2K6VA

Solution structures of apo sco1 protein from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPSFLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytochrome c oxidase assembly protein
publication title Mechanism of Cu(A) assembly.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2k6vA00
3VI5A 4ECIA 4KE3A 2ON7A 2A2SA 1XWCA 4N0ZA 4WXTA 3IR4A 3TDGA 1GL8A 2HFDA 1ZMAA 2PPTA 4ZIJA 1SYXA 4NWYA 1X0RA 3IE3A 2YN1A 1SKSB 2DBCA 5GSTA 2FA8A 2EIQA 4L5LA 4F9ZA 1FB0A 1EWXA 4JU5A 4F2IA 1TRSA 1PRXA 2VO4A 3LGCA 5KN2A 1R5PA 1OE8A 3DXBA 3DIEA 4O5RA 3G7YA 2DJ1A 1GUMA 4PQHA 4GQFA 2LJAA 1SJZA 3UARA 1O8XA 4MH2A 2PGTA 3DVWA 1WP0A 1R5AA 1B4PA 5DVBA 1QXHA 4EO3A 5C04A 4K2DA 1AC1A 3KTBA 6GSYA 1GSEA 1FW1A 5D9WA 1SENA 1XW9A 4CDOA 2FGXA 2H6YA 3GKKA 1THXA 2WFCA 4POMA 2YWIA 6GSWA 2VCTA 4F0BA 3F9UA 5HFKA 1YKAA 6GSTA 5HFIA 3KM6A 2J9HA 1YJ6A 4MZBA 1SKWB 3G7IA 3HCZA 4ZL7A 1LU4A 2B5YA 2LUSA 1OC9B 4EXJA 1ZOFA 5IO2A 5B6NA 1V2AA 2PU9C 3LG6A 5HR0A 4KGIA 5KN3A 3UMAA 1ST9A 2MZCA 1V58A 3A2XA 1W89A 5IQYA 3SBCA 4O7HA 5D8IA 3ZVJA 2L6CA 4LL1B 1TK5B 5H5RA 1U88A 4IW9A 1XXUA 3CRTA 3JCML 1ZGNA 1OC8A 5J9CA 5FHIA 4CW9A 5IOXA 4FIWA 3GV1A 5F07A 3CTGA 5GAPD 2X8HA 2C3QA 2VLUA 4I2UA 3VI7A 1EP7A 3ZREA 4BVYA 3N5OA 5CO3A 2HRFA 4PNGA 2IMDA 2B1KA 2B5EA 2GSSA 1ILOA 1FG4A 5F05A 2YJHA 4PUFC 3VK9A 4ID0A 2HLSA 4KW6A 1Y6EA 1I5GA 4OCFA 2WDUA 1K0CA 4HU9A 1OYJA 3HVXA 4F03A 1PD21 4O92A 3F4SA 4ZB6A 5AGYA 1NM3A 1CQHA 3GL5A 5HR3A 2H73A 2IIYA 2JSYA 1PQNA 1ACVA 3IXRA 4ILFA 4IKHA 3CTFA 3IPZA 2IMFA 4HS1A 2O85A 1TDIA 1B8XA 1HYUA 2A4VA 1OE7A 2DMMA 3FK8A 1K0OA 3ME8A 2C0EA 2LQQA 2M72A 2DMLA 3L4NA 4PX1A 2IJYA 3RHCA 3GKMA 2MBSA 4HDEA 2GVPA 3IHQA 2H74A 1PX7A 2IMKA 2V1MA 3V1WA 1A0FA 3SWLA 4MF5A 1GLPA 2VLTA 1S3DA 1GSUA 1EZKA 4GTUA 2YANA 4AJ8A 2NPBA 4OO5A 3FR6A 1SL1B 3QAGA 4OWYA 4AGSA 2ZUPA 2V41A 3FZ5A 2HXKA 1TOFA 2GTUA 3TJKA 5B8AA 4ECJA 2RM6A 1R26A 1DE2A 3TRQA 2FD3A 1XWAA 2VL2A 3QD9A 5G1LA 1TK8B 3RDWA 5ABRA 4RUVA 3BD2A 2REMA 1T8EB 3KGKA 4X0XA 2H01A 3L9UA 1E6BA 3ZITA 3ZL5A 4O32A 3W8SA 2C80A 1K0MA 4KB3A 3GSSA 3MSZA 3D21A 3ZFBA 2H0GA 3GX8A 2I4AA 3LFLA 3LXZA 1GSFA 1SK0A 1F3BA 2Z9SA 5CRWA 1UN2A 1U6TA 6GSVA 1XOBA 4MF6A 4BWSA 2MBTA 5A5KA 2OACA 3O6TA 3GURA 2B5XA 3MWHA 4DSSB 5ECNB 5F06A 1TW9A 3TUEA 2O87A 1W4VA 3QFAC 1OVNA 2DLXA 3KEBA 1DE1A 5DJMA 5FT3A 2GQKA 2CVKA 2RUFA 1X9WB 1PKWA 2E2MA 3VWVA 2YV7A 3H4KA 2GS3A 5B7CA 2EIRA 4KCEA 4EF0A 1AUCA 1Z5YE 4XRDA 1OC3A 5DQYA 3TGZA 1C72A 3ZIVA 4AF2A 3HY2A 3DMLA 3QAWA 3TKSA 1T4ZA 1SYRA 3BCIA 4YAVA 4V1Ap 2OADA 5CRGA 1TRVA 2K9FA 2CVBA 3LEFA 4NHZA 3GA4A 3F8UA 1OC9A 4RQRA 5IMAA 1J0FA 1UVZA 2H0IA 3UEMA 3APOA 3LXTA 1ZYQB 2WJUA 4MH3A 1GSQA 2YJ7A 2F51A 4GSTA 1PSQA 2MMZA 3RAZA 5D96A 3ISOA 1J9BA 4NMUA 5GAND 1JZRA 4PXOA 3F3RA 2H1AA 1Z9HA 5DCHA 3QCPA 4MDCA 3HVSA 4IBPA 3CYNA 4TN8A 2YCDA 3FRCA 4IP6A 3GH6A 1X5CA 4OCEA 2V6KA 2VOCA 1BJXA 3HJMA 3CSJA 2WRTA 3HD5A 4IELA 3LORA 2LRTA 2YZHA 3EE2A 3ZVJD 5CP1A 2HSYA 1G6WA 3RPNA 5AIXA 5AN1A 3TKRA 3Q6OA 1T7PB 3UL3A 1YQ1A 3Q74A 4J57E 2YWOA 1K0BA 4JEDA 2H71A 5D73A 5IMFA 2GZYA 3VWUA 4GQCA 3F4RA 1JZDA 1M2BA 4G2EA 3BBYA 2CZ2A 2LSTA 4N10A 2FWGA 3RBTA 4Z7XA 3FZAA 1TRWA 1GUKA 2KOKA 3LWAA 3CSIA 3KP9A 3UJ1A 1YF0A 5ID2A 2N5FA 3HKRA 4I2TA 4KNDA 3VPTA 2R4VA 4FYCA 3FHKA 3EINA 2FWEA 2RM5A 3C71A 3IDVA 1M0UA 1O6JA 1THOA 4OD7A 4Q5FA 1K3OA 2B1LA 4XCSA 3ZTLA 2K6VA 4XS4B 1PKZA 1JLWA 2LEGA 2IN3A 1A23A 4XRAA 1BX9A 2ALBA 3F6FA 1QFNA 4GLTA 2L5LA 5HQPA 2P31A 3A2VA 2CA8A 2IFQB 2O8VB 4PGTA 5J3RA 4DSRA 2DJ3A 1GTBA 3GKNA 4L5OA 3TOUA 3W8JA 4G9HA 2C3TA 3TKQA 4CHSA 1ZL9A 3HZ4A 3APQA 1AW9A 1GNWA 3K8NA 1O73A 2B3SA 4Q5QA 5ECLB 1M2DA 1XWKA 4NHWA 3D4MA 4XHMA 1TU7A 1VF1A 2H0HA 3US3A 4D73B 4HJMA 3W6GA 4WBJA 4K7OA 5J4UA 1X5EA 2CZ3A 4KSMA 5IO0A 3KMNA 3E0UA 3KP8A 3C73A 4WR4A 3CBUA 1SJIA 3RHBA 3HZ8A 1KTEA 3TJBA 1WMJA 4OO4A 1T4YA 4HZ2A 3F0IA 3QPMA 2VCVA 3FR9A 3KH7A 3PGTA 1GTIA 4WR5A 1TP9A 3TJFA 3H93A 3UAPA 3WT2A 4ZB9A 5INYA 1BG5A 1QGVA 2DJJA 5DALA 4K0NA 3ZIJA 4GSSA 4E8EA 4RI6A 3M8NA 4WETA 1GWCA 1EOGA 4ACSA 1HQOA 1K0DA 5ECRB 1SKRB 3HDCA 4TR4A 3J7Yb 2F9SA 13GSA 2OBIA 2HI7A 1SL2B 2H70A 3CXGA 4IGJA 5ECIB 2H8LA 2X8GA 3M9KA 5JCGA 1ERWA 4TR1A 2FA4A 3P7XA 4WKWA 2DJ2A 10GSA 2KHPA 3WT1A 1TI3A 5DDLA 4EUYA 3GL3A 3J7Yk 3C8EA 1JFUA 3QFBC 9GSSA 1Z3EA 3ZLPA 1XIYA 3IV4A 1E2YA 2EIOA 2PVOC 2GZZA 8GSSA 3EMPA 1NHYA 1F9MA 2PN8A 1WOUA 3ME7A 1KBNA 2VIMA 1K3YA 3CSHA 1Z6NA 4N0VA 3UIWA 4NPBA 4KH7A 2F3MA 1XOAA 2VCWA 3BCKA 5AIVA 1U87A 2IMEA 4JZQA 4DSQA 3P8WA 1FO5A 4BPYA 4TXOB 1WIKA 3GTUB 3M9JA 1TTZA 2QGVA 3F4TA 3TJJA 2QKEA 2C0GA 4EL1A 3HVVA 2A2RA 2F8FA 2NDOA 2RUEA 2DSAA 2AAWA 3HXSA 1WWJA 4ZILA 4X1UA 5JWOB 5A4WA 4V2MA 2FLSA 1SK1A 3IAM2 2GSTA 20GSA 3DD3A 5IOWA 1XVWA 2B7JA 4BVXA 1GSDA 1TI1A 4MPGA 2L57A 3D0ZA 4K0GA 5B8BA 3IBHA 1Y25A 3FYGA 2J23A 5B6MA 2OE0A 4JR6A 2BMXA 4L0WA 4KDYA 2YWMA 1S3AA 4IN0A 4GSNA 5G5EA 4G10A 4EC0A 4L0UA 3L0HA 3VFIA 2ES7A 5H5SA 2MMAA 1MD3A 3KIJA 2I9HA 1XWGA 4RQXA 5ELGA 2HZEB 6GSXA 6GSSA 3M0FA 2C0DA 3LJRA 1A2JA 4RI7A 3QR6A 3D6IA 4XS4A 5G1KA 3GFKA 3MAKA 4K7IA 4WBRD 1TU8A 3KTLA 4MPFA 1MEKA 5DAKB 3FZ4A 2IFQA 2PBJA 2K8SA 3VWWA 3F63A 5A4UA 4KDUA 3GN3A 2GGTA 4YAPA 1AXDA 6GSUA 2XBIA 4TXVA 4MK3A 3I6AA 2XHFA 5ECSA 1AQWA 1R4WA 1V98A 4N11A 4J2FA 2XC2A 2AV4A 4GF0A 2ZCTA 1NSWA 3HHVA 3UBLA 2LTKA 3H1NA 2K8VA 1G0TA 3ZRDA 3C1RA 5DBQA 2HYXA 3EURA 4GXZA 2FWHA 2X99A 3TJGA 4MF7A 5D9VA 2GZPA 3PH9A 3QDNA 1B4QA 3HJPA 3D5JA 3GMFA 2H30A 5D9TA 1K0AA 1T00A 1YEPA 3LYKA 5EL8A 3P2AA 3EU3A 17GSA 4IVFA 2DC5A 2O7KA 2E2GA 3M3MA 2HSHA 2I81A 4LA1A 5G30A 4HQZA 2JU5A 5G2ZA 2CX4A 1RW1A 1KNGA 1GRXA 2LJKA 1Z6MA 1WJKA 4KA0A 1XWBA 3HYPA 1T1VA 1ERTA 3NOFA 3WYWA 2H19A 1VF3A 4KCAA 2M46A 4MLYA 22GSA 