5ABRA

Structure of fesi protein from azotobacter vinelandii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
PEFHIFICAQNRPAGHPRGSCGAKGAEGVYNAFAQVLIQKNLTNRIALTTTGCLGPCQAGANVLIYPGAVMYSWVEPADAAIIVEQHLLGGEPYADKLTPAEIW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN, 2FE-2S
publication title Structure of Fesi Protein from Azotobacter Vinelandii
rcsb
source organism Azotobacter vinelandii
total genus 29
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5abrA00
4ZIJA 4BWSA 3FK8A 4Q5FA 4YAPA 1EP8A 4IJ3A 3KGKA 2RLIA 4ZL8A 5D9VA 1U6TA 3KMNA 4PNFA 3OR5A 2G2QA 2BMXA 3VWVA 2OKAA 1T4YA 5E4WA 1DUGA 1RW1A 5FWGA 3H8QA 2HXKA 3ZVJA 4XRDA 1Z5YE 4CDOA 2VUPA 1FG4A 5GZZB 3TOUA 1M0UA 3DD3A 4FH8A 5CRHA 5ECHB 3GMFA 4K6XA 4JR4A 2L5LA 1G6YA 2L4QA 2PVQA 1K0BA 4GRFA 2OADA 1JHBA 2WULA 1WMJA 2H19A 2YWMA 3A2VA 2OA7A 1ZYEA 4EE0A 4MJEA 2IMEA 2IFQA 4PXOA 2YNXA 5CNWA 5COHA 3ZMKA 2B5EA 4GTUA 4IN0A 1TK0B 4I2UA 1K3LA 4IELA 3EURA 1M99A 4PURA 1YF0A 2LNTA 2PWJA 12GSA 3GURA 2YPMA 3UVTA 1EV4A 1T8EB 5JWRB 1PMTA 3GKMA 2H1DA 4IQAA 1TOFA 1XOAA 1VRSD 2YV7A 4IBPA 2CX3A 4GLTA 4LL4B 3UARA 2M80A 1H75A 2HYXA 1GSQA 2GQKA 3IDVA 2JACA 3ZZXA 3KM6A 3FRCA 1PL1A 5EY6A 1JLVA 2OACA 4E8EA 3VPTA 2WB9A 5D9TA 4TW5A 1DSBA 4GCIA 1JZRA 3BBYA 1SKRB 3M9KA 10GSA 1GH2A 2R4VA 4D73A 3TJBA 1GNWA 1SJZA 2EC4A 2XBQA 3APSA 1O73A 5IPHA 6GSVA 2R6KA 3EU3A 2LJKA 4DVCA 3KXOA 1TU8A 3Q6OA 3LQ7A 2VO4A 5G1LA 2IFQB 2NBSA 4MF7A 1EEMA 6GSWA 3F4TA 4ACSA 1URMA 1GSUA 2M72A 1SD8A 5LD0A 4Z7XA 3ZFBA 2TIRA 3TJKA 1G7EA 2C0FA 2XC2A 4H86A 2IL3A 3KIJA 1FVKA 2C1YA 5IMVA 5ECKB 1S3AA 4OMVA 1R7HA 4DEJA 2JZTA 2XBIA 1GP1A 3QFBC 2QSIA 1VF4A 3TDGA 1X5CA 4KNDA 4V2LA 1O81A 4D73B 4NMUA 2BTOT 3US3A 2C0GA 3ZIJA 3IK9A 3RPNA 3W6GA 3C71A 4JBBA 2C8UA 3APQA 4NPBA 2V1MA 2B1LA 1PGTA 2L59A 5IM9A 2P0GA 2YN1A 2FD3A 3QR6A 1B9XC 4Q5NA 2H0IA 1TU7A 3VWWA 1U88A 5IMCA 1GTIA 4OWYA 3EMXA 11GSA 2ES7A 4YQVA 2OE0A 3QD9A 4K7IA 4HJ2A 2AUVA 2H01A 2WZ9A 1FHEA 4OFNA 4XTSA 1XVWA 4V2MA 1A8LA 4ISDA 2WRTA 1X9WB 3FR6A 4KX4A 4ULXA 2PPTA 2IMFA 1V9WA 1SYRA 4LMWA 2RM6A 4NWYA 3WT2A 3GL5A 4ID0A 4PX1A 1A2JA 2HT9A 2K8SA 1DE2A 4N10A 4J2FA 2KP1A 2YANA 1K0NA 2E2MA 1VF2A 4XS6A 2O7KA 1PQNA 4MDCA 3RDWA 2X8CA 3RHCA 1ZL9A 2GZPA 3D4TA 4LLRA 2PBJA 5ECSA 4JEDA 2I4AA 2WCIA 1WIKA 22GSA 3KH7A 4JRRA 3QAVA 2NDOA 3EMPA 1AQVA 5CREA 2QGVA 5L71A 4JZQA 2H30A 2V2GA 4L8EA 1ST9A 3D6IA 4V2NA 1O85A 4TOPA 1X0RA 1ZZYA 4RQRA 3CRTA 5G31A 1ERTA 2VLUA 4KH7A 2C3TA 4MH3A 1OC3A 4ECIA 4BWQA 1M2BA 1V2AA 1PN9A 3LSZA 3ZTLA 1JFUA 2GT6A 2AJQB 5G30A 5H5RA 1K0DA 4ZXGA 2GSRA 1SK1A 1ABAA 4IS0A 2EIQA 1UVZA 3DEXA 4F9ZA 4POBA 5G5FA 2DJJA 2FCHA 2WDUA 3D22A 2F9SA 2FNOA 5A4VA 4PNGA 2LNSA 4PQ1A 2I1UA 2H73A 5ECQB 2F8FA 2HI7A 5D93A 1GSDA 4MP4A 3WT1A 3BCIA 2HE3A 3D21A 2AV4A 4GQCA 2AYTA 1USBA 3GYKA 1XVQA 1GUMA 1SJ6A 4OCEA 4LA1A 3UAPA 5AISA 3FZ9A 1SL1B 2ON7A 5KN0A 3CRUA 1C72A 3G7IA 4X1UA 1EGRA 5A4WA 3UL3A 1NSWA 1SD9A 5FHIA 3WGXA 4HEA2 1IYIA 2DMLA 4WF5A 2GGTA 3FR9A 3TKSE 2I81A 5FT3A 2IPAA 4FO5A 3UIWA 2B6MA 3VFIA 3H93A 2MMZA 4ZB8A 1A0RP 4FYUA 3IV4A 5DDLA 1BX9A 6GSTA 4V1Ap 1JZWA 2WJUA 1GSFA 2MBTA 1V40A 3SWLA 3GKKA 5F07A 19GSA 3QDNA 5B7CA 2TRCP 4O92A 1X5EA 4K7NA 5A4UA 4X43A 3UEMA 1GNEA 3TUEA 2N5FA 1A24A 2H76A 4RI6A 1XWAA 1J9BA 1WP0A 2HFDA 3F6FA 1SL0B 5F05A 4CW9A 4BL7A 3BOAA 4MA9A 3ERGA 2I9HA 2MMNA 6GSYA 1OE7A 4EC0A 2MMAA 4ML6A 1BAYA 3JCML 1HNCA 3VWUA 2GT5A 3TKPA 2O89A 4ECCA 4KSOA 4HU7A 2LS5A 2E7PA 3TKRA 3D4MA 5IQYA 5HFKA 2L5OA 1ZCPA 1T4ZA 2B1KA 2I3YA 2A2RA 3E3EA 2GS3A 1QMVA 1VF3A 2DIYA 2LV3A 4QL9A 1RK4A 4MPFA 2VAFA 5DJMA 3F3RA 2CVBA 4P3YB 4Q5QA 4KA0A 1GSSA 1X5DA 4G10A 2K18A 1T7PB 1ERUA 2PU9C 3UBLA 5A5KA 4KE3A 5AGYA 4AJ6A 1E2YA 5ID2A 1BG5A 3KEBA 2FA4A 1ZYQB 5E59A 3ZYWA 5GAPD 4GSTA 1I5GA 1PRXA 1SK2A 2C0DA 3UMAA 4HS1A 1JZDA 4HOJA 5DCHA 4IKHA 3LYPA 3KD0A 2B5XA 1A23A 2J9HA 2H1BA 4XCSA 2VL2A 2H0GA 4ZB6A 4EXJA 2VCWA 1AQWA 5AIXA 3PR8A 3LXZA 2JZRA 2Z9SA 1M9BA 3EYTA 4POLA 1A8YA 1YEXA 1GSEA 1S3CA 2CQ9A 3EC3A 2K8VA 3DRNA 1Y6EA 4GSSA 3NZNA 3M0FA 3W8JA 2DJ3A 5CRGA 4ML1A 3WYWA 3GN3A 3HZ8A 3PGTA 1R4WA 3L9SA 4MJCA 3IE3A 4OFTA 5KEJA 5EL8A 4YQMA 5DQSA 2LSTA 4HDEA 5ID2B 4ZL7A 1A2LA 2CAQA 4MF5A 3GX8A 2AHEA 1PKWA 2WFCA 2JSZA 4KCEA 1SYXA 2VL2C 1XFLA 4BVYA 2CAIA 3GRXA 2HLSA 5IMDA 1GWCA 3L0HA 2F8AA 1HNAA 1SK0A 1VGLA 1A2MA 3TRXA 4K1FA 4BPYA 3HY2A 4JR6A 2FWEA 4WKWA 1H4OA 1OAZA 1PX6A 3BCKA 3KTLA 1B4QA 3IRAA 2RUEA 20GSA 2V6KA 3Q74A 16GSA 1QK8A 3KP8A 3A3TA 3NIVA 5B8AA 2HZEA 1M7TA 1XZOA 4GXZA 1G0TA 1E6BA 4I8BA 3LWAA 1HNBA 1MDKA 4FIWA 2ZNMA 2KLXA 3FW2A 2GTUA 1XWBA 1Z6NA 2PN8A 4TXOB 2G0FA 3L78A 5G2ZA 3EVIA 1GUKA 2A4VA 1TRVA 1B48A 3KJYA 4ECBA 1M9AA 1Z7RA 3F0IA 3ZITA 1TW9A 2O87A 1ERWA 4IW9A 5J9CA 1PL2A 3RHBA 2L57A 1EV9A 1F9MA 1M2DA 5GSTA 4EUYA 4ZL9A 1FB6A 4AF2A 1TI3A 2M46A 3CBUA 4F82A 1THOA 5HQPA 2GZZA 3UOMA 5KN2A 2H66A 1SKSB 2CX4A 5HFGA 4F0CA 2HZEB 2HRFA 4KB3A 3IC4A 3VPQA 4XHMA 2XPEA 1U3AA 3IAM2 1GULA 1OKDA 3KCMA 1QFNA 4N0VA 5IMZA 1TDIA 1CQGA 5KN1A 5IMAA 1QUWA 1YJ6A 1FVJA 4TR4A 2ALBA 3TJJA 3WD6A 2NPBA 2IMKA 3E0UA 2FHEA 3ZFLA 3GH9A 2LJRA 1HQOA 4MPGA 2LQQA 1QXHA 2AAWA 4YH2A 3UVHA 2VD0A 3QAGA 3ZIVA 1MD4A 1YY7A 3EINA 4POKA 5ENUA 2LEGA 4K2DA 2DJ2A 3I9V2 4TR3A 1S3DA 3F8UA 2QKEA 3HDCA 4ZBDA 3CSHA 1XXUA 4L5OA 3F6DA 1K3YA 3GIXA 6GSXA 2B5YA 4KW6A 1O8WA 4HZ4A 3VI7A 1NHYA 2LRNA 3QPMA 4FYBA 3N5OA 2CZ2A 1KEBA 5DJLA 1FO5A 1XWCA 2FY6A 3RAZA 5ECNB 1G6WA 2H6YA 2EIRA 1WRYA 1R26A 4K0GA 1AAZA 4MZCA 7GSSA 3V1WA 4TVEA 2R5GA 2H70A 1O6JA 3FEUA 2JZSA 3HHVA 2VL3A 4LMVA 1XPVA 2VLVA 1DE1A 1W4VA 5CRWA 1EOGA 3LYKA 1HYUA 5IO0A 5H5SA 3F4SA 4G2EA 2X99A 5HR1A 2YWOA 2FWHA 3DIEA 4KCAA 1OYJA 1FB0A 4IP6A 1J08A 3GNJA 5ECIB 2C80A 2JADA 1OKTA 2CV4A 1GTBA 2E0QA 5KN3A 3C73A 5IMFA 3C1SA 4POMA 4PQHA 4LL1B 5EVOA 4PUFC 3M3MA 5CP1A 2VCQA 2IMDA 4MABA 3G9BA 3VK9A 5J4UA 1MDIA 2VOCA 3BJ5A 1KTEA 2K9FA 3M8NA 4HU9A 2MMOA 4I5QA 1AQXA 4ZILA 3FZ4A 5G1KA 3HD5A 1XW5A 4QQ7A 4MF6A 3DMLA 4TR1A 1B8XA 3EU4A 5IIZA 1TK8B 4XRAA 3VI5A 4OFMA 4EL1A 3M9JA 3F4RA 4YQUA 3CTFA 5DVBA 5ECLB 2N5BA 4MCUA 1U87A 3RPPA 2TRXA 5DQYA 1JZOA 3HVSA 4MJBA 1WOUA 3CSIA 3P2AA 4XIHA 3GL3A 1AC1A 4ZBBA 4NHZA 3CYNA 4HQSA 3MSZA 5HFIA 3LG6A 1BEDA 2XPDA 2GVPA 2GZYA 4RUVA 3C7MA 1T3BA 2R3XA 2H6ZA 3HYPA 5ECRB 1QQ2A 4KDUA 4HUAA 2VCTA 1BYEA 1ERVA 1ILOA 3VWXA 2H6XA 5J5NA 5CO3A 3ME7A 4GF0A 4MLYA 3TRPA 2FWGA 1T1VA 5J41A 5F06A 1F6MC 4AGSA 5JCUA 1ZMAA 1YQ1A 4GSNA 4KDYA 2DIZA 4TR1B 2OE1A 3ZL5A 4XS1A 5F8BA 1YF1A 5ABRA 2P31A 2GSSA 2N5AA 4MZBA 1PX7A 1K3OA 1WE0A 2KUCA 3ZRDA 2F3MA 1NHOA 3UBKA 2R37A 1LBKA 1TJDA 2FUG2 4E8HA 2E2GA 1OC9B 2L4CA 2C0EA 4IQ1A 2H71A 3DGQA 4KAEA 17GSA 3GKNA 4PQIA 4RQXA 1EZKA 2J23A 4YAVA 2IN3A 4J56E 1WWJA 3TCOA 2RUFA 2H0HA 1LJRA 1Q4JA 2YWIA 1TRWA 1NW2A 4TKYA 2X8GA 4TR0A 1SL2B 3I43A 1K0AA 2A2SA 3G7JA 1Z6MA 3O3TA 3D0ZA 3FKFA 4G9HA 3P8WA 1JLWA 4BVXA 3L9UA 4OO4A 3I6AA 2RM5A 1XWGA 2ZCTA 3TJGA 3ZREA 1RQMA 4KUNA 5D9WA 5LCZA 5DALA 3A2WA 2CT6A 3P7XA 2HRNA 3P90A 3GUSA 1SENA 4L5LA 4WETA 2JSYA 3TKSA 1QGVA 3KH9A 3IA1A 1FOVA 1ACVA 1CQHA 1HD2A 4ZBAA 4MJAA 3ME8A 4N11A 2YCDA 2F51A 3HJMA 2H72A 3DWVA 3S9FA 1WJKA 2IIYA 2RIIA 2IJYA 1I9DA 5B8BA 3KTBA 14GSA 4F03A 1PSQA 2CA8A 1B9YC 3LEFA 4K8MA 5DCGA 3QMXA 5C00A 2PGTA 4EVMA 1N2AA 4TXOA 1TRSA 3A5WA 2WGRA 3ZLPA 5CAXA 3FZ5A 2NTOA 3HA9A 3FR3A 4IP1A 1R5AA 4HI7A 5DAKA 3TB2A 2GQLA 3TKSC 2VM1A 2MZCA 2DJ1A 2YOIA 2VIMA 1SU9A 5DALB 4QL7A 3VURA 2VCXA 13GSA 3PINA 1GLPA 1IYHA 3ED3A 4GWRA 2GSQA 2IMIA 4K0NA 2ON5A 4NHWA 5JWQB 4DSSA 1TXXA 2MBSA 5HR3A 2DLXA 4N0ZA 3IHQA 1FAAA 6GSUA 2C3NA 1GUHA 4NV2A 5ECOB 1W89A 4EO3A 4TRXA 2X64A 1T00A 4O32A 3RBTA 4K7OA 4WF4A 1F3BA 5B6NA 3CTGA 4KGIA 3DVXA 2LQOA 5ECMB 3CMIA 2YZUA 3TGZA 3DKSA 1O7UA 3H1NA 3LORA 4XS4A 1KBNA 2OBIA 5ECPB 3L9VA 3F63A 2EIOA 5DAKB 2P5QA 1XCCA 2XHFA 2H1GA 1K0CA 3U6VA 3IK7A 2C4JA 2MYGA 4N30A 2C3QA 5LNKe 3GA4A 5DBQA 3TRQA 2DBCA 3PH9A 1J0FA 1UC7A 2PUKC 1OE8A 1TTZA 2LUSA 1XW6A 5INYA 4OO5A 1XOBA 2OE3A 1VF1A 4J57E 1AUCA 2H74A 2BJXA 2AB6A 5AIVA 4DSSB 18GSA 4F2IA 1ON4A 2OBKA 3N9JA 1AIUA 2LRCA 3MAKA 3K8NA 3IXRA 2HSHA 4NAXA 5IO2A 2CVDA 3QAWA 1G7OA 2YJ7A 3CXGA 1GSYA 3F9UA 1ML6A 4G19A 3IPZA 4K9ZA 3EE2A 2O8VB 5GAND 4XS4B 1R5PA 1TRUA 2DJKA 2REMA 5F0GA 2VM2A 4I97A 4IHUA 4MZWA 1YEPA 3U5RE 5IOXA 3KZQA 2CVKA 4HQZA 1V58A 1F3AA 2KHPA 3LXTA 3GH6A 1EGOA 1Q98A 3Q18A 4EDZA 1YKAA 3F3QA 3IBHA 2B3SA 3MDKA 2B7KA 1ZOFA 2H75A 4WXTA 3ERFA 4HZ2A 4Q5RA 1EP7A 1K0MA 1K0OA 3CSJA 1XBSA 2L6DA 4V1Ag 4MK3A 3TJFA 3HKRA 3GFKA 4JE1A 4OCFA 1B4PA 2FLSA 5B6MA 1GTAA 1F37A 3J7Yb 1N8JA 3GTUA 4L0WA 1OC8A 3G7YA 4ECJA 1O8XA 5G5EA 3L4NA 4F0BA 4IVFA 5CRDA 1MTCA 1BJXA 1XIYA 2R2JA 4WR4A 3ZMLA 1V57A 3GV1A 2GSTA 3Q19A 1DBYA 3AY8A 5IOWA 4AJ7A 5HR0A 3HXSA 3IAS2 1SKWB 3KMOA 2H8LA 2YJHA 4IJIA 3I69A 3J7Yk 5D9XA 1NM3A 3QOUA 2LRTA 2WS2A 3IR4A 4TXVA 3APOA 1MDJA 4IGJA 5HR2A 4OD7A 2YV9A 3FYGA 5D96A 3R2QA 1EEJA 1PD21 2PVOC 3TKQA 3HJPA 3ISOA 2K6VA 3GTUB 3LFLA 1Z9HA 3LGCA 5D73A 3W8SA 4JU5A 2HZFA 3DXBA 2FWFA 3VLNA 2V6OA 5CYYA 1TK5B 1SJIA 4FYCA 2IWTA 3UJ1A 3NOFA 3GKXA 1X9SB 2PMTA 3M1GA 2KOKA 3ERWA 2QC7A 3BD2A 4RI7A 5ELAA 4I2TA 2PERA 3MWHA 1BQ7A 4MH2A 4TN8A 1AW9A 1Y25A 2X8HA 4HJMA 1GL8A 3D5JA 3C1RA 2V41A 3GX0A 4WEYA 2JL4A 1EWXA 1Z7PA 4MMMA 2OJLA 3QCPA 3WGDA 3HVVA 3ZVJD 3FZAA 4PUAA 2CZ3A 3DYRA 1MD3A 1AXDA 1XWKA 1OC9A 4WBRD 4NXIA 3DVWA 1MEKA 5C04A 1FW1A 1TKDB 5AN1A 3HZ4A 2ZUPA 4AJ8A 2P5RA 2D2ZA 1WPIA 3A2XA 4WBJA 3GSTA 5IPGA 1XW9A 1Z3EA 3IOSA 4KSMA 2HSYA 3MNGA 1UN2A 2DJ0A 2YZHA 2V32A 9GSSA 3O6TA 2B7JA 1X9MB 5ELGA 4L0UA 2FGXA 5JCGA 2DC5A 3QFAC 4NV5A 3TOTA 1F2EA 1U3IA 2NVLA 2VLTA 3GSSA 4ZB9A 3GHAA 3FY7A 4BA7A 2YP6A 2VL9A 4DSRA 2HNLA 2LKUA 1ZGNA 1M2AA 5GSSA 5JCWA 1V98A 2LJAA 3O76A 5J9BA 4DSQA 1LU4A 5EPFA 4GQFA 3SBCA 4EDYA 1OVNA 4EKZA 1GTUA 3KP9A 3WGEA 3LJRA 4I6XA 6GSSA 1KNGA 3HCZA 2FA8A 1YDKA 1YZXA 3HVXA 2KP2A 3H79A 3FHKA 1PA3A 2JU5A 4EF0A 2DSAA 4WR5A 1TI1A 2H1AA 1GLQA 5JWOB 1YKCA 3EWLA 2O85A 2GLRA 3E9JB 1PKZA 2GDRA 2GQMA 4X0XA 1A0FA 3H4KA 1EOHA 3HJOA 1GRXA 2L6CA 1THXA 5D8IA 3C8EA 5H5QA 4CHSA 8GSSA 1TP9A 2VCZA 4PGTA 2DMMA 4ILFA 1UA5A 4O7HA 5J3RA 2VD1A 2LTKA 4O5RA 4KDXA 2YWNA 2VCVA
