A;  3NOF A;  2VAF A;  5AIX A;  1K0D A;  2N5F A;  3ZML A;  5HR1 A;  4AF2 A;  5DAL B;  2DJ2 A;  3AY8 A;  3UVH A;  4EE0 A;  1PA3 A;  2HI7 A;  3HJM A;  2VO4 A;  2H0H A;  4YQV A;  1THO A;  3LQ7 A;  1QGV A;  1OC9 B;  2FWE A;  3VI7 A;  3A5W A;  1ZOF A;  2I81 A;  1JFU A;  5DAK B;  4N0Z A;  2GZP A;  3F0I A;  3FRC A;  17GS A;  5G1L A;  3FZ4 A;  3GKN A;  4ZIL A;  3TKP A;  3IC4 A;  5ELG A;  2KP1 A;  4OFT A;  1MD3 A;  1USB A;  2H73 A;  6GSU A;  2VCT A;  5IO0 A;  2IPA A;  1EV9 A;  3ED3 A;  2C3T A;  2VL9 A;  3H93 A;  1V40 A;  3HJP A;  1Z7R A;  3GA4 A;  1TRW A;  1YF0 A;  4TR1 B;  5GST A;  2PGT A;  1FB6 A;  2RUE A;  3ZIJ A;  1CQG A;  2HZF A;  1QUW A;  2H0I A;  2R3X A;  4MJE A;  5HR3 A;  1OC8 A;  4WR4 A;  1Y25 A;  3F4T A;  2IN3 A;  1EWX A;  1YJ6 A;  3LXZ A;  1W4V A;  5EY6 A;  5E4W A;  1XWB A;  2B7K A;  2J9H A;  1SJ6 A;  3UVT A;  1SK2 A;  1EP8 A;  2WDU A;  1A2J A;  2WJU A;  3WGX A;  3KMO A;  2ES7 A;  3LYP A;  3IPZ A;  5IMA A;  2FGX A;  2H74 A;  2YN1 A;  2QC7 A;  3SWL A;  5G5E A;  3H1N A;  1RK4 A;  4TXO B;  9GSS A;  1FAA A;  1MTC A;  4IP1 A;  3J7Y b;  3KTL A;  3HA9 A;  1SJI A;  1OKD A;  1Z7P A;  2E7P A;  4HOJ A;  4ISD A;  1U88 A;  1HQO A;  1K3L A;  1E2Y A;  3QOU A;  2G0F A;  4TRX A;  1GUL A;  4ECC A;  4IBP A;  1AXD A;  4I5Q A;  4PQ1 A;  4KSO A;  3HHV A;  5INY A;  3N5O A;  1TK8 B;  5J9B A;  4GST A;  4RQR A;  1OC3 A;  2PMT A;  2DJ1 A;  5G5F A;  1ERT A;  3F63 A;  1ERV A;  2DIY A;  2WGR A;  5CYY A;  2DC5 A;  3ERG A;  3HCZ A;  3FW2 A;  4F9Z A;  1TK0 B;  2X99 A;  3GKK A;  2WZ9 A;  2IFQ A;  1ABA A;  1GUM A;  1GLQ A;  2YZH A;  1A0F A;  1TK5 B;  5IMD A;  2H1B A;  1B4P A;  2WFC A;  5HFI A;  4ECI A;  3GL3 A;  5ELA A;  2YWN A;  2YJ7 A;  4LL4 B;  3ZRD A;  2BMX A;  1K0A A;  2H30 A;  4Q5F A;  1XVW A;  2AB6 A;  1J08 A;  4NHW A;  5DJM A;  1Q4J A;  2X64 A;  2F9S A;  4G19 A;  5IOW A;  1YZX A;  4KA0 A;  1AQW A;  4RUV A;  4X0X A;  1TKD B;  2GZZ A;  3KCM A;  4JRR A;  3F6F A;  3K8N A;  3VWX A;  3GHA A;  2V32 A;  4QL7 A;  4JR4 A;  4TR0 A;  4ZIJ A;  1QXH A;  1TXX A;  4BWS A;  4KH7 A;  4F0C A;  5D73 A;  2DJ3 A;  2FCH A;  3TOU A;  4EDY A;  13GS A;  4I2U A;  1UVZ A;  3QDN A;  3TJK A;  2OBK A;  2VOC A;  3RPN A;  3LEF A;  2TIR A;  1UN2 A;  3FYG A;  3APQ A;  1J9B A;  2L57 A;  1OE7 A;  3SBC A;  3ZL5 A;  2H01 A;  4OMV A;  3DYR A;  3UBL A;  4TW5 A;  4RQX A;  2IIY A;  3FZ5 A;  5GAP D;  4DSR A;  4K9Z A;  3BCK A;  1C72 A;  1FW1 A;  1U6T A;  4GQC A;  1XOB A;  4IW9 A;  5ECL B;  4IQ1 A;  1F3A A;  5IIZ A;  2FY6 A;  2LJA A;  4XTS A;  4K7O A;  4ACS A;  3NIV A;  2DIZ A;  5KN2 A;  5ENU A;  4HS1 A;  4OO5 A;  4QQ7 A;  3EVI A;  3IAS 2;  1N8J A;  3H79 A;  2GDR A;  3IA1 A;  4MF6 A;  2GS3 A;  4OWY A;  1GSE A;  2YJH A;  5H5R A;  3A3T A;  5IMF A;  4EUY A;  2VM1 A;  5EL8 A;  5KEJ A;  3PH9 A;  3MAK A;  2KLX A;  2JZR A;  6GST A;  4WF5 A;  2B1K A;  2V2G A;  5E59 A;  2NVL A;  3C71 A;  1LJR A;  1M9A A;  1RW1 A;  1BG5 A;  3FKF A;  2XPD A;  4HZ2 A;  4MLY A;  6GSY A;  2AUV A;  2C4J A;  4KSM A;  1GL8 A;  3GUS A;  3C1S A;  2L4C A;  1XCC A;  5ECO B;  2LST A;  1M9B A;  4POL A;  2VLU A;  4GSN A;  3HVX A;  1EV4 A;  2VCQ A;  4PUF C;  1NHO A;  3CYN A;  2H6X A;  2H8L A;  2REM A;  2LEG A;  4ULX A;  2ON7 A;  2H72 A;  1WMJ A;  2OE1 A;  4GF0 A;  1HYU A;  2HZE A;  1FVK A;  4HJM A;  4ZB8 A;  1DUG A;  4EVM A;  3VLN A;  4Q5Q A;  2PN8 A;  3ZMK A;  3TRX A;  3FZA A;  1XXU A;  5G2Z A;  5ID2 B;  1SL1 B;  1WJK A;  3IXR A;  5DCH A;  3QMX A;  5LCZ A;  3GMF A;  4HI7 A;  1PX7 A;  4FYB A;  4YQM A;  2O8V B;  3ME7 A;  1AAZ A;  2M72 A;  3TKS E;  5B6M A;  4POB A;  5G31 A;  2H75 A;  1PL2 A;  3FY7 A;  3KP8 A;  1SL0 B;  2X8C A;  2IWT A;  2HYX A;  4MZC A;  11GS A;  3C8E A;  1B9X C;  3DML A;  3EYT A;  3TCO A;  5G30 A;  2WCI A;  1TDI A;  1X5D A;  4POM A;  3JCM L;  4NV2 A;  2HNL A;  1WWJ A;  5CRW A;  2O89 A;  4V2N A;  4TVE A;  2QGV A;  4BL7 A;  1MDJ A;  2VL2 C;  1GTI A;  1GUH A;  4WEY A;  4J56 E;  3VUR A;  7GSS A;  2LNT A;  2IMD A;  1AQX A;  4IN0 A;  3CSJ A;  5HFG A;  2GQK A;  3O76 A;  2FNO A;  1T3B A;  5ECI B;  1EGO A;  5GZZ B;  1S3D A;  1FG4 A;  5A4V A;  1U87 A;  2VD1 A;  1X5E A;  2L59 A;  1JHB A;  2FA4 A;  4V2M A;  2P0G A;  3Q19 A;  1R7H A;  2VCV A;  1JZR A;  4JED A;  4GCI A;  1IYI A;  3DWV A;  1F37 A;  4OFM A;  5ECK B;  3FEU A;  2R4V A;  14GS A;  3C7M A;  3HKR A;  3L4N A;  2DML A;  4MDC A;  2H70 A;  1PN9 A;  1VGL A;  2KHP A;  5JWQ B;  3H4K A;  5FWG A;  1I9D A;  4E8E A;  1OC9 A;  1YKA A;  1QQ2 A;  4WBR D;  4KGI A;  3TKS A;  1SYX A;  2MMA A;  1X0R A;  4E8H A;  2OAD A;  2K8S A;  3CBU A;  1PSQ A;  5DQY A;  3WGE A;  5DAK A;  3RBT A;  3M9K A;  2GGT A;  6GSS A;  5AIV A;  1GNE A;  4MJA A;  4DSS B;  3DEX A;  4TR3 A;  1TI3 A;  1O85 A;  