2H66A 1TJDA 1V9WA 4IHUA 1YF1A 4FYUA 2WULA 2G2QA 1AQXA 2GDRA 1LJRA 4HQSA 2FNOA 4ZBBA 1WE0A 1SL0B 1M9AA 4HI7A 4V2LA 4AJ6A 5E4WA 5ECQB 3GHAA 5GZZB 4LMVA 2H75A 1JZOA 2O89A 2TRCP 1CQGA 1WPIA 1XCCA 5E59A 3PINA 4GWRA 4K9ZA 3WD6A 2FWFA 2WGRA 5L71A 3UVHA 2AB6A 5DJLA 3KH9A 4N30A 2GQLA 4X43A 2K18A 1KEBA 1TRUA 2VL9A 4TOPA 3TRPA 1A0RP 2XBQA 3GYKA 5JWQB 2R5GA 4WF4A 16GSA 3R2QA 4TXOA 3GTUA 4KUNA 5ECMB 3FEUA 19GSA 2RLIA 3ZMLA 3WGXA 5JCUA 4YQMA 3ZZXA 3MNGA 4EDZA 3DRNA 4MZCA 5KN1A 2AYTA 1Z7RA 3F6DA 1MD4A 2R3XA 2FHEA 2C3NA 2DIZA 3IRAA 1B48A 1PL1A 3TCOA 2V32A 5CRHA 2WCIA 2WB9A 2N5BA 1XBSA 1X5DA 2VL2C 4KAEA 2H6XA 2V2GA 2CAQA 2GT6A 4HUAA 4AJ7A 3L9SA 3KZQA 2PWJA 3GIXA 4MJCA 1JHBA 1GP1A 3A2WA 3AY8A 3FY7A 4MJBA 4ML1A 1ZCPA 2TRXA 4IJ3A 2LQOA 3CMIA 2FCHA 1K0NA 5ECPB 1XW6A 3CRUA 1M99A 2DJKA 2OE1A 1MDJA 1TK0B 1DSBA 5IIZA 1H4OA 2VUPA 3TKPA 5IPHA 1VRSD 1G7EA 4LLRA 2HZEA 2OKAA 1M2AA 1XW5A 3UBKA 1IYIA 4QL9A 5AISA 2YZUA 2H1DA 1GSYA 3D4TA 1GULA 2E0QA 3A5WA 4I6XA 4HZ4A 5CRDA 1GSSA 1FHEA 2B7KA 4JR4A 5G31A 3A3TA 4ZBDA 5DAKA 3G7JA 2F8AA 3U6VA 3NZNA 4K1FA 3Q18A 2GLRA 2H1GA 1O8WA 4PQIA 4BL7A 1FOVA 1N8JA 3HJOA 1YZXA 4ZXGA 3WGEA 1Q4JA 2HZFA 3FKFA 3H79A 4ZL9A 1VGLA 2VLVA 4ZB8A 1N2AA 1BAYA 3TKSC 4MP4A 1O85A 5GSSA 3E9JB 5DQSA 3EU4A 4DVCA 2WS2A 3LYPA 2CV4A 5IMZA 3ZYWA 4V2NA 2YOIA 1NW2A 1SU9A 4IQ1A 2VCZA 4HEA2 1UC7A 2CQ9A 4HOJA 2R37A 3Q19A 5EY6A 4DSSA 1FVKA 1A2MA 1FVJA 1PL2A 1ON4A 3OR5A 2R2JA 3VWXA 3I69A 4ZBAA 3EYTA 4E8HA 1HNAA 2AUVA 2AHEA 2OA7A 1FAAA 1U3AA 4MJAA 2P5QA 4IP1A 3BJ5A 1OKTA 3TKSE 4ECCA 2JZRA 3KCMA 2DJ0A 2LRNA 1PMTA 1A2LA 1YKCA 3O76A 1O81A 2CT6A 2FY6A 1H75A 2NTOA 3GH9A 4LL4B 1HNCA 1EV4A 2LKUA 2JZTA 4NV2A 4F82A 2I3YA 4ML6A 4OFNA 2JADA 4OMVA 2WZ9A 1GTUA 4JE1A 5KEJA 5ENUA 4K8MA 4G19A 1QMVA 3LQ7A 2IMIA 3ERWA 2L59A 5ELAA 4WF5A 1ZYEA 4TR3A 5HR1A 2LNTA 1ERVA 2KLXA 1HD2A 4QQ7A 3E3EA 2OJLA 2IL3A 4MA9A 3VLNA 1OKDA 2GSRA 2GSQA 2GT5A 3S9FA 2LRCA 4PNFA 4POBA 3ZFLA 14GSA 2YWNA 3DKSA 4NV5A 1V57A 4Q5RA 5FWGA 5DCGA 2PMTA 1URMA 2KP2A 1EGRA 2HE3A 4NAXA 2VCXA 2PERA 1G7OA 5A4VA 2JACA 1PX6A 4K7NA 1XVQA 4MCUA 4TW5A 2C1YA 1EEJA 1MDKA 5ID2B 4MJEA 1AIUA 1MDIA 2PVQA 1GNEA 3IA1A 1Z7PA 2JZSA 2L4CA 3N9JA 2QC7A 1HNBA 1IYHA 1XZOA 1GH2A 5LCZA 5F0GA 2HRNA 5LD0A 2EC4A 4EE0A 1A24A 2E7PA 1R7HA 1GLQA 1A8YA 1TKDB 2ZNMA 1M7TA 4FYBA 1A8LA 1EV9A 3GUSA 1I9DA 5CNWA 5HFGA 3O3TA 4IS0A 2MMOA 3DGQA 1ERUA 5EPFA 1NHOA 3IK9A 4I8BA 4EVMA 5HR2A 2FUG2 5KN0A 1U3IA 2ON5A 5H5QA 2BJXA 4ZL8A 4WEYA 2LNSA 1SJ6A 4ULXA 5CAXA 2TIRA 3QOUA 2IPAA 3C7MA 3HA9A 11GSA 5ECHB 2YNXA 3APSA 1EGOA 1ZZYA 4GRFA 1X9MB 2XPDA 2P0GA 4D73A 1FB6A 2VCQA 1RK4A 3FW2A 1GUHA 2HT9A 3NIVA 2CX3A 5J5NA 1OAZA 3TRXA 4HU7A 2I1UA 2H1BA 4TR0A 5J41A 3FR3A 2V6OA 2L4QA 1SD9A 1QUWA 3GNJA 5JWRB 1DBYA 1AQVA 2BTOT 3H8QA 4NXIA 5ECKB 4I5QA 2AJQB 2B6MA 4BA7A 3KXOA 1V40A 3D22A 2HNLA 1F2EA 5DALB 2L6DA 4MMMA 3GX0A 3DVXA 1J08A 2H72A 2KUCA 4FO5A 3MDKA 3TB2A 4EKZA 1T3BA 4JBBA 4ISDA 1MTCA 3QMXA 4YQUA 1VF2A 4XTSA 4KX4A 4ECBA 1K3LA 3IOSA 2R6KA 1GTAA 3KMOA 3PR8A 2CAIA 4TR1B 2JSZA 3KD0A 5C00A 1SD8A 1S3CA 4K6XA 1B9XC 3EWLA 2N5AA 3C1SA 1RQMA 2M80A 2H6ZA 1B9YC 1DUGA 2LJRA 2YV9A 4LMWA 2MYGA 1Q98A 4XS6A 4GCIA 5D93A 5IM9A 3IAS2 5J9BA 1YY7A 1WRYA 2LV3A 5IMVA 1O7UA 3G9BA 1JZWA 1AAZA 3L78A 5IPGA 2MMNA 1M9BA 2D2ZA 2VL3A 2H76A 3BOAA 5ECOB 3I9V2 1G6YA 3GSTA 1ML6A 1F37A 4POKA 2YPMA 3DEXA 3UOMA 1EP8A 3IK7A 4OFMA 3VPQA 1ABAA 4P3YB 2VAFA 4BWQA 2VM1A 4KSOA 1BEDA 4MABA 4HJ2A 1PA3A 2C0FA 2VD0A 4IQAA 2VM2A 4PQ1A 1LBKA 1VF4A 1QQ2A 3RPPA 5G5FA 1YEXA 3UVTA 2OBKA 4J56E 4F0CA 3WGDA 3QAVA 1F3AA 3GKXA 2KP1A 4QL7A 2C8UA 2CVDA 3I43A 2PUKC 4XS1A 3GRXA 1UA5A 4TRXA 18GSA 5F8BA 3U5RE 4TVEA 5D9XA 4Q5NA 1EOHA 2NBSA 12GSA 1TXXA 1PGTA 4KDXA 5CREA 1BQ7A 4I97A 4OFTA 3M1GA 2L5OA 1XFLA 5LNKe 3F3QA 4POLA 1QK8A 4XIHA 2C4JA 4PUAA 2X64A 2IWTA 4V1Ag 3ZMKA 4L8EA 1BYEA 3FZ9A 5CYYA 2YP6A 4EDYA 1EEMA 3EVIA 2X8CA 2VD1A 2OE3A 2NVLA 3KJYA 2P5RA 5EVOA 4MZWA 2GQMA 3LSZA 1PN9A 1USBA 3ERFA 4YQVA 1SK2A 4YH2A 5COHA 5IMCA 3TOTA 2JL4A 3DWVA 4DEJA 1X9SB 3DYRA 2DIYA 1F6MC 4FH8A 4JRRA 4PURA 3L9VA 4IJIA 3VURA 5IMDA 7GSSA 3P90A 2G0FA 4H86A 4TKYA 2XPEA 2LS5A 2RIIA 3ED3A 5JCWA 1XPVA 1JLVA 2QSIA 3ERGA 1YDKA 3EMXA 3IC4A 3EC3A
chains in the Genus database with same CATH superfamily
3VI5A 4ECIA 4KE3A 2ON7A 2A2SA 1XWCA 4N0ZA 4WXTA 3IR4A 3TDGA 1GL8A 2HFDA 1ZMAA 2PPTA 4ZIJA 1SYXA 4NWYA 1X0RA 3IE3A 2YN1A 1SKSB 2DBCA 5GSTA 2FA8A 2EIQA 4L5LA 4F9ZA 1FB0A 1EWXA 4JU5A 4F2IA 1TRSA 1PRXA 2VO4A 4PTSA 3LGCA 5KN2A 4FQUA 1R5PA 1OE8A 3DXBA 3DIEA 4O5RA 3G7YA 2DJ1A 1GUMA 4PQHA 4GQFA 2LJAA 1SJZA 3UARA 1O8XA 4MH2A 2PGTA 3DVWA 1WP0A 1R5AA 1B4PA 5DVBA 1QXHA 4EO3A 5C04A 4K2DA 1AC1A 3KTBA 6GSYA 1GSEA 1FW1A 5D9WA 1SENA 1XW9A 4CDOA 2FGXA 2H6YA 3GKKA 1THXA 2WFCA 4POMA 2YWIA 6GSWA 2VCTA 4F0BA 3F9UA 5HFKA 1YKAA 6GSTA 5HFIA 3KM6A 2J9HA 1YJ6A 4MZBA 1SKWB 3G7IA 3HCZA 2X4AA 4ZL7A 1LU4A 2B5YA 2LUSA 1OC9B 4EXJA 1ZOFA 5IO2A 5B6NA 1V2AA 2PU9C 3LG6A 3HVNA 5HR0A 4KGIA 5KN3A 3UMAA 1XG8A 1ST9A 2MZCA 1V58A 3A2XA 1W89A 5IQYA 3SBCA 4O7HA 5D8IA 3ZVJA 2L6CA 4LL1B 1TK5B 5H5RA 1U88A 4IW9A 1XXUA 3CRTA 3JCML 1ZGNA 1OC8A 5J9CA 5FHIA 4CW9A 5IOXA 4Z2UA 4FIWA 3EPTA 3GV1A 5F07A 3CTGA 5GAPD 2X8HA 2C3QA 2VLUA 4I2UA 3VI7A 1EP7A 3ZREA 4BVYA 3N5OA 5CO3A 2HRFA 4PNGA 2IMDA 2B1KA 2B5EA 2GSSA 1ILOA 1FG4A 5F05A 2YJHA 4PUFC 3VK9A 4ID0A 2HLSA 4KW6A 1Y6EA 1I5GA 4OCFA 2WDUA 1K0CA 4HU9A 1OYJA 3HVXA 4F03A 1PD21 4O92A 3F4SA 4ZB6A 5AGYA 1NM3A 1CQHA 3GL5A 5HR3A 2H73A 2IIYA 2JSYA 1PQNA 1ACVA 3IXRA 4ILFA 4IKHA 3CTFA 3IPZA 2IMFA 4HS1A 2O85A 1TDIA 1B8XA 1HYUA 3A5IA 4O5QA 2A4VA 1OE7A 2DMMA 3FK8A 1K0OA 3ME8A 2C0EA 2LQQA 2M72A 2DMLA 3L4NA 4PX1A 2IJYA 3RHCA 3GKMA 2MBSA 4HDEA 2GVPA 