chains in the Genus database with same CATH superfamily
4ZIJA 4BWSA 3FK8A 4Q5FA 4YAPA 1EP8A 4IJ3A 3KGKA 2RLIA 4ZL8A 5D9VA 1U6TA 3KMNA 4PNFA 3OR5A 2G2QA 2BMXA 3VWVA 2OKAA 1T4YA 5E4WA 1DUGA 1RW1A 5FWGA 3H8QA 2HXKA 3ZVJA 4XRDA 1Z5YE 4CDOA 2VUPA 1FG4A 5GZZB 3TOUA 1M0UA 3DD3A 4FH8A 5CRHA 5ECHB 3GMFA 4K6XA 4JR4A 2L5LA 1G6YA 2L4QA 2PVQA 1K0BA 4GRFA 4EIQA 2OADA 1JHBA 2WULA 1WMJA 2H19A 2YWMA 3A2VA 4MNNA 2OA7A 1ZYEA 4EE0A 4MJEA 2IMEA 2IFQA 4PXOA 2YNXA 5CNWA 5COHA 3ZMKA 2B5EA 4GTUA 4IN0A 1TK0B 4I2UA 1K3LA 4IELA 3EURA 1M99A 4PURA 1YF0A 2LNTA 2PWJA 12GSA 3GURA 2YPMA 3UVTA 1EV4A 1T8EB 5JWRB 1PMTA 3GKMA 2H1DA 4IQAA 1TOFA 1XOAA 1VRSD 2YV7A 4IBPA 2CX3A 4GLTA 4A5PA 4LL4B 4CY8A 3UARA 2M80A 1H75A 2HYXA 1GSQA 2GQKA 3IDVA 2JACA 3ZZXA 3KM6A 3FRCA 1PL1A 5EY6A 1JLVA 2OACA 4E8EA 3VPTA 2WB9A 5D9TA 4TW5A 1DSBA 4GCIA 1JZRA 3BBYA 4EIPA 1SKRB 3M9KA 10GSA 1GH2A 2R4VA 3PPUA 4D73A 3TJBA 1GNWA 1SJZA 2EC4A 2XBQA 3APSA 1O73A 5IPHA 6GSVA 2R6KA 3EU3A 2LJKA 4DVCA 3KXOA 1TU8A 3Q6OA 3LQ7A 2VO4A 5G1LA 2IFQB 2NBSA 4MF7A 1EEMA 6GSWA 3F4TA 4ACSA 1URMA 1GSUA 2M72A 1SD8A 5LD0A 4Z7XA 3ZFBA 2TIRA 3TJKA 1G7EA 2C0FA 2XC2A 4H86A 2IL3A 3KIJA 1FVKA 2C1YA 5IMVA 5ECKB 1S3AA 4OMVA 1R7HA 4USSA 4CY6A 4DEJA 2JZTA 2XBIA 1GP1A 3MIXA 3QFBC 2QSIA 1M3JA 1VF4A 3TDGA 1X5CA 4KNDA 4V2LA 1O81A 4D73B 4NMUA 2BTOT 3US3A 2C0GA 3ZIJA 3IK9A 3RPNA 3W6GA 3C71A 4JBBA 2C8UA 3APQA 4NPBA 2V1MA 2B1LA 1PGTA 2L59A 5IM9A 2P0GA 2YN1A 2FD3A 3QR6A 1B9XC 4Q5NA 2H0IA 1TU7A 3VWWA 1U88A 5IMCA 1GTIA 4OWYA 3EMXA 11GSA 2ES7A 4YQVA 2OE0A 3QD9A 4K7IA 4HJ2A 2AUVA 2H01A 2WZ9A 1FHEA 4OFNA 4XTSA 4V2MA 1XVWA 1A8LA 4ISDA 2WRTA 1X9WB 3FR6A 2HSMA 4KX4A 4ULXA 2PPTA 2IMFA 1V9WA 1SYRA 4LMWA 2RM6A 4NWYA 3WT2A 3GL5A 4ID0A 4YKFA 4PX1A 1A2JA 2HT9A 2K8SA 1DE2A 2DKHA 4N10A 4J2FA 2KP1A 2YANA 1K0NA 2E2MA 1VF2A 4XS6A 2O7KA 1PQNA 4MDCA 3RDWA 2X8CA 3RHCA 1ZL9A 2GZPA 3D4TA 4LLRA 2PBJA 5ECSA 4JEDA 2I4AA 2WCIA 1WIKA 22GSA 3KH7A 4JRRA 3QAVA 2NDOA 3EMPA 1AQVA 5CREA 2QGVA 5L71A 4JZQA 2H30A 2V2GA 4L8EA 1ST9A 3D6IA 4V2NA 1O85A 4TOPA 1M3IA 1X0RA 1ZZYA 4RQRA 3CRTA 5G31A 1ERTA 2VLUA 4KH7A 2C3TA 4MH3A 1OC3A 4ECIA 4BWQA 1M2BA 1V2AA 1PN9A 3LSZA 3ZTLA 1JFUA 2GT6A 2AJQB 5G30A 5H5RA 1K0DA 4ZXGA 2GSRA 1SK1A 1ABAA 4IS0A 2EIQA 1UVZA 3DEXA 4F9ZA 4POBA 5G5FA 2DJJA 2FCHA 2WDUA 3D22A 2F9SA 2FNOA 5A4VA 4PNGA 2LNSA 4PQ1A 2I1UA 2H73A 5ECQB 2F8FA 2HI7A 2X4AA 5D93A 1GSDA 4MP4A 3WT1A 3BCIA 2HE3A 3D21A 2AV4A 4GQCA 2AYTA 1USBA 3GYKA 1XVQA 1GUMA 1SJ6A 4OCEA 4LA1A 3UAPA 5AISA 3FZ9A 1SL1B 2ON7A 5KN0A 3CRUA 1C72A 3G7IA 4X1UA 1EGRA 5A4WA 3UL3A 1NSWA 1SD9A 5FHIA 3WGXA 4HEA2 1IYIA 2DMLA 4WF5A 2GGTA 3FR9A 3TKSE 2I81A 5FT3A 2IPAA 4FO5A 3UIWA 2B6MA 3VFIA 3H93A 2MMZA 4ZB8A 1A0RP 4FYUA 3IV4A 5DDLA 1BX9A 6GSTA 4V1Ap 1JZWA 2WJUA 1GSFA 2MBTA 1V40A 3SWLA 3GKKA 5F07A 19GSA 3QDNA 5B7CA 2TRCP 4O92A 1X5EA 4K7NA 5A4UA 4X43A 3UEMA 1GNEA 3TUEA 2N5FA 1A24A 1PFOA 2H76A 4RI6A 1XWAA 1J9BA 1WP0A 2HFDA 3F6FA 1SL0B 5F05A 4CW9A 4BL7A 3BOAA 4MA9A 3ERGA 2I9HA 2MMNA 6GSYA 1OE7A 4EC0A 2MMAA 4ML6A 1BAYA 3JCML 1HNCA 3VWUA 2GT5A 3TKPA 2O89A 4ECCA 4KSOA 4HU7A 2LS5A 2E7PA 3TKRA 3D4MA 5IQYA 5HFKA 2L5OA 1ZCPA 1T4ZA 2B1KA 2I3YA 2A2RA 3E3EA 2GS3A 1QMVA 1VF3A 2DIYA 2LV3A 4QL9A 1RK4A 4MPFA 2VAFA 5DJMA 3F3RA 2CVBA 4P3YB 4Q5QA 4KA0A 1GSSA 1X5DA 4G10A 2K18A 1T7PB 1ERUA 2PU9C 3UBLA 5A5KA 4KE3A 5AGYA 4AJ6A 1E2YA 5ID2A 1BG5A 3KEBA 2FA4A 1ZYQB 5E59A 3ZYWA 5GAPD 4GSTA 1I5GA 1PRXA 4BL7B 1SK2A 2C0DA 3UMAA 4HS1A 1JZDA 4HOJA 5DCHA 4IKHA 3LYPA 3KD0A 2B5XA 1A23A 2J9HA 2H1BA 4XCSA 2VL2A 2H0GA 4ZB6A 4EXJA 2VCWA 1AQWA 5AIXA 3PR8A 2R0CA 3LXZA 2JZRA 2Z9SA 1M9BA 3EYTA 4POLA 1A8YA 1YEXA 1GSEA 1S3CA 2CQ9A 3EC3A 2K8VA 3DRNA 1Y6EA 4GSSA 3NZNA 3M0FA 3W8JA 2DJ3A 5CRGA 4ML1A 3WYWA 3GN3A 3HZ8A 1ZYPA 3PGTA 1R4WA 3L9SA 4MJCA 3IE3A 4OFTA 5KEJA 5EL8A 4YQMA 5DQSA 2LSTA 4HDEA 5ID2B 4ZL7A 1A2LA 2CAQA 4MF5A 3GX8A 2AHEA 1PKWA 2WFCA 2JSZA 4KCEA 1SYXA 2VL2C 1XFLA 4BVYA 2CAIA 3GRXA 2HLSA 5IMDA 1GWCA 3L0HA 2F8AA 1HNAA 1SK0A 1VGLA 1A2MA 3TRXA 4K1FA 4BPYA 3HY2A 3IHGA 4JR6A 2FWEA 4WKWA 1H4OA 1OAZA 1PX6A 3BCKA 3KTLA 1B4QA 3IRAA 2RUEA 20GSA 2V6KA 3Q74A 16GSA 1QK8A 3KP8A 3A3TA 4O5UA 2X49A 3NIVA 5B8AA 2R0PA 2HZEA 1M7TA 1XZOA 4GXZA 1G0TA 1E6BA 4I8BA 3LWAA 1HNBA 1MDKA 4FIWA 2ZNMA 2KLXA 3FW2A 2GTUA 1XWBA 1Z6NA 2PN8A 4TXOB 2G0FA 3L78A 5G2ZA 3EVIA 1GUKA 2A4VA 1TRVA 1B48A 3KJYA 4ECBA 1M9AA 1Z7RA 3F0IA 3ZITA 1TW9A 2O87A 1ERWA 4IW9A 5J9CA 1PL2A 3RHBA 2L57A 1EV9A 4BVYB 1F9MA 1M2DA 5GSTA 4EUYA 4ZL9A 1FB6A 4AF2A 1TI3A 2M46A 3CBUA 4F82A 1THOA 5HQPA 5BMUA 2GZZA 3UOMA 5KN2A 2H66A 1SKSB 2CX4A 5HFGA 4F0CA 2HZEB 2HRFA 4KB3A 3IC4A 3VPQA 4XHMA 2XPEA 1U3AA 3EPTA 3IAM2 1GULA 1OKDA 3KCMA 1QFNA 4N0VA 5IMZA 1TDIA 1CQGA 5KN1A 5IMAA 1QUWA 1YJ6A 1FVJA 1FOHA 4TR4A 2ALBA 4K5RA 3TJJA 3WD6A 2NPBA 2IMKA 3E0UA 2FHEA 3ZFLA 3GH9A 2LJRA 1HQOA 4MPGA 5KOXA 2LQQA 1QXHA 2AAWA 4YH2A 3UVHA 2VD0A 3QAGA 3ZIVA 1MD4A 1YY7A 4Z2RA 3EINA 4POKA 5ENUA 2LEGA 4K2DA 2DJ2A 3I9V2 2QA1A 4TR3A 1S3DA 3F8UA 2QKEA 3HDCA 4ZBDA 3CSHA 1XXUA 4L5OA 3F6DA 1K3YA 3GIXA 6GSXA 2B5YA 4KW6A 1O8WA 4HZ4A 3VI7A 1NHYA 2LRNA 3QPMA 4FYBA 3N5OA 2CZ2A 1KEBA 5DJLA 1FO5A 1XWCA 2FY6A 3RAZA 5ECNB 1G6WA 2H6YA 2EIRA 1WRYA 1R26A 4K0GA 1AAZA 4MZCA 7GSSA 3V1WA 4TVEA 2R5GA 3R3EA 2H70A 1O6JA 3FEUA 2JZSA 3HHVA 2VL3A 4LMVA 1XPVA 2VLVA 1DE1A 1W4VA 5CRWA 1EOGA 3LYKA 1HYUA 5IO0A 5H5SA 3F4SA 4G2EA 2X99A 5HR1A 2YWOA 2FWHA 3DIEA 4KCAA 1OYJA 1FB0A 4IP6A 1J08A 3GNJA 5ECIB 2C80A 2JADA 1OKTA 2CV4A 1GTBA 2E0QA 5KN3A 3C73A 5IMFA 3C1SA 4POMA 4PQHA 4LL1B 3LW9A 5EVOA 4PUFC 3M3MA 5CP1A 2VCQA 2IMDA 4MABA 3G9BA 3VK9A 5J4UA 1MDIA 2VOCA 3BJ5A 1KTEA 2K9FA 3M8NA 4HU9A 2MMOA 4I5QA 1AQXA 4ZILA 3FZ4A 4BIKA 5G1KA 5KOWA 3HD5A 1XW5A 4QQ7A 4MF6A 3DMLA 4TR1A 1B8XA 3EU4A 5IIZA 1TK8B 4XRAA 3VI5A 4OFMA 4EL1A 3M9JA 3F4RA 4YQUA 3CTFA 5DVBA 5ECLB 2N5BA 4MCUA 1U87A 3RPPA 2TRXA 5DQYA 1JZOA 4O5QA 3HVSA 4MJBA 2R0GA 1WOUA 3CSIA 3P2AA 4XIHA 3GL3A 1AC1A 4ZBBA 4NHZA 4HSCX 3CYNA 4HQSA 3MSZA 5HFIA 3LG6A 1BEDA 2XPDA 2GVPA 2GZYA 4RUVA 3C7MA 1T3BA 2R3XA 2H6ZA 3HYPA 5ECRB 1QQ2A 4KDUA 4HUAA 2VCTA 1BYEA 1ERVA 1ILOA 3VWXA 2H6XA 5J5NA 5CO3A 3ME7A 4GF0A 4MLYA 3TRPA 2FWGA 1T1VA 5J41A 5F06A 2A2PA 1F6MC 4AGSA 5JCUA 1ZMAA 1YQ1A 4GSNA 4KDYA 2DIZA 4TR1B 2OE1A 2UZ8A 3ZL5A 4XS1A 5F8BA 1YF1A 5ABRA 2P31A 2GSSA 2N5AA 3MYDA 4MZBA 1PX7A 1ZYNA 1K3OA 4G0IA 1WE0A 2KUCA 3ZRDA 2F3MA 1NHOA 3UBKA 2R37A 1LBKA 1TJDA 2FUG2 4E8HA 2E2GA 1OC9B 2L4CA 2C0EA 4IQ1A 2H71A 3DGQA 4KAEA 17GSA 3GKNA 4PQIA 4RQXA 1EZKA 4PTSA 2J23A 4YAVA 2IN3A 4J56E 1WWJA 3TCOA 2RUFA 4K2XA 2H0HA 1LJRA 1Q4JA 2YWIA 1TRWA 3IC8A 1NW2A 4TKYA 2X8GA 4TR0A 1SL2B 3I43A 5BRTA 1K0AA 2A2SA 3G7JA 1Z6MA 3O3TA 3D0ZA 3FKFA 4G9HA 3P8WA 1JLWA 4BVXA 3L9UA 4OO4A 3I6AA 2RM5A 1XWGA 2ZCTA 3TJGA 3ZREA 1RQMA 4KUNA 5D9WA 5LCZA 5DALA 3A2WA 2CT6A 3P7XA 2HRNA 3P90A 3GUSA 1SENA 4Z2UA 4L5LA 4WETA 2JSYA 3TKSA 1QGVA 3KH9A 3IA1A 1FOVA 1ACVA 1CQHA 1HD2A 4ZBAA 4MJAA 3ME8A 4N11A 2YCDA 2F51A 3HJMA 2H72A 3DWVA 3S9FA 1WJKA 2IIYA 2RIIA 2IJYA 1I9DA 5B8BA 3KTBA 14GSA 4F03A 1PSQA 2CA8A 2DKIA 1B9YC 3LEFA 4K8MA 5DCGA 4KF9A 3QMXA 5C00A 2PGTA 4EVMA 1N2AA 4TXOA 1TRSA 3A5WA 2WGRA 3ZLPA 5CAXA 3FZ5A 2NTOA 3HA9A 3FR3A 4IP1A 1R5AA 4HI7A 5DAKA 4BVXB 3TB2A 2GQLA 3TKSC 2VM1A 2MZCA 2DJ1A 2YOIA 2VIMA 1SU9A 5DALB 4QL7A 3VURA 2VCXA 13GSA 1PN0A 3PINA 3HVNA 1GLPA 1IYHA 3ED3A 4GWRA 3A5IA 2GSQA 2IMIA 4K0NA 2ON5A 4NHWA 5JWQB 4DSSA 1TXXA 2MBSA 5HR3A 2DLXA 4N0ZA 3IHQA 1FAAA 6GSUA 2C3NA 1GUHA 4NV2A 5ECOB 1W89A 4EO3A 4TRXA 2X64A 1T00A 4O32A 3RBTA 4K7OA 4WF4A 1F3BA 5B6NA 3CTGA 4KGIA 3DVXA 2LQOA 5ECMB 3CMIA 2YZUA 3TGZA 3DKSA 1O7UA 3H1NA 3LORA 4XS4A 1KBNA 2OBIA 5ECPB 3L9VA 3F63A 2EIOA 5DAKB 2P5QA 1XCCA 2XHFA 2H1GA 1K0CA 3U6VA 3IK7A 2C4JA 2MYGA 4N30A 2C3QA 5LNKe 3GA4A 5DBQA 3TRQA 2DBCA 3PH9A 1J0FA 1UC7A 2PUKC 1OE8A 1TTZA 2LUSA 1XW6A 5INYA 4OO5A 1XOBA 2OE3A 1VF1A 4J57E 1AUCA 2H74A 2BJXA 2AB6A 5AIVA 4DSSB 18GSA 4F2IA 1ON4A 2OBKA 3N9JA 1AIUA 2LRCA 3MAKA 3K8NA 3IXRA 2HSHA 4NAXA 5IO2A 2CVDA 3QAWA 1G7OA 2YJ7A 3CXGA 1GSYA 3F9UA 1ML6A 4G19A 3IPZA 4K9ZA 3EE2A 2O8VB 5GAND 4XS4B 1R5PA 1TRUA 2DJKA 2REMA 5F0GA 2VM2A 4I97A 4IHUA 4MZWA 1YEPA 3U5RE 5IOXA 3KZQA 2CVKA 4HQZA 1V58A 1F3AA 2KHPA 3LXTA 3GH6A 1EGOA 1Q98A 3Q18A 4EDZA 1YKAA 3F3QA 3IBHA 2B3SA 3MDKA 2B7KA 1ZOFA 2H75A 4WXTA 3ERFA 4HZ2A 4Q5RA 1EP7A 1K0MA 1K0OA 3CSJA 1XBSA 2L6DA 4V1Ag 4MK3A 3TJFA 3HKRA 3GFKA 4JE1A 4OCFA 1B4PA 2FLSA 5B6MA 1GTAA 1F37A 3J7Yb 1N8JA 3GTUA 4L0WA 1OC8A 3G7YA 4ECJA 1O8XA 5G5EA 3L4NA 4F0BA 4IVFA 5CRDA 1MTCA 3CQFA 1BJXA 1XIYA 2R2JA 4WR4A 2HRKA 3ZMLA 1V57A 3GV1A 2GSTA 3Q19A 1DBYA 3AY8A 5IOWA 4AJ7A 5HR0A 3HXSA 3IAS2 1SKWB 3KMOA 2H8LA 