2K18 A;  1ZZY A;  3E9J B;  1F6M C;  2L5L A;  2YOI A;  4PNF A;  1X9M B;  5IMC A;  3IV4 A;  2DMM A;  1B4Q A;  1A2L A;  3TUE A;  3TRQ A;  3GFK A;  4TR1 A;  3D21 A;  2L4Q A;  2R5G A;  22GS A;  1K0C A;  5F07 A;  1OE8 A;  1GSY A;  2YWI A;  2L5O A;  3D6I A;  5B8B A;  1X9W B;  1ACV A;  2LRN A;  2CV4 A;  4K0G A;  1AIU A;  3GNJ A;  2BTO T;  3C1R A;  2L6C A;  5IMZ A;  3QFA C;  4LLR A;  4WBJ A;  5B6N A;  1WP0 A;  2WB9 A;  4F0B A;  2J23 A;  3FR3 A;  1A24 A;  1K0N A;  2K9F A;  4OCF A;  4MCU A;  5JCG A;  3W6G A;  2IMF A;  1LU4 A;  2MBT A;  4OD7 A;  1SU9 A;  4PUR A;  4NXI A;  2OE3 A;  3GH9 A;  3WD6 A;  1DSB A;  2DLX A;  2LKU A;  5IO2 A;  2H66 A;  3BOA A;  5ECP B;  4EXJ A;  5DQS A;  4ID0 A;  5DVB A;  1WOU A;  3W8S A;  3FR9 A;  1SYR A;  3ZFL A;  3IK7 A;  4TXO A;  3LOR A;  4ZB9 A;  1V2A A;  4MA9 A;  2OKA A;  3TJF A;  1FB0 A;  1LBK A;  2M80 A;  2HSH A;  1MDK A;  3HVS A;  5IM9 A;  5AN1 A;  2PBJ A;  1QK8 A;  2PVQ A;  3KP9 A;  1A0R P;  4EDZ A;  2D2Z A;  1SJZ A;  1H4O A;  4K8M A;  4K0N A;  1TU7 A;  3E0U A;  3O3T A;  2CA8 A;  2H6Z A;  3RAZ A;  2JSY A;  1YDK A;  1KTE A;  3TGZ A;  3D5J A;  1XIY A;  3D0Z A;  4FH8 A;  4FYC A;  1XFL A;  4IP6 A;  3F4R A;  2B5Y A;  2GZY A;  3V1W A;  2H71 A;  1FHE A;  1JLW A;  4I8B A;  10GS A;  6GSX A;  3GYK A;  2JSZ A;  5F06 A;  1Z9H A;  2YZU A;  3TJG A;  1K3Y A;  1XBS A;  3DD3 A;  2OBI A;  1XWG A;  2KOK A;  1GH2 A;  2F8F A;  3LXT A;  1Z3E A;  4F03 A;  1PQN A;  4V1A p;  1EOH A;  1RQM A;  4ZBD A;  1PL1 A;  3EIN A;  3P7X A;  1SK0 A;  1XVQ A;  3PIN A;  5JCU A;  5B7C A;  2FWF A;  4ECB A;  4FYU A;  5JWR B;  3TJJ A;  1ZL9 A;  1Z5Y E;  4IKH A;  3CSI A;  4N11 A;  2FLS A;  2N5A A;  2C80 A;  3DRN A;  3M3M A;  4KW6 A;  2GLR A;  4I6X A;  4Q5R A;  1DE2 A;  5IMV A;  4IGJ A;  3H8Q A;  4MH3 A;  4O32 A;  3UAP A;  4L8E A;  2PWJ A;  5DCG A;  3ZLP A;  1ML6 A;  5AGY A;  1SK1 A;  3CTG A;  1AC1 A;  2LJR A;  2LTK A;  4JZQ A;  2A2R A;  1B9Y C;  5F0G A;  1S3A A;  2YPM A;  5F8B A;  2GQL A;  4HZ4 A;  4HU7 A;  4WXT A;  2ALB A;  2A2S A;  3ZRE A;  2GVP A;  5G1K A;  3BJ5 A;  1ILO A;  3HY2 A;  1T7P B;  2MMZ A;  3PGT A;  3BD2 A;  4TKY A;  1O8X A;  2GSQ A;  1SKW B;  2VD0 A;  18GS A;  4BVX A;  5H5S A;  2E2G A;  2VLT A;  2F3M A;  2GQM A;  3I9V 2;  4KE3 A;  2OJL A;  3MSZ A;  1GWC A;  3L0H A;  1AW9 A;  3EWL A;  3EC3 A;  5A4W A;  1MDI A;  1VF4 A;  4JBB A;  2C8U A;  2DJK A;  3IAM 2;  5GAN D;  3FK8 A;  3BBY A;  4KDU A;  2HT9 A;  4MPG A;  3ZTL A;  4HDE A;  3UJ1 A;  4HUA A;  2XPE A;  2NDO A;  2DSA A;  2H76 A;  4K2D A;  3DVW A;  4EL1 A;  4IVF A;  3GTU B;  1BYE A;  2LV3 A;  3GSS A;  4HU9 A;  2PPT A;  1THX A;  3ME8 A;  5J3R A;  4NWY A;  3P90 A;  5D9V A;  5IOX A;  5KN1 A;  4JE1 A;  1NM3 A;  2XBQ A;  8GSS A;  2NBS A;  2AJQ B;  3GH6 A;  1YKC A;  3N9J A;  5ECS A;  1G7E A;  4Q5N A;  5C00 A;  5DBQ A;  1WPI A;  3D4M A;  1T00 A;  2OAC A;  3MNG A;  3UL3 A;  5EVO A;  3A2W A;  3VI5 A;  1OVN A;  1YY7 A;  2IMK A;  3D4T A;  3ZVJ A;  5AIS A;  1R5A A;  3APS A;  1SEN A;  3F4S A;  4EKZ A;  4ML6 A;  5JCW A;  3M9J A;  1YEP A;  3F3Q A;  2GTU A;  2GSS A;  1EP7 A;  2CVK A;  3LGC A;  4TXV A; 
#chains in the Genus database with same CATH topology
 1SL2 B;  1BED A;  2RM5 A;  5IQY A;  3QR6 A;  1PX6 A;  1EOG A;  1KNG A;  2LQQ A;  2YNX A;  1VF3 A;  1S3C A;  4XCS A;  4XS1 A;  1EGR A;  2E2M A;  3CRT A;  1X9S B;  1B48 A;  3G7J A;  5HQP A;  1I5G A;  3U5R E;  4LL1 B;  4IS0 A;  4GTU A;  4I2T A;  1Q98 A;  1A2M A;  4NHZ A;  3ZIT A;  4I97 A;  2CQ9 A;  4POK A;  2PVO C;  3QD9 A;  5D9X A;  2LQO A;  1PFO A;  2EIO A;  5ID2 A;  3LWA A;  3ZZX A;  3QPM A;  4ECJ A;  4KCA A;  2E0Q A;  3LJR A;  4N10 A;  4TN8 A;  1QFN A;  1EZK A;  3ERF A;  1M0U A;  3RHC A;  2QSI A;  3EUR A;  6GSW A;  4KX4 A;  4QL9 A;  4PX1 A;  4ZL8 A;  2Z9S A;  3PR8 A;  5DDL A;  1M7T A;  2BJX A;  2IJY A;  1IYH A;  2V6O A;  2HRF A;  1R4W A;  1JLV A;  2MYG A;  1GSS A;  1O81 A;  4N0V A;  4X1U A;  5J4U A;  4MPF A;  1FVJ A;  1HNA A;  2R0P A;  3US3 A;  3WGD A;  4BVY A;  2N5B A;  3KTB A;  4HSC X;  2FA8 A;  3TOT A;  4MF7 A;  3LG6 A;  3KEB A;  4RI6 A;  2EIR A;  2R2J A;  4ZBB A;  2XBI A;  3WT1 A;  5ECH B;  1GTB A;  1TW9 A;  2ZNM A;  4K5S A;  5B8A A;  1PGT A;  4NMU A;  4L0U A;  1DE1 A;  1EEJ A;  4ZBA A;  3FZ9 A;  2H1D A;  2GSR A;  5CO3 A;  5IPG A;  4MJB A;  3APO A;  3W8J A;  4ILF A;  2JZT A;  2HRA A;  3EU4 A;  5L71 A;  3Q74 A;  2K6V A;  3IOS A;  2V1M A;  4LMW A;  2YCD A;  3HD5 A;  4EC0 A;  4PTS A;  2DKH A;  3KJY A;  1WE0 A;  1UA5 A;  4PNG A;  4J2F A;  4TOP A;  5KN3 A;  1F9M A;  3IE3 A;  3M0F A;  1M99 A;  2YWO A;  1HNC A;  3HXS A;  3ZVJ D;  3KGK A;  2A4V A;  1M3I A;  4GXZ A;  1XWK A;  2H19 A;  1UC7 A;  4CW9 A;  2FHE A;  3Q6O A;  2VCX A;  3P8W A;  