3IHQA 2H74A 1PX7A 2IMKA 2V1MA 3V1WA 1A0FA 3SWLA 4MF5A 1GLPA 2VLTA 1S3DA 1GSUA 1EZKA 4GTUA 2YANA 4AJ8A 2NPBA 4OO5A 3FR6A 1SL1B 3QAGA 4OWYA 4AGSA 2ZUPA 2V41A 3FZ5A 4EIPA 2HXKA 3MIXA 1TOFA 2GTUA 3TJKA 5B8AA 4ECJA 4HSCX 4BL7B 2RM6A 1R26A 1DE2A 3TRQA 2FD3A 1XWAA 2VL2A 3QD9A 5G1LA 1TK8B 3RDWA 5ABRA 4RUVA 3BD2A 2REMA 1T8EB 3KGKA 4X0XA 2H01A 4Z2TA 3L9UA 1E6BA 1PFOA 3ZITA 3ZL5A 4O32A 3W8SA 2C80A 1K0MA 4KB3A 3GSSA 3MSZA 3D21A 3ZFBA 2H0GA 3GX8A 2I4AA 3LFLA 3LXZA 1GSFA 1SK0A 1F3BA 2Z9SA 5CRWA 1UN2A 1U6TA 6GSVA 1XOBA 4MF6A 4BWSA 2MBTA 5A5KA 2OACA 3O6TA 3GURA 2B5XA 3MWHA 4DSSB 5ECNB 5F06A 1S3RA 1TW9A 3TUEA 2O87A 1W4VA 3QFAC 1OVNA 2DLXA 3KEBA 1DE1A 5DJMA 5FT3A 2GQKA 2A2PA 2CVKA 2RUFA 1X9WB 1PKWA 2E2MA 3VWVA 2YV7A 3H4KA 4BIKA 2GS3A 5B7CA 2EIRA 4KCEA 4EF0A 1AUCA 1Z5YE 4XRDA 1OC3A 5DQYA 3TGZA 1C72A 3ZIVA 4AF2A 3HY2A 3DMLA 3QAWA 3TKSA 1T4ZA 1SYRA 2HRAA 3BCIA 4YAVA 4V1Ap 2OADA 5CRGA 4KF9A 1TRVA 2K9FA 2CVBA 3LEFA 4NHZA 3GA4A 3F8UA 1OC9A 4RQRA 5IMAA 1J0FA 1UVZA 2H0IA 3UEMA 3APOA 3LXTA 1ZYQB 2WJUA 4MH3A 1GSQA 2YJ7A 2F51A 4GSTA 1PSQA 2MMZA 3RAZA 5D96A 3ISOA 1J9BA 4NMUA 5GAND 1JZRA 4PXOA 3F3RA 2H1AA 1Z9HA 5DCHA 3QCPA 4X4JA 4MDCA 3HVSA 4IBPA 3CYNA 4TN8A 2YCDA 3FRCA 4IP6A 3GH6A 1X5CA 4OCEA 4Z2RA 2V6KA 2VOCA 4CY6A 1BJXA 3HJMA 3CSJA 2WRTA 3HD5A 4IELA 3LORA 2LRTA 2YZHA 3EE2A 3ZVJD 5CP1A 2HSYA 1G6WA 3RPNA 5AIXA 5AN1A 3TKRA 3Q6OA 1T7PB 3UL3A 1YQ1A 3Q74A 4J57E 2YWOA 1K0BA 4JEDA 2H71A 5D73A 5IMFA 2GZYA 3VWUA 4GQCA 3F4RA 1JZDA 1M2BA 4G2EA 3BBYA 2CZ2A 2LSTA 4N10A 2FWGA 3RBTA 4Z7XA 3FZAA 1TRWA 1GUKA 2KOKA 3LWAA 3CSIA 3KP9A 1M3IA 3UJ1A 1YF0A 5ID2A 3FMWA 2N5FA 3HKRA 4I2TA 4KNDA 3VPTA 2R4VA 4FYCA 3FHKA 3EINA 2FWEA 2RM5A 2X49A 3C71A 3IDVA 1M0UA 1O6JA 1THOA 4OD7A 4Q5FA 1K3OA 2B1LA 4XCSA 3ZTLA 2K6VA 4XS4B 1PKZA 1JLWA 2LEGA 2DKHA 2IN3A 1A23A 4XRAA 1BX9A 2ALBA 3F6FA 1QFNA 4GLTA 2L5LA 5HQPA 2P31A 3A2VA 2CA8A 2IFQB 2O8VB 4PGTA 5J3RA 4DSRA 2DJ3A 1GTBA 3GKNA 4L5OA 3TOUA 3W8JA 4G9HA 2C3TA 3TKQA 4CHSA 1ZL9A 3HZ4A 3APQA 1AW9A 1GNWA 3K8NA 1O73A 2B3SA 4Q5QA 5ECLB 1M2DA 1XWKA 4NHWA 3D4MA 4XHMA 1TU7A 1VF1A 2H0HA 3US3A 4D73B 4HJMA 3W6GA 4WBJA 4K7OA 5J4UA 1X5EA 2CZ3A 4KSMA 5IO0A 3KMNA 3E0UA 3IHGA 3KP8A 3C73A 4WR4A 3CBUA 1SJIA 3RHBA 3HZ8A 1KTEA 3TJBA 1WMJA 4OO4A 1T4YA 4HZ2A 3F0IA 3QPMA 2VCVA 3FR9A 3KH7A 3PGTA 1GTIA 4WR5A 1TP9A 3TJFA 3H93A 3UAPA 3LW9A 3WT2A 4ZB9A 5INYA 1BG5A 1QGVA 2DJJA 5DALA 4K0NA 3ZIJA 4GSSA 4E8EA 4RI6A 3M8NA 4WETA 1GWCA 1EOGA 4ACSA 1HQOA 1K0DA 5ECRB 1SKRB 3HDCA 4TR4A 3J7Yb 2F9SA 13GSA 2OBIA 2HI7A 1SL2B 2H70A 3CXGA 4IGJA 5ECIB 2H8LA 2X8GA 3M9KA 2R0GA 5JCGA 1ERWA 4TR1A 2FA4A 3P7XA 4WKWA 2DJ2A 10GSA 2KHPA 3WT1A 1TI3A 5DDLA 4EUYA 3GL3A 3J7Yk 3C8EA 1JFUA 3QFBC 9GSSA 3IC8A 1Z3EA 3ZLPA 1XIYA 3IV4A 1E2YA 2EIOA 2PVOC 2GZZA 8GSSA 3EMPA 1NHYA 1F9MA 2PN8A 1WOUA 3ME7A 1KBNA 4YKFA 2VIMA 1K3YA 3CSHA 1Z6NA 4N0VA 3UIWA 4NPBA 4G0LA 4KH7A 2F3MA 1XOAA 2VCWA 3BCKA 5AIVA 1U87A 2IMEA 4JZQA 4DSQA 3P8WA 1FO5A 4BPYA 4TXOB 1WIKA 3GTUB 3M9JA 1TTZA 2QGVA 3F4TA 3TJJA 2QKEA 2C0GA 4EL1A 3HVVA 2A2RA 2F8FA 2NDOA 2RUEA 2DSAA 2AAWA 3HXSA 1WWJA 4ZILA 4X1UA 5JWOB 5A4WA 4V2MA 2FLSA 1SK1A 3IAM2 2GSTA 20GSA 3DD3A 5IOWA 1XVWA 2B7JA 4BVXA 1GSDA 1TI1A 4MPGA 2L57A 3D0ZA 5BRTA 4K0GA 5B8BA 3IBHA 1Y25A 3FYGA 2J23A 5B6MA 2OE0A 4JR6A 2BMXA 4L0WA 4KDYA 2YWMA 1S3AA 4IN0A 4GSNA 5G5EA 4G10A 4EC0A 4L0UA 3L0HA 3VFIA 2ES7A 5H5SA 2MMAA 3R3EA 1MD3A 3KIJA 2I9HA 1XWGA 4RQXA 5ELGA 2HZEB 6GSXA 6GSSA 3M0FA 2C0DA 3LJRA 1ZYNA 1A2JA 4RI7A 3QR6A 3D6IA 4XS4A 5G1KA 2A4HA 3GFKA 3MAKA 4K7IA 4WBRD 1TU8A 3KTLA 4MPFA 1MEKA 5DAKB 3FZ4A 2IFQA 2PBJA 2K8SA 4ICYA 3VWWA 3F63A 5A4UA 4KDUA 3GN3A 2GGTA 4YAPA 1AXDA 6GSUA 2XBIA 4TXVA 4MK3A 3I6AA 2XHFA 5ECSA 1AQWA 1R4WA 1V98A 4N11A 4J2FA 2XC2A 2AV4A 4GF0A 2ZCTA 1NSWA 3HHVA 3UBLA 2LTKA 3H1NA 2K8VA 1G0TA 3ZRDA 3C1RA 5DBQA 2HYXA 3EURA 4GXZA 2FWHA 2X99A 3TJGA 4MF7A 5D9VA 2GZPA 3PH9A 3QDNA 1B4QA 3HJPA 3D5JA 3GMFA 2H30A 5D9TA 1K0AA 1T00A 1YEPA 3LYKA 5EL8A 3P2AA 3EU3A 17GSA 4IVFA 2DC5A 2O7KA 2E2GA 3M3MA 2HSHA 2I81A 4LA1A 5G30A 4HQZA 2JU5A 5G2ZA 2CX4A 1RW1A 1KNGA 1GRXA 2LJKA 1Z6MA 1PN0A 1WJKA 1M3JA 4KA0A 1XWBA 3HYPA 1T1VA 1ERTA 3NOFA 3WYWA 2H19A 1VF3A 4KCAA 2M46A 2R0CA 4MLYA 22GSA 2H66A 1TJDA 1V9WA 4IHUA 1YF1A 4FYUA 2WULA 2G2QA 1AQXA 2GDRA 1LJRA 4HQSA 2FNOA 4ZBBA 1WE0A 1SL0B 1M9AA 4HI7A 4V2LA 4K2XA 4AJ6A 5E4WA 2DKIA 5ECQB 3GHAA 5GZZB 4LMVA 2H75A 1JZOA 2O89A 2TRCP 1CQGA 1WPIA 1XCCA 5E59A 3PINA 4GWRA 4K9ZA 3WD6A 2FWFA 2WGRA 5L71A 3UVHA 2AB6A 5DJLA 3KH9A 4N30A 2GQLA 4X43A 2K18A 1KEBA 1TRUA 4TOPA 2VL9A 3TRPA 1A0RP 2XBQA 3GYKA 5JWQB 4YKGA 2R5GA 4WF4A 16GSA 3R2QA 4TXOA 3GTUA 4KUNA 5ECMB 3FEUA 19GSA 2RLIA 3ZMLA 3WGXA 5JCUA 4YQMA 3ZZXA 3MNGA 4EDZA 3DRNA 4MZCA 5KN1A 2AYTA 1Z7RA 3F6DA 1MD4A 2R3XA 2FHEA 2C3NA 2DIZA 3IRAA 1B48A 1PL1A 3TCOA 2V32A 5CRHA 4K5RA 2WCIA 2WB9A 2N5BA 1XBSA 1X5DA 2VL2C 4MNNA 4KAEA 2H6XA 2V2GA 2CAQA 2GT6A 4HUAA 4AJ7A 3L9SA 3KZQA 4EIQA 2PWJA 3GIXA 4MJCA 1JHBA 1GP1A 3A2WA 3AY8A 3FY7A 4MJBA 4ML1A 1ZCPA 2TRXA 4IJ3A 2LQOA 3CMIA 2FCHA 1K0NA 5ECPB 1XW6A 3CRUA 1M99A 2DJKA 2OE1A 1MDJA 1TK0B 1DSBA 5IIZA 1H4OA 2VUPA 3TKPA 5IPHA 1VRSD 1G7EA 4LLRA 2HZEA 2OKAA 1M2AA 1XW5A 3UBKA 1IYIA 4QL9A 5AISA 2YZUA 2H1DA 1GSYA 3D4TA 1GULA 2E0QA 3A5WA 4I6XA 4HZ4A 5CRDA 1GSSA 1FHEA 2B7KA 4JR4A 5G31A 3A3TA 4ZBDA 5DAKA 3G7JA 2F8AA 3U6VA 4K5SA 3NZNA 4K1FA 3Q18A 2GLRA 2H1GA 1O8WA 4PQIA 4BL7A 1FOVA 1N8JA 3HJOA 1YZXA 4ZXGA 3WGEA 1Q4JA 2HZFA 3FKFA 3H79A 4ZL9A 1VGLA 2VLVA 4ZB8A 1N2AA 1BAYA 3TKSC 4MP4A 1O85A 5GSSA 3E9JB 5DQSA 3EU4A 4DVCA 2WS2A 3LYPA 2CV4A 5IMZA 3ZYWA 4V2NA 2YOIA 1NW2A 1SU9A 4IQ1A 2VCZA 4HEA2 1UC7A 2CQ9A 4HOJA 2R37A 3Q19A 5EY6A 4DSSA 1FVKA 1A2MA 1FVJA 1PL2A 1ON4A 3OR5A 2R2JA 