2YJHA 4IJIA 3I69A 3J7Yk 5D9XA 4G0LA 1NM3A 3QOUA 2LRTA 2WS2A 3IR4A 4TXVA 3APOA 1MDJA 4IGJA 5HR2A 4OD7A 2YV9A 3FYGA 5D96A 3R2QA 1EEJA 1PD21 2PVOC 3TKQA 3HJPA 3ISOA 2K6VA 3GTUB 3LFLA 1Z9HA 3LGCA 5D73A 3W8SA 4JU5A 2HZFA 3DXBA 2FWFA 3VLNA 2V6OA 5CYYA 1TK5B 1SJIA 4X4JA 3FMWA 2IWTA 4FYCA 3UJ1A 3NOFA 3GKXA 1X9SB 2PMTA 3M1GA 2KOKA 3ERWA 2QC7A 3BD2A 4RI7A 5ELAA 4I2TA 2PERA 3MWHA 1BQ7A 4MH2A 4TN8A 1AW9A 1Y25A 2X8HA 4HJMA 1GL8A 3D5JA 3C1RA 2V41A 3GX0A 4WEYA 2JL4A 1EWXA 1Z7PA 4MMMA 2OJLA 4K5SA 3QCPA 3WGDA 3HVVA 3ZVJD 3FZAA 4PUAA 2CZ3A 3DYRA 1MD3A 4G0KA 1AXDA 1XWKA 1OC9A 4WBRD 4NXIA 3DVWA 1MEKA 5C04A 1FW1A 1TKDB 5AN1A 3HZ4A 2ZUPA 4AJ8A 2P5RA 2D2ZA 1WPIA 3A2XA 4WBJA 3GSTA 5IPGA 1XW9A 1Z3EA 3IOSA 4KSMA 2HSYA 3MNGA 1UN2A 2DJ0A 2YZHA 2V32A 9GSSA 3O6TA 2B7JA 1X9MB 5ELGA 4L0UA 2FGXA 5JCGA 2DC5A 3QFAC 4NV5A 3TOTA 1F2EA 1U3IA 2NVLA 2VLTA 2A4HA 3GSSA 4ZB9A 3GHAA 3FY7A 4BA7A 2YP6A 2VL9A 4DSRA 2HNLA 2LKUA 1ZGNA 1M2AA 5GSSA 5JCWA 1V98A 2LJAA 3O76A 5J9BA 1XG8A 4DSQA 1LU4A 5EPFA 4GQFA 3SBCA 4EDYA 1OVNA 4EKZA 1GTUA 4ICYA 3KP9A 3WGEA 3LJRA 4I6XA 6GSSA 1KNGA 3HCZA 4Z2TA 2FA8A 1YDKA 4YKGA 1YZXA 3HVXA 2KP2A 3H79A 3FHKA 1PA3A 2JU5A 4EF0A 2DSAA 4WR5A 1TI1A 2H1AA 1GLQA 5JWOB 1YKCA 3EWLA 2O85A 2GLRA 2HRAA 2QA2A 3E9JB 1PKZA 2GDRA 2GQMA 1S3RA 4X0XA 1A0FA 3H4KA 1EOHA 3HJOA 1GRXA 2L6CA 4FQUA 1THXA 5D8IA 3C8EA 5H5QA 4CHSA 8GSSA 1TP9A 2VCZA 4PGTA 2DMMA 4ILFA 1UA5A 4O7HA 5J3RA 2VD1A 2LTKA 4O5RA 4KDXA 2YWNA 2VCVA
chains in the Genus database with same CATH topology
4ZIJA 4BWSA 3FK8A 4Q5FA 4YAPA 1EP8A 4IJ3A 3KGKA 2RLIA 4ZL8A 5D9VA 1U6TA 3KMNA 4PNFA 3OR5A 2G2QA 2BMXA 3VWVA 2OKAA 1T4YA 5E4WA 1DUGA 1RW1A 5FWGA 3H8QA 2HXKA 3ZVJA 4XRDA 1Z5YE 4CDOA 2VUPA 1FG4A 5GZZB 3TOUA 1M0UA 3DD3A 4FH8A 5CRHA 5ECHB 3GMFA 4K6XA 4JR4A 2L5LA 1G6YA 2L4QA 2PVQA 1K0BA 4GRFA 4EIQA 2OADA 1JHBA 2WULA 1WMJA 2H19A 2YWMA 3A2VA 4MNNA 2OA7A 1ZYEA 4EE0A 4MJEA 2IMEA 2IFQA 4PXOA 2YNXA 5CNWA 5COHA 3ZMKA 2B5EA 4GTUA 4IN0A 1TK0B 4I2UA 1K3LA 4IELA 3EURA 1M99A 4PURA 1YF0A 2LNTA 2PWJA 12GSA 3GURA 2YPMA 3UVTA 1EV4A 1T8EB 5JWRB 1PMTA 3GKMA 2H1DA 4IQAA 1TOFA 1XOAA 1VRSD 2YV7A 4IBPA 2CX3A 4GLTA 4A5PA 4LL4B 4CY8A 3UARA 2M80A 1H75A 2HYXA 1GSQA 2GQKA 3IDVA 2JACA 3ZZXA 3KM6A 3FRCA 1PL1A 5EY6A 1JLVA 2OACA 4E8EA 3VPTA 2WB9A 5D9TA 4TW5A 1DSBA 4GCIA 1JZRA 3BBYA 4EIPA 1SKRB 3M9KA 10GSA 1GH2A 2R4VA 3PPUA 4D73A 3TJBA 1GNWA 1SJZA 2EC4A 2XBQA 3APSA 1O73A 5IPHA 6GSVA 2R6KA 3EU3A 2LJKA 4DVCA 3KXOA 1TU8A 3Q6OA 3LQ7A 2VO4A 5G1LA 2IFQB 2NBSA 4MF7A 1EEMA 6GSWA 3F4TA 4ACSA 1URMA 1GSUA 2M72A 1SD8A 5LD0A 4Z7XA 3ZFBA 2TIRA 3TJKA 1G7EA 2C0FA 2XC2A 4H86A 2IL3A 3KIJA 1FVKA 2C1YA 5IMVA 5ECKB 1S3AA 4OMVA 1R7HA 4USSA 4CY6A 4DEJA 2JZTA 2XBIA 1GP1A 3MIXA 3QFBC 2QSIA 1VF4A 3TDGA 1X5CA 4KNDA 4V2LA 1O81A 4D73B 4NMUA 2BTOT 3US3A 2C0GA 3ZIJA 3IK9A 3RPNA 3W6GA 3C71A 4JBBA 2C8UA 3APQA 4NPBA 2V1MA 2B1LA 1PGTA 2L59A 5IM9A 2P0GA 2YN1A 2FD3A 3QR6A 1B9XC 4Q5NA 2H0IA 1TU7A 3VWWA 1U88A 5IMCA 1GTIA 4OWYA 3EMXA 11GSA 2ES7A 4YQVA 2OE0A 3QD9A 4K7IA 4HJ2A 2AUVA 2H01A 2WZ9A 1FHEA 4OFNA 4XTSA 4V2MA 1XVWA 1A8LA 4ISDA 2WRTA 1X9WB 3FR6A 2HSMA 4KX4A 4ULXA 2PPTA 2IMFA 1V9WA 1SYRA 4LMWA 2RM6A 4NWYA 3WT2A 3GL5A 4ID0A 4YKFA 4PX1A 1A2JA 2HT9A 2K8SA 1DE2A 2DKHA 4N10A 4J2FA 2KP1A 2YANA 1K0NA 2E2MA 1VF2A 4XS6A 2O7KA 1PQNA 4MDCA 3RDWA 2X8CA 3RHCA 1ZL9A 2GZPA 3D4TA 4LLRA 2PBJA 5ECSA 4JEDA 2I4AA 2WCIA 1WIKA 22GSA 3KH7A 4JRRA 3QAVA 2NDOA 3EMPA 1AQVA 5CREA 2QGVA 5L71A 4JZQA 2H30A 2V2GA 4L8EA 1ST9A 3D6IA 4V2NA 1O85A 4TOPA 1X0RA 1ZZYA 4RQRA 3CRTA 5G31A 1ERTA 2VLUA 4KH7A 2C3TA 4MH3A 1OC3A 4ECIA 4BWQA 1M2BA 1V2AA 1PN9A 3LSZA 3ZTLA 1JFUA 2GT6A 2AJQB 5G30A 5H5RA 1K0DA 4ZXGA 2GSRA 1SK1A 1ABAA 4IS0A 2EIQA 1UVZA 3DEXA 4F9ZA 4POBA 5G5FA 2DJJA 2FCHA 2WDUA 3D22A 2F9SA 2FNOA 5A4VA 4PNGA 2LNSA 4PQ1A 2I1UA 2H73A 5ECQB 2F8FA 2HI7A 2X4AA 5D93A 1GSDA 4MP4A 3WT1A 3BCIA 2HE3A 3D21A 2AV4A 4GQCA 2AYTA 1USBA 3GYKA 1XVQA 1GUMA 1SJ6A 4OCEA 4LA1A 3UAPA 5AISA 3FZ9A 1SL1B 2ON7A 5KN0A 3CRUA 1C72A 3G7IA 4X1UA 1EGRA 5A4WA 3UL3A 1NSWA 1SD9A 5FHIA 3WGXA 4HEA2 1IYIA 2DMLA 4WF5A 2GGTA 3FR9A 3TKSE 2I81A 5FT3A 2IPAA 4FO5A 3UIWA 2B6MA 3VFIA 3H93A 2MMZA 4ZB8A 1A0RP 4FYUA 3IV4A 5DDLA 1BX9A 6GSTA 4V1Ap 1JZWA 2WJUA 1GSFA 2MBTA 1V40A 3SWLA 3GKKA 5F07A 19GSA 3QDNA 5B7CA 2TRCP 4O92A 1X5EA 4K7NA 5A4UA 4X43A 3UEMA 1GNEA 3TUEA 2N5FA 1A24A 2H76A 4RI6A 1XWAA 1J9BA 1WP0A 2HFDA 3F6FA 1SL0B 5F05A 4CW9A 4BL7A 3BOAA 4MA9A 3ERGA 2I9HA 2MMNA 6GSYA 1OE7A 4EC0A 2MMAA 4ML6A 1BAYA 3JCML 1HNCA 3VWUA 2GT5A 3TKPA 2O89A 4ECCA 4KSOA 4HU7A 2LS5A 2E7PA 3TKRA 3D4MA 5IQYA 5HFKA 2L5OA 1ZCPA 1T4ZA 2B1KA 2I3YA 2A2RA 3E3EA 2GS3A 1QMVA 1VF3A 2DIYA 2LV3A 4QL9A 1RK4A 4MPFA 2VAFA 5DJMA 3F3RA 2CVBA 4P3YB 4Q5QA 4KA0A 1GSSA 1X5DA 4G10A 2K18A 1T7PB 1ERUA 2PU9C 3UBLA 5A5KA 4KE3A 5AGYA 4AJ6A 1E2YA 5ID2A 1BG5A 3KEBA 2FA4A 1ZYQB 5E59A 3ZYWA 5GAPD 4GSTA 1I5GA 1PRXA 4BL7B 1SK2A 2C0DA 3UMAA 4HS1A 1JZDA 4HOJA 5DCHA 4IKHA 3LYPA 3KD0A 2B5XA 1A23A 2J9HA 2H1BA 4XCSA 2VL2A 2H0GA 4ZB6A 4EXJA 2VCWA 1AQWA 5AIXA 3PR8A 2R0CA 3LXZA 2JZRA 2Z9SA 1M9BA 3EYTA 4POLA 1A8YA 1YEXA 1GSEA 1S3CA 2CQ9A 3EC3A 2K8VA 3DRNA 1Y6EA 4GSSA 3NZNA 3M0FA 3W8JA 2DJ3A 5CRGA 4ML1A 3WYWA 3GN3A 3HZ8A 1ZYPA 3PGTA 1R4WA 3L9SA 4MJCA 3IE3A 4OFTA 5KEJA 5EL8A 4YQMA 5DQSA 2LSTA 4HDEA 5ID2B 4ZL7A 1A2LA 2CAQA 4MF5A 3GX8A 2AHEA 1PKWA 2WFCA 2JSZA 4KCEA 1SYXA 2VL2C 1XFLA 4BVYA 2CAIA 3GRXA 2HLSA 5IMDA 1GWCA 3L0HA 2F8AA 1HNAA 1SK0A 1VGLA 1A2MA 3TRXA 4K1FA 4BPYA 3HY2A 3IHGA 4JR6A 2FWEA 4WKWA 1H4OA 1OAZA 1PX6A 3BCKA 3KTLA 1B4QA 3IRAA 2RUEA 20GSA 2V6KA 3Q74A 16GSA 1QK8A 3KP8A 3A3TA 4O5UA 2X49A 3NIVA 5B8AA 2R0PA 2HZEA 1M7TA 1XZOA 4GXZA 1G0TA 1E6BA 4I8BA 3LWAA 1HNBA 1MDKA 4FIWA 2ZNMA 2KLXA 3FW2A 2GTUA 1XWBA 1Z6NA 2PN8A 4TXOB 2G0FA 3L78A 5G2ZA 3EVIA 1GUKA 2A4VA 1TRVA 1B48A 3KJYA 4ECBA 1M9AA 1Z7RA 3F0IA 3ZITA 1TW9A 2O87A 1ERWA 4IW9A 5J9CA 1PL2A 3RHBA 2L57A 1EV9A 4BVYB 1F9MA 1M2DA 5GSTA 4EUYA 4ZL9A 1FB6A 4AF2A 1TI3A 2M46A 3CBUA 4F82A 1THOA 5HQPA 5BMUA 2GZZA 3UOMA 5KN2A 2H66A 1SKSB 2CX4A 5HFGA 4F0CA 2HZEB 2HRFA 4KB3A 3IC4A 3VPQA 4XHMA 2XPEA 1U3AA 3EPTA 3IAM2 1GULA 1OKDA 3KCMA 1QFNA 4N0VA 5IMZA 1TDIA 1CQGA 5KN1A 5IMAA 1QUWA 1YJ6A 1FVJA 1FOHA 4TR4A 2ALBA 4K5RA 3TJJA 3WD6A 2NPBA 2IMKA 3E0UA 2FHEA 3ZFLA 3GH9A 2LJRA 1HQOA 4MPGA 5KOXA 2LQQA 1QXHA 2AAWA 4YH2A 3UVHA 2VD0A 3QAGA 3ZIVA 1MD4A 1YY7A 4Z2RA 3EINA 4POKA 5ENUA 2LEGA 4K2DA 2DJ2A 3I9V2 2QA1A 4TR3A 1S3DA 3F8UA 2QKEA 3HDCA 4ZBDA 3CSHA 1XXUA 4L5OA 3F6DA 1K3YA 3GIXA 6GSXA 2B5YA 4KW6A 1O8WA 4HZ4A 3VI7A 1NHYA 2LRNA 3QPMA 4FYBA 3N5OA 2CZ2A 1KEBA 5DJLA 1FO5A 1XWCA 2FY6A 3RAZA 5ECNB 1G6WA 2H6YA 2EIRA 1WRYA 1R26A 4K0GA 1AAZA 4MZCA 7GSSA 3V1WA 4TVEA 2R5GA 3R3EA 2H70A 1O6JA 3FEUA 2JZSA 3HHVA 2VL3A 4LMVA 1XPVA 2VLVA 1DE1A 1W4VA 5CRWA 1EOGA 3LYKA 1HYUA 5IO0A 5H5SA 3F4SA 4G2EA 2X99A 5HR1A 2YWOA 2FWHA 3DIEA 4KCAA 1OYJA 1FB0A 4IP6A 1J08A 3GNJA 5ECIB 2C80A 2JADA 1OKTA 2CV4A 1GTBA 2E0QA 5KN3A 3C73A 5IMFA 3C1SA 4POMA 4PQHA 4LL1B 3LW9A 5EVOA 4PUFC 3M3MA 5CP1A 2VCQA 2IMDA 4MABA 3G9BA 3VK9A 5J4UA 1MDIA 2VOCA 3BJ5A 1KTEA 2K9FA 3M8NA 4HU9A 2MMOA 4I5QA 1AQXA 4ZILA 3FZ4A 5G1KA 5KOWA 3HD5A 1XW5A 4QQ7A 4MF6A 3DMLA 4TR1A 1B8XA 3EU4A 5IIZA 1TK8B 4XRAA 3VI5A 4OFMA 4EL1A 3M9JA 3F4RA 4YQUA 3CTFA 5DVBA 5ECLB 2N5BA 4MCUA 1U87A 3RPPA 2TRXA 5DQYA 1JZOA 4O5QA 3HVSA 4MJBA 2R0GA 1WOUA 3CSIA 3P2AA 4XIHA 3GL3A 1AC1A 4ZBBA 4NHZA 3CYNA 4HQSA 3MSZA 5HFIA 3LG6A 1BEDA 2XPDA 2GVPA 2GZYA 4RUVA 3C7MA 1T3BA 2R3XA 2H6ZA 3HYPA 5ECRB 1QQ2A 4KDUA 4HUAA 2VCTA 1BYEA 1ERVA 1ILOA 3VWXA 2H6XA 5J5NA 5CO3A 3ME7A 4GF0A 4MLYA 3TRPA 2FWGA 1T1VA 5J41A 5F06A 2A2PA 1F6MC 4AGSA 5JCUA 1ZMAA 1YQ1A 4GSNA 4KDYA 2DIZA 4TR1B 2OE1A 2UZ8A 3ZL5A 4XS1A 5F8BA 1YF1A 5ABRA 2P31A 2GSSA 2N5AA 3MYDA 4MZBA 1PX7A 1ZYNA 1K3OA 4G0IA 1WE0A 2KUCA 3ZRDA 2F3MA 1NHOA 3UBKA 2R37A 1LBKA 1TJDA 2FUG2 4E8HA 2E2GA 1OC9B 2L4CA 2C0EA 4IQ1A 2H71A 3DGQA 4KAEA 17GSA 3GKNA 4PQIA 4RQXA 1EZKA 4PTSA 2J23A 4YAVA 2IN3A 4J56E 1WWJA 3TCOA 2RUFA 4K2XA 2H0HA 1LJRA 1Q4JA 2YWIA 1TRWA 3IC8A 1NW2A 4TKYA 2X8GA 4TR0A 1SL2B 3I43A 5BRTA 1K0AA 2A2SA 3G7JA 1Z6MA 3O3TA 3D0ZA 3FKFA 4G9HA 3P8WA 1JLWA 4BVXA 3L9UA 4OO4A 3I6AA 2RM5A 1XWGA 2ZCTA 3TJGA 3ZREA 1RQMA 4KUNA 5D9WA 5LCZA 5DALA 3A2WA 2CT6A 3P7XA 2HRNA 3P90A 3GUSA 1SENA 4Z2UA 4L5LA 4WETA 2JSYA 3TKSA 1QGVA 3KH9A 3IA1A 1FOVA 1ACVA 1CQHA 1HD2A 4ZBAA 4MJAA 3ME8A 4N11A 2YCDA 2F51A 3HJMA 2H72A 3DWVA 3S9FA 1WJKA 2IIYA 2RIIA 2IJYA 1I9DA 5B8BA 3KTBA 14GSA 4F03A 1PSQA 2CA8A 2DKIA 1B9YC 3LEFA 4K8MA 5DCGA 4KF9A 3QMXA 5C00A 2PGTA 4EVMA 1N2AA 4TXOA 1TRSA 3A5WA 2WGRA 3ZLPA 5CAXA 3FZ5A 2NTOA 3HA9A 3FR3A 4IP1A 1R5AA 4HI7A 5DAKA 4BVXB 3TB2A 2GQLA 3TKSC 2VM1A 2MZCA 2DJ1A 2YOIA 2VIMA 1SU9A 5DALB 4QL7A 3VURA 2VCXA 13GSA 1PN0A 3PINA 1GLPA 1IYHA 3ED3A 4GWRA 3A5IA 2GSQA 2IMIA 4K0NA 2ON5A 4NHWA 5JWQB 4DSSA 1TXXA 2MBSA 5HR3A 2DLXA 4N0ZA 3IHQA 1FAAA 6GSUA 2C3NA 1GUHA 4NV2A 5ECOB 1W89A 4EO3A 4TRXA 2X64A 1T00A 4O32A 3RBTA 4K7OA 4WF4A 1F3BA 5B6NA 3CTGA 4KGIA 3DVXA 2LQOA 5ECMB 3CMIA 2YZUA 3TGZA 3DKSA 1O7UA 3H1NA 3LORA 4XS4A 1KBNA 2OBIA 5ECPB 3L9VA 3F63A 2EIOA 5DAKB 2P5QA 1XCCA 2XHFA 2H1GA 1K0CA 3U6VA 3IK7A 2C4JA 2MYGA 4N30A 2C3QA 5LNKe 3GA4A 5DBQA 3TRQA 2DBCA 3PH9A 1J0FA 1UC7A 2PUKC 1OE8A 1TTZA 2LUSA 1XW6A 5INYA 4OO5A 1XOBA 2OE3A 1VF1A 4J57E 1AUCA 2H74A 2BJXA 2AB6A 5AIVA 4DSSB 18GSA 4F2IA 1ON4A 2OBKA 3N9JA 1AIUA 2LRCA 