2HE3 A;  5CRE A;  3KH9 A;  3KIJ A;  4D73 B;  3UMA A;  4KDY A;  3KM6 A;  1GUK A;  4AJ6 A;  2B1L A;  2YWM A;  1K3O A;  4WET A;  5LNK e;  3RPP A;  3TKQ A;  1TOF A;  1AQV A;  3S9F A;  3UEM A;  5H5Q A;  2PU9 C;  5DAL A;  2AAW A;  2HXK A;  3O6T A;  19GS A;  3M1G A;  5D9W A;  3L9V A;  1PRX A;  4EF0 A;  3EMP A;  1DBY A;  2B6M A;  3TKS C;  3IHQ A;  4ZL7 A;  3TDG A;  3F3R A;  3GRX A;  3ISO A;  1XPV A;  2KP2 A;  1URM A;  1A8Y A;  5ECR B;  5DJL A;  2TRC P;  1ZYE A;  2MZC A;  4XS4 B;  2B5X A;  4DSS A;  5KOX A;  2G2Q A;  1GRX A;  1M2D A;  4G9H A;  2JU5 A;  4DEJ A;  3WYW A;  4J57 E;  3DKS A;  1PKZ A;  5CAX A;  2XHF A;  4IJ3 A;  1Z6M A;  1F3B A;  3QAG A;  3J7Y k;  4GRF A;  1ZMA A;  3I6A A;  4IHU A;  16GS A;  3HJO A;  4FIW A;  2I3Y A;  2PER A;  5ECQ B;  2IMI A;  2IL3 A;  1YQ1 A;  1O73 A;  3CXG A;  4KB3 A;  5J9C A;  1B8X A;  4YKG A;  5IPH A;  3ERW A;  3UOM A;  5KN0 A;  2YP6 A;  1GSD A;  3C73 A;  4ZXG A;  4YAP A;  4YAV A;  3A2V A;  1ON4 A;  1BX9 A;  2LUS A;  4K7N A;  3QAW A;  1G0T A;  5ECM B;  4BPY A;  2LRC A;  2QKE A;  1CQH A;  1PKW A;  1GLP A;  5D96 A;  1T8E B;  2C0F A;  3CSH A;  4CDO A;  3GUR A;  5COH A;  2C0G A;  1ZYQ B;  2RLI A;  1VF2 A;  3QFB C;  5EPF A;  4G10 A;  5C04 A;  3TRP A;  4ML1 A;  5GSS A;  4O5R A;  2B5E A;  2JAC A;  2CVB A;  4MK3 A;  4V2L A;  2R0G A;  5A4U A;  1QMV A;  2ZUP A;  2AV4 A;  2P5R A;  6GSV A;  5BMU A;  2DJJ A;  2H6Y A;  2QA1 A;  4KUN A;  3WT2 A;  3KD0 A;  1K0O A;  1NHY A;  2YV7 A;  3I69 A;  4MH2 A;  3G9B A;  1KEB A;  2F51 A;  4GQF A;  3IBH A;  1YEX A;  5CP1 A;  1JZD A;  4G0I A;  1GNW A;  4MP4 A;  2FD3 A;  2V41 A;  5D9T A;  3GL5 A;  2VL3 A;  3M8N A;  3MDK A;  4KDX A;  5J5N A;  4YKF A;  4HQS A;  5JWO B;  1BJX A;  3DVX A;  5ECN B;  2VCZ A;  2HLS A;  2I4A A;  3LFL A;  1WIK A;  3HVV A;  1A8L A;  4NV5 A;  4OO4 A;  3IK9 A;  4AJ8 A;  1A23 A;  3UIW A;  1XWC A;  1NW2 A;  2VIM A;  2CVD A;  3VPT A;  3ZYW A;  1TP9 A;  1HD2 A;  2GT6 A;  2H1A A;  4PQI A;  3EMX A;  2K8V A;  2RM6 A;  1W89 A;  4K1F A;  1O8W A;  1ZYN A;  3VWW A;  1GSF A;  3CQF A;  1AUC A;  2FWH A;  3VWV A;  2YV9 A;  4KF9 A;  1F2E A;  3GKM A;  3IR4 A;  1JZW A;  3ZIV A;  2IFQ B;  1YF1 A;  4N30 A;  1U3I A;  2HRN A;  3EE2 A;  1M2B A;  4LA1 A;  5CRH A;  4IJI A;  2LJK A;  2P5Q A;  5LD0 A;  4EO3 A;  2IME A;  1ERW A;  2CAQ A;  4NAX A;  1U3A A;  5CRD A;  4F2I A;  1KBN A;  2WUL A;  1TRS A;  1TRU A;  3KZQ A;  4H86 A;  4A5P A;  3EU3 A;  1PD2 1;  1MEK A;  2GST A;  4L0W A;  3CTF A;  20GS A;  2C0D A;  1HNB A;  2LS5 A;  2OE0 A;  1H75 A;  2LNS A;  4HJ2 A;  5D93 A;  2CX4 A;  2EIQ A;  1WRY A;  2NTO A;  3GTU A;  3VWU A;  3D22 A;  2CAI A;  1XW9 A;  2X8G A;  2X4A A;  1SKS B;  2CX3 A;  2VCW A;  2KUC A;  4DSQ A;  2DKI A;  1R26 A;  2RUF A;  4TR4 A;  3TJB A;  1Z6N A;  2C0E A;  4BVX B;  3QCP A;  4YQU A;  1O6J A;  1OKT A;  2MMN A;  1G7O A;  4O5U A;  4WF4 A;  4PUA A;  2HSY A;  2CT6 A;  3HDC A;  4GSS A;  1XZO A;  4KAE A;  4NPB A;  4KND A;  1XOA A;  4AGS A;  2FWG A;  3VFI A;  4OFN A;  3L9S A;  4USS A;  1VF1 A;  4F82 A;  2JAD A;  1OAZ A;  2O7K A;  4KCE A;  1VRS D;  2B3S A;  4WKW A;  2O87 A;  2MBS A;  4AJ7 A;  3BCI A;  4PQH A;  1G6Y A;  3GX0 A;  1MD4 A;  1XW6 A;  4XRA A;  4K6X A;  1TU8 A;  1XW5 A;  2OA7 A;  1N2A A;  2CZ2 A;  2L6D A;  5CNW A;  4CHS A;  1SKR B;  5F05 A;  1GSQ A;  1G6W A;  3DXB A;  1FOV A;  3IRA A;  1X5C A;  2M46 A;  4L5L A;  3L78 A;  4O92 A;  5ABR A;  3TKR A;  2UZ8 A;  3MYD A;  4MZW A;  2H0G A;  4OCE A;  5CRG A;  2AHE A;  2JL4 A;  5HR0 A;  2R0C A;  1JZO A;  3IC8 A;  2X8H A;  2A4H A;  3VPQ A;  3KMN A;  1TJD A;  1T4Z A;  4MF5 A;  2VLV A;  2DJ0 A;  2C3N A;  4BA7 A;  3F6D A;  3UBK A;  2P31 A;  2JZS A;  3R2Q A;  2R37 A;  1SD9 A;  1TRV A;  2DBC A;  1O7U A;  4ZB6 A;  3HZ8 A;  2RII A;  4MMM A;  2V6K A;  4PXO A;  4BWQ A;  3GV1 A;  1TTZ A;  3VK9 A;  1ERU A;  1GSU A;  3KH7 A;  4V1A g;  2LRT A;  1Y6E A;  4XRD A;  1E6B A;  4Z7X A;  4X43 A;  3QAV A;  4HQZ A;  3DGQ A;  1GP1 A;  2I1U A;  1BQ7 A;  1ZCP A;  4G2E A;  2WS2 A;  4JR6 A;  2MMO A;  3F9U A;  1ST9 A;  3IDV A;  12GS A;  1GTU A;  3Q18 A;  4YH2 A;  5HFK A;  4IQA A;  2XC2 A;  1K0M A;  1OYJ A;  3E3E A;  3HYP A;  2YAN A;  2I9H A;  2HZE B;  5A5K A;  3LYK A;  1T4Y A;  4GLT A;  4JU5 A;  4LMV A;  2F8A A;  3LSZ A;  1SD8 A;  1J0F A;  3HZ4 A;  4MAB A;  2PUK C;  1ZGN A;  2H1G A;  3RHB A;  1V57 A;  4IEL A;  4K7I A;  4ZL9 A;  3MWH A;  2R6K A;  3TB2 A;  4MZB A;  2ON5 A;  4RI7 A;  2TRX A;  3L9U A;  1M2A A;  4XHM A;  4XIH A;  3GKX A;  4L5O A;  2CZ3 A;  3G7I A;  2GT5 A;  2ZCT A;  1EEM A;  2FUG 2;  3DIE A;  1FO5 A;  2O85 A;  3KXO A;  5KOW A;  4DVC A;  4O7H A;  2HFD A;  4XS6 A;  5D8I A;  1V58 A;  2VM2 A;  1GTA A;  3A2X A;  4ICY A;  4D73 A;  5FHI A;  2EC4 