3VWXA 3I69A 4ZBAA 3EYTA 4E8HA 3MYDA 1HNAA 2AUVA 2AHEA 2OA7A 1FAAA 1U3AA 4MJAA 2P5QA 4IP1A 3BJ5A 1OKTA 4CY8A 3TKSE 2R0PA 4ECCA 2JZRA 3KCMA 2DJ0A 2LRNA 1PMTA 1A2LA 1YKCA 3O76A 1O81A 2CT6A 2FY6A 1H75A 2NTOA 3GH9A 4LL4B 1HNCA 1EV4A 2LKUA 2JZTA 4NV2A 4F82A 2I3YA 4ML6A 4OFNA 2JADA 4OMVA 2WZ9A 1GTUA 4JE1A 5KEJA 5ENUA 4K8MA 4USSA 4G19A 1QMVA 3LQ7A 2IMIA 3ERWA 2L59A 5ELAA 4WF5A 1ZYEA 4TR3A 5HR1A 2LNTA 1ERVA 2KLXA 1HD2A 4QQ7A 3E3EA 2OJLA 2IL3A 4MA9A 3VLNA 1OKDA 4G0IA 2GSRA 2GSQA 2GT5A 3S9FA 2LRCA 4PNFA 4POBA 3ZFLA 3PPUA 14GSA 5KOWA 2YWNA 3DKSA 4NV5A 1V57A 4Q5RA 5FWGA 5DCGA 2PMTA 1URMA 2KP2A 1EGRA 2HE3A 4NAXA 2VCXA 2PERA 1G7OA 5A4VA 2JACA 1PX6A 4K7NA 1XVQA 4MCUA 4TW5A 2C1YA 1EEJA 1MDKA 5ID2B 4MJEA 1AIUA 1MDIA 2PVQA 1GNEA 3IA1A 1Z7PA 2JZSA 2L4CA 3N9JA 2QC7A 1HNBA 1IYHA 2QA2A 1XZOA 4G0KA 1GH2A 5LCZA 5F0GA 2HRNA 5LD0A 2EC4A 4EE0A 1A24A 2E7PA 1R7HA 1GLQA 1A8YA 1TKDB 2ZNMA 1M7TA 4FYBA 1A8LA 3CQFA 1EV9A 3GUSA 1I9DA 5CNWA 5HFGA 3O3TA 4IS0A 2MMOA 3DGQA 1ERUA 5EPFA 1NHOA 3IK9A 4I8BA 4EVMA 5HR2A 2FUG2 5KN0A 1U3IA 2ON5A 5H5QA 2BJXA 4ZL8A 4WEYA 2LNSA 1SJ6A 4ULXA 5CAXA 2TIRA 1ZYPA 3QOUA 2IPAA 3C7MA 3HA9A 11GSA 2YNXA 3APSA 5ECHB 1EGOA 1ZZYA 4GRFA 1X9MB 2XPDA 2P0GA 4D73A 1FB6A 2VCQA 1RK4A 3FW2A 1GUHA 2HT9A 3NIVA 5KOXA 2CX3A 5J5NA 1OAZA 3TRXA 4HU7A 2I1UA 2HRKA 2H1BA 4TR0A 5J41A 3FR3A 2V6OA 2L4QA 1SD9A 1QUWA 3GNJA 5JWRB 1DBYA 1AQVA 2BTOT 3H8QA 4NXIA 5ECKB 4I5QA 2AJQB 2B6MA 4BA7A 3KXOA 1V40A 3D22A 2HNLA 1F2EA 5DALB 2L6DA 4MMMA 3GX0A 3DVXA 1J08A 2H72A 2KUCA 4FO5A 3MDKA 3TB2A 4EKZA 1T3BA 4JBBA 4ISDA 1MTCA 3QMXA 4YQUA 1VF2A 4XTSA 4KX4A 4ECBA 1K3LA 3IOSA 2R6KA 1GTAA 3KMOA 3PR8A 2CAIA 4TR1B 2JSZA 3KD0A 5C00A 1SD8A 1S3CA 4K6XA 1B9XC 3EWLA 2N5AA 3C1SA 1RQMA 2M80A 2H6ZA 1B9YC 1DUGA 2LJRA 2YV9A 4LMWA 2MYGA 1Q98A 4XS6A 4GCIA 5D93A 5IM9A 3IAS2 5J9BA 1YY7A 1WRYA 2LV3A 5IMVA 1O7UA 3G9BA 1JZWA 1AAZA 3L78A 5IPGA 2MMNA 1M9BA 2D2ZA 2VL3A 2H76A 3BOAA 5ECOB 3I9V2 1G6YA 3GSTA 1ML6A 1F37A 4POKA 2YPMA 3DEXA 3UOMA 1EP8A 3IK7A 4OFMA 3VPQA 1ABAA 4P3YB 2VAFA 4BVYB 4BWQA 4KSOA 2VM1A 2UZ8A 5BMUA 1BEDA 4MABA 4HJ2A 1PA3A 2C0FA 2VD0A 4IQAA 2VM2A 4PQ1A 1LBKA 1VF4A 1QQ2A 3RPPA 5G5FA 1YEXA 3UVTA 2OBKA 4J56E 4F0CA 3WGDA 3QAVA 1F3AA 3GKXA 2KP1A 4QL7A 2C8UA 2CVDA 3I43A 2PUKC 4XS1A 4BVXB 2HSMA 1UA5A 3GRXA 4TRXA 18GSA 5F8BA 3U5RE 4TVEA 5D9XA 4Q5NA 1EOHA 2NBSA 12GSA 1TXXA 1PGTA 4KDXA 5CREA 1BQ7A 4I97A 4OFTA 3M1GA 2L5OA 1XFLA 5LNKe 3F3QA 4POLA 1QK8A 4XIHA 2QA1A 2C4JA 4PUAA 2X64A 2IWTA 4V1Ag 3ZMKA 4L8EA 1BYEA 1FOHA 3FZ9A 5CYYA 2YP6A 4EDYA 1EEMA 3EVIA 2X8CA 2VD1A 2OE3A 2NVLA 3KJYA 2P5RA 5EVOA 4MZWA 2GQMA 3LSZA 1PN9A 1USBA 3ERFA 4YQVA 1SK2A 4YH2A 5COHA 5IMCA 3TOTA 2JL4A 3DWVA 4DEJA 1X9SB 3DYRA 2DIYA 1F6MC 4FH8A 4JRRA 4PURA 3L9VA 4IJIA 3VURA 5IMDA 7GSSA 3P90A 2G0FA 4H86A 4TKYA 2XPEA 2LS5A 4O5UA 2RIIA 3ED3A 5JCWA 1XPVA 1JLVA 2QSIA 3ERGA 1YDKA 3EMXA 4A5PA 3IC4A 3EC3A
chains in the Genus database with same CATH topology
3VI5A 4ECIA 4KE3A 2ON7A 2A2SA 1XWCA 4N0ZA 4WXTA 3IR4A 3TDGA 1GL8A 2HFDA 1ZMAA 2PPTA 4ZIJA 1SYXA 4NWYA 1X0RA 3IE3A 2YN1A 1SKSB 2DBCA 5GSTA 2FA8A 2EIQA 4L5LA 4F9ZA 1FB0A 1EWXA 4JU5A 4F2IA 1TRSA 1PRXA 2VO4A 4PTSA 3LGCA 5KN2A 4FQUA 1R5PA 1OE8A 3DXBA 3DIEA 4O5RA 3G7YA 2DJ1A 1GUMA 4PQHA 4GQFA 2LJAA 1SJZA 3UARA 1O8XA 4MH2A 2PGTA 3DVWA 1WP0A 1R5AA 1B4PA 5DVBA 1QXHA 4EO3A 5C04A 4K2DA 1AC1A 3KTBA 6GSYA 1GSEA 1FW1A 5D9WA 1SENA 1XW9A 4CDOA 2FGXA 2H6YA 3GKKA 1THXA 2WFCA 4POMA 2YWIA 6GSWA 2VCTA 4F0BA 3F9UA 5HFKA 1YKAA 6GSTA 5HFIA 3KM6A 2J9HA 1YJ6A 4MZBA 1SKWB 3G7IA 3HCZA 2X4AA 4ZL7A 1LU4A 2B5YA 2LUSA 1OC9B 4EXJA 1ZOFA 5IO2A 5B6NA 1V2AA 2PU9C 3LG6A 5HR0A 4KGIA 5KN3A 3UMAA 1ST9A 2MZCA 1V58A 3A2XA 1W89A 5IQYA 3SBCA 4O7HA 5D8IA 3ZVJA 2L6CA 4LL1B 1TK5B 5H5RA 1U88A 4IW9A 1XXUA 3CRTA 3JCML 1ZGNA 1OC8A 5J9CA 5FHIA 4CW9A 5IOXA 4Z2UA 4FIWA 3EPTA 3GV1A 5F07A 3CTGA 5GAPD 2X8HA 2C3QA 2VLUA 4I2UA 3VI7A 1EP7A 3ZREA 4BVYA 3N5OA 5CO3A 2HRFA 4PNGA 2IMDA 2B1KA 2B5EA 2GSSA 1ILOA 1FG4A 5F05A 2YJHA 4PUFC 3VK9A 4ID0A 2HLSA 4KW6A 1Y6EA 1I5GA 4OCFA 2WDUA 1K0CA 4HU9A 1OYJA 3HVXA 4F03A 1PD21 4O92A 3F4SA 4ZB6A 5AGYA 1NM3A 1CQHA 3GL5A 5HR3A 2H73A 2IIYA 2JSYA 1PQNA 1ACVA 3IXRA 4ILFA 4IKHA 3CTFA 3IPZA 2IMFA 4HS1A 2O85A 1TDIA 1B8XA 1HYUA 3A5IA 4O5QA 2A4VA 1OE7A 2DMMA 3FK8A 1K0OA 3ME8A 2C0EA 2LQQA 2M72A 2DMLA 3L4NA 4PX1A 2IJYA 3RHCA 3GKMA 2MBSA 4HDEA 2GVPA 3IHQA 2H74A 1PX7A 2IMKA 2V1MA 3V1WA 1A0FA 3SWLA 4MF5A 1GLPA 2VLTA 1S3DA 1GSUA 1EZKA 4GTUA 2YANA 4AJ8A 2NPBA 4OO5A 3FR6A 1SL1B 3QAGA 4OWYA 4AGSA 2ZUPA 2V41A 3FZ5A 4EIPA 2HXKA 3MIXA 1TOFA 2GTUA 3TJKA 5B8AA 4ECJA 4BL7B 2RM6A 1R26A 1DE2A 3TRQA 2FD3A 1XWAA 2VL2A 3QD9A 5G1LA 1TK8B 3RDWA 5ABRA 4RUVA 3BD2A 2REMA 1T8EB 3KGKA 4X0XA 2H01A 4Z2TA 3L9UA 1E6BA 3ZITA 3ZL5A 4O32A 3W8SA 2C80A 1K0MA 4KB3A 3GSSA 3MSZA 3D21A 3ZFBA 2H0GA 3GX8A 2I4AA 3LFLA 3LXZA 1GSFA 1SK0A 1F3BA 2Z9SA 5CRWA 1UN2A 1U6TA 6GSVA 1XOBA 4MF6A 4BWSA 2MBTA 5A5KA 2OACA 3O6TA 3GURA 2B5XA 3MWHA 4DSSB 5ECNB 5F06A 1TW9A 3TUEA 2O87A 1W4VA 3QFAC 1OVNA 2DLXA 3KEBA 1DE1A 5DJMA 5FT3A 2GQKA 2A2PA 2CVKA 2RUFA 1X9WB 1PKWA 2E2MA 3VWVA 2YV7A 3H4KA 2GS3A 5B7CA 2EIRA 4KCEA 4EF0A 1AUCA 1Z5YE 4XRDA 1OC3A 5DQYA 3TGZA 1C72A 3ZIVA 4AF2A 3HY2A 3DMLA 3QAWA 3TKSA 1T4ZA 1SYRA 2HRAA 3BCIA 4YAVA 4V1Ap 2OADA 5CRGA 4KF9A 1TRVA 2K9FA 2CVBA 3LEFA 4NHZA 3GA4A 3F8UA 1OC9A 4RQRA 5IMAA 1J0FA 1UVZA 2H0IA 3UEMA 3APOA 3LXTA 1ZYQB 2WJUA 4MH3A 1GSQA 2YJ7A 2F51A 4GSTA 1PSQA 2MMZA 3RAZA 5D96A 3ISOA 1J9BA 4NMUA 5GAND 1JZRA 4PXOA 3F3RA 2H1AA 1Z9HA 5DCHA 3QCPA 4X4JA 4MDCA 3HVSA 4IBPA 3CYNA 4TN8A 2YCDA 3FRCA 4IP6A 3GH6A 1X5CA 4OCEA 4Z2RA 2V6KA 2VOCA 4CY6A 1BJXA 3HJMA 3CSJA 2WRTA 3HD5A 4IELA 3LORA 2LRTA 2YZHA 3EE2A 3ZVJD 