3MAKA 3K8NA 3IXRA 2HSHA 4NAXA 5IO2A 2CVDA 3QAWA 1G7OA 2YJ7A 3CXGA 1GSYA 3F9UA 1ML6A 4G19A 3IPZA 4K9ZA 3EE2A 2O8VB 5GAND 4XS4B 1R5PA 1TRUA 2DJKA 2REMA 5F0GA 2VM2A 4I97A 4IHUA 4MZWA 1YEPA 3U5RE 5IOXA 3KZQA 2CVKA 4HQZA 1V58A 1F3AA 2KHPA 3LXTA 3GH6A 1EGOA 1Q98A 3Q18A 4EDZA 1YKAA 3F3QA 3IBHA 2B3SA 3MDKA 2B7KA 1ZOFA 2H75A 4WXTA 3ERFA 4HZ2A 4Q5RA 1EP7A 1K0MA 1K0OA 3CSJA 1XBSA 2L6DA 4V1Ag 4MK3A 3TJFA 3HKRA 3GFKA 4JE1A 4OCFA 1B4PA 2FLSA 5B6MA 1GTAA 1F37A 3J7Yb 1N8JA 3GTUA 4L0WA 1OC8A 3G7YA 4ECJA 1O8XA 5G5EA 3L4NA 4F0BA 4IVFA 5CRDA 1MTCA 1BJXA 1XIYA 2R2JA 4WR4A 2HRKA 3ZMLA 1V57A 3GV1A 2GSTA 3Q19A 1DBYA 3AY8A 5IOWA 4AJ7A 5HR0A 3HXSA 3IAS2 1SKWB 3KMOA 2H8LA 2YJHA 4IJIA 3I69A 3J7Yk 5D9XA 4G0LA 1NM3A 3QOUA 2LRTA 2WS2A 3IR4A 4TXVA 3APOA 1MDJA 4IGJA 5HR2A 4OD7A 2YV9A 3FYGA 5D96A 3R2QA 1EEJA 1PD21 2PVOC 3TKQA 3HJPA 3ISOA 2K6VA 3GTUB 3LFLA 1Z9HA 3LGCA 5D73A 3W8SA 4JU5A 2HZFA 3DXBA 2FWFA 3VLNA 2V6OA 5CYYA 1TK5B 1SJIA 4X4JA 3FMWA 2IWTA 4FYCA 3UJ1A 3NOFA 3GKXA 1X9SB 2PMTA 3M1GA 2KOKA 3ERWA 2QC7A 3BD2A 4RI7A 5ELAA 4I2TA 2PERA 3MWHA 1BQ7A 4MH2A 4TN8A 1AW9A 1Y25A 2X8HA 4HJMA 1GL8A 3D5JA 3C1RA 2V41A 3GX0A 4WEYA 2JL4A 1EWXA 1Z7PA 4MMMA 2OJLA 4K5SA 3QCPA 3WGDA 3HVVA 3ZVJD 3FZAA 4PUAA 2CZ3A 3DYRA 1MD3A 4G0KA 1AXDA 1XWKA 1OC9A 4WBRD 4NXIA 3DVWA 1MEKA 5C04A 1FW1A 1TKDB 5AN1A 3HZ4A 2ZUPA 4AJ8A 2P5RA 2D2ZA 1WPIA 3A2XA 4WBJA 3GSTA 5IPGA 1XW9A 1Z3EA 3IOSA 4KSMA 2HSYA 3MNGA 1UN2A 2DJ0A 2YZHA 2V32A 9GSSA 3O6TA 2B7JA 1X9MB 5ELGA 4L0UA 2FGXA 5JCGA 2DC5A 3QFAC 4NV5A 3TOTA 1F2EA 1U3IA 2NVLA 2VLTA 2A4HA 3GSSA 4ZB9A 3GHAA 3FY7A 4BA7A 2YP6A 2VL9A 4DSRA 2HNLA 2LKUA 1ZGNA 1M2AA 5GSSA 5JCWA 1V98A 2LJAA 3O76A 5J9BA 4DSQA 1LU4A 5EPFA 4GQFA 3SBCA 4EDYA 1OVNA 4EKZA 1GTUA 4ICYA 3KP9A 3WGEA 3LJRA 4I6XA 6GSSA 1KNGA 3HCZA 4Z2TA 2FA8A 1YDKA 4YKGA 1YZXA 3HVXA 2KP2A 3H79A 3FHKA 1PA3A 2JU5A 4EF0A 2DSAA 4WR5A 1TI1A 2H1AA 1GLQA 5JWOB 1YKCA 3EWLA 2O85A 2GLRA 2HRAA 2QA2A 3E9JB 1PKZA 2GDRA 2GQMA 4X0XA 1A0FA 3H4KA 1EOHA 3HJOA 1GRXA 2L6CA 4FQUA 1THXA 5D8IA 3C8EA 5H5QA 4CHSA 8GSSA 1TP9A 2VCZA 4PGTA 2DMMA 4ILFA 1UA5A 4O7HA 5J3RA 2VD1A 2LTKA 4O5RA 4KDXA 2YWNA 2VCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIJ A;  4BWS A;  3FK8 A;  4Q5F A;  4YAP A;  1EP8 A;  4IJ3 A;  3KGK A;  2RLI A;  4ZL8 A;  5D9V A;  1U6T A;  3KMN A;  4PNF A;  3OR5 A;  2G2Q A;  2BMX A;  3VWV A;  2OKA A;  1T4Y A;  5E4W A;  1DUG A;  1RW1 A;  5FWG A;  3H8Q A;  2HXK A;  3ZVJ A;  4XRD A;  1Z5Y E;  4CDO A;  2VUP A;  1FG4 A;  5GZZ B;  3TOU A;  1M0U A;  3DD3 A;  4FH8 A;  5CRH A;  5ECH B;  3GMF A;  4K6X A;  4JR4 A;  2L5L A;  1G6Y A;  2L4Q A;  2PVQ A;  1K0B A;  4GRF A;  2OAD A;  1JHB A;  2WUL A;  1WMJ A;  2H19 A;  2YWM A;  3A2V A;  2OA7 A;  1ZYE A;  4EE0 A;  4MJE A;  2IME A;  2IFQ A;  4PXO A;  2YNX A;  5CNW A;  5COH A;  3ZMK A;  2B5E A;  4GTU A;  4IN0 A;  1TK0 B;  4I2U A;  1K3L A;  4IEL A;  3EUR A;  1M99 A;  4PUR A;  1YF0 A;  2LNT A;  2PWJ A;  12GS A;  3GUR A;  2YPM A;  3UVT A;  1EV4 A;  1T8E B;  5JWR B;  1PMT A;  3GKM A;  2H1D A;  4IQA A;  1TOF A;  1XOA A;  1VRS D;  2YV7 A;  4IBP A;  2CX3 A;  4GLT A;  4LL4 B;  3UAR A;  2M80 A;  1H75 A;  2HYX A;  1GSQ A;  2GQK A;  3IDV A;  2JAC A;  3ZZX A;  3KM6 A;  3FRC A;  1PL1 A;  5EY6 A;  1JLV A;  2OAC A;  4E8E A;  3VPT A;  2WB9 A;  5D9T A;  4TW5 A;  1DSB A;  4GCI A;  1JZR A;  3BBY A;  1SKR B;  3M9K A;  10GS A;  1GH2 A;  2R4V A;  4D73 A;  3TJB A;  1GNW A;  1SJZ A;  2EC4 A;  2XBQ A;  3APS A;  1O73 A;  5IPH A;  6GSV A;  2R6K A;  3EU3 A;  2LJK A;  4DVC A;  3KXO A;  1TU8 A;  3Q6O A;  3LQ7 A;  2VO4 A;  5G1L A;  2IFQ B;  2NBS A;  4MF7 A;  1EEM A;  6GSW A;  3F4T A;  4ACS A;  1URM A;  1GSU A;  2M72 A;  1SD8 A;  5LD0 A;  4Z7X A;  3ZFB A;  2TIR A;  3TJK A;  1G7E A;  2C0F A;  2XC2 A;  4H86 A;  2IL3 A;  3KIJ A;  1FVK A;  2C1Y A;  5IMV A;  5ECK B;  1S3A A;  4OMV A;  1R7H A;  4DEJ A;  2JZT A;  2XBI A;  1GP1 A;  3QFB C;  2QSI A;  1VF4 A;  3TDG A;  1X5C A;  4KND A;  4V2L A;  1O81 A;  4D73 B;  4NMU A;  2BTO T;  3US3 A;  2C0G A;  3ZIJ A;  3IK9 A;  3RPN A;  3W6G A;  3C71 A;  4JBB A;  2C8U A;  3APQ A;  4NPB A;  2V1M A;  2B1L A;  1PGT A;  2L59 A;  5IM9 A;  2P0G A;  2YN1 A;  2FD3 A;  3QR6 A;  1B9X C;  4Q5N A;  2H0I A;  1TU7 A;  3VWW A;  1U88 A;  5IMC A;  1GTI A;  4OWY A;  3EMX A;  11GS A;  2ES7 A;  4YQV A;  2OE0 A;  3QD9 A;  4K7I A;  4HJ2 A;  2AUV A;  2H01 A;  2WZ9 A;  1FHE A;  4OFN A;  4XTS A;  1XVW A;  4V2M A;  1A8L A;  4ISD A;  2WRT A;  1X9W B;  3FR6 A;  4KX4 A;  4ULX A;  2PPT A;  2IMF A;  1V9W A;  1SYR A;  4LMW A;  2RM6 A;  4NWY A;  3WT2 A;  3GL5 A;  4ID0 A;  4PX1 A;  1A2J A;  2HT9 A;  2K8S A;  1DE2 A;  4N10 A;  4J2F A;  2KP1 A;  2YAN A;  1K0N A;  2E2M A;  1VF2 A;  4XS6 A;  2O7K A;  1PQN A;  4MDC A;  3RDW A;  2X8C A;  3RHC A;  1ZL9 A;  2GZP A;  3D4T A;  4LLR A;  2PBJ A;  5ECS A;  4JED A;  2I4A A;  2WCI A;  1WIK A;  22GS A;  3KH7 A;  4JRR A;  3QAV A;  2NDO A;  3EMP A;  1AQV A;  5CRE A;  2QGV A;  5L71 A;  4JZQ A;  2H30 A;  2V2G A;  4L8E A;  1ST9 A;  3D6I A;  4V2N A;  1O85 A;  4TOP A;  1X0R A;  1ZZY A;  4RQR A;  3CRT A;  5G31 A;  1ERT A;  2VLU A;  4KH7 A;  2C3T A;  4MH3 A;  1OC3 A;  4ECI A;  4BWQ A;  1M2B A;  1V2A A;  1PN9 A;  3LSZ A;  3ZTL A;  1JFU A;  2GT6 A;  2AJQ B;  5G30 A;  5H5R A;  1K0D A;  4ZXG A;  2GSR A;  1SK1 A;  1ABA A;  4IS0 A;  2EIQ A;  1UVZ A;  3DEX A;  4F9Z A;  4POB A;  5G5F A;  2DJJ A;  2FCH A;  2WDU A;  3D22 A;  2F9S A;  2FNO A;  5A4V A;  4PNG A;  2LNS A;  4PQ1 A;  2I1U A;  2H73 A;  5ECQ B;  2F8F A;  2HI7 A;  5D93 A;  1GSD A;  4MP4 A;  3WT1 A;  3BCI A;  2HE3 A;  3D21 A;  2AV4 A;  4GQC A;  2AYT A;  1USB A;  3GYK A;  1XVQ A;  1GUM A;  1SJ6 A;  4OCE A;  4LA1 A;  3UAP A;  5AIS A;  3FZ9 A;  1SL1 B;  2ON7 A;  5KN0 A;  3CRU A;  1C72 A;  3G7I A;  4X1U A;  1EGR A;  5A4W A;  3UL3 A;  1NSW A;  1SD9 A;  5FHI A;  3WGX A;  4HEA 2;  1IYI A;  2DML A;  4WF5 A;  2GGT A;  3FR9 A;  3TKS E;  2I81 A;  5FT3 A;  2IPA A;  4FO5 A;  3UIW A;  2B6M A;  3VFI A;  3H93 A;  2MMZ A;  4ZB8 A;  1A0R P;  4FYU A;  3IV4 A;  5DDL A;  1BX9 A;  6GST A;  4V1A p;  1JZW A;  2WJU A;  1GSF A;  2MBT A;  1V40 A;  3SWL A;  3GKK A;  5F07 A;  19GS A;  3QDN A;  5B7C A;  2TRC P;  4O92 A;  1X5E A;  4K7N A;  5A4U A;  4X43 A;  3UEM A;  1GNE A;  3TUE A;  2N5F A;  1A24 A;  2H76 A;  4RI6 A;  1XWA A;  1J9B A;  1WP0 A;  2HFD A;  3F6F A;  1SL0 B;  5F05 A;  4CW9 A;  4BL7 A;  3BOA A;  4MA9 A;  3ERG A;  2I9H A;  2MMN A;  6GSY A;  1OE7 A;  4EC0 A;  2MMA A;  4ML6 A;  1BAY A;  3JCM L;  1HNC A;  3VWU A;  2GT5 A;  3TKP A;  2O89 A;  4ECC A;  4KSO A;  4HU7 A;  2LS5 A;  2E7P A;  3TKR A;  3D4M A;  5IQY A;  5HFK A;  2L5O A;  1ZCP A;  1T4Z A;  2B1K A;  2I3Y A;  2A2R A;  3E3E A;  2GS3 A;  1QMV A;  1VF3 A;  2DIY A;  2LV3 A;  4QL9 A;  1RK4 A;  4MPF A;  2VAF A;  5DJM A;  3F3R A;  2CVB A;  4P3Y B;  4Q5Q A;  4KA0 A;  1GSS A;  1X5D A;  4G10 A;  2K18 A;  1T7P B;  1ERU A;  2PU9 C;  3UBL A;  5A5K A;  4KE3 A;  5AGY A;  4AJ6 A;  1E2Y A;  5ID2 A;  1BG5 A;  3KEB A;  2FA4 A;  1ZYQ B;  5E59 A;  3ZYW A;  5GAP D;  4GST A;  1I5G A;  1PRX A;  1SK2 A;  2C0D A;  3UMA A;  4HS1 A;  1JZD A;  4HOJ A;  5DCH A;  4IKH A;  3LYP A;  3KD0 A;  2B5X A;  1A23 A;  2J9H A;  2H1B A;  4XCS A;  2VL2 A;  2H0G A;  4ZB6 A;  4EXJ A;  2VCW A;  1AQW A;  5AIX A;  3PR8 A;  3LXZ A;  2JZR A;  2Z9S A;  1M9B A;  3EYT A;  4POL A;  1A8Y A;  1YEX A;  1GSE A;  1S3C A;  2CQ9 A;  3EC3 A;  2K8V A;  3DRN A;  1Y6E A;  4GSS A;  3NZN A;  3M0F A;  3W8J A;  2DJ3 A;  5CRG A;  4ML1 A;  3WYW A;  3GN3 A;  3HZ8 A;  3PGT A;  1R4W A;  3L9S A;  4MJC A;  3IE3 A;  4OFT A;  5KEJ A;  5EL8 A;  4YQM A;  5DQS A;  2LST A;  4HDE A;  5ID2 B;  4ZL7 A;  1A2L A;  2CAQ A;  4MF5 A;  3GX8 A;  2AHE A;  1PKW A;  2WFC A;  2JSZ A;  4KCE A;  1SYX A;  2VL2 C;  1XFL A;  4BVY A;  2CAI A;  3GRX A;  2HLS A;  5IMD A;  1GWC A;  3L0H A;  2F8A A;  1HNA A;  1SK0 A;  1VGL A;  1A2M A;  3TRX A;  4K1F A;  4BPY A;  3HY2 A;  4JR6 A;  2FWE A;  4WKW A;  1H4O A;  1OAZ A;  1PX6 A;  3BCK A;  3KTL A;  1B4Q A;  3IRA A;  2RUE A;  20GS A;  2V6K A;  3Q74 A;  16GS A;  1QK8 A;  3KP8 A;  3A3T A;  3NIV A;  5B8A A;  2HZE A;  1M7T A;  1XZO A;  4GXZ A;  1G0T A;  1E6B A;  4I8B A;  3LWA A;  1HNB A;  1MDK A;  4FIW A;  2ZNM A;  2KLX A;  3FW2 A;  2GTU A;  1XWB A;  1Z6N A;  2PN8 A;  4TXO B;  2G0F A;  3L78 A;  5G2Z A;  3EVI A;  1GUK A;  2A4V A;  1TRV A;  1B48 A;  3KJY A;  4ECB A;  1M9A A;  1Z7R A;  3F0I A;  3ZIT A;  1TW9 A;  2O87 A;  1ERW A;  4IW9 A;  5J9C A;  1PL2 A;  3RHB A;  2L57 A;  1EV9 A;  1F9M A;  1M2D A;  5GST A;  4EUY A;  4ZL9 A;  1FB6 A;  4AF2 A;  1TI3 A;  2M46 A;  3CBU A;  4F82 A;  1THO A;  5HQP A;  2GZZ A;  3UOM A;  5KN2 A;  2H66 A;  1SKS B;  2CX4 A;  5HFG A;  4F0C A;  2HZE B;  2HRF A;  4KB3 A;  3IC4 A;  3VPQ A;  4XHM A;  2XPE A;  1U3A A;  3IAM 2;  1GUL A;  1OKD A;  3KCM A;  1QFN A;  4N0V A;  5IMZ A;  1TDI A;  1CQG A;  5KN1 A;  5IMA A;  1QUW A;  1YJ6 A;  1FVJ A;  4TR4 A;  2ALB A;  3TJJ A;  3WD6 A;  2NPB A;  2IMK A;  3E0U A;  2FHE A;  3ZFL A;  3GH9 A;  2LJR A;  1HQO A;  4MPG A;  2LQQ A;  1QXH A;  2AAW A;  4YH2 A;  3UVH A;  2VD0 A;  3QAG A;  3ZIV A;  1MD4 A;  1YY7 A;  3EIN A;  4POK A;  5ENU A;  2LEG A;  4K2D A;  2DJ2 A;  3I9V 2;  4TR3 A;  1S3D A;  3F8U A;  2QKE A;  3HDC A;  4ZBD A;  3CSH A;  1XXU A;  4L5O A;  3F6D A;  1K3Y