A;  2VUP A;  3GX8 A;  2NPB A;  3FHK A;  1R5P A;  4HEA 2;  2WRT A;  4WR5 A;  3F8U A;  3GIX A;  1PMT A;  1T1V A;  3G7Y A;  2VL2 A;  3I43 A;  3FR6 A;  1XWA A;  5FT3 A;  2B7J A;  2C3Q A;  4BL7 B;  3UAR A;  1TI1 A;  3OR5 A;  3RDW A;  4P3Y B;  4XS4 A;  4GWR A;  5J41 A;  5HR2 A;  3GST A;  3CRU A;  1NSW A;  4FO5 A;  4MJC A;  1V98 A;  3P2A A;  3U6V A;  3NZN A;  3ZFB A;  1V9W A;  1BAY A;  1K0B A;  2C1Y A;  2AYT A;  3GN3 A;  4PGT A;  3CMI A;  3A5I A;  3NOF A;  2VAF A;  5AIX A;  1K0D A;  2N5F A;  3ZML A;  5HR1 A;  4AF2 A;  5DAL B;  2DJ2 A;  3AY8 A;  3UVH A;  4EE0 A;  1PA3 A;  2HI7 A;  3HJM A;  2VO4 A;  2H0H A;  4YQV A;  1THO A;  3LQ7 A;  1QGV A;  1OC9 B;  2FWE A;  3VI7 A;  3A5W A;  1ZOF A;  2I81 A;  1JFU A;  4N0Z A;  5DAK B;  2GZP A;  3F0I A;  3FRC A;  17GS A;  5G1L A;  3FZ4 A;  3GKN A;  4ZIL A;  3TKP A;  3IC4 A;  5ELG A;  2KP1 A;  4OFT A;  1MD3 A;  1USB A;  2H73 A;  6GSU A;  2VCT A;  5IO0 A;  2IPA A;  1EV9 A;  3ED3 A;  2C3T A;  2VL9 A;  3H93 A;  1V40 A;  3HJP A;  1Z7R A;  3GA4 A;  1TRW A;  1YF0 A;  4TR1 B;  5GST A;  2PGT A;  1FB6 A;  2RUE A;  3ZIJ A;  1CQG A;  2HZF A;  1QUW A;  2H0I A;  2R3X A;  4MJE A;  5HR3 A;  1OC8 A;  4WR4 A;  1Y25 A;  3F4T A;  2IN3 A;  1EWX A;  1YJ6 A;  3LXZ A;  1W4V A;  5EY6 A;  5E4W A;  1XWB A;  2B7K A;  2J9H A;  1SJ6 A;  3UVT A;  1SK2 A;  1EP8 A;  2WDU A;  1A2J A;  2WJU A;  3WGX A;  3KMO A;  2ES7 A;  3LYP A;  3IPZ A;  5IMA A;  2FGX A;  2H74 A;  2YN1 A;  2QC7 A;  3SWL A;  5G5E A;  3H1N A;  1RK4 A;  4TXO B;  9GSS A;  1FAA A;  3FMW A;  1MTC A;  4IP1 A;  3J7Y b;  4CY8 A;  3KTL A;  3HA9 A;  1SJI A;  1OKD A;  1Z7P A;  2E7P A;  4HOJ A;  4ISD A;  1U88 A;  1HQO A;  1K3L A;  1E2Y A;  3QOU A;  2G0F A;  4TRX A;  1GUL A;  4ECC A;  4IBP A;  1AXD A;  4I5Q A;  4PQ1 A;  4KSO A;  3HHV A;  5INY A;  3N5O A;  1TK8 B;  5J9B A;  4GST A;  4RQR A;  1OC3 A;  2PMT A;  2DJ1 A;  5G5F A;  1ERT A;  3F63 A;  1ERV A;  2DIY A;  2WGR A;  5CYY A;  2DC5 A;  4EIQ A;  3ERG A;  3HCZ A;  3FW2 A;  4F9Z A;  1TK0 B;  2X99 A;  3GKK A;  2WZ9 A;  2IFQ A;  1ABA A;  1GUM A;  1GLQ A;  2YZH A;  1A0F A;  1TK5 B;  5IMD A;  2H1B A;  1B4P A;  2WFC A;  5HFI A;  4ECI A;  3GL3 A;  5ELA A;  2YWN A;  2YJ7 A;  4LL4 B;  3ZRD A;  2BMX A;  1K0A A;  2H30 A;  4Q5F A;  1XVW A;  2AB6 A;  1J08 A;  4NHW A;  5DJM A;  1Q4J A;  2X64 A;  2F9S A;  4G19 A;  5IOW A;  4Z2T A;  1YZX A;  2A2P A;  4KA0 A;  1AQW A;  4RUV A;  4X0X A;  1TKD B;  2GZZ A;  3KCM A;  4JRR A;  3F6F A;  3K8N A;  3VWX A;  3GHA A;  2V32 A;  4QL7 A;  4JR4 A;  4TR0 A;  4ZIJ A;  1QXH A;  1TXX A;  4BWS A;  4KH7 A;  4F0C A;  5D73 A;  2DJ3 A;  2FCH A;  3TOU A;  4EDY A;  13GS A;  4I2U A;  4Z2R A;  1UVZ A;  3QDN A;  3TJK A;  2OBK A;  2VOC A;  3RPN A;  3LEF A;  2TIR A;  1UN2 A;  3FYG A;  3APQ A;  1J9B A;  2L57 A;  1OE7 A;  3SBC A;  3ZL5 A;  4Z2U A;  2H01 A;  4OMV A;  3DYR A;  3UBL A;  4TW5 A;  4RQX A;  2IIY A;  3FZ5 A;  5GAP D;  4DSR A;  4K9Z A;  3BCK A;  1C72 A;  1FW1 A;  1U6T A;  4GQC A;  1XOB A;  4IW9 A;  5ECL B;  4IQ1 A;  1F3A A;  5IIZ A;  2FY6 A;  2LJA A;  4XTS A;  4K7O A;  4ACS A;  2X49 A;  3NIV A;  2DIZ A;  5KN2 A;  5ENU A;  4HS1 A;  4OO5 A;  4QQ7 A;  3EVI A;  3IAS 2;  1N8J A;  3H79 A;  4G0L A;  2GDR A;  3IA1 A;  3MIX A;  4MF6 A;  2GS3 A;  4OWY A;  1GSE A;  2YJH A;  5H5R A;  3A3T A;  5IMF A;  4EUY A;  2VM1 A;  1XG8 A;  5EL8 A;  5KEJ A;  3PH9 A;  3MAK A;  2KLX A;  2JZR A;  6GST A;  4WF5 A;  2B1K A;  2V2G A;  5E59 A;  2NVL A;  3C71 A;  1LJR A;  1M9A A;  1RW1 A;  1BG5 A;  5BRT A;  3FKF A;  2XPD A;  4HZ2 A;  4MLY A;  4O5Q A;  6GSY A;  2AUV A;  2C4J A;  4KSM A;  1GL8 A;  3GUS A;  3C1S A;  2L4C A;  1XCC A;  5ECO B;  2LST A;  1M9B A;  4POL A;  2VLU A;  4GSN A;  3HVX A;  1EV4 A;  2VCQ A;  4PUF C;  1NHO A;  3CYN A;  2H6X A;  3EPT A;  4EIP A;  2H8L A;  2REM A;  2LEG A;  4ULX A;  2ON7 A;  2H72 A;  1WMJ A;  2OE1 A;  4GF0 A;  1HYU A;  2HZE A;  1FVK A;  4FQU A;  4HJM A;  4ZB8 A;  1DUG A;  4EVM A;  3VLN A;  4Q5Q A;  2PN8 A;  3ZMK A;  3TRX A;  3FZA A;  1XXU A;  5G2Z A;  5ID2 B;  1SL1 B;  1WJK A;  3IXR A;  5DCH A;  3QMX A;  5LCZ A;  3GMF A;  4HI7 A;  1PX7 A;  4FYB A;  4YQM A;  2O8V B;  3ME7 A;  1AAZ A;  2M72 A;  4MNN A;  3TKS E;  5B6M A;  4POB A;  5G31 A;  2H75 A;  1PL2 A;  3FY7 A;  3KP8 A;  1SL0 B;  2X8C A;  2IWT A;  2HYX A;  3LW9 A;  4MZC A;  11GS A;  3C8E A;  4BVY B;  1B9X C;  3DML A;  3EYT A;  3TCO A;  5G30 A;  2WCI A;  1TDI A;  1X5D A;  4POM A;  3JCM L;  4NV2 A;  2HNL A;  1WWJ A;  5CRW A;  2O89 A;  4V2N A;  4TVE A;  2QGV A;  4BL7 A;  1MDJ A;  2VL2 C;  1GTI A;  1GUH A;  4WEY A;  4J56 E;  3VUR A;  7GSS A;  2LNT A;  2IMD A;  1AQX A;  4IN0 A;  3CSJ A;  5HFG A;  2GQK A;  3O76 A;  2FNO A;  1T3B A;  5ECI B;  1EGO A;  5GZZ B;  