5CP1A 2HSYA 1G6WA 3RPNA 5AIXA 5AN1A 3TKRA 3Q6OA 1T7PB 3UL3A 1YQ1A 3Q74A 4J57E 2YWOA 1K0BA 4JEDA 2H71A 5D73A 5IMFA 2GZYA 3VWUA 4GQCA 3F4RA 1JZDA 1M2BA 4G2EA 3BBYA 2CZ2A 2LSTA 4N10A 2FWGA 3RBTA 4Z7XA 3FZAA 1TRWA 1GUKA 2KOKA 3LWAA 3CSIA 3KP9A 3UJ1A 1YF0A 5ID2A 3FMWA 2N5FA 3HKRA 4I2TA 4KNDA 3VPTA 2R4VA 4FYCA 3FHKA 3EINA 2FWEA 2RM5A 2X49A 3C71A 3IDVA 1M0UA 1O6JA 1THOA 4OD7A 4Q5FA 1K3OA 2B1LA 4XCSA 3ZTLA 2K6VA 4XS4B 1PKZA 1JLWA 2LEGA 2DKHA 2IN3A 1A23A 4XRAA 1BX9A 2ALBA 3F6FA 1QFNA 4GLTA 2L5LA 5HQPA 2P31A 3A2VA 2CA8A 2IFQB 2O8VB 4PGTA 5J3RA 4DSRA 2DJ3A 1GTBA 3GKNA 4L5OA 3TOUA 3W8JA 4G9HA 2C3TA 3TKQA 4CHSA 1ZL9A 3HZ4A 3APQA 1AW9A 1GNWA 3K8NA 1O73A 2B3SA 4Q5QA 5ECLB 1M2DA 1XWKA 4NHWA 3D4MA 4XHMA 1TU7A 1VF1A 2H0HA 3US3A 4D73B 4HJMA 3W6GA 4WBJA 4K7OA 5J4UA 1X5EA 2CZ3A 4KSMA 5IO0A 3KMNA 3E0UA 3IHGA 3KP8A 3C73A 4WR4A 3CBUA 1SJIA 3RHBA 3HZ8A 1KTEA 3TJBA 1WMJA 4OO4A 1T4YA 4HZ2A 3F0IA 3QPMA 2VCVA 3FR9A 3KH7A 3PGTA 1GTIA 4WR5A 1TP9A 3TJFA 3H93A 3UAPA 3LW9A 3WT2A 4ZB9A 5INYA 1BG5A 1QGVA 2DJJA 5DALA 4K0NA 3ZIJA 4GSSA 4E8EA 4RI6A 3M8NA 4WETA 1GWCA 1EOGA 4ACSA 1HQOA 1K0DA 5ECRB 1SKRB 3HDCA 4TR4A 3J7Yb 2F9SA 13GSA 2OBIA 2HI7A 1SL2B 2H70A 3CXGA 4IGJA 5ECIB 2H8LA 2X8GA 3M9KA 2R0GA 5JCGA 1ERWA 4TR1A 2FA4A 3P7XA 4WKWA 2DJ2A 10GSA 2KHPA 3WT1A 1TI3A 5DDLA 4EUYA 3GL3A 3J7Yk 3C8EA 1JFUA 3QFBC 9GSSA 3IC8A 1Z3EA 3ZLPA 1XIYA 3IV4A 1E2YA 2EIOA 2PVOC 2GZZA 8GSSA 3EMPA 1NHYA 1F9MA 2PN8A 1WOUA 3ME7A 1KBNA 4YKFA 2VIMA 1K3YA 3CSHA 1Z6NA 4N0VA 3UIWA 4NPBA 4G0LA 4KH7A 2F3MA 1XOAA 2VCWA 3BCKA 5AIVA 1U87A 2IMEA 4JZQA 4DSQA 3P8WA 1FO5A 4BPYA 4TXOB 1WIKA 3GTUB 3M9JA 1TTZA 2QGVA 3F4TA 3TJJA 2QKEA 2C0GA 4EL1A 3HVVA 2A2RA 2F8FA 2NDOA 2RUEA 2DSAA 2AAWA 3HXSA 1WWJA 4ZILA 4X1UA 5JWOB 5A4WA 4V2MA 2FLSA 1SK1A 3IAM2 2GSTA 20GSA 3DD3A 5IOWA 1XVWA 2B7JA 4BVXA 1GSDA 1TI1A 4MPGA 2L57A 3D0ZA 5BRTA 4K0GA 5B8BA 3IBHA 1Y25A 3FYGA 2J23A 5B6MA 2OE0A 4JR6A 2BMXA 4L0WA 4KDYA 2YWMA 1S3AA 4IN0A 4GSNA 5G5EA 4G10A 4EC0A 4L0UA 3L0HA 3VFIA 2ES7A 5H5SA 2MMAA 3R3EA 1MD3A 3KIJA 2I9HA 1XWGA 4RQXA 5ELGA 2HZEB 6GSXA 6GSSA 3M0FA 2C0DA 3LJRA 1ZYNA 1A2JA 4RI7A 3QR6A 3D6IA 4XS4A 5G1KA 2A4HA 3GFKA 3MAKA 4K7IA 4WBRD 1TU8A 3KTLA 4MPFA 1MEKA 5DAKB 3FZ4A 2IFQA 2PBJA 2K8SA 4ICYA 3VWWA 3F63A 5A4UA 4KDUA 3GN3A 2GGTA 4YAPA 1AXDA 6GSUA 2XBIA 4TXVA 4MK3A 3I6AA 2XHFA 5ECSA 1AQWA 1R4WA 1V98A 4N11A 4J2FA 2XC2A 2AV4A 4GF0A 2ZCTA 1NSWA 3HHVA 3UBLA 2LTKA 3H1NA 2K8VA 1G0TA 3ZRDA 3C1RA 5DBQA 2HYXA 3EURA 4GXZA 2FWHA 2X99A 3TJGA 4MF7A 5D9VA 2GZPA 3PH9A 3QDNA 1B4QA 3HJPA 3D5JA 3GMFA 2H30A 5D9TA 1K0AA 1T00A 1YEPA 3LYKA 5EL8A 3P2AA 3EU3A 17GSA 4IVFA 2DC5A 2O7KA 2E2GA 3M3MA 2HSHA 2I81A 4LA1A 5G30A 4HQZA 2JU5A 5G2ZA 2CX4A 1RW1A 1KNGA 1GRXA 2LJKA 1Z6MA 1PN0A 1WJKA 4KA0A 1XWBA 3HYPA 1T1VA 1ERTA 3NOFA 3WYWA 2H19A 1VF3A 4KCAA 2M46A 2R0CA 4MLYA 22GSA 2H66A 1TJDA 1V9WA 4IHUA 1YF1A 4FYUA 2WULA 2G2QA 1AQXA 2GDRA 1LJRA 4HQSA 2FNOA 4ZBBA 1WE0A 1SL0B 1M9AA 4HI7A 4V2LA 4K2XA 4AJ6A 5E4WA 2DKIA 5ECQB 3GHAA 5GZZB 4LMVA 2H75A 1JZOA 2O89A 2TRCP 1CQGA 1WPIA 1XCCA 5E59A 3PINA 4GWRA 4K9ZA 3WD6A 2FWFA 2WGRA 5L71A 3UVHA 2AB6A 5DJLA 3KH9A 4N30A 2GQLA 4X43A 2K18A 1KEBA 1TRUA 2VL9A 4TOPA 3TRPA 1A0RP 2XBQA 3GYKA 5JWQB 4YKGA 2R5GA 4WF4A 16GSA 3R2QA 4TXOA 3GTUA 4KUNA 5ECMB 3FEUA 19GSA 2RLIA 3ZMLA 3WGXA 5JCUA 4YQMA 3ZZXA 3MNGA 4EDZA 3DRNA 4MZCA 5KN1A 2AYTA 1Z7RA 3F6DA 1MD4A 2R3XA 2FHEA 2C3NA 2DIZA 3IRAA 1B48A 1PL1A 3TCOA 2V32A 5CRHA 4K5RA 2WCIA 2WB9A 2N5BA 1XBSA 1X5DA 2VL2C 4MNNA 4KAEA 2H6XA 2V2GA 2CAQA 2GT6A 4HUAA 4AJ7A 3L9SA 3KZQA 4EIQA 2PWJA 3GIXA 4MJCA 1JHBA 1GP1A 3A2WA 3AY8A 3FY7A 4MJBA 4ML1A 1ZCPA 2TRXA 4IJ3A 2LQOA 3CMIA 2FCHA 1K0NA 5ECPB 1XW6A 3CRUA 1M99A 2DJKA 2OE1A 1MDJA 1TK0B 1DSBA 5IIZA 1H4OA 2VUPA 3TKPA 5IPHA 1VRSD 1G7EA 4LLRA 2HZEA 2OKAA 1M2AA 1XW5A 3UBKA 1IYIA 4QL9A 5AISA 2YZUA 2H1DA 1GSYA 3D4TA 1GULA 2E0QA 3A5WA 4I6XA 4HZ4A 5CRDA 1GSSA 1FHEA 2B7KA 4JR4A 5G31A 3A3TA 4ZBDA 5DAKA 3G7JA 2F8AA 3U6VA 4K5SA 3NZNA 4K1FA 3Q18A 2GLRA 2H1GA 1O8WA 4PQIA 4BL7A 1FOVA 1N8JA 3HJOA 1YZXA 4ZXGA 3WGEA 1Q4JA 2HZFA 3FKFA 3H79A 4ZL9A 1VGLA 2VLVA 4ZB8A 1N2AA 1BAYA 3TKSC 4MP4A 1O85A 5GSSA 3E9JB 5DQSA 3EU4A 4DVCA 2WS2A 3LYPA 2CV4A 5IMZA 3ZYWA 4V2NA 2YOIA 1NW2A 1SU9A 4IQ1A 2VCZA 4HEA2 1UC7A 2CQ9A 4HOJA 2R37A 3Q19A 5EY6A 4DSSA 1FVKA 1A2MA 1FVJA 1PL2A 1ON4A 3OR5A 2R2JA 3VWXA 3I69A 4ZBAA 3EYTA 4E8HA 3MYDA 1HNAA 2AUVA 2AHEA 2OA7A 1FAAA 1U3AA 4MJAA 2P5QA 4IP1A 3BJ5A 1OKTA 4CY8A 3TKSE 2R0PA 4ECCA 2JZRA 3KCMA 2DJ0A 2LRNA 1PMTA 1A2LA 1YKCA 3O76A 1O81A 2CT6A 2FY6A 1H75A 2NTOA 3GH9A 4LL4B 1HNCA 1EV4A 2LKUA 2JZTA 4NV2A 4F82A 2I3YA 4ML6A 4OFNA 2JADA 4OMVA 2WZ9A 1GTUA 4JE1A 5KEJA 5ENUA 4K8MA 4USSA 4G19A 1QMVA 3LQ7A 2IMIA 3ERWA 2L59A 5ELAA 4WF5A 1ZYEA 4TR3A 5HR1A 2LNTA 1ERVA 2KLXA 1HD2A 4QQ7A 3E3EA 2OJLA 2IL3A 4MA9A 3VLNA 1OKDA 4G0IA 2GSRA 2GSQA 2GT5A 3S9FA 2LRCA 4PNFA 4POBA 3ZFLA 3PPUA 14GSA 5KOWA 2YWNA 3DKSA 4NV5A 1V57A 4Q5RA 5FWGA 5DCGA 2PMTA 1URMA 2KP2A 1EGRA 2HE3A 4NAXA 2VCXA 2PERA 1G7OA 5A4VA 2JACA 1PX6A 4K7NA 1XVQA 4MCUA 4TW5A 2C1YA 1EEJA 1MDKA 5ID2B 4MJEA 1AIUA 1MDIA 2PVQA 1GNEA 3IA1A 1Z7PA 2JZSA 2L4CA 3N9JA 2QC7A 1HNBA 1IYHA 2QA2A 1XZOA 4G0KA 1GH2A 5LCZA 5F0GA 2HRNA 5LD0A 2EC4A 4EE0A 1A24A 2E7PA 1R7HA 1GLQA 1A8YA 1TKDB 2ZNMA 1M7TA 4FYBA 1A8LA 1EV9A 3GUSA 1I9DA 5CNWA 5HFGA 3O3TA 4IS0A 2MMOA 3DGQA 1ERUA 5EPFA 1NHOA 3IK9A 4I8BA 4EVMA 5HR2A 2FUG2 5KN0A 1U3IA 2ON5A 5H5QA 2BJXA 4ZL8A 4WEYA 2LNSA 1SJ6A 4ULXA 5CAXA 2TIRA 1ZYPA 3QOUA 2IPAA 3C7MA 3HA9A 11GSA 2YNXA 3APSA 5ECHB 1EGOA 1ZZYA 4GRFA 1X9MB 2XPDA 2P0GA 4D73A 1FB6A 2VCQA 1RK4A 3FW2A 1GUHA 2HT9A 3NIVA 5KOXA 2CX3A 5J5NA 1OAZA 3TRXA 4HU7A 2I1UA 2HRKA 2H1BA 4TR0A 5J41A 3FR3A 2V6OA 