A;  3GIX A;  6GSX A;  2B5Y A;  4KW6 A;  1O8W A;  4HZ4 A;  3VI7 A;  1NHY A;  2LRN A;  3QPM A;  4FYB A;  3N5O A;  2CZ2 A;  1KEB A;  5DJL A;  1FO5 A;  1XWC A;  2FY6 A;  3RAZ A;  5ECN B;  1G6W A;  2H6Y A;  2EIR A;  1WRY A;  1R26 A;  4K0G A;  1AAZ A;  4MZC A;  7GSS A;  3V1W A;  4TVE A;  2R5G A;  2H70 A;  1O6J A;  3FEU A;  2JZS A;  3HHV A;  2VL3 A;  4LMV A;  1XPV A;  2VLV A;  1DE1 A;  1W4V A;  5CRW A;  1EOG A;  3LYK A;  1HYU A;  5IO0 A;  5H5S A;  3F4S A;  4G2E A;  2X99 A;  5HR1 A;  2YWO A;  2FWH A;  3DIE A;  4KCA A;  1OYJ A;  1FB0 A;  4IP6 A;  1J08 A;  3GNJ A;  5ECI B;  2C80 A;  2JAD A;  1OKT A;  2CV4 A;  1GTB A;  2E0Q A;  5KN3 A;  3C73 A;  5IMF A;  3C1S A;  4POM A;  4PQH A;  4LL1 B;  5EVO A;  4PUF C;  3M3M A;  5CP1 A;  2VCQ A;  2IMD A;  4MAB A;  3G9B A;  3VK9 A;  5J4U A;  1MDI A;  2VOC A;  3BJ5 A;  1KTE A;  2K9F A;  3M8N A;  4HU9 A;  2MMO A;  4I5Q A;  1AQX A;  4ZIL A;  3FZ4 A;  5G1K A;  3HD5 A;  1XW5 A;  4QQ7 A;  4MF6 A;  3DML A;  4TR1 A;  1B8X A;  3EU4 A;  5IIZ A;  1TK8 B;  4XRA A;  3VI5 A;  4OFM A;  4EL1 A;  3M9J A;  3F4R A;  4YQU A;  3CTF A;  5DVB A;  5ECL B;  2N5B A;  4MCU A;  1U87 A;  3RPP A;  2TRX A;  5DQY A;  1JZO A;  3HVS A;  4MJB A;  1WOU A;  3CSI A;  3P2A A;  4XIH A;  3GL3 A;  1AC1 A;  4ZBB A;  4NHZ A;  3CYN A;  4HQS A;  3MSZ A;  5HFI A;  3LG6 A;  1BED A;  2XPD A;  2GVP A;  2GZY A;  4RUV A;  3C7M A;  1T3B A;  2R3X A;  2H6Z A;  3HYP A;  5ECR B;  1QQ2 A;  4KDU A;  4HUA A;  2VCT A;  1BYE A;  1ERV A;  1ILO A;  3VWX A;  2H6X A;  5J5N A;  5CO3 A;  3ME7 A;  4GF0 A;  4MLY A;  3TRP A;  2FWG A;  1T1V A;  5J41 A;  5F06 A;  1F6M C;  4AGS A;  5JCU A;  1ZMA A;  1YQ1 A;  4GSN A;  4KDY A;  2DIZ A;  4TR1 B;  2OE1 A;  3ZL5 A;  4XS1 A;  5F8B A;  1YF1 A;  5ABR A;  2P31 A;  2GSS A;  2N5A A;  4MZB A;  1PX7 A;  1K3O A;  1WE0 A;  2KUC A;  3ZRD A;  2F3M A;  1NHO A;  3UBK A;  2R37 A;  1LBK A;  1TJD A;  2FUG 2;  4E8H A;  2E2G A;  1OC9 B;  2L4C A;  2C0E A;  4IQ1 A;  2H71 A;  3DGQ A;  4KAE A;  17GS A;  3GKN A;  4PQI A;  4RQX A;  1EZK A;  2J23 A;  4YAV A;  2IN3 A;  4J56 E;  1WWJ A;  3TCO A;  2RUF A;  2H0H A;  1LJR A;  1Q4J A;  2YWI A;  1TRW A;  1NW2 A;  4TKY A;  2X8G A;  4TR0 A;  1SL2 B;  3I43 A;  1K0A A;  2A2S A;  3G7J A;  1Z6M A;  3O3T A;  3D0Z A;  3FKF A;  4G9H A;  3P8W A;  1JLW A;  4BVX A;  3L9U A;  4OO4 A;  3I6A A;  2RM5 A;  1XWG A;  2ZCT A;  3TJG A;  3ZRE A;  1RQM A;  4KUN A;  5D9W A;  5LCZ A;  5DAL A;  3A2W A;  2CT6 A;  3P7X A;  2HRN A;  3P90 A;  3GUS A;  1SEN A;  4L5L A;  4WET A;  2JSY A;  3TKS A;  1QGV A;  3KH9 A;  3IA1 A;  1FOV A;  1ACV A;  1CQH A;  1HD2 A;  4ZBA A;  4MJA A;  3ME8 A;  4N11 A;  2YCD A;  2F51 A;  3HJM A;  2H72 A;  3DWV A;  3S9F A;  1WJK A;  2IIY A;  2RII A;  2IJY A;  1I9D A;  5B8B A;  3KTB A;  14GS A;  4F03 A;  1PSQ A;  2CA8 A;  1B9Y C;  3LEF A;  4K8M A;  5DCG A;  3QMX A;  5C00 A;  2PGT A;  4EVM A;  1N2A A;  4TXO A;  1TRS A;  3A5W A;  2WGR A;  3ZLP A;  5CAX A;  3FZ5 A;  2NTO A;  3HA9 A;  3FR3 A;  4IP1 A;  1R5A A;  4HI7 A;  5DAK A;  3TB2 A;  2GQL A;  3TKS C;  2VM1 A;  2MZC A;  2DJ1 A;  2YOI A;  2VIM A;  1SU9 A;  5DAL B;  4QL7 A;  3VUR A;  2VCX A;  13GS A;  3PIN A;  1GLP A;  1IYH A;  3ED3 A;  4GWR A;  2GSQ A;  2IMI A;  4K0N A;  2ON5 A;  4NHW A;  5JWQ B;  4DSS A;  1TXX A;  2MBS A;  5HR3 A;  2DLX A;  4N0Z A;  3IHQ A;  1FAA A;  6GSU A;  2C3N A;  1GUH A;  4NV2 A;  5ECO B;  1W89 A;  4EO3 A;  4TRX A;  2X64 A;  1T00 A;  4O32 A;  3RBT A;  4K7O A;  4WF4 A;  1F3B A;  5B6N A;  3CTG A;  4KGI A;  3DVX A;  2LQO A;  5ECM B;  3CMI A;  2YZU A;  3TGZ A;  3DKS A;  1O7U A;  3H1N A;  3LOR A;  4XS4 A;  1KBN A;  2OBI A;  5ECP B;  3L9V A;  3F63 A;  2EIO A;  5DAK B;  2P5Q A;  1XCC A;  2XHF A;  2H1G A;  1K0C A;  3U6V A;  3IK7 A;  2C4J A;  2MYG A;  4N30 A;  2C3Q A;  5LNK e;  3GA4 A;  5DBQ A;  3TRQ A;  2DBC A;  3PH9 A;  1J0F A;  1UC7 A;  2PUK C;  1OE8 A;  1TTZ A;  2LUS A;  1XW6 A;  5INY A;  4OO5 A;  1XOB A;  2OE3 A;  1VF1 A;  4J57 E;  1AUC A;  2H74 A;  2BJX A;  2AB6 A;  5AIV A;  4DSS B;  18GS A;  4F2I A;  1ON4 A;  2OBK A;  3N9J A;  1AIU A;  2LRC A;  3MAK A;  3K8N A;  3IXR A;  2HSH A;  4NAX A;  5IO2 A;  2CVD A;  3QAW A;  1G7O A;  2YJ7 A;  3CXG A;  1GSY A;  3F9U A;  1ML6 A;  4G19 A;  3IPZ A;  4K9Z A;  3EE2 A;  2O8V B;  5GAN D;  4XS4 B;  1R5P A;  1TRU A;  2DJK A;  2REM A;  5F0G A;  2VM2 A;  4I97 A;  4IHU A;  4MZW A;  1YEP A;  3U5R E;  5IOX A;  3KZQ A;  2CVK A;  4HQZ A;  1V58 A;  1F3A A;  2KHP A;  3LXT A;  3GH6 A;  1EGO A;  1Q98 A;  3Q18 A;  4EDZ A;  1YKA A;  3F3Q A;  3IBH A;  2B3S A;  3MDK A;  2B7K A;  1ZOF A;  2H75 A;  4WXT A;  3ERF A;  4HZ2 A;  4Q5R A;  1EP7 A;  1K0M A;  1K0O A;  3CSJ A;  1XBS A;  2L6D A;  4V1A g;  4MK3 A;  3TJF A;  3HKR A;  3GFK A;  4JE1 A;  4OCF A;  1B4P A;  2FLS A;  5B6M A;  1GTA A;  1F37 A;  3J7Y b;  1N8J A;  3GTU A;  4L0W A;  1OC8 A;  3G7Y A;  4ECJ A;  1O8X A;  5G5E A;  3L4N A;  4F0B A;  4IVF A;  5CRD A;  1MTC A;  1BJX A;  1XIY A;  2R2J A;  4WR4 A;  3ZML A;  1V57 A;  3GV1 A;  2GST A;  3Q19 A;  1DBY A;  3AY8 A;  5IOW A;  4AJ7 A;  5HR0 A;  3HXS A;  3IAS 2;  1SKW B;  3KMO A;  2H8L A;  2YJH A;  4IJI A;  3I69 A;  3J7Y k;  5D9X A;  1NM3 A;  3QOU A;  2LRT A;  2WS2 A;  3IR4 A;  4TXV A;  3APO A;  1MDJ A;  4IGJ A;  5HR2 A;  4OD7 A;  2YV9 A;  3FYG A;  5D96 A;  3R2Q A;  1EEJ A;  1PD2 1;  2PVO C;  3TKQ A;  3HJP A;  3ISO A;  2K6V A;  3GTU B;  3LFL A;  1Z9H A;  3LGC A;  5D73 A;  3W8S A;  4JU5 A;  2HZF A;  3DXB A;  2FWF A;  3VLN A;  2V6O A;  5CYY A;  1TK5 B;  1SJI A;  4FYC A;  2IWT A;  3UJ1 A;  3NOF A;  3GKX A;  1X9S B;  2PMT A;  3M1G A;  2KOK A;  3ERW A;  2QC7 A;  3BD2 A;  4RI7 A;  5ELA A;  4I2T A;  2PER A;  3MWH A;  1BQ7 A;  4MH2 A;  4TN8 A;  1AW9 A;  1Y25 A;  2X8H A;  4HJM A;  1GL8 A;  3D5J A;  3C1R A;  2V41 A;  3GX0 A;  4WEY A;  2JL4 A;  1EWX A;  1Z7P A;  4MMM A;  2OJL A;  3QCP A;  3WGD A;  3HVV A;  3ZVJ D;  3FZA A;  4PUA A;  2CZ3 A;  3DYR A;  1MD3 A;  1AXD A;  1XWK A;  1OC9 A;  4WBR D;  4NXI A;  3DVW A;  1MEK A;  5C04 A;  1FW1 A;  1TKD B;  5AN1 A;  3HZ4 A;  2ZUP A;  4AJ8 A;  2P5R A;  2D2Z A;  1WPI A;  3A2X A;  4WBJ A;  3GST A;  5IPG A;  1XW9 A;  1Z3E A;  3IOS A;  4KSM A;  2HSY A;  3MNG A;  1UN2 A;  2DJ0 A;  2YZH A;  2V32 A;  9GSS A;  3O6T A;  2B7J A;  1X9M B;  5ELG A;  4L0U A;  2FGX A;  5JCG A;  2DC5 A;  3QFA C;  4NV5 A;  3TOT A;  1F2E A;  1U3I A;  2NVL A;  2VLT A;  3GSS A;  4ZB9 A;  3GHA A;  3FY7 A;  4BA7 A;  2YP6 A;  2VL9 A;  4DSR A;  2HNL A;  2LKU A;  1ZGN A;  1M2A A;  5GSS A;  5JCW A;  1V98 A;  2LJA A;  3O76 A;  5J9B A;  4DSQ A;  1LU4 A;  5EPF A;  4GQF A;  3SBC A;  4EDY A;  1OVN A;  4EKZ A;  1GTU A;  3KP9 A;  3WGE A;  3LJR A;  4I6X A;  6GSS A;  1KNG A;  3HCZ A;  2FA8 A;  1YDK A;  1YZX A;  3HVX A;  2KP2 A;  3H79 A;  3FHK A;  1PA3 A;  2JU5 A;  4EF0 A;  2DSA A;  4WR5 A;  1TI1 A;  2H1A A;  1GLQ A;  5JWO B;  1YKC A;  3EWL A;  2O85 A;  2GLR A;  3E9J B;  1PKZ A;  2GDR A;  2GQM A;  4X0X A;  1A0F A;  3H4K A;  1EOH A;  3HJO A;  1GRX A;  2L6C A;  1THX A;  5D8I A;  3C8E A;  5H5Q A;  4CHS A;  8GSS A;  1TP9 A;  2VCZ A;  4PGT A;  2DMM A;  4ILF A;  1UA5 A;  4O7H A;  5J3R A;  2VD1 A;  2LTK A;  4O5R A;  4KDX A;  2YWN A;  2VCV A; 
#chains in the Genus database with same CATH topology
 4ZIJ A;  4BWS A;  3FK8 A;  4Q5F A;  4YAP A;  1EP8 A;  4IJ3 A;  3KGK A;  2RLI A;  4ZL8 A;  5D9V A;  1U6T A;  3KMN A;  4PNF A;  3OR5 A;  2G2Q A;  2BMX A;  3VWV A;  2OKA A;  1T4Y A;  5E4W A;  1DUG A;  1RW1 A;  5FWG A;  3H8Q A;  2HXK A;  3ZVJ A;  4XRD A;  1Z5Y E;  4CDO A;  2VUP A;  1FG4 A;  5GZZ B;  3TOU A;  1M0U A;  3DD3 A;  4FH8 A;  5CRH A;  5ECH B;  3GMF A;  4K6X A;  4JR4 A;  2L5L A;  1G6Y A;  2L4Q A;  2PVQ A;  1K0B A;  4GRF A;  4EIQ A;  2OAD A;  1JHB A;  2WUL A;  1WMJ A;  2H19 A;  2YWM A;  3A2V A;  4MNN A;  2OA7 A;  1ZYE A;  4EE0 A;  4MJE A;  2IME A;  2IFQ A;  4PXO A;  2YNX A;  5CNW A;  5COH A;  3ZMK A;  2B5E A;  4GTU A;  4IN0 A;  1TK0 B;  4I2U A;  1K3L A;  4IEL A;  3EUR A;  1M99 A;  4PUR A;  1YF0 A;  2LNT A;  2PWJ A;  12GS A;  3GUR A;  2YPM A;  3UVT A;  1EV4 A;  1T8E B;  5JWR B;  1PMT A;  3GKM A;  2H1D A;  4IQA A;  1TOF A;  1XOA A;  1VRS D;  2YV7 A;  4IBP A;  2CX3 A;  4GLT A;  4A5P A;  4LL4 B;  4CY8 A;  3UAR A;  2M80 A;  1H75 A;  2HYX A;  1GSQ A;  2GQK A;  3IDV A;  2JAC A;  3ZZX A;  3KM6 A;  3FRC A;  1PL1 A;  5EY6 A;  1JLV A;  2OAC A;  4E8E A;  3VPT A;  2WB9 A;  5D9T A;  4TW5 A;  1DSB A;  4GCI A;  1JZR A;  3BBY A;  4EIP A;  1SKR B;  3M9K A;  10GS A;  1GH2 A;  2R4V A;  3PPU A;  4D73 A;  3TJB A;  1GNW A;  1SJZ A;  2EC4 A;  2XBQ A;  3APS A;  1O73 A;  5IPH A;  6GSV A;  2R6K A;  3EU3 A;  2LJK A;  4DVC A;  3KXO A;  1TU8 A;  3Q6O A;  3LQ7 A;  2VO4 A;  5G1L A;  2IFQ B;  2NBS A;  4MF7 A;  1EEM A;  6GSW A;  3F4T A;  4ACS A;  1URM A;  1GSU A;  2M72 A;  1SD8 A;  5LD0 A;  4Z7X A;  3ZFB A;  2TIR A;  3TJK A;  1G7E A;  2C0F A;  2XC2 A;  4H86 A;  2IL3 A;  3KIJ A;  1FVK A;  2C1Y A;  5IMV A;  5ECK B;  1S3A A;  4OMV A;  1R7H A;  4USS A;  4CY6 A;  4DEJ A;  2JZT A;  2XBI A;  1GP1 A;  3MIX A;  3QFB C;  2QSI A;  1M3J A;  1VF4 A;  3TDG A;  1X5C A;  4KND A;  4V2L A;  1O81 A;  4D73 B;  4NMU A;  2BTO T;  3US3 A;  2C0G A;  3ZIJ A;  3IK9 A;  3RPN A;  3W6G A;  3C71 A;  4JBB A;  2C8U A;  3APQ A;  4NPB A;  2V1M A;  2B1L A;  1PGT A;  2L59 A;  5IM9 