1S3D A;  1FG4 A;  5A4V A;  1U87 A;  2VD1 A;  1X5E A;  2L59 A;  1JHB A;  2FA4 A;  4V2M A;  2P0G A;  3Q19 A;  1R7H A;  2VCV A;  3IHG A;  1JZR A;  4JED A;  4GCI A;  4K2X A;  1IYI A;  3DWV A;  1F37 A;  4OFM A;  5ECK B;  3FEU A;  2R4V A;  14GS A;  3C7M A;  3HKR A;  3L4N A;  2DML A;  4MDC A;  2H70 A;  1PN9 A;  1VGL A;  2KHP A;  5JWQ B;  3H4K A;  5FWG A;  1I9D A;  3R3E A;  4E8E A;  1OC9 A;  1YKA A;  1QQ2 A;  4WBR D;  4KGI A;  3TKS A;  1SYX A;  2MMA A;  1X0R A;  4E8H A;  2OAD A;  2K8S A;  3CBU A;  1PSQ A;  5DQY A;  3WGE A;  5DAK A;  3HVN A;  3RBT A;  3M9K A;  2GGT A;  6GSS A;  5AIV A;  1GNE A;  4CY6 A;  4MJA A;  4DSS B;  3DEX A;  4TR3 A;  1TI3 A;  1O85 A;  2K18 A;  1ZZY A;  3E9J B;  1F6M C;  2L5L A;  2YOI A;  4PNF A;  1X9M B;  5IMC A;  3IV4 A;  2DMM A;  1B4Q A;  1A2L A;  3TUE A;  3TRQ A;  3GFK A;  4TR1 A;  3D21 A;  2L4Q A;  2R5G A;  22GS A;  1K0C A;  5F07 A;  1OE8 A;  1GSY A;  2YWI A;  2L5O A;  3D6I A;  5B8B A;  1X9W B;  1ACV A;  2LRN A;  2CV4 A;  4K0G A;  1AIU A;  3GNJ A;  2BTO T;  1PN0 A;  3C1R A;  2L6C A;  5IMZ A;  3QFA C;  4LLR A;  4WBJ A;  5B6N A;  1WP0 A;  2WB9 A;  4F0B A;  2J23 A;  3FR3 A;  1A24 A;  1K0N A;  2K9F A;  4OCF A;  4MCU A;  5JCG A;  3W6G A;  2IMF A;  1LU4 A;  1ZYP A;  2MBT A;  4OD7 A;  1SU9 A;  4PUR A;  2HRK A;  4NXI A;  2OE3 A;  3GH9 A;  3WD6 A;  1DSB A;  2DLX A;  2LKU A;  5IO2 A;  2H66 A;  3BOA A;  5ECP B;  2QA2 A;  4EXJ A;  5DQS A;  4ID0 A;  5DVB A;  1WOU A;  3W8S A;  3FR9 A;  1SYR A;  3ZFL A;  3IK7 A;  4TXO A;  3LOR A;  4ZB9 A;  1V2A A;  4MA9 A;  2OKA A;  3TJF A;  1FB0 A;  1LBK A;  2M80 A;  2HSH A;  1MDK A;  3HVS A;  5IM9 A;  4BIK A;  5AN1 A;  2PBJ A;  1QK8 A;  2PVQ A;  3KP9 A;  1A0R P;  4EDZ A;  2D2Z A;  1SJZ A;  1H4O A;  4K8M A;  4K0N A;  1TU7 A;  3E0U A;  3O3T A;  2CA8 A;  2H6Z A;  3RAZ A;  2JSY A;  1YDK A;  1FOH A;  1KTE A;  3TGZ A;  3D5J A;  1XIY A;  3D0Z A;  4FH8 A;  4FYC A;  1XFL A;  4IP6 A;  3F4R A;  2B5Y A;  2GZY A;  3V1W A;  2H71 A;  1FHE A;  1JLW A;  4I8B A;  10GS A;  6GSX A;  3GYK A;  2JSZ A;  5F06 A;  1Z9H A;  2YZU A;  3TJG A;  1K3Y A;  1XBS A;  3DD3 A;  2OBI A;  1XWG A;  2KOK A;  1GH2 A;  2F8F A;  3LXT A;  1Z3E A;  4F03 A;  1PQN A;  4V1A p;  1EOH A;  1RQM A;  4ZBD A;  1PL1 A;  3EIN A;  3P7X A;  1SK0 A;  1XVQ A;  3PIN A;  5JCU A;  5B7C A;  2FWF A;  4G0K A;  4ECB A;  4FYU A;  5JWR B;  3TJJ A;  1ZL9 A;  1Z5Y E;  4IKH A;  2HSM A;  3CSI A;  4N11 A;  2FLS A;  2N5A A;  2C80 A;  3DRN A;  3M3M A;  4KW6 A;  2GLR A;  4I6X A;  4Q5R A;  1DE2 A;  5IMV A;  4IGJ A;  3H8Q A;  4MH3 A;  4O32 A;  3UAP A;  4L8E A;  1M3J A;  2PWJ A;  5DCG A;  3ZLP A;  1ML6 A;  5AGY A;  1SK1 A;  3CTG A;  1AC1 A;  2LJR A;  2LTK A;  4JZQ A;  2A2R A;  1B9Y C;  5F0G A;  1S3A A;  2YPM A;  5F8B A;  2GQL A;  4HZ4 A;  4HU7 A;  4WXT A;  2ALB A;  2A2S A;  3ZRE A;  2GVP A;  5G1K A;  3BJ5 A;  1ILO A;  3HY2 A;  1T7P B;  3PPU A;  2MMZ A;  3PGT A;  3BD2 A;  4TKY A;  1O8X A;  2GSQ A;  1SKW B;  2VD0 A;  18GS A;  4BVX A;  5H5S A;  2E2G A;  2VLT A;  2F3M A;  2GQM A;  3I9V 2;  4KE3 A;  2OJL A;  3MSZ A;  1GWC A;  3L0H A;  1AW9 A;  3EWL A;  3EC3 A;  5A4W A;  1MDI A;  1VF4 A;  4JBB A;  2C8U A;  2DJK A;  3IAM 2;  5GAN D;  3FK8 A;  3BBY A;  4K5R A;  4KDU A;  2HT9 A;  4MPG A;  3ZTL A;  4HDE A;  3UJ1 A;  4HUA A;  2XPE A;  2NDO A;  2DSA A;  2H76 A;  4K2D A;  3DVW A;  4EL1 A;  4IVF A;  3GTU B;  1BYE A;  2LV3 A;  3GSS A;  4HU9 A;  2PPT A;  1THX A;  3ME8 A;  5J3R A;  4NWY A;  3P90 A;  5D9V A;  5IOX A;  5KN1 A;  4JE1 A;  1NM3 A;  2XBQ A;  8GSS A;  2NBS A;  2AJQ B;  3GH6 A;  1YKC A;  3N9J A;  5ECS A;  1G7E A;  4Q5N A;  5C00 A;  5DBQ A;  1WPI A;  3D4M A;  1T00 A;  2OAC A;  3MNG A;  3UL3 A;  5EVO A;  3A2W A;  1S3R A;  3VI5 A;  1OVN A;  1YY7 A;  2IMK A;  3D4T A;  3ZVJ A;  5AIS A;  1R5A A;  3APS A;  1SEN A;  3F4S A;  4EKZ A;  4ML6 A;  5JCW A;  3M9J A;  4X4J A;  1YEP A;  3F3Q A;  2GTU A;  2GSS A;  1EP7 A;  2CVK A;  3LGC A;  4TXV A; 
#chains in the Genus database with same CATH homology
 1SL2 B;  1BED A;  2RM5 A;  5IQY A;  3QR6 A;  1PX6 A;  1EOG A;  1KNG A;  2LQQ A;  2YNX A;  1VF3 A;  1S3C A;  4XCS A;  4XS1 A;  1EGR A;  2E2M A;  3CRT A;  1X9S B;  1B48 A;  3G7J A;  5HQP A;  1I5G A;  3U5R E;  4LL1 B;  4IS0 A;  4GTU A;  4I2T A;  1Q98 A;  1A2M A;  4NHZ A;  3ZIT A;  4I97 A;  2CQ9 A;  4POK A;  2PVO C;  3QD9 A;  5D9X A;  2LQO A;  2EIO A;  5ID2 A;  3LWA A;  3ZZX A;  3QPM A;  4ECJ A;  4KCA A;  2E0Q A;  3LJR A;  4N10 A;  4TN8 A;  1QFN A;  1EZK A;  3ERF A;  1M0U A;  3RHC A;  2QSI A;  3EUR A;  6GSW A;  4KX4 A;  4QL9 A;  4PX1 A;  4ZL8 A;  2Z9S A;  3PR8 A;  5DDL A;  1M7T A;  2BJX A;  2IJY A;  1IYH A;  2V6O A;  2HRF A;  1R4W A;  1JLV A;  2MYG A;  1GSS A;  1O81 A;  4N0V A;  4X1U