2L4QA 1SD9A 1QUWA 3GNJA 5JWRB 1DBYA 1AQVA 2BTOT 3H8QA 4NXIA 5ECKB 4I5QA 2AJQB 2B6MA 4BA7A 3KXOA 1V40A 3D22A 2HNLA 1F2EA 5DALB 2L6DA 4MMMA 3GX0A 3DVXA 1J08A 2H72A 2KUCA 4FO5A 3MDKA 3TB2A 4EKZA 1T3BA 4JBBA 4ISDA 1MTCA 3QMXA 4YQUA 1VF2A 4XTSA 4KX4A 4ECBA 1K3LA 3IOSA 2R6KA 1GTAA 3KMOA 3PR8A 2CAIA 4TR1B 2JSZA 3KD0A 5C00A 1SD8A 1S3CA 4K6XA 1B9XC 3EWLA 2N5AA 3C1SA 1RQMA 2M80A 2H6ZA 1B9YC 1DUGA 2LJRA 2YV9A 4LMWA 2MYGA 1Q98A 4XS6A 4GCIA 5D93A 5IM9A 3IAS2 5J9BA 1YY7A 1WRYA 2LV3A 5IMVA 1O7UA 3G9BA 1JZWA 1AAZA 3L78A 5IPGA 2MMNA 1M9BA 2D2ZA 2VL3A 2H76A 3BOAA 5ECOB 3I9V2 1G6YA 3GSTA 1ML6A 1F37A 4POKA 2YPMA 3DEXA 3UOMA 1EP8A 3IK7A 4OFMA 3VPQA 1ABAA 4P3YB 2VAFA 4BVYB 4BWQA 2VM1A 2UZ8A 4KSOA 5BMUA 1BEDA 4MABA 4HJ2A 1PA3A 2C0FA 2VD0A 4IQAA 2VM2A 4PQ1A 1LBKA 1VF4A 1QQ2A 3RPPA 5G5FA 1YEXA 3UVTA 2OBKA 4J56E 4F0CA 3WGDA 3QAVA 1F3AA 3GKXA 2KP1A 4QL7A 2C8UA 2CVDA 3I43A 2PUKC 4XS1A 4BVXB 2HSMA 1UA5A 3GRXA 4TRXA 18GSA 5F8BA 3U5RE 4TVEA 5D9XA 4Q5NA 1EOHA 2NBSA 12GSA 1TXXA 1PGTA 4KDXA 5CREA 1BQ7A 4I97A 4OFTA 3M1GA 2L5OA 1XFLA 5LNKe 3F3QA 4POLA 1QK8A 4XIHA 2QA1A 2C4JA 4PUAA 2X64A 2IWTA 4V1Ag 3ZMKA 4L8EA 1BYEA 1FOHA 3FZ9A 5CYYA 2YP6A 4EDYA 1EEMA 3EVIA 2X8CA 2VD1A 2OE3A 2NVLA 3KJYA 2P5RA 5EVOA 4MZWA 2GQMA 3LSZA 1PN9A 1USBA 3ERFA 4YQVA 1SK2A 4YH2A 5COHA 5IMCA 3TOTA 2JL4A 3DWVA 4DEJA 1X9SB 3DYRA 2DIYA 1F6MC 4FH8A 4JRRA 4PURA 3L9VA 4IJIA 3VURA 5IMDA 7GSSA 3P90A 2G0FA 4H86A 4TKYA 2XPEA 2LS5A 4O5UA 2RIIA 3ED3A 5JCWA 1XPVA 1JLVA 2QSIA 3ERGA 1YDKA 3EMXA 4A5PA 3IC4A 3EC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI5 A;  4ECI A;  4KE3 A;  2ON7 A;  2A2S A;  1XWC A;  4N0Z A;  4WXT A;  3IR4 A;  3TDG A;  1GL8 A;  2HFD A;  1ZMA A;  2PPT A;  4ZIJ A;  1SYX A;  4NWY A;  1X0R A;  3IE3 A;  2YN1 A;  1SKS B;  2DBC A;  5GST A;  2FA8 A;  2EIQ A;  4L5L A;  4F9Z A;  1FB0 A;  1EWX A;  4JU5 A;  4F2I A;  1TRS A;  1PRX A;  2VO4 A;  3LGC A;  5KN2 A;  1R5P A;  1OE8 A;  3DXB A;  3DIE A;  4O5R A;  3G7Y A;  2DJ1 A;  1GUM A;  4PQH A;  4GQF A;  2LJA A;  1SJZ A;  3UAR A;  1O8X A;  4MH2 A;  2PGT A;  3DVW A;  1WP0 A;  1R5A A;  1B4P A;  5DVB A;  1QXH A;  4EO3 A;  5C04 A;  4K2D A;  1AC1 A;  3KTB A;  6GSY A;  1GSE A;  1FW1 A;  5D9W A;  1SEN A;  1XW9 A;  4CDO A;  2FGX A;  2H6Y A;  3GKK A;  1THX A;  2WFC A;  4POM A;  2YWI A;  6GSW A;  2VCT A;  4F0B A;  3F9U A;  5HFK A;  1YKA A;  6GST A;  5HFI A;  3KM6 A;  2J9H A;  1YJ6 A;  4MZB A;  1SKW B;  3G7I A;  3HCZ A;  4ZL7 A;  1LU4 A;  2B5Y A;  2LUS A;  1OC9 B;  4EXJ A;  1ZOF A;  5IO2 A;  5B6N A;  1V2A A;  2PU9 C;  3LG6 A;  5HR0 A;  4KGI A;  5KN3 A;  3UMA A;  1ST9 A;  2MZC A;  1V58 A;  3A2X A;  1W89 A;  5IQY A;  3SBC A;  4O7H A;  5D8I A;  3ZVJ A;  2L6C A;  4LL1 B;  1TK5 B;  5H5R A;  1U88 A;  4IW9 A;  1XXU A;  3CRT A;  3JCM L;  1ZGN A;  1OC8 A;  5J9C A;  5FHI A;  4CW9 A;  5IOX A;  4FIW A;  3GV1 A;  5F07 A;  3CTG A;  5GAP D;  2X8H A;  2C3Q A;  2VLU A;  4I2U A;  3VI7 A;  1EP7 A;  3ZRE A;  4BVY A;  3N5O A;  5CO3 A;  2HRF A;  4PNG A;  2IMD A;  2B1K A;  2B5E A;  2GSS A;  1ILO A;  1FG4 A;  5F05 A;  2YJH A;  4PUF C;  3VK9 A;  4ID0 A;  2HLS A;  4KW6 A;  1Y6E A;  1I5G A;  4OCF A;  2WDU A;  1K0C A;  4HU9 A;  1OYJ A;  3HVX A;  4F03 A;  1PD2 1;  4O92 A;  3F4S A;  4ZB6 A;  5AGY A;  1NM3 A;  1CQH A;  3GL5 A;  5HR3 A;  2H73 A;  2IIY A;  2JSY A;  1PQN A;  1ACV A;  3IXR A;  4ILF A;  4IKH A;  3CTF A;  3IPZ A;  2IMF A;  4HS1 A;  2O85 A;  1TDI A;  1B8X A;  1HYU A;  2A4V A;  1OE7 A;  2DMM A;  3FK8 A;  1K0O A;  3ME8 A;  2C0E A;  2LQQ A;  2M72 A;  2DML A;  3L4N A;  4PX1 A;  2IJY A;  3RHC A;  3GKM A;  2MBS A;  4HDE A;  2GVP A;  3IHQ A;  2H74 A;  1PX7 A;  2IMK A;  2V1M A;  3V1W A;  1A0F A;  3SWL A;  4MF5 A;  1GLP A;  2VLT A;  1S3D A;  1GSU A;  1EZK A;  4GTU A;  2YAN A;  4AJ8 A;  2NPB A;  4OO5 A;  3FR6 A;  1SL1 B;  3QAG A;  4OWY A;  4AGS A;  2ZUP A;  2V41 A;  3FZ5 A;  2HXK A;  1TOF A;  2GTU A;  3TJK A;  5B8A A;  4ECJ A;  2RM6 A;  1R26 A;  1DE2 A;  3TRQ A;  2FD3 A;  1XWA A;  2VL2 A;  3QD9 A;  5G1L A;  1TK8 B;  3RDW A;  5ABR A;  4RUV A;  3BD2 A;  2REM A;  1T8E B;  3KGK A;  4X0X A;  2H01 A;  3L9U A;  1E6B A;  3ZIT A;  3ZL5 A;  4O32 A;  3W8S A;  2C80 A;  1K0M A;  4KB3 A;  3GSS A;  3MSZ A;  3D21 A;  3ZFB A;  2H0G A;  3GX8 A;  2I4A A;  3LFL A;  3LXZ A;  1GSF A;  1SK0 A;  1F3B A;  2Z9S A;  5CRW A;  1UN2 A;  1U6T A;  6GSV A;  1XOB A;  4MF6 A;  4BWS A;  2MBT A;  5A5K A;  2OAC A;  3O6T A;  3GUR A;  2B5X A;  3MWH A;  4DSS B;  5ECN B;  5F06 A;  1TW9 A;  3TUE A;  2O87 A;  1W4V A;  3QFA C;  1OVN A;  2DLX A;  3KEB A;  1DE1 A;  5DJM A;  5FT3 A;  2GQK A;  2CVK A;  2RUF A;  1X9W B;  1PKW A;  2E2M A;  3VWV A;  2YV7 A;  3H4K A;  2GS3 A;  5B7C A;  2EIR A;  4KCE A;  4EF0 A;  1AUC A;  1Z5Y E;  4XRD A;  1OC3 A;  5DQY A;  3TGZ A;  1C72 A;  3ZIV A;  4AF2 A;  3HY2 A;  3DML A;  3QAW A;  3TKS A;  1T4Z A;  1SYR A;  3BCI A;  4YAV A;  4V1A p;  2OAD A;  5CRG A;  1TRV A;  2K9F A;  2CVB A;  3LEF A;  4NHZ A;  3GA4 A;  3F8U A;  1OC9 A;  4RQR A;  5IMA A;  1J0F A;  1UVZ A;  2H0I A;  3UEM A;  3APO A;  3LXT A;  1ZYQ B;  2WJU A;  4MH3 A;  1GSQ A;  2YJ7 A;  2F51 A;  4GST A;  1PSQ A;  2MMZ A;  3RAZ A;  5D96 A;  3ISO A;  1J9B A;  4NMU A;  5GAN D;  1JZR A;  4PXO A;  3F3R A;  2H1A A;  1Z9H A;  5DCH A;  3QCP A;  4MDC A;  3HVS A;  4IBP A;  3CYN A;  4TN8 A;  2YCD A;  3FRC A;  4IP6 A;  3GH6 A;  1X5C A;  4OCE A;  2V6K A;  2VOC A;  1BJX A;  3HJM A;  3CSJ A;  2WRT A;  3HD5 A;  4IEL A;  3LOR A;  2LRT A;  2YZH A;  3EE2 A;  3ZVJ D;  5CP1 A;  2HSY A;  1G6W A;  3RPN A;  5AIX A;  5AN1 A;  3TKR A;  3Q6O A;  1T7P B;  3UL3 A;  1YQ1 A;  3Q74 A;  4J57 E;  2YWO A;  1K0B A;  4JED A;  2H71 A;  5D73 A;  5IMF A;  2GZY A;  3VWU A;  4GQC A;  3F4R A;  1JZD A;  1M2B A;  4G2E A;  3BBY A;  2CZ2 A;  2LST A;  4N10 A;  2FWG A;  3RBT A;  4Z7X A;  3FZA A;  1TRW A;  1GUK A;  2KOK A;  3LWA A;  3CSI A;  3KP9 A;  3UJ1 A;  1YF0 A;  5ID2 A;  2N5F A;  3HKR A;  4I2T A;  4KND A;  3VPT A;  2R4V A;  4FYC A;  3FHK A;  3EIN A;  2FWE A;  2RM5 A;  3C71 A;  3IDV A;  1M0U A;  1O6J A;  1THO A;  4OD7 A;  4Q5F A;  1K3O A;  2B1L A;  4XCS A;  3ZTL A;  2K6V A;  4XS4 B;  1PKZ A;  1JLW A;  2LEG A;  2IN3 A;  1A23 A;  4XRA A;  1BX9 A;  2ALB A;  3F6F A;  1QFN A;  4GLT A;  2L5L A;  5HQP A;  2P31 A;  3A2V A;  2CA8 A;  2IFQ B;  2O8V B;  4PGT A;  5J3R A;  4DSR A;  2DJ3 A;  1GTB A;  3GKN A;  4L5O A;  3TOU A;  3W8J A;  4G9H A;  2C3T A;  3TKQ A;  4CHS A;  1ZL9 A;  3HZ4 A;  3APQ A;  1AW9 A;  1GNW A;  3K8N A;  1O73 A;  2B3S A;  4Q5Q A;  5ECL B;  1M2D A;  1XWK A;  4NHW A;  3D4M A;  4XHM A;  1TU7 A;  1VF1 A;  2H0H A;  3US3 A;  4D73 B;  4HJM A;  3W6G A;  4WBJ A;  4K7O A;  5J4U A;  1X5E A;  2CZ3 A;  4KSM A;  5IO0 A;  3KMN A;  3E0U A;  3KP8 A;  3C73 A;  4WR4 A;  3CBU A;  1SJI A;  3RHB A;  3HZ8 A;  1KTE A;  3TJB A;  1WMJ A;  4OO4 A;  1T4Y A;  4HZ2 A;  3F0I A;  3QPM A;  2VCV A;  3FR9 A;  3KH7 A;  3PGT A;  1GTI A;  4WR5 A;  1TP9 A;  3TJF A;  3H93 A;  3UAP A;  3WT2 A;  4ZB9 A;  5INY A;  1BG5 A;  1QGV A;  2DJJ A;  5DAL A;  4K0N A;  3ZIJ A;  4GSS A;  4E8E A;  4RI6 A;  3M8N A;  4WET A;  1GWC A;  1EOG A;  4ACS A;  1HQO A;  1K0D A;  5ECR B;  1SKR B;  3HDC A;  4TR4 A;  3J7Y b;  2F9S A;  13GS A;  2OBI A;  2HI7 A;  1SL2 B;  2H70 A;  3CXG A;  4IGJ A;  5ECI B;  2H8L A;  2X8G A;  3M9K A;  5JCG A;  1ERW A;  4TR1 A;  2FA4 A;  3P7X A;  4WKW A;  2DJ2 A;  10GS A;  2KHP A;  3WT1 A;  1TI3 A;  5DDL A;  4EUY A;  3GL3 A;  3J7Y k;  3C8E A;  1JFU A;  3QFB C;  9GSS A;  1Z3E A;  3ZLP A;  1XIY A;  3IV4 A;  1E2Y A;  2EIO A;  2PVO C;  2GZZ A;  8GSS A;  3EMP A;  1NHY A;  1F9M A;  2PN8 A;  1WOU A;  3ME7 A;  1KBN A;  2VIM A;  1K3Y A;  3CSH A;  1Z6N A;  4N0V A;  3UIW A;  4NPB A;  4KH7 A;  2F3M A;  1XOA A;  2VCW A;  3BCK A;  5AIV A;  1U87 A;  2IME A;  4JZQ A;  4DSQ A;  3P8W A;  1FO5 A;  4BPY A;  4TXO B;  1WIK A;  3GTU B;  3M9J A;  1TTZ A;  2QGV A;  3F4T A;  3TJJ A;  2QKE A;  2C0G A;  4EL1 A;  3HVV A;  2A2R A;  2F8F A;  2NDO A;  2RUE A;  2DSA A;  2AAW A;  3HXS A;  1WWJ A;  4ZIL A;  4X1U A;  5JWO B;  5A4W A;  4V2M A;  2FLS A;  1SK1 A;  3IAM 2;  2GST A;  20GS A;  3DD3 A;  5IOW A;  1XVW A;  2B7J A;  4BVX A;  1GSD A;  1TI1 A;  4MPG A;  2L57 A;  3D0Z A;  4K0G A;  5B8B A;  3IBH A;  1Y25 A;  3FYG A;  2J23 A;  5B6M A;  2OE0 A;  4JR6 A;  2BMX A;  4L0W A;  4KDY A;  2YWM A;  1S3A A;  4IN0 A;  4GSN A;  5G5E A;  4G10 A;  4EC0 A;  4L0U A;  3L0H A;  3VFI A;  2ES7 A;  5H5S A;  2MMA A;  1MD3 A;  3KIJ A;  2I9H A;  1XWG A;  4RQX A;  5ELG A;  2HZE B;  6GSX A;  6GSS A;  3M0F A;  2C0D A;  3LJR A;  1A2J A;  4RI7 A;  3QR6 A;  3D6I A;  4XS4 A;  5G1K A;  3GFK A;  3MAK A;  4K7I A;  4WBR D;  1TU8 A;  3KTL A;  4MPF A;  1MEK A;  5DAK B;  3FZ4 A;  2IFQ A;  2PBJ A;  2K8S A;  3VWW A;  3F63 A;  5A4U A;  4KDU A;  3GN3 A;  2GGT A;  4YAP A;  1AXD A;  6GSU A;  2XBI A;  4TXV A;  4MK3 A;  3I6A A;  2XHF A;  5ECS A;  1AQW A;  1R4W A;  1V98 A;  4N11 A;  4J2F A;  2XC2 A;  2AV4 A;  4GF0 A;  2ZCT A;  1NSW A;  3HHV A;  3UBL A;  2LTK A;  3H1N A;  2K8V A;  1G0T A;  3ZRD A;  3C1R A;  5DBQ A;  2HYX A;  3EUR A;  4GXZ A;  2FWH A;  2X99 A;  3TJG A;  4MF7 A;  5D9V A;  2GZP A;  3PH9 A;  3QDN A;  1B4Q A;  3HJP A;  3D5J A;  3GMF A;  2H30 A;  5D9T A;  1K0A A;  1T00 A;  1YEP A;  3LYK A;  5EL8 A;  3P2A A;  3EU3 A;  17GS A;  4IVF A;  2DC5 A;  2O7K A;  2E2G A;  3M3M A;  2HSH A;  2I81 A;  4LA1 A;  5G30 A;  4HQZ A;  2JU5 A;  5G2Z A;  2CX4 A;  1RW1 A;  1KNG A;  1GRX A;  2LJK A;  1Z6M A;  1WJK A;  4KA0 A;  1XWB A;  3HYP A;  1T1V A;  1ERT A;  3NOF A;  3WYW A;  2H19 A;  1VF3 A;  4KCA A;  2M46 A;  4MLY A;  22GS A;  2H66 A;  1TJD A;  1V9W A;  4IHU A;  1YF1 A;  4FYU A;  2WUL A;  2G2Q A;  1AQX A;  2GDR A;  1LJR A;  4HQS A;  2FNO A;  4ZBB A;  1WE0 A;  1SL0 B;  1M9A A;  4HI7 A;  4V2L A;  4AJ6 A;  5E4W A;  5ECQ B;  3GHA A;  5GZZ B;  4LMV A;  2H75 A;  1JZO A;  2O89 A;  2TRC P;  1CQG A;  1WPI A;  1XCC A;  5E59 A;  3PIN A;  4GWR A;  4K9Z A;  3WD6 A;  2FWF A;  2WGR A;  5L71 A;  3UVH A;  2AB6 A;  5DJL A;  3KH9 A;  4N30 A;  2GQL A;  4X43 A;  2K18 A;  1KEB A;  1TRU A;  2VL9 A;  4TOP A;  3TRP A;  1A0R P;  2XBQ A;  3GYK A;  5JWQ B;  2R5G A;  4WF4 A;  16GS A;  3R2Q A;  4TXO A;  3GTU A;  4KUN A;  5ECM B;  3FEU A;  19GS A;  2RLI A;  3ZML A;  3WGX A;  5JCU A;  4YQM A;  3ZZX A;  3MNG A;  4EDZ A;  3DRN A;  4MZC A;  5KN1 A;  2AYT A;  1Z7R A;  3F6D A;  1MD4 A;  2R3X A;  2FHE A;  2C3N A;  2DIZ A;  3IRA A;  1B48 A;  1PL1 A;  3TCO A;  2V32 A;  5CRH A;  2WCI A;  2WB9 A;  2N5B A;  1XBS A;  1X5D A;  2VL2 C;  4KAE A;  2H6X A;  2V2G A;  2CAQ A;  2GT6 A;  4HUA A;  4AJ7 A;  3L9S A;  3KZQ A;  2PWJ A;  3GIX A;  4MJC A;  1JHB A;  1GP1 A;  3A2W A;  3AY8 A;  3FY7 A;  4MJB A;  4ML1 A;  1ZCP A;  2TRX A;  4IJ3 A;  2LQO A;  3CMI A;  2FCH A;  1K0N A;  5ECP B;  1XW6 A;  3CRU A;  1M99 A;  2DJK A;  2OE1 A;  1MDJ A;  1TK0 B;  1DSB A;  5IIZ A;  1H4O A;  2VUP A;  3TKP A;  5IPH A;  1VRS D;  1G7E A;  4LLR A;  2HZE A;  2OKA A;  1M2A A;  1XW5 A;  3UBK A;  1IYI A;  4QL9 A;  5AIS A;  2YZU A;  2H1D A;  1GSY A;  3D4T A;  1GUL A;  2E0Q A;  3A5W A;  4I6X A;  4HZ4 A;  5CRD A;  1GSS A;  1FHE A;  2B7K A;  4JR4 A;  5G31 A;  3A3T A;  4ZBD A;  5DAK A;  3G7J A;  2F8A A;  3U6V A;  3NZN A;  4K1F A;  3Q18 A;  2GLR A;  2H1G A;  1O8W A;  4PQI A;  4BL7 A;  1FOV A;  1N8J A;  3HJO A;  1YZX A;  4ZXG A;  