A;  2P0G A;  2YN1 A;  2FD3 A;  3QR6 A;  1B9X C;  4Q5N A;  2H0I A;  1TU7 A;  3VWW A;  1U88 A;  5IMC A;  1GTI A;  4OWY A;  3EMX A;  11GS A;  2ES7 A;  4YQV A;  2OE0 A;  3QD9 A;  4K7I A;  4HJ2 A;  2AUV A;  2H01 A;  2WZ9 A;  1FHE A;  4OFN A;  4XTS A;  4V2M A;  1XVW A;  1A8L A;  4ISD A;  2WRT A;  1X9W B;  3FR6 A;  2HSM A;  4KX4 A;  4ULX A;  2PPT A;  2IMF A;  1V9W A;  1SYR A;  4LMW A;  2RM6 A;  4NWY A;  3WT2 A;  3GL5 A;  4ID0 A;  4YKF A;  4PX1 A;  1A2J A;  2HT9 A;  2K8S A;  1DE2 A;  2DKH A;  4N10 A;  4J2F A;  2KP1 A;  2YAN A;  1K0N A;  2E2M A;  1VF2 A;  4XS6 A;  2O7K A;  1PQN A;  4MDC A;  3RDW A;  2X8C A;  3RHC A;  1ZL9 A;  2GZP A;  3D4T A;  4LLR A;  2PBJ A;  5ECS A;  4JED A;  2I4A A;  2WCI A;  1WIK A;  22GS A;  3KH7 A;  4JRR A;  3QAV A;  2NDO A;  3EMP A;  1AQV A;  5CRE A;  2QGV A;  5L71 A;  4JZQ A;  2H30 A;  2V2G A;  4L8E A;  1ST9 A;  3D6I A;  4V2N A;  1O85 A;  4TOP A;  1M3I A;  1X0R A;  1ZZY A;  4RQR A;  3CRT A;  5G31 A;  1ERT A;  2VLU A;  4KH7 A;  2C3T A;  4MH3 A;  1OC3 A;  4ECI A;  4BWQ A;  1M2B A;  1V2A A;  1PN9 A;  3LSZ A;  3ZTL A;  1JFU A;  2GT6 A;  2AJQ B;  5G30 A;  5H5R A;  1K0D A;  4ZXG A;  2GSR A;  1SK1 A;  1ABA A;  4IS0 A;  2EIQ A;  1UVZ A;  3DEX A;  4F9Z A;  4POB A;  5G5F A;  2DJJ A;  2FCH A;  2WDU A;  3D22 A;  2F9S A;  2FNO A;  5A4V A;  4PNG A;  2LNS A;  4PQ1 A;  2I1U A;  2H73 A;  5ECQ B;  2F8F A;  2HI7 A;  2X4A A;  5D93 A;  1GSD A;  4MP4 A;  3WT1 A;  3BCI A;  2HE3 A;  3D21 A;  2AV4 A;  4GQC A;  2AYT A;  1USB A;  3GYK A;  1XVQ A;  1GUM A;  1SJ6 A;  4OCE A;  4LA1 A;  3UAP A;  5AIS A;  3FZ9 A;  1SL1 B;  2ON7 A;  5KN0 A;  3CRU A;  1C72 A;  3G7I A;  4X1U A;  1EGR A;  5A4W A;  3UL3 A;  1NSW A;  1SD9 A;  5FHI A;  3WGX A;  4HEA 2;  1IYI A;  2DML A;  4WF5 A;  2GGT A;  3FR9 A;  3TKS E;  2I81 A;  5FT3 A;  2IPA A;  4FO5 A;  3UIW A;  2B6M A;  3VFI A;  3H93 A;  2MMZ A;  4ZB8 A;  1A0R P;  4FYU A;  3IV4 A;  5DDL A;  1BX9 A;  6GST A;  4V1A p;  1JZW A;  2WJU A;  1GSF A;  2MBT A;  1V40 A;  3SWL A;  3GKK A;  5F07 A;  19GS A;  3QDN A;  5B7C A;  2TRC P;  4O92 A;  1X5E A;  4K7N A;  5A4U A;  4X43 A;  3UEM A;  1GNE A;  3TUE A;  2N5F A;  1A24 A;  1PFO A;  2H76 A;  4RI6 A;  1XWA A;  1J9B A;  1WP0 A;  2HFD A;  3F6F A;  1SL0 B;  5F05 A;  4CW9 A;  4BL7 A;  3BOA A;  4MA9 A;  3ERG A;  2I9H A;  2MMN A;  6GSY A;  1OE7 A;  4EC0 A;  2MMA A;  4ML6 A;  1BAY A;  3JCM L;  1HNC A;  3VWU A;  2GT5 A;  3TKP A;  2O89 A;  4ECC A;  4KSO A;  4HU7 A;  2LS5 A;  2E7P A;  3TKR A;  3D4M A;  5IQY A;  5HFK A;  2L5O A;  1ZCP A;  1T4Z A;  2B1K A;  2I3Y A;  2A2R A;  3E3E A;  2GS3 A;  1QMV A;  1VF3 A;  2DIY A;  2LV3 A;  4QL9 A;  1RK4 A;  4MPF A;  2VAF A;  5DJM A;  3F3R A;  2CVB A;  4P3Y B;  4Q5Q A;  4KA0 A;  1GSS A;  1X5D A;  4G10 A;  2K18 A;  1T7P B;  1ERU A;  2PU9 C;  3UBL A;  5A5K A;  4KE3 A;  5AGY A;  4AJ6 A;  1E2Y A;  5ID2 A;  1BG5 A;  3KEB A;  2FA4 A;  1ZYQ B;  5E59 A;  3ZYW A;  5GAP D;  4GST A;  1I5G A;  1PRX A;  4BL7 B;  1SK2 A;  2C0D A;  3UMA A;  4HS1 A;  1JZD A;  4HOJ A;  5DCH A;  4IKH A;  3LYP A;  3KD0 A;  2B5X A;  1A23 A;  2J9H A;  2H1B A;  4XCS A;  2VL2 A;  2H0G A;  4ZB6 A;  4EXJ A;  2VCW A;  1AQW A;  5AIX A;  3PR8 A;  2R0C A;  3LXZ A;  2JZR A;  2Z9S A;  1M9B A;  3EYT A;  4POL A;  1A8Y A;  1YEX A;  1GSE A;  1S3C A;  2CQ9 A;  3EC3 A;  2K8V A;  3DRN A;  1Y6E A;  4GSS A;  3NZN A;  3M0F A;  3W8J A;  2DJ3 A;  5CRG A;  4ML1 A;  3WYW A;  3GN3 A;  3HZ8 A;  1ZYP A;  3PGT A;  1R4W A;  3L9S A;  4MJC A;  3IE3 A;  4OFT A;  5KEJ A;  5EL8 A;  4YQM A;  5DQS A;  2LST A;  4HDE A;  5ID2 B;  4ZL7 A;  1A2L A;  2CAQ A;  4MF5 A;  3GX8 A;  2AHE A;  1PKW A;  2WFC A;  2JSZ A;  4KCE A;  1SYX A;  2VL2 C;  1XFL A;  4BVY A;  2CAI A;  3GRX A;  2HLS A;  5IMD A;  1GWC A;  3L0H A;  2F8A A;  1HNA A;  1SK0 A;  1VGL A;  1A2M A;  3TRX A;  4K1F A;  4BPY A;  3HY2 A;  3IHG A;  4JR6 A;  2FWE A;  4WKW A;  1H4O A;  1OAZ A;  1PX6 A;  3BCK A;  3KTL A;  1B4Q A;  3IRA A;  2RUE A;  20GS A;  2V6K A;  3Q74 A;  16GS A;  1QK8 A;  3KP8 A;  3A3T A;  4O5U A;  2X49 A;  3NIV A;  5B8A A;  2R0P A;  2HZE A;  1M7T A;  1XZO A;  4GXZ A;  1G0T A;  1E6B A;  4I8B A;  3LWA A;  1HNB A;  1MDK A;  4FIW A;  2ZNM A;  2KLX A;  3FW2 A;  2GTU A;  1XWB A;  1Z6N A;  2PN8 A;  4TXO B;  2G0F A;  3L78 A;  5G2Z A;  3EVI A;  1GUK A;  2A4V A;  1TRV A;  1B48 A;  3KJY A;  4ECB A;  1M9A A;  1Z7R A;  3F0I A;  3ZIT A;  1TW9 A;  2O87 A;  1ERW A;  4IW9 A;  5J9C A;  1PL2 A;  3RHB A;  2L57 A;  1EV9 A;  4BVY B;  1F9M A;  1M2D A;  5GST A;  4EUY A;  4ZL9 A;  1FB6 A;  4AF2 A;  1TI3 A;  2M46 A;  3CBU A;  4F82 A;  1THO A;  5HQP A;  5BMU A;  2GZZ A;  3UOM A;  5KN2 A;  2H66 A;  1SKS B;  2CX4 A;  5HFG A;  4F0C A;  2HZE B;  2HRF A;  4KB3 A;  3IC4 A;  3VPQ A;  4XHM A;  2XPE A;  1U3A A;  3EPT A;  3IAM 2;  1GUL A;  1OKD A;  3KCM A;  1QFN A;  4N0V A;  5IMZ A;  1TDI A;  1CQG A;  5KN1 A;  5IMA A;  1QUW A;  1YJ6 A;  1FVJ A;  1FOH A;  4TR4 A;  2ALB A;  4K5R A;  3TJJ A;  3WD6 A;  2NPB A;  2IMK A;  3E0U A;  2FHE A;  3ZFL A;  3GH9 A;  2LJR A;  1HQO A;  4MPG A;  5KOX A;  2LQQ A;  1QXH A;  2AAW A;  4YH2 A;  3UVH A;  2VD0 A;  3QAG A;  3ZIV A;  1MD4 A;  1YY7 A;  4Z2R A;  3EIN A;  4POK A;  5ENU A;  2LEG A;  4K2D A;  2DJ2 A;  3I9V 2;  2QA1 A;  4TR3 A;  1S3D A;  3F8U A;  2QKE A;  3HDC A;  4ZBD A;  3CSH A;  1XXU A;  4L5O A;  3F6D A;  1K3Y A;  3GIX A;  6GSX A;  2B5Y A;  4KW6 A;  1O8W A;  4HZ4 A;  3VI7 A;  1NHY A;  2LRN A;  3QPM A;  4FYB A;  3N5O A;  2CZ2 A;  1KEB A;  5DJL A;  1FO5 A;  1XWC A;  2FY6 A;  3RAZ A;  5ECN B;  1G6W A;  2H6Y A;  2EIR A;  1WRY A;  1R26 A;  4K0G A;  1AAZ A;  4MZC A;  7GSS A;  3V1W A;  4TVE A;  2R5G A;  3R3E A;  2H70 A;  1O6J A;  3FEU A;  2JZS A;  3HHV A;  2VL3 A;  4LMV A;  1XPV A;  2VLV A;  1DE1 A;  1W4V A;  5CRW A;  1EOG A;  3LYK A;  1HYU A;  5IO0 A;  5H5S A;  3F4S A;  4G2E A;  2X99 A;  5HR1 A;  2YWO A;  2FWH A;  3DIE A;  4KCA A;  1OYJ A;  1FB0 A;  4IP6 A;  1J08 A;  3GNJ A;  5ECI B;  2C80 A;  2JAD A;  1OKT A;  2CV4 A;  1GTB A;  2E0Q A;  5KN3 A;  3C73 A;  5IMF A;  3C1S A;  4POM A;  4PQH A;  4LL1 B;  3LW9 A;  5EVO A;  4PUF C;  3M3M A;  5CP1 A;  2VCQ A;  2IMD A;  4MAB A;  3G9B A;  3VK9 A;  5J4U A;  1MDI A;  2VOC A;  3BJ5 A;  1KTE A;  2K9F A;  3M8N A;  4HU9 A;  2MMO A;  4I5Q A;  1AQX A;  4ZIL A;  3FZ4 A;  4BIK A;  5G1K A;  5KOW A;  3HD5 A;  1XW5 A;  4QQ7 A;  4MF6 A;  3DML A;  4TR1 A;  1B8X A;  3EU4 A;  5IIZ A;  1TK8 B;  4XRA A;  3VI5 A;  4OFM A;  4EL1 A;  3M9J A;  3F4R A;  4YQU A;  3CTF A;  5DVB A;  5ECL B;  2N5B A;  4MCU A;  1U87 A;  3RPP A;  2TRX A;  5DQY A;  1JZO A;  4O5Q A;  3HVS A;  4MJB A;  2R0G A;  1WOU A;  3CSI A;  3P2A A;  4XIH A;  3GL3 A;  1AC1 A;  4ZBB A;  4NHZ A;  4HSC X;  3CYN A;  4HQS A;  3MSZ A;  5HFI A;  3LG6 A;  1BED A;  2XPD A;  2GVP A;  2GZY A;  4RUV A;  3C7M A;  1T3B A;  2R3X A;  2H6Z A;  3HYP A;  5ECR B;  1QQ2 A;  4KDU A;  4HUA A;  2VCT A;  1BYE A;  1ERV A;  1ILO A;  3VWX A;  2H6X A;  5J5N A;  5CO3 A;  3ME7 A;  4GF0 A;  4MLY A;  3TRP A;  2FWG A;  1T1V A;  5J41 A;  5F06 A;  2A2P A;  1F6M C;  4AGS A;  5JCU A;  1ZMA A;  1YQ1 A;  4GSN A;  4KDY A;  2DIZ A;  4TR1 B;  2OE1 A;  2UZ8 A;  3ZL5 A;  4XS1 A;  5F8B A;  1YF1 A;  5ABR A;  2P31 A;  2GSS A;  2N5A A;  3MYD A;  4MZB A;  1PX7 A;  1ZYN A;  1K3O A;  4G0I A;  1WE0 A;  2KUC A;  3ZRD A;  2F3M A;  1NHO A;  3UBK A;  2R37 A;  1LBK A;  1TJD A;  2FUG 2;  4E8H A;  2E2G A;  1OC9 B;  2L4C A;  2C0E A;  4IQ1 A;  2H71 A;  3DGQ A;  4KAE A;  17GS A;  3GKN A;  4PQI A;  4RQX A;  1EZK A;  4PTS A;  2J23 A;  4YAV A;  2IN3 A;  4J56 E;  1WWJ A;  3TCO A;  2RUF A;  4K2X A;  2H0H A;  1LJR A;  1Q4J A;  2YWI A;  1TRW A;  3IC8 A;  1NW2 A;  4TKY A;  2X8G A;  4TR0 A;  1SL2 B;  3I43 A;  5BRT A;  1K0A A;  2A2S A;  3G7J A;  1Z6M A;  3O3T A;  3D0Z A;  3FKF A;  4G9H A;  3P8W A;  1JLW A;  4BVX A;  3L9U A;  4OO4 A;  3I6A A;  2RM5 A;  1XWG A;  2ZCT A;  3TJG A;  3ZRE A;  1RQM A;  4KUN A;  5D9W A;  5LCZ A;  5DAL A;  3A2W A;  2CT6 A;  3P7X A;  2HRN A;  3P90 A;  3GUS A;  1SEN A;  4Z2U A;  4L5L A;  4WET A;  2JSY A;  3TKS A;  1QGV A;  3KH9 A;  3IA1 A;  1FOV A;  1ACV A;  1CQH A;  1HD2 A;  4ZBA A;  4MJA A;  3ME8 A;  4N11 A;  2YCD A;  2F51 A;  3HJM A;  2H72 A;  3DWV A;  3S9F A;  1WJK A;  2IIY A;  2RII A;  2IJY A;  1I9D A;  5B8B A;  3KTB A;  14GS A;  4F03 A;  1PSQ A;  2CA8 A;  2DKI A;  1B9Y C;  3LEF A;  4K8M A;  5DCG A;  4KF9 A;  3QMX A;  5C00 A;  2PGT A;  4EVM A;  1N2A A;  4TXO A;  1TRS A;  3A5W A;  2WGR A;  3ZLP A;  5CAX A;  3FZ5 A;  2NTO A;  3HA9 A;  3FR3 A;  4IP1 A;  1R5A A;  4HI7 A;  5DAK A;  4BVX B;  3TB2 A;  2GQL A;  3TKS C;  2VM1 A;  2MZC A;  2DJ1 A;  2YOI A;  2VIM A;  1SU9 A;  5DAL B;  4QL7 A;  3VUR A;  2VCX A;  13GS A;  1PN0 A;  3PIN A;  3HVN A;  1GLP A;  1IYH A;  3ED3 A;  4GWR A;  3A5I A;  2GSQ A;  2IMI A;  4K0N A;  2ON5 A;  4NHW A;  5JWQ B;  4DSS A;  1TXX A;  2MBS A;  5HR3 A;  2DLX A;  4N0Z A;  3IHQ A;  1FAA A;  6GSU A;  2C3N A;  1GUH A;  4NV2 A;  5ECO B;  1W89 A;  4EO3 A;  4TRX A;  2X64 A;  1T00 A;  4O32 A;  3RBT A;  4K7O A;  4WF4 A;  1F3B A;  5B6N A;  3CTG A;  4KGI A;  3DVX A;  2LQO A;  5ECM B;  3CMI A;  2YZU A;  3TGZ A;  3DKS A;  1O7U A;  3H1N A;  3LOR A;  4XS4 A;  1KBN A;  2OBI A;  5ECP B;  3L9V A;  3F63 A;  2EIO A;  5DAK B;  2P5Q A;  1XCC A;  2XHF A;  2H1G A;  