A;  5J4U A;  4MPF A;  1FVJ A;  1HNA A;  2R0P A;  3US3 A;  3WGD A;  4BVY A;  2N5B A;  3KTB A;  2FA8 A;  3TOT A;  4MF7 A;  3LG6 A;  3KEB A;  4RI6 A;  2EIR A;  2R2J A;  4ZBB A;  2XBI A;  3WT1 A;  5ECH B;  1GTB A;  1TW9 A;  2ZNM A;  4K5S A;  5B8A A;  1PGT A;  4NMU A;  4L0U A;  1DE1 A;  1EEJ A;  4ZBA A;  3FZ9 A;  2H1D A;  2GSR A;  5CO3 A;  5IPG A;  4MJB A;  3APO A;  3W8J A;  4ILF A;  2JZT A;  2HRA A;  3EU4 A;  5L71 A;  3Q74 A;  2K6V A;  3IOS A;  2V1M A;  4LMW A;  2YCD A;  3HD5 A;  4EC0 A;  4PTS A;  2DKH A;  3KJY A;  1WE0 A;  1UA5 A;  4PNG A;  4J2F A;  4TOP A;  5KN3 A;  1F9M A;  3IE3 A;  3M0F A;  1M99 A;  2YWO A;  1HNC A;  3HXS A;  3ZVJ D;  3KGK A;  2A4V A;  4GXZ A;  1XWK A;  2H19 A;  1UC7 A;  4CW9 A;  2FHE A;  3Q6O A;  2VCX A;  3P8W A;  2HE3 A;  5CRE A;  3KH9 A;  3KIJ A;  4D73 B;  3UMA A;  4KDY A;  3KM6 A;  1GUK A;  4AJ6 A;  2B1L A;  2YWM A;  1K3O A;  4WET A;  5LNK e;  3RPP A;  3TKQ A;  1TOF A;  1AQV A;  3S9F A;  3UEM A;  5H5Q A;  2PU9 C;  5DAL A;  2AAW A;  2HXK A;  3O6T A;  19GS A;  3M1G A;  5D9W A;  3L9V A;  1PRX A;  4EF0 A;  3EMP A;  1DBY A;  2B6M A;  3TKS C;  3IHQ A;  4ZL7 A;  3TDG A;  3F3R A;  3GRX A;  3ISO A;  1XPV A;  2KP2 A;  1URM A;  1A8Y A;  5ECR B;  5DJL A;  2TRC P;  1ZYE A;  2MZC A;  4XS4 B;  2B5X A;  4DSS A;  5KOX A;  2G2Q A;  1GRX A;  1M2D A;  4G9H A;  2JU5 A;  4DEJ A;  3WYW A;  4J57 E;  3DKS A;  1PKZ A;  5CAX A;  2XHF A;  4IJ3 A;  1Z6M A;  1F3B A;  3QAG A;  3J7Y k;  4GRF A;  1ZMA A;  3I6A A;  4IHU A;  16GS A;  3HJO A;  4FIW A;  2I3Y A;  2PER A;  5ECQ B;  2IMI A;  2IL3 A;  1YQ1 A;  1O73 A;  3CXG A;  4KB3 A;  5J9C A;  1B8X A;  4YKG A;  5IPH A;  3ERW A;  3UOM A;  5KN0 A;  2YP6 A;  1GSD A;  3C73 A;  4ZXG A;  4YAP A;  4YAV A;  3A2V A;  1ON4 A;  1BX9 A;  2LUS A;  4K7N A;  3QAW A;  1G0T A;  5ECM B;  4BPY A;  2LRC A;  2QKE A;  1CQH A;  1PKW A;  1GLP A;  5D96 A;  1T8E B;  2C0F A;  3CSH A;  4CDO A;  3GUR A;  5COH A;  2C0G A;  1ZYQ B;  2RLI A;  1VF2 A;  3QFB C;  5EPF A;  4G10 A;  5C04 A;  3TRP A;  4ML1 A;  5GSS A;  4O5R A;  2B5E A;  2JAC A;  2CVB A;  4MK3 A;  4V2L A;  2R0G A;  5A4U A;  1QMV A;  2ZUP A;  2AV4 A;  2P5R A;  6GSV A;  5BMU A;  2DJJ A;  2H6Y A;  2QA1 A;  4KUN A;  3WT2 A;  3KD0 A;  1K0O A;  1NHY A;  2YV7 A;  3I69 A;  4MH2 A;  3G9B A;  1KEB A;  2F51 A;  4GQF A;  3IBH A;  1YEX A;  5CP1 A;  1JZD A;  4G0I A;  1GNW A;  4MP4 A;  2FD3 A;  2V41 A;  5D9T A;  3GL5 A;  2VL3 A;  3M8N A;  3MDK A;  4KDX A;  5J5N A;  4YKF A;  4HQS A;  5JWO B;  1BJX A;  3DVX A;  5ECN B;  2VCZ A;  2HLS A;  2I4A A;  3LFL A;  1WIK A;  3HVV A;  1A8L A;  4NV5 A;  4OO4 A;  3IK9 A;  4AJ8 A;  1A23 A;  3UIW A;  1XWC A;  1NW2 A;  2VIM A;  2CVD A;  3VPT A;  3ZYW A;  1TP9 A;  1HD2 A;  2GT6 A;  2H1A A;  4PQI A;  3EMX A;  2K8V A;  2RM6 A;  1W89 A;  4K1F A;  1O8W A;  1ZYN A;  3VWW A;  1GSF A;  1AUC A;  2FWH A;  3VWV A;  2YV9 A;  4KF9 A;  1F2E A;  3GKM A;  3IR4 A;  1JZW A;  3ZIV A;  2IFQ B;  1YF1 A;  4N30 A;  1U3I A;  2HRN A;  3EE2 A;  1M2B A;  4LA1 A;  5CRH A;  4IJI A;  2LJK A;  2P5Q A;  5LD0 A;  4EO3 A;  2IME A;  1ERW A;  2CAQ A;  4NAX A;  1U3A A;  5CRD A;  4F2I A;  1KBN A;  2WUL A;  1TRS A;  1TRU A;  3KZQ A;  4H86 A;  4A5P A;  3EU3 A;  1PD2 1;  1MEK A;  2GST A;  4L0W A;  3CTF A;  20GS A;  2C0D A;  1HNB A;  2LS5 A;  2OE0 A;  1H75 A;  2LNS A;  4HJ2 A;  5D93 A;  2CX4 A;  2EIQ A;  1WRY A;  2NTO A;  3GTU A;  3VWU A;  3D22 A;  2CAI A;  1XW9 A;  2X8G A;  2X4A A;  1SKS B;  2CX3 A;  2VCW A;  2KUC A;  4DSQ A;  2DKI A;  1R26 A;  2RUF A;  4TR4 A;  3TJB A;  1Z6N A;  2C0E A;  4BVX B;  3QCP A;  4YQU A;  1O6J A;  1OKT A;  2MMN A;  1G7O A;  4O5U A;  4WF4 A;  4PUA A;  2HSY A;  2CT6 A;  3HDC A;  4GSS A;  1XZO A;  4KAE A;  4NPB A;  4KND A;  1XOA A;  4AGS A;  2FWG A;  3VFI A;  4OFN A;  3L9S A;  4USS A;  1VF1 A;  4F82 A;  2JAD A;  1OAZ A;  2O7K A;  4KCE A;  1VRS D;  2B3S A;  4WKW A;  2O87 A;  2MBS A;  4AJ7 A;  3BCI A;  4PQH A;  1G6Y A;  3GX0 A;  1MD4 A;  1XW6 A;  4XRA A;  4K6X A;  1TU8 A;  1XW5 A;  2OA7 A;  1N2A A;  2CZ2 A;  2L6D A;  5CNW A;  4CHS A;  1SKR B;  5F05 A;  1GSQ A;  1G6W A;  3DXB A;  1FOV A;  3IRA A;  1X5C A;  2M46 A;  4L5L A;  3L78 A;  4O92 A;  5ABR A;  3TKR A;  2UZ8 A;  3MYD A;  4MZW A;  2H0G A;  4OCE A;  5CRG A;  2AHE A;  2JL4 A;  5HR0 A;  2R0C A;  1JZO A;  3IC8 A;  2X8H A;  2A4H A;  3VPQ A;  3KMN A;  1TJD A;  1T4Z A;  4MF5 A;  2VLV A;  2DJ0 A;  2C3N A;  4BA7 A;  3F6D A;  3UBK A;  2P31 A;  2JZS A;  3R2Q A;  2R37 A;  1SD9 A;  1TRV A;  2DBC A;  1O7U A;  4ZB6 A;  3HZ8 A;  2RII A;  4MMM A;  2V6K A;  4PXO A;  4BWQ A;  3GV1 A;  1TTZ A;  3VK9 A;  1ERU A;  1GSU A;  3KH7 A;  4V1A g;  2LRT A;  1Y6E A;  4XRD A;  1E6B A;  4Z7X A;  4X43 A;  3QAV A;  4HQZ A;  3DGQ A;  1GP1 A;  2I1U A;  1BQ7 A;  1ZCP A;  4G2E A;  2WS2 A;  4JR6 A;  2MMO A;  3F9U A;  1ST9 A;  3IDV A;  12GS A;  1GTU A;  3Q18 A;  4YH2 A;  5HFK A;  4IQA A;  2XC2 A;  1K0M A;  1OYJ A;  3E3E A;  3HYP A;  2YAN A;  2I9H A;  2HZE B;  5A5K A;  3LYK A;  1T4Y A;  4GLT A;  4JU5 A;  4LMV A;  2F8A A;  3LSZ A;  1SD8 A;  1J0F A;  3HZ4 A;  4MAB A;  2PUK C;  1ZGN A;  2H1G A;  3RHB A;  1V57 A;  4IEL A;  4K7I A;  4ZL9 A;  3MWH A;  2R6K A;  3TB2 A;  4MZB A;  2ON5 A;  4RI7 A;  2TRX A;  3L9U A;  1M2A A;  4XHM A;  4XIH A;  3GKX A;  4L5O A;  2CZ3 A;  3G7I A;  2GT5 A;  2ZCT A;  1EEM A;  2FUG 2;  3DIE A;  1FO5 A;  2O85 A;  3KXO A;  5KOW A;  4DVC A;  4O7H A;  2HFD A;  4XS6 A;  5D8I A;  1V58 A;  2VM2 A;  1GTA A;  3A2X A;  4ICY A;  4D73 A;  5FHI A;  2EC4 A;  2VUP A;  3GX8 A;  2NPB A;  3FHK A;  1R5P A;  4HEA 2;  2WRT A;  4WR5 A;  3F8U A;  3GIX A;  1PMT A;  1T1V A;  3G7Y A;  2VL2 A;  3I43 A;  3FR6 A;  1XWA A;  5FT3 A;  2B7J A;  2C3Q A;  4BL7 B;  3UAR A;  1TI1 A;  3OR5 A;  3RDW A;  4P3Y B;  4XS4 A;  4GWR A;  5J41 A;  5HR2 A;  3GST A;  3CRU A;  1NSW A;  4FO5 A;  4MJC A;  1V98 A;  3P2A A;  3U6V A;  3NZN A;  3ZFB A;  1V9W A;  1BAY A;  1K0B A;  2C1Y A;  2AYT A;  3GN3 A;  4PGT A;  3CMI A;  3A5I A;  3NOF A;  2VAF A;  5AIX A;  1K0D A;  2N5F A;  3ZML A;  5HR1 A;  4AF2 A;  5DAL B;  2DJ2 A;  3AY8 A;  3UVH A;  4EE0 A;  1PA3 A;  2HI7 A;  3HJM A;  2VO4 A;  2H0H A;  4YQV A;  1THO A;  3LQ7 A;  1QGV A;  1OC9 B;  2FWE A;  3VI7 A;  3A5W A;  1ZOF A;  2I81 A;  1JFU A;  4N0Z A;  5DAK B;  2GZP A;  3F0I A;  3FRC A;  17GS A;  5G1L A;  3FZ4 A;  3GKN A;  4ZIL A;  3TKP A;  3IC4 A;  5ELG A;  2KP1 A;  4OFT A;  1MD3 A;  1USB A;  2H73 A;  6GSU A;  2VCT A;  5IO0 A;  2IPA A;  1EV9 A;  3ED3 A;  2C3T A;  2VL9 A;  3H93 A;  1V40 A;  3HJP A;  1Z7R A;  3GA4 A;  1TRW A;  1YF0 A;  4TR1 B;  5GST A;  2PGT A;  1FB6 A;  2RUE A;  3ZIJ A;  1CQG A;  2HZF A;  1QUW A;  2H0I A;  2R3X A;  4MJE A;  5HR3 A;  1OC8 A;  4WR4 A;  1Y25 A;  3F4T A;  2IN3 A;  1EWX A;  1YJ6 A;  3LXZ A;  1W4V A;  5EY6 A;  5E4W A;  1XWB A;  2B7K A;  2J9H A;  1SJ6 A;  3UVT A;  1SK2 A;  1EP8 A;  2WDU A;  1A2J A;  2WJU A;  3WGX A;  3KMO A;  2ES7 A;  3LYP A;  3IPZ A;  5IMA A;  2FGX A;  2H74 A;  2YN1 A;  2QC7 A;  3SWL A;  5G5E A;  3H1N A;  1RK4 A;  4TXO B;  9GSS A;  1FAA A;  3FMW A;  1MTC A;  4IP1 A;  3J7Y b;  4CY8 A;  3KTL A;  3HA9 A;  1SJI A;  1OKD A;  1Z7P A;  2E7P A;  4HOJ A;  4ISD A;  1U88 A;  1HQO A;  1K3L A;  1E2Y A;  3QOU A;  2G0F A;  4TRX A;  1GUL A;  4ECC A;  4IBP A;  1AXD A;  4I5Q A;  4PQ1 A;  4KSO A;  3HHV A;  5INY A;  3N5O A;  1TK8 B;  5J9B A;  4GST A;  4RQR A;  1OC3 A;  2PMT A;  2DJ1 A;  5G5F A;  1ERT A;  3F63 A;  1ERV A;  2DIY A;  2WGR A;  5CYY A;  2DC5 A;  4EIQ A;  3ERG A;  3HCZ A;  3FW2 A;  4F9Z A;  1TK0 B;  2X99 A;  3GKK A;  2WZ9 A;  2IFQ A;  1ABA A;  1GUM A;  1GLQ A;  2YZH A;  1A0F A;  1TK5 B;  5IMD A;  2H1B A;  1B4P A;  2WFC A;  5HFI A;  4ECI A;  3GL3 A;  5ELA A;  2YWN A;  2YJ7 A;  4LL4 B;  3ZRD A;  2BMX A;  1K0A A;  2H30 A;  4Q5F A;  1XVW A;  2AB6 A;  1J08 A;  4NHW A;  5DJM A;  1Q4J A;  2X64 A;  2F9S A;  4G19 A;  5IOW A;  4Z2T A;  1YZX A;  2A2P A;  4KA0 A;  1AQW A;  4RUV A;  4X0X A;  1TKD B;  2GZZ A;  3KCM A;  4JRR A;  3F6F A;  3K8N A;  3VWX A;  3GHA A;  2V32 A;  4QL7 A;  4JR4 A;  4TR0 A;  4ZIJ A;  1QXH A;  1TXX A;  4BWS A;  4KH7 A;  4F0C A;  5D73 A;  2DJ3 A;  2FCH A;  3TOU A;  4EDY A;  13GS A;  4I2U A;  4Z2R A;  1UVZ A;  3QDN A;  3TJK A;  2OBK A;  2VOC A;  3RPN A;  3LEF A;  2TIR A;  1UN2 A;  3FYG A;  3APQ A;  1J9B A;  2L57 A;  1OE7 A;  3SBC A;  3ZL5 A;  4Z2U A;  2H01 A;  4OMV A;  3DYR A;  3UBL A;  4TW5 A;  4RQX A;  2IIY A;  3FZ5 A;  5GAP D;  4DSR A;  4K9Z A;  3BCK A;  1C72 A;  1FW1 A;  1U6T A;  4GQC A;  1XOB A;  4IW9 A;  5ECL B;  4IQ1 A;  1F3A A;  5IIZ A;  2FY6 A;  2LJA A;  4XTS A;  4K7O A;  4ACS A;  2X49 A;  3NIV A;  2DIZ A;  5KN2 A;  5ENU A;  4HS1 A;  4OO5 A;  4QQ7 A;  3EVI A;  3IAS 2;  1N8J A;  3H79 A;  4G0L A;  2GDR A;  3IA1 A;  3MIX A;  4MF6 A;  2GS3 A;  4OWY A;  1GSE A;  2YJH A;  5H5R A;  3A3T A;  5IMF A;  4EUY A;  2VM1 A;  5EL8 A;  5KEJ A;  3PH9 A;  3MAK A;  2KLX A;  2JZR A;  6GST A;  4WF5 A;  2B1K A;  2V2G A;  5E59 A;  2NVL A;  3C71 A;  1LJR A;  1M9A A;  1RW1 A;  1BG5 A;  5BRT A;  3FKF A;  2XPD A;  4HZ2 A;  4MLY A;  4O5Q A;  6GSY A;  2AUV A;  2C4J A;  4KSM A;  1GL8 A;  3GUS A;  3C1S A;  2L4C A;  1XCC A;  5ECO B;  2LST A;  1M9B A;  4POL A;  2VLU A;  4GSN A;  3HVX A;  1EV4 A;  2VCQ A;  4PUF C;  1NHO A;  3CYN A;  2H6X A;  3EPT A;  4EIP A;  2H8L A;  2REM A;  2LEG A;  4ULX A;  2ON7 A;  2H72 A;  1WMJ A;  2OE1 A;  4GF0 A;  1HYU A;  2HZE A;  1FVK A;  4FQU A;  4HJM A;  4ZB8 A;  1DUG A;  4EVM A;  3VLN A;  