1K0C A;  3U6V A;  3IK7 A;  2C4J A;  2MYG A;  4N30 A;  2C3Q A;  5LNK e;  3GA4 A;  5DBQ A;  3TRQ A;  2DBC A;  3PH9 A;  1J0F A;  1UC7 A;  2PUK C;  1OE8 A;  1TTZ A;  2LUS A;  1XW6 A;  5INY A;  4OO5 A;  1XOB A;  2OE3 A;  1VF1 A;  4J57 E;  1AUC A;  2H74 A;  2BJX A;  2AB6 A;  5AIV A;  4DSS B;  18GS A;  4F2I A;  1ON4 A;  2OBK A;  3N9J A;  1AIU A;  2LRC A;  3MAK A;  3K8N A;  3IXR A;  2HSH A;  4NAX A;  5IO2 A;  2CVD A;  3QAW A;  1G7O A;  2YJ7 A;  3CXG A;  1GSY A;  3F9U A;  1ML6 A;  4G19 A;  3IPZ A;  4K9Z A;  3EE2 A;  2O8V B;  5GAN D;  4XS4 B;  1R5P A;  1TRU A;  2DJK A;  2REM A;  5F0G A;  2VM2 A;  4I97 A;  4IHU A;  4MZW A;  1YEP A;  3U5R E;  5IOX A;  3KZQ A;  2CVK A;  4HQZ A;  1V58 A;  1F3A A;  2KHP A;  3LXT A;  3GH6 A;  1EGO A;  1Q98 A;  3Q18 A;  4EDZ A;  1YKA A;  3F3Q A;  3IBH A;  2B3S A;  3MDK A;  2B7K A;  1ZOF A;  2H75 A;  4WXT A;  3ERF A;  4HZ2 A;  4Q5R A;  1EP7 A;  1K0M A;  1K0O A;  3CSJ A;  1XBS A;  2L6D A;  4V1A g;  4MK3 A;  3TJF A;  3HKR A;  3GFK A;  4JE1 A;  4OCF A;  1B4P A;  2FLS A;  5B6M A;  1GTA A;  1F37 A;  3J7Y b;  1N8J A;  3GTU A;  4L0W A;  1OC8 A;  3G7Y A;  4ECJ A;  1O8X A;  5G5E A;  3L4N A;  4F0B A;  4IVF A;  5CRD A;  1MTC A;  3CQF A;  1BJX A;  1XIY A;  2R2J A;  4WR4 A;  2HRK A;  3ZML A;  1V57 A;  3GV1 A;  2GST A;  3Q19 A;  1DBY A;  3AY8 A;  5IOW A;  4AJ7 A;  5HR0 A;  3HXS A;  3IAS 2;  1SKW B;  3KMO A;  2H8L A;  2YJH A;  4IJI A;  3I69 A;  3J7Y k;  5D9X A;  4G0L A;  1NM3 A;  3QOU A;  2LRT A;  2WS2 A;  3IR4 A;  4TXV A;  3APO A;  1MDJ A;  4IGJ A;  5HR2 A;  4OD7 A;  2YV9 A;  3FYG A;  5D96 A;  3R2Q A;  1EEJ A;  1PD2 1;  2PVO C;  3TKQ A;  3HJP A;  3ISO A;  2K6V A;  3GTU B;  3LFL A;  1Z9H A;  3LGC A;  5D73 A;  3W8S A;  4JU5 A;  2HZF A;  3DXB A;  2FWF A;  3VLN A;  2V6O A;  5CYY A;  1TK5 B;  1SJI A;  4X4J A;  3FMW A;  2IWT A;  4FYC A;  3UJ1 A;  3NOF A;  3GKX A;  1X9S B;  2PMT A;  3M1G A;  2KOK A;  3ERW A;  2QC7 A;  3BD2 A;  4RI7 A;  5ELA A;  4I2T A;  2PER A;  3MWH A;  1BQ7 A;  4MH2 A;  4TN8 A;  1AW9 A;  1Y25 A;  2X8H A;  4HJM A;  1GL8 A;  3D5J A;  3C1R A;  2V41 A;  3GX0 A;  4WEY A;  2JL4 A;  1EWX A;  1Z7P A;  4MMM A;  2OJL A;  4K5S A;  3QCP A;  3WGD A;  3HVV A;  3ZVJ D;  3FZA A;  4PUA A;  2CZ3 A;  3DYR A;  1MD3 A;  4G0K A;  1AXD A;  1XWK A;  1OC9 A;  4WBR D;  4NXI A;  3DVW A;  1MEK A;  5C04 A;  1FW1 A;  1TKD B;  5AN1 A;  3HZ4 A;  2ZUP A;  4AJ8 A;  2P5R A;  2D2Z A;  1WPI A;  3A2X A;  4WBJ A;  3GST A;  5IPG A;  1XW9 A;  1Z3E A;  3IOS A;  4KSM A;  2HSY A;  3MNG A;  1UN2 A;  2DJ0 A;  2YZH A;  2V32 A;  9GSS A;  3O6T A;  2B7J A;  1X9M B;  5ELG A;  4L0U A;  2FGX A;  5JCG A;  2DC5 A;  3QFA C;  4NV5 A;  3TOT A;  1F2E A;  1U3I A;  2NVL A;  2VLT A;  2A4H A;  3GSS A;  4ZB9 A;  3GHA A;  3FY7 A;  4BA7 A;  2YP6 A;  2VL9 A;  4DSR A;  2HNL A;  2LKU A;  1ZGN A;  1M2A A;  5GSS A;  5JCW A;  1V98 A;  2LJA A;  3O76 A;  5J9B A;  1XG8 A;  4DSQ A;  1LU4 A;  5EPF A;  4GQF A;  3SBC A;  4EDY A;  1OVN A;  4EKZ A;  1GTU A;  4ICY A;  3KP9 A;  3WGE A;  3LJR A;  4I6X A;  6GSS A;  1KNG A;  3HCZ A;  4Z2T A;  2FA8 A;  1YDK A;  4YKG A;  1YZX A;  3HVX A;  2KP2 A;  3H79 A;  3FHK A;  1PA3 A;  2JU5 A;  4EF0 A;  2DSA A;  4WR5 A;  1TI1 A;  2H1A A;  1GLQ A;  5JWO B;  1YKC A;  3EWL A;  2O85 A;  2GLR A;  2HRA A;  2QA2 A;  3E9J B;  1PKZ A;  2GDR A;  2GQM A;  1S3R A;  4X0X A;  1A0F A;  3H4K A;  1EOH A;  3HJO A;  1GRX A;  2L6C A;  4FQU A;  1THX A;  5D8I A;  3C8E A;  5H5Q A;  4CHS A;  8GSS A;  1TP9 A;  2VCZ A;  4PGT A;  2DMM A;  4ILF A;  1UA5 A;  4O7H A;  5J3R A;  2VD1 A;  2LTK A;  4O5R A;  4KDX A;  2YWN A;  2VCV A; 
#chains in the Genus database with same CATH homology
 4ZIJ A;  4BWS A;  3FK8 A;  4Q5F A;  4YAP A;  1EP8 A;  4IJ3 A;  3KGK A;  2RLI A;  4ZL8 A;  5D9V A;  1U6T A;  3KMN A;  4PNF A;  3OR5 A;  2G2Q A;  2BMX A;  3VWV A;  2OKA A;  1T4Y A;  5E4W A;  1DUG A;  1RW1 A;  5FWG A;  3H8Q A;  2HXK A;  3ZVJ A;  4XRD A;  1Z5Y E;  4CDO A;  2VUP A;  1FG4 A;  5GZZ B;  3TOU A;  1M0U A;  3DD3 A;  4FH8 A;  5CRH A;  5ECH B;  3GMF A;  4K6X A;  4JR4 A;  2L5L A;  1G6Y A;  2L4Q A;  2PVQ A;  1K0B A;  4GRF A;  4EIQ A;  2OAD A;  1JHB A;  2WUL A;  1WMJ A;  2H19 A;  2YWM A;  3A2V A;  4MNN A;  2OA7 A;  1ZYE A;  4EE0 A;  4MJE A;  2IME A;  2IFQ A;  4PXO A;  2YNX A;  5CNW A;  5COH A;  3ZMK A;  2B5E A;  4GTU A;  4IN0 A;  1TK0 B;  4I2U A;  1K3L A;  4IEL A;  3EUR A;  1M99 A;  4PUR A;  1YF0 A;  2LNT A;  2PWJ A;  12GS A;  3GUR A;  2YPM A;  3UVT A;  1EV4 A;  1T8E B;  5JWR B;  1PMT A;  3GKM A;  2H1D A;  4IQA A;  1TOF A;  1XOA A;  1VRS D;  2YV7 A;  4IBP A;  2CX3 A;  4GLT A;  4A5P A;  4LL4 B;  4CY8 A;  3UAR A;  2M80 A;  1H75 A;  2HYX A;  1GSQ A;  2GQK A;  3IDV A;  2JAC A;  3ZZX A;  3KM6 A;  3FRC A;  1PL1 A;  5EY6 A;  1JLV A;  2OAC A;  4E8E A;  3VPT A;  2WB9 A;  5D9T A;  4TW5 A;  1DSB A;  4GCI A;  1JZR A;  3BBY A;  4EIP A;  1SKR B;  3M9K A;  10GS A;  1GH2 A;  2R4V A;  3PPU A;  4D73 A;  3TJB A;  1GNW A;  1SJZ A;  2EC4 A;  2XBQ A;  3APS A;  1O73 A;  5IPH A;  6GSV A;  2R6K A;  3EU3 A;  2LJK A;  4DVC A;  3KXO A;  1TU8 A;  3Q6O A;  3LQ7 A;  2VO4 A;  5G1L A;  2IFQ B;  2NBS A;  4MF7 A;  1EEM A;  6GSW A;  3F4T A;  4ACS A;  1URM A;  1GSU A;  2M72 A;  1SD8 A;  5LD0 A;  4Z7X A;  3ZFB A;  2TIR A;  3TJK A;  1G7E A;  2C0F A;  2XC2 A;  4H86 A;  2IL3 A;  3KIJ A;  1FVK A;  2C1Y A;  5IMV A;  5ECK B;  1S3A A;  4OMV A;  1R7H A;  4USS A;  4CY6 A;  4DEJ A;  2JZT A;  2XBI A;  1GP1 A;  3MIX A;  3QFB C;  2QSI A;  1VF4 A;  3TDG A;  1X5C A;  4KND A;  4V2L A;  1O81 A;  4D73 B;  4NMU A;  2BTO T;  3US3 A;  2C0G A;  3ZIJ A;  3IK9 A;  3RPN A;  3W6G A;  3C71 A;  4JBB A;  2C8U A;  3APQ A;  4NPB A;  2V1M A;  2B1L A;  1PGT A;  2L59 A;  5IM9 A;  2P0G A;  2YN1 A;  2FD3 A;  3QR6 A;  1B9X C;  4Q5N A;  2H0I A;  1TU7 A;  3VWW A;  1U88 A;  5IMC A;  1GTI A;  4OWY A;  3EMX A;  11GS A;  2ES7 A;  4YQV A;  2OE0 A;  3QD9 A;  4K7I A;  4HJ2 A;  2AUV A;  2H01 A;  2WZ9 A;  1FHE A;  4OFN A;  4XTS A;  4V2M A;  1XVW A;  1A8L A;  4ISD A;  2WRT A;  1X9W B;  3FR6 A;  2HSM A;  4KX4 A;  4ULX A;  2PPT A;  2IMF A;  1V9W A;  1SYR A;  4LMW A;  2RM6 A;  4NWY A;  3WT2 A;  3GL5 A;  4ID0 A;  4YKF A;  4PX1 A;  1A2J A;  2HT9 A;  2K8S A;  1DE2 A;  2DKH A;  4N10 A;  4J2F A;  2KP1 A;  2YAN A;  1K0N A;  2E2M A;  1VF2 A;  4XS6 A;  2O7K A;  1PQN A;  4MDC A;  3RDW A;  2X8C A;  3RHC A;  1ZL9 A;  2GZP A;  3D4T A;  4LLR A;  2PBJ A;  5ECS A;  4JED A;  2I4A A;  2WCI A;  1WIK A;  22GS A;  3KH7 A;  4JRR A;  3QAV A;  2NDO A;  3EMP A;  1AQV A;  5CRE A;  2QGV A;  5L71 A;  4JZQ A;  2H30 A;  2V2G A;  4L8E A;  1ST9 A;  3D6I A;  4V2N A;  1O85 A;  4TOP A;  1X0R A;  1ZZY A;  4RQR A;  3CRT A;  5G31 A;  1ERT A;  2VLU A;  4KH7 A;  2C3T A;  4MH3 A;  1OC3 A;  4ECI A;  4BWQ A;  1M2B A;  1V2A A;  1PN9 A;  3LSZ A;  3ZTL A;  1JFU A;  2GT6 A;  2AJQ B;  5G30 A;  5H5R A;  1K0D A;  4ZXG A;  2GSR A;  1SK1 A;  1ABA A;  4IS0 A;  2EIQ A;  1UVZ A;  3DEX A;  4F9Z A;  4POB A;  5G5F A;  2DJJ A;  2FCH A;  2WDU A;  3D22 A;  2F9S A;  2FNO A;  5A4V A;  4PNG A;  2LNS A;  4PQ1 A;  2I1U A;  2H73 A;  5ECQ B;  2F8F A;  2HI7 A;  2X4A A;  5D93 A;  1GSD A;  4MP4 A;  3WT1 A;  3BCI A;  2HE3 A;  3D21 A;  2AV4 A;  4GQC A;  2AYT A;  1USB A;  3GYK A;  1XVQ A;  1GUM A;  1SJ6 A;  4OCE A;  4LA1 A;  3UAP A;  5AIS A;  3FZ9 A;  1SL1 B;  2ON7 A;  5KN0 A;  3CRU A;  1C72 A;  3G7I A;  4X1U A;  1EGR A;  5A4W A;  3UL3 A;  1NSW A;  1SD9 A;  5FHI A;  3WGX A;  4HEA 2;  1IYI A;  2DML A;  4WF5 A;  2GGT A;  3FR9 A;  3TKS E;  2I81 A;  5FT3 A;  2IPA A;  4FO5 A;  3UIW A;  2B6M A;  3VFI A;  3H93 A;  2MMZ A;  4ZB8 A;  1A0R P;  4FYU A;  3IV4 A;  5DDL A;  1BX9 A;  6GST A;  4V1A p;  1JZW A;  2WJU A;  1GSF A;  2MBT A;  1V40 A;  3SWL A;  3GKK A;  5F07 A;  19GS A;  3QDN A;  5B7C A;  2TRC P;  4O92 A;  1X5E A;  4K7N A;  5A4U A;  4X43 A;  3UEM A;  1GNE A;  3TUE A;  2N5F A;  1A24 A;  2H76 A;  4RI6 A;  1XWA A;  1J9B A;  1WP0 A;  2HFD A;  3F6F A;  1SL0 B;  5F05 A;  4CW9 A;  4BL7 A;  3BOA A;  4MA9 A;  3ERG A;  2I9H A;  2MMN A;  6GSY A;  1OE7 A;  4EC0 A;  2MMA A;  4ML6 A;  1BAY A;  3JCM L;  1HNC A;  3VWU A;  2GT5 A;  3TKP A;  2O89 A;  4ECC A;  4KSO A;  4HU7 A;  2LS5 A;  2E7P A;  3TKR A;  3D4M A;  5IQY A;  5HFK A;  2L5O A;  1ZCP A;  1T4Z A;  2B1K A;  2I3Y A;  2A2R A;  3E3E A;  2GS3 A;  1QMV A;  1VF3 A;  2DIY A;  2LV3 A;  4QL9 A;  1RK4 A;  4MPF A;  2VAF A;  5DJM A;  3F3R A;  2CVB A;  4P3Y B;  4Q5Q A;  4KA0 A;  1GSS A;  1X5D A;  4G10 A;  2K18 A;  1T7P B;  1ERU A;  2PU9 C;  3UBL A;  5A5K A;  4KE3 A;  5AGY A;  4AJ6 A;  1E2Y A;  5ID2 A;  1BG5 A;  3KEB A;  2FA4 A;  1ZYQ B;  5E59 A;  3ZYW A;  5GAP D;  4GST A;  1I5G A;  1PRX A;  4BL7 B;  1SK2 A;  2C0D A;  3UMA A;  4HS1 A;  1JZD A;  4HOJ A;  5DCH A;  4IKH A;  3LYP A;  3KD0 A;  2B5X A;  1A23 A;  2J9H A;  2H1B A;  4XCS A;  2VL2 A;  2H0G A;  4ZB6 A;  4EXJ A;  2VCW A;  1AQW A;  5AIX A;  3PR8 A;  2R0C A;  3LXZ A;  2JZR A;  2Z9S A;  1M9B A;  3EYT A;  4POL A;  1A8Y A;  1YEX A;  1GSE A;  1S3C A;  2CQ9 A;  3EC3 A;  2K8V A;  3DRN A;  1Y6E A;  4GSS A;  3NZN A;  3M0F A;  3W8J A;  2DJ3 A;  5CRG A;  4ML1 A;  3WYW A;  3GN3 A;  3HZ8 A;  1ZYP A;  3PGT A;  1R4W A;  3L9S A;  4MJC A;  3IE3 A;  4OFT A;  5KEJ A;  5EL8 A;  4YQM A;  5DQS A;  2LST A;  4HDE A;  5ID2 B;  4ZL7 A;  1A2L A;  2CAQ A;  4MF5 A;  3GX8 A;  2AHE A;  1PKW A;  2WFC A;  2JSZ A;  4KCE A;  1SYX A;  2VL2 C;  1XFL A;  4BVY A;  2CAI A;  3GRX A;  2HLS A;  5IMD A;  1GWC A;  3L0H A;  2F8A A;  1HNA A;  1SK0 A;  1VGL A;  1A2M A;  3TRX A;  4K1F A;  4BPY A;  3HY2 A;  3IHG A;  4JR6 A;  2FWE A;  4WKW A;  1H4O A;  1OAZ A;  1PX6 A;  3BCK A;  3KTL A;  1B4Q A;  3IRA A;  2RUE A;  20GS A;  2V6K A;  3Q74 A;  16GS A;  1QK8 A;  3KP8 A;  3A3T A;  4O5U A;  2X49 A;  3NIV A;  5B8A A;  2R0P A;  2HZE A;  1M7T A;  1XZO A;  4GXZ A;  1G0T A;  1E6B A;  4I8B A;  3LWA A;  1HNB A;  1MDK A;  4FIW A;  2ZNM A;  2KLX A;  3FW2 A;  2GTU A;  1XWB A;  1Z6N A;  2PN8 A;  4TXO B;  2G0F A;  3L78 A;  5G2Z A;  3EVI A;  1GUK A;  2A4V A;  1TRV A;  1B48 A;  3KJY A;  4ECB A;  1M9A A;  1Z7R A;  3F0I A;  3ZIT A;  1TW9 A;  2O87 A;  1ERW A;  4IW9 A;  5J9C A;  1PL2 A;  3RHB A;  2L57 A;  1EV9 A;  4BVY B;  1F9M A;  1M2D A;  5GST A;  4EUY A;  4ZL9 A;  1FB6 A;  4AF2 A;  1TI3 A;  2M46 A;  3CBU A;  4F82 A;  1THO A;  5HQP A;  5BMU A;  2GZZ A;  3UOM A;  5KN2 A;  2H66 A;  1SKS B;  2CX4 A;  5HFG A;  4F0C A;  2HZE B;  2HRF A;  4KB3 A;  3IC4 A;  3VPQ A;  4XHM A;  2XPE A;  1U3A A;  3EPT A;  3IAM 2;  1GUL A;  1OKD A;  3KCM A;  1QFN A;  4N0V A;  5IMZ A;  1TDI A;  1CQG A;  5KN1 A;  5IMA A;  1QUW A;  1YJ6 A;  1FVJ A;  1FOH A;  4TR4 A;  2ALB A;  4K5R A;  3TJJ A;  3WD6 A;  2NPB A;  2IMK A;  3E0U A;  2FHE A;  3ZFL A;  3GH9 A;  2LJR A;  1HQO A;  4MPG A;  5KOX A;  2LQQ A;  1QXH A;  2AAW A;  4YH2 A;  3UVH A;  2VD0 A;  3QAG A;  3ZIV A;  1MD4 A;  1YY7 A;  4Z2R A;  3EIN A;  4POK A;  5ENU A;  2LEG A;  4K2D A;  2DJ2 A;  3I9V 2;  2QA1 A;  4TR3 A;  1S3D A;  3F8U A;  2QKE A;  3HDC A;  4ZBD A;  3CSH A;  1XXU A;  4L5O A;  3F6D A;  1K3Y A;  3GIX A;  6GSX A;  2B5Y A;  4KW6 A;  1O8W A;  4HZ4 A;  3VI7 A;  1NHY A;  2LRN A;  3QPM A;  4FYB A;  3N5O A;  2CZ2 A;  1KEB A;  5DJL A;  1FO5 A;  1XWC A;  2FY6 A;  3RAZ A;  5ECN B;  1G6W A;  2H6Y A;  2EIR A;  1WRY A;  1R26 A;  4K0G A;  1AAZ A;  4MZC A;  7GSS A;  3V1W A;  4TVE A;  2R5G A;  3R3E A;  2H70 A;  1O6J A;  3FEU A;  2JZS A;  3HHV A;  2VL3 A;  4LMV A;  1XPV A;  2VLV A;  1DE1 A;  1W4V A;  5CRW A;  1EOG A;  3LYK A;  1HYU A;  5IO0 A;  5H5S A;  3F4S A;  4G2E A;  2X99 A;  5HR1 A;  2YWO A;  2FWH A;  3DIE A;  4KCA A;  1OYJ A;  1FB0 A;  4IP6 A;  1J08 A;  3GNJ A;  5ECI B;  2C80 A;  2JAD A;  1OKT A;  2CV4 A;  1GTB A;  2E0Q A;  5KN3 A;  3C73 A;  5IMF A;  3C1S A;  4POM A;  4PQH A;  4LL1 B;  3LW9 A;  5EVO A;  4PUF C;  3M3M A;  5CP1 A;  2VCQ A;  2IMD A;  4MAB A;  3G9B A;  3VK9 A;  5J4U A;  1MDI A;  2VOC A;  3BJ5 A;  1KTE A;  2K9F A;  3M8N A;  4HU9 A;  2MMO A;  4I5Q A;  1AQX A;  4ZIL A;  3FZ4 A;  5G1K A;  5KOW A;  3HD5 A;  1XW5 A;  4QQ7 A;  4MF6 A;  3DML A;  4TR1 A;  1B8X A;  3EU4 A;  5IIZ A;  1TK8 B;  4XRA A;  3VI5 A;  4OFM A;  4EL1 A;  3M9J A;  3F4R A;  4YQU A;  3CTF A;  5DVB A;  5ECL B;  2N5B A;  4MCU A;  1U87 A;  3RPP A;  2TRX A;  5DQY A;  1JZO A;  4O5Q A;  3HVS A;  4MJB A;  2R0G A;  1WOU A;  3CSI A;  3P2A A;  4XIH A;  3GL3 A;  1AC1 A;  4ZBB A;  4NHZ A;  3CYN A;  4HQS A;  3MSZ A;  5HFI A;  3LG6 A;  1BED A;  2XPD A;  2GVP A;  2GZY A;  4RUV A;  3C7M A;  1T3B A;  2R3X A;  2H6Z A;  3HYP A;  5ECR B;  1QQ2 A;  4KDU A;  4HUA A;  2VCT A;  1BYE A;  1ERV A;  1ILO A;  3VWX A;  2H6X A;  5J5N A;  5CO3 A;  3ME7 A;  4GF0 A;  4MLY A;  3TRP A;  2FWG A;  1T1V A;  5J41 A;  5F06 A;  2A2P A;  1F6M C;  4AGS A;  5JCU A;  1ZMA A;  1YQ1 A;  4GSN A;  4KDY A;  2DIZ A;  4TR1 B;  2OE1 A;  2UZ8 A;  3ZL5 A;  4XS1 A;  5F8B A;  1YF1 A;  5ABR A;  2P31 A;  2GSS A;  2N5A A;  3MYD A;  4MZB A;  1PX7 A;  1ZYN A;  1K3O A;  4G0I A;  1WE0 A;  2KUC A;  3ZRD A;  2F3M A;  1NHO A;  3UBK A;  2R37 A;  1LBK A;  1TJD A;  2FUG 2;  4E8H A;  2E2G A;  1OC9 B;  2L4C A;  2C0E A;  4IQ1 A;  2H71 A;  3DGQ A;  4KAE A;  17GS A;  3GKN A;  4PQI A;  4RQX A;  1EZK A;  4PTS A;  2J23 A;  4YAV A;  2IN3 A;  4J56 E;  1WWJ A;  3TCO A;  2RUF A;  4K2X A;  2H0H A;  1LJR A;  1Q4J A;  2YWI A;  1TRW A;  3IC8 A;  1NW2 A;  4TKY A;  2X8G A;  4TR0 A;  1SL2 B;  3I43 A;  5BRT A;  1K0A A;  2A2S A;  3G7J A;  1Z6M A;  3O3T A;  3D0Z A;  3FKF A;  4G9H A;  3P8W A;  1JLW A;  4BVX A;  3L9U A;  4OO4 A;  3I6A A;  2RM5 A;  1XWG A;  2ZCT A;  3TJG A;  3ZRE A;  1RQM A;  4KUN A;  5D9W A;  5LCZ A;  5DAL A;  3A2W A;  2CT6 A;  3P7X A;  2HRN A;  3P90 A;  3GUS A;  1SEN A;  4Z2U A;  4L5L A;  4WET A;  2JSY A;  3TKS A;  1QGV A;  3KH9 A;  3IA1 A;  1FOV A;  1ACV A;  1CQH A;  1HD2 A;  4ZBA A;  4MJA A;  3ME8 A;  4N11 A;  2YCD A;  2F51 A;  3HJM A;  2H72 A;  3DWV A;  3S9F A;  1WJK A;  2IIY A;  2RII A;  2IJY A;  1I9D A;  5B8B A;  3KTB A;  14GS A;  4F03 A;  1PSQ A;  2CA8 A;  2DKI A;  1B9Y C;  3LEF A;  4K8M A;  5DCG A;  4KF9 A;  3QMX A;  5C00 A;  2PGT A;  4EVM A;  1N2A A;  4TXO A;  1TRS A;  3A5W A;  2WGR A;  3ZLP A;  5CAX A;  3FZ5 A;  2NTO A;  3HA9 A;  3FR3 A;  4IP1 A;  1R5A A;  4HI7 A;  5DAK A;  4BVX B;  3TB2 A;  2GQL A;  3TKS C;  2VM1 A;  2MZC A;  2DJ1 A;  2YOI A;  2VIM A;  1SU9 A;  5DAL B;  4QL7 A;  3VUR A;  2VCX A;  13GS A;  1PN0 A;  3PIN A;  1GLP A;  1IYH A;  3ED3 A;  4GWR A;  3A5I A;  2GSQ A;  2IMI A;  4K0N A;  2ON5 A;  4NHW A;  5JWQ B;  4DSS A;  1TXX A;  2MBS A;  5HR3 A;  2DLX A;  4N0Z A;  3IHQ A;  1FAA A;  6GSU A;  2C3N A;  1GUH A;  4NV2 A;  5ECO B;  1W89 A;  4EO3 A;  4TRX A;  2X64 A;  1T00 A;  4O32 A;  3RBT A;  4K7O A;  4WF4 A;  1F3B A;  5B6N A;  3CTG A;  4KGI A;  3DVX A;  2LQO A;  5ECM B;  3CMI A;  2YZU A;  3TGZ A;  3DKS A;  1O7U A;  3H1N A;  3LOR A;  4XS4 A;  1KBN A;  2OBI A;  5ECP B;  3L9V A;  3F63 A;  2EIO A;  5DAK B;  2P5Q A;  1XCC A;  2XHF A;  2H1G A;  1K0C A;  3U6V A;  3IK7 A;  2C4J A;  2MYG A;  4N30 A;  2C3Q A;  5LNK e;  3GA4 A;  5DBQ A;  3TRQ A;  2DBC A;  3PH9 A;  1J0F A;  1UC7 A;  2PUK C;  1OE8 A;  1TTZ A;  2LUS A;  1XW6 A;  5INY A;  4OO5 A;  1XOB A;  2OE3 A;  1VF1 A;  4J57 E;  1AUC A;  2H74 A;  2BJX A;  2AB6 A;  5AIV A;  4DSS B;  18GS A;  4F2I A;  1ON4 A;  2OBK A;  3N9J A;  1AIU A;  2LRC A;  3MAK A;  3K8N A;  3IXR A;  2HSH A;  4NAX A;  5IO2 A;  2CVD A;  3QAW A;  1G7O A;  2YJ7 A;  3CXG A;  1GSY A;  3F9U A;  1ML6 A;  4G19 A;  3IPZ A;  4K9Z A;  3EE2 A;  2O8V B;  5GAN D;  4XS4 B;  1R5P A;  1TRU A;  2DJK A;  2REM A;  5F0G A;  2VM2 A;  4I97 A;  4IHU A;  4MZW A;  1YEP A;  3U5R E;  5IOX A;  3KZQ A;  2CVK A;  4HQZ A;  1V58 A;  1F3A A;  2KHP A;  3LXT A;  3GH6 A;  1EGO A;  1Q98 A;  3Q18 A;  4EDZ A;  1YKA A;  3F3Q A;  3IBH A;  2B3S A;  3MDK A;  2B7K A;  1ZOF A;  2H75 A;  4WXT A;  3ERF A;  4HZ2 A;  4Q5R A;  1EP7 A;  1K0M A;  1K0O A;  3CSJ A;  1XBS A;  2L6D A;  4V1A g;  4MK3 A;  3TJF A;  3HKR A;  3GFK A;  4JE1 A;  4OCF A;  1B4P A;  2FLS A;  5B6M A;  1GTA A;  1F37 A;  3J7Y b;  1N8J A;  3GTU A;  4L0W A;  1OC8 A;  3G7Y A;  4ECJ A;  1O8X A;  5G5E A;  3L4N A;  4F0B A;  4IVF A;  5CRD A;  1MTC A;  1BJX A;  1XIY A;  2R2J A;  4WR4 A;  2HRK A;  3ZML A;  1V57 A;  3GV1 A;  2GST A;  3Q19 A;  1DBY A;  3AY8 A;  5IOW A;  4AJ7 A;  5HR0 A;  3HXS A;  3IAS 2;  1SKW B;  3KMO A;  2H8L A;  2YJH A;  4IJI A;  3I69 A;  3J7Y k;  5D9X A;  4G0L A;  1NM3 A;  3QOU A;  2LRT A;  2WS2 A;  3IR4 A;  4TXV A;  3APO A;  1MDJ A;  4IGJ A;  5HR2 A;  4OD7 A;  2YV9 A;  3FYG A;  5D96 A;  3R2Q A;  1EEJ A;  1PD2 1;  2PVO C;  3TKQ A;  3HJP A;  3ISO A;  2K6V A;  3GTU B;  3LFL A;  1Z9H A;  3LGC A;  5D73 A;  3W8S A;  4JU5 A;  2HZF A;  3DXB A;  2FWF A;  3VLN A;  2V6O A;  5CYY A;  1TK5 B;  1SJI A;  4X4J A;  3FMW A;  2IWT A;  4FYC A;  3UJ1 A;  3NOF A;  3GKX A;  1X9S B;  2PMT A;  3M1G A;  2KOK A;  3ERW A;  2QC7 A;  3BD2 A;  4RI7 A;  5ELA A;  4I2T A;  2PER A;  3MWH A;  1BQ7 A;  4MH2 A;  4TN8 A;  1AW9 A;  1Y25 A;  2X8H A;  4HJM A;  1GL8 A;  3D5J A;  3C1R A;  2V41 A;  3GX0 A;  4WEY A;  2JL4 A;  1EWX A;  1Z7P A;  4MMM A;  2OJL A;  4K5S A;  3QCP A;  3WGD A;  3HVV A;  3ZVJ D;  3FZA A;  4PUA A;  2CZ3 A;  3DYR A;  1MD3 A;  4G0K A;  1AXD A;  1XWK A;  1OC9 A;  4WBR D;  4NXI A;  3DVW A;  1MEK A;  5C04 A;  1FW1 A;  1TKD B;  5AN1 A;  3HZ4 A;  2ZUP A;  4AJ8 A;  2P5R A;  2D2Z A;  1WPI A;  3A2X A;  4WBJ A;  3GST A;  5IPG A;  1XW9 A;  1Z3E A;  3IOS A;  4KSM A;  2HSY A;  3MNG A;  1UN2 A;  2DJ0 A;  2YZH A;  2V32 A;  9GSS A;  3O6T A;  2B7J A;  1X9M B;  5ELG A;  4L0U A;  2FGX A;  5JCG A;  2DC5 A;  3QFA C;  4NV5 A;  3TOT A;  1F2E A;  1U3I A;  2NVL A;  2VLT A;  2A4H A;  3GSS A;  4ZB9 A;  3GHA A;  3FY7 A;  4BA7 A;  2YP6 A;  2VL9 A;  4DSR A;  2HNL A;  2LKU A;  1ZGN A;  1M2A A;  5GSS A;  5JCW A;  1V98 A;  2LJA A;  3O76 A;  5J9B A;  4DSQ A;  1LU4 A;  5EPF A;  4GQF A;  3SBC A;  4EDY A;  1OVN A;  4EKZ A;  1GTU A;  4ICY A;  3KP9 A;  3WGE A;  3LJR A;  4I6X A;  6GSS A;  1KNG A;  3HCZ A;  4Z2T A;  2FA8 A;  1YDK A;  4YKG A;  1YZX A;  3HVX A;  2KP2 A;  3H79 A;  3FHK A;  1PA3 A;  2JU5 A;  4EF0 A;  2DSA A;  4WR5 A;  1TI1 A;  2H1A A;  1GLQ A;  5JWO B;  1YKC A;  3EWL A;  2O85 A;  2GLR A;  2HRA A;  2QA2 A;  3E9J B;  1PKZ A;  2GDR A;  2GQM A;  4X0X A;  1A0F A;  3H4K A;  1EOH A;  3HJO A;  1GRX A;  2L6C A;  4FQU A;  1THX A;  5D8I A;  3C8E A;  5H5Q A;  4CHS A;  8GSS A;  1TP9 A;  2VCZ A;  4PGT A;  2DMM A;  4ILF A;  1UA5 A;  4O7H A;  5J3R A;  2VD1 A;  2LTK A;  4O5R A;  4KDX A;  2YWN A;  2VCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...