4Q5Q A;  2PN8 A;  3ZMK A;  3TRX A;  3FZA A;  1XXU A;  5G2Z A;  5ID2 B;  1SL1 B;  1WJK A;  3IXR A;  5DCH A;  3QMX A;  5LCZ A;  3GMF A;  4HI7 A;  1PX7 A;  4FYB A;  4YQM A;  2O8V B;  3ME7 A;  1AAZ A;  2M72 A;  4MNN A;  3TKS E;  5B6M A;  4POB A;  5G31 A;  2H75 A;  1PL2 A;  3FY7 A;  3KP8 A;  1SL0 B;  2X8C A;  2IWT A;  2HYX A;  3LW9 A;  4MZC A;  11GS A;  3C8E A;  4BVY B;  1B9X C;  3DML A;  3EYT A;  3TCO A;  5G30 A;  2WCI A;  1TDI A;  1X5D A;  4POM A;  3JCM L;  4NV2 A;  2HNL A;  1WWJ A;  5CRW A;  2O89 A;  4V2N A;  4TVE A;  2QGV A;  4BL7 A;  1MDJ A;  2VL2 C;  1GTI A;  1GUH A;  4WEY A;  4J56 E;  3VUR A;  7GSS A;  2LNT A;  2IMD A;  1AQX A;  4IN0 A;  3CSJ A;  5HFG A;  2GQK A;  3O76 A;  2FNO A;  1T3B A;  5ECI B;  1EGO A;  5GZZ B;  1S3D A;  1FG4 A;  5A4V A;  1U87 A;  2VD1 A;  1X5E A;  2L59 A;  1JHB A;  2FA4 A;  4V2M A;  2P0G A;  3Q19 A;  1R7H A;  2VCV A;  3IHG A;  1JZR A;  4JED A;  4GCI A;  4K2X A;  1IYI A;  3DWV A;  1F37 A;  4OFM A;  5ECK B;  3FEU A;  2R4V A;  14GS A;  3C7M A;  3HKR A;  3L4N A;  2DML A;  4MDC A;  2H70 A;  1PN9 A;  1VGL A;  2KHP A;  5JWQ B;  3H4K A;  5FWG A;  1I9D A;  3R3E A;  4E8E A;  1OC9 A;  1YKA A;  1QQ2 A;  4WBR D;  4KGI A;  3TKS A;  1SYX A;  2MMA A;  1X0R A;  4E8H A;  2OAD A;  2K8S A;  3CBU A;  1PSQ A;  5DQY A;  3WGE A;  5DAK A;  3RBT A;  3M9K A;  2GGT A;  6GSS A;  5AIV A;  1GNE A;  4CY6 A;  4MJA A;  4DSS B;  3DEX A;  4TR3 A;  1TI3 A;  1O85 A;  2K18 A;  1ZZY A;  3E9J B;  1F6M C;  2L5L A;  2YOI A;  4PNF A;  1X9M B;  5IMC A;  3IV4 A;  2DMM A;  1B4Q A;  1A2L A;  3TUE A;  3TRQ A;  3GFK A;  4TR1 A;  3D21 A;  2L4Q A;  2R5G A;  22GS A;  1K0C A;  5F07 A;  1OE8 A;  1GSY A;  2YWI A;  2L5O A;  3D6I A;  5B8B A;  1X9W B;  1ACV A;  2LRN A;  2CV4 A;  4K0G A;  1AIU A;  3GNJ A;  2BTO T;  1PN0 A;  3C1R A;  2L6C A;  5IMZ A;  3QFA C;  4LLR A;  4WBJ A;  5B6N A;  1WP0 A;  2WB9 A;  4F0B A;  2J23 A;  3FR3 A;  1A24 A;  1K0N A;  2K9F A;  4OCF A;  4MCU A;  5JCG A;  3W6G A;  2IMF A;  1LU4 A;  1ZYP A;  2MBT A;  4OD7 A;  1SU9 A;  4PUR A;  2HRK A;  4NXI A;  2OE3 A;  3GH9 A;  3WD6 A;  1DSB A;  2DLX A;  2LKU A;  5IO2 A;  2H66 A;  3BOA A;  5ECP B;  2QA2 A;  4EXJ A;  5DQS A;  4ID0 A;  5DVB A;  1WOU A;  3W8S A;  3FR9 A;  1SYR A;  3ZFL A;  3IK7 A;  4TXO A;  3LOR A;  4ZB9 A;  1V2A A;  4MA9 A;  2OKA A;  3TJF A;  1FB0 A;  1LBK A;  2M80 A;  2HSH A;  1MDK A;  3HVS A;  5IM9 A;  5AN1 A;  2PBJ A;  1QK8 A;  2PVQ A;  3KP9 A;  1A0R P;  4EDZ A;  2D2Z A;  1SJZ A;  1H4O A;  4K8M A;  4K0N A;  1TU7 A;  3E0U A;  3O3T A;  2CA8 A;  2H6Z A;  3RAZ A;  2JSY A;  1YDK A;  1FOH A;  1KTE A;  3TGZ A;  3D5J A;  1XIY A;  3D0Z A;  4FH8 A;  4FYC A;  1XFL A;  4IP6 A;  3F4R A;  2B5Y A;  2GZY A;  3V1W A;  2H71 A;  1FHE A;  1JLW A;  4I8B A;  10GS A;  6GSX A;  3GYK A;  2JSZ A;  5F06 A;  1Z9H A;  2YZU A;  3TJG A;  1K3Y A;  1XBS A;  3DD3 A;  2OBI A;  1XWG A;  2KOK A;  1GH2 A;  2F8F A;  3LXT A;  1Z3E A;  4F03 A;  1PQN A;  4V1A p;  1EOH A;  1RQM A;  4ZBD A;  1PL1 A;  3EIN A;  3P7X A;  1SK0 A;  1XVQ A;  3PIN A;  5JCU A;  5B7C A;  2FWF A;  4G0K A;  4ECB A;  4FYU A;  5JWR B;  3TJJ A;  1ZL9 A;  1Z5Y E;  4IKH A;  2HSM A;  3CSI A;  4N11 A;  2FLS A;  2N5A A;  2C80 A;  3DRN A;  3M3M A;  4KW6 A;  2GLR A;  4I6X A;  4Q5R A;  1DE2 A;  5IMV A;  4IGJ A;  3H8Q A;  4MH3 A;  4O32 A;  3UAP A;  4L8E A;  2PWJ A;  5DCG A;  3ZLP A;  1ML6 A;  5AGY A;  1SK1 A;  3CTG A;  1AC1 A;  2LJR A;  2LTK A;  4JZQ A;  2A2R A;  1B9Y C;  5F0G A;  1S3A A;  2YPM A;  5F8B A;  2GQL A;  4HZ4 A;  4HU7 A;  4WXT A;  2ALB A;  2A2S A;  3ZRE A;  2GVP A;  5G1K A;  3BJ5 A;  1ILO A;  3HY2 A;  1T7P B;  3PPU A;  2MMZ A;  3PGT A;  3BD2 A;  4TKY A;  1O8X A;  2GSQ A;  1SKW B;  2VD0 A;  18GS A;  4BVX A;  5H5S A;  2E2G A;  2VLT A;  2F3M A;  2GQM A;  3I9V 2;  4KE3 A;  2OJL A;  3MSZ A;  1GWC A;  3L0H A;  1AW9 A;  3EWL A;  3EC3 A;  5A4W A;  1MDI A;  1VF4 A;  4JBB A;  2C8U A;  2DJK A;  3IAM 2;  5GAN D;  3FK8 A;  3BBY A;  4K5R A;  4KDU A;  2HT9 A;  4MPG A;  3ZTL A;  4HDE A;  3UJ1 A;  4HUA A;  2XPE A;  2NDO A;  2DSA A;  2H76 A;  4K2D A;  3DVW A;  4EL1 A;  4IVF A;  3GTU B;  1BYE A;  2LV3 A;  3GSS A;  4HU9 A;  2PPT A;  1THX A;  3ME8 A;  5J3R A;  4NWY A;  3P90 A;  5D9V A;  5IOX A;  5KN1 A;  4JE1 A;  1NM3 A;  2XBQ A;  8GSS A;  2NBS A;  2AJQ B;  3GH6 A;  1YKC A;  3N9J A;  5ECS A;  1G7E A;  4Q5N A;  5C00 A;  5DBQ A;  1WPI A;  3D4M A;  1T00 A;  2OAC A;  3MNG A;  3UL3 A;  5EVO A;  3A2W A;  3VI5 A;  1OVN A;  1YY7 A;  2IMK A;  3D4T A;  3ZVJ A;  5AIS A;  1R5A A;  3APS A;  1SEN A;  3F4S A;  4EKZ A;  4ML6 A;  5JCW A;  3M9J A;  4X4J A;  1YEP A;  3F3Q A;  2GTU A;  2GSS A;  1EP7 A;  2CVK A;  3LGC A;  4TXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...