3WGE A;  1Q4J A;  2HZF A;  3FKF A;  3H79 A;  4ZL9 A;  1VGL A;  2VLV A;  4ZB8 A;  1N2A A;  1BAY A;  3TKS C;  4MP4 A;  1O85 A;  5GSS A;  3E9J B;  5DQS A;  3EU4 A;  4DVC A;  2WS2 A;  3LYP A;  2CV4 A;  5IMZ A;  3ZYW A;  4V2N A;  2YOI A;  1NW2 A;  1SU9 A;  4IQ1 A;  2VCZ A;  4HEA 2;  1UC7 A;  2CQ9 A;  4HOJ A;  2R37 A;  3Q19 A;  5EY6 A;  4DSS A;  1FVK A;  1A2M A;  1FVJ A;  1PL2 A;  1ON4 A;  3OR5 A;  2R2J A;  3VWX A;  3I69 A;  4ZBA A;  3EYT A;  4E8H A;  1HNA A;  2AUV A;  2AHE A;  2OA7 A;  1FAA A;  1U3A A;  4MJA A;  2P5Q A;  4IP1 A;  3BJ5 A;  1OKT A;  3TKS E;  4ECC A;  2JZR A;  3KCM A;  2DJ0 A;  2LRN A;  1PMT A;  1A2L A;  1YKC A;  3O76 A;  1O81 A;  2CT6 A;  2FY6 A;  1H75 A;  2NTO A;  3GH9 A;  4LL4 B;  1HNC A;  1EV4 A;  2LKU A;  2JZT A;  4NV2 A;  4F82 A;  2I3Y A;  4ML6 A;  4OFN A;  2JAD A;  4OMV A;  2WZ9 A;  1GTU A;  4JE1 A;  5KEJ A;  5ENU A;  4K8M A;  4G19 A;  1QMV A;  3LQ7 A;  2IMI A;  3ERW A;  2L59 A;  5ELA A;  4WF5 A;  1ZYE A;  4TR3 A;  5HR1 A;  2LNT A;  1ERV A;  2KLX A;  1HD2 A;  4QQ7 A;  3E3E A;  2OJL A;  2IL3 A;  4MA9 A;  3VLN A;  1OKD A;  2GSR A;  2GSQ A;  2GT5 A;  3S9F A;  2LRC A;  4PNF A;  4POB A;  3ZFL A;  14GS A;  2YWN A;  3DKS A;  4NV5 A;  1V57 A;  4Q5R A;  5FWG A;  5DCG A;  2PMT A;  1URM A;  2KP2 A;  1EGR A;  2HE3 A;  4NAX A;  2VCX A;  2PER A;  1G7O A;  5A4V A;  2JAC A;  1PX6 A;  4K7N A;  1XVQ A;  4MCU A;  4TW5 A;  2C1Y A;  1EEJ A;  1MDK A;  5ID2 B;  4MJE A;  1AIU A;  1MDI A;  2PVQ A;  1GNE A;  3IA1 A;  1Z7P A;  2JZS A;  2L4C A;  3N9J A;  2QC7 A;  1HNB A;  1IYH A;  1XZO A;  1GH2 A;  5LCZ A;  5F0G A;  2HRN A;  5LD0 A;  2EC4 A;  4EE0 A;  1A24 A;  2E7P A;  1R7H A;  1GLQ A;  1A8Y A;  1TKD B;  2ZNM A;  1M7T A;  4FYB A;  1A8L A;  1EV9 A;  3GUS A;  1I9D A;  5CNW A;  5HFG A;  3O3T A;  4IS0 A;  2MMO A;  3DGQ A;  1ERU A;  5EPF A;  1NHO A;  3IK9 A;  4I8B A;  4EVM A;  5HR2 A;  2FUG 2;  5KN0 A;  1U3I A;  2ON5 A;  5H5Q A;  2BJX A;  4ZL8 A;  4WEY A;  2LNS A;  1SJ6 A;  4ULX A;  5CAX A;  2TIR A;  3QOU A;  2IPA A;  3C7M A;  3HA9 A;  11GS A;  5ECH B;  2YNX A;  3APS A;  1EGO A;  1ZZY A;  4GRF A;  1X9M B;  2XPD A;  2P0G A;  4D73 A;  1FB6 A;  2VCQ A;  1RK4 A;  3FW2 A;  1GUH A;  2HT9 A;  3NIV A;  2CX3 A;  5J5N A;  1OAZ A;  3TRX A;  4HU7 A;  2I1U A;  2H1B A;  4TR0 A;  5J41 A;  3FR3 A;  2V6O A;  2L4Q A;  1SD9 A;  1QUW A;  3GNJ A;  5JWR B;  1DBY A;  1AQV A;  2BTO T;  3H8Q A;  4NXI A;  5ECK B;  4I5Q A;  2AJQ B;  2B6M A;  4BA7 A;  3KXO A;  1V40 A;  3D22 A;  2HNL A;  1F2E A;  5DAL B;  2L6D A;  4MMM A;  3GX0 A;  3DVX A;  1J08 A;  2H72 A;  2KUC A;  4FO5 A;  3MDK A;  3TB2 A;  4EKZ A;  1T3B A;  4JBB A;  4ISD A;  1MTC A;  3QMX A;  4YQU A;  1VF2 A;  4XTS A;  4KX4 A;  4ECB A;  1K3L A;  3IOS A;  2R6K A;  1GTA A;  3KMO A;  3PR8 A;  2CAI A;  4TR1 B;  2JSZ A;  3KD0 A;  5C00 A;  1SD8 A;  1S3C A;  4K6X A;  1B9X C;  3EWL A;  2N5A A;  3C1S A;  1RQM A;  2M80 A;  2H6Z A;  1B9Y C;  1DUG A;  2LJR A;  2YV9 A;  4LMW A;  2MYG A;  1Q98 A;  4XS6 A;  4GCI A;  5D93 A;  5IM9 A;  3IAS 2;  5J9B A;  1YY7 A;  1WRY A;  2LV3 A;  5IMV A;  1O7U A;  3G9B A;  1JZW A;  1AAZ A;  3L78 A;  5IPG A;  2MMN A;  1M9B A;  2D2Z A;  2VL3 A;  2H76 A;  3BOA A;  5ECO B;  3I9V 2;  1G6Y A;  3GST A;  1ML6 A;  1F37 A;  4POK A;  2YPM A;  3DEX A;  3UOM A;  1EP8 A;  3IK7 A;  4OFM A;  3VPQ A;  1ABA A;  4P3Y B;  2VAF A;  4BWQ A;  2VM1 A;  4KSO A;  1BED A;  4MAB A;  4HJ2 A;  1PA3 A;  2C0F A;  2VD0 A;  4IQA A;  2VM2 A;  4PQ1 A;  1LBK A;  1VF4 A;  1QQ2 A;  3RPP A;  5G5F A;  1YEX A;  3UVT A;  2OBK A;  4J56 E;  4F0C A;  3WGD A;  3QAV A;  1F3A A;  3GKX A;  2KP1 A;  4QL7 A;  2C8U A;  2CVD A;  3I43 A;  2PUK C;  4XS1 A;  3GRX A;  1UA5 A;  4TRX A;  18GS A;  5F8B A;  3U5R E;  4TVE A;  5D9X A;  4Q5N A;  1EOH A;  2NBS A;  12GS A;  1TXX A;  1PGT A;  4KDX A;  5CRE A;  1BQ7 A;  4I97 A;  4OFT A;  3M1G A;  2L5O A;  1XFL A;  5LNK e;  3F3Q A;  4POL A;  1QK8 A;  4XIH A;  2C4J A;  4PUA A;  2X64 A;  2IWT A;  4V1A g;  3ZMK A;  4L8E A;  1BYE A;  3FZ9 A;  5CYY A;  2YP6 A;  4EDY A;  1EEM A;  3EVI A;  2X8C A;  2VD1 A;  2OE3 A;  2NVL A;  3KJY A;  2P5R A;  5EVO A;  4MZW A;  2GQM A;  3LSZ A;  1PN9 A;  1USB A;  3ERF A;  4YQV A;  1SK2 A;  4YH2 A;  5COH A;  5IMC A;  3TOT A;  2JL4 A;  3DWV A;  4DEJ A;  1X9S B;  3DYR A;  2DIY A;  1F6M C;  4FH8 A;  4JRR A;  4PUR A;  3L9V A;  4IJI A;  3VUR A;  5IMD A;  7GSS A;  3P90 A;  2G0F A;  4H86 A;  4TKY A;  2XPE A;  2LS5 A;  2RII A;  3ED3 A;  5JCW A;  1XPV A;  1JLV A;  2QSI A;  3ERG A;  1YDK A;  3EMX A;  3IC4 A;  3EC3 A; 
#chains in the Genus database with same CATH topology
 3VI5 A;  4ECI A;  4KE3 A;  2ON7 A;  2A2S A;  1XWC A;  4N0Z A;  4WXT A;  3IR4 A;  3TDG A;  1GL8 A;  2HFD A;  1ZMA A;  2PPT A;  4ZIJ A;  1SYX A;  4NWY A;  1X0R A;  3IE3 A;  2YN1 A;  1SKS B;  2DBC A;  5GST A;  2FA8 A;  2EIQ A;  4L5L A;  4F9Z A;  1FB0 A;  1EWX A;  4JU5 A;  4F2I A;  1TRS A;  1PRX A;  2VO4 A;  4PTS A;  3LGC A;  5KN2 A;  4FQU A;  1R5P A;  1OE8 A;  3DXB A;  3DIE A;  4O5R A;  3G7Y A;  2DJ1 A;  1GUM A;  4PQH A;  4GQF A;  2LJA A;  1SJZ A;  3UAR A;  1O8X A;  4MH2 A;  2PGT A;  3DVW A;  1WP0 A;  1R5A A;  1B4P A;  5DVB A;  1QXH A;  4EO3 A;  5C04 A;  4K2D A;  1AC1 A;  3KTB A;  6GSY A;  1GSE A;  1FW1 A;  5D9W A;  1SEN A;  1XW9 A;  4CDO A;  2FGX A;  2H6Y A;  3GKK A;  1THX A;  2WFC A;  4POM A;  2YWI A;  6GSW A;  2VCT A;  4F0B A;  3F9U A;  5HFK A;  1YKA A;  6GST A;  5HFI A;  3KM6 A;  2J9H A;  1YJ6 A;  4MZB A;  1SKW B;  3G7I A;  3HCZ A;  2X4A A;  4ZL7 A;  1LU4 A;  2B5Y A;  2LUS A;  1OC9 B;  4EXJ A;  1ZOF A;  5IO2 A;  5B6N A;  1V2A A;  2PU9 C;  3LG6 A;  3HVN A;  5HR0 A;  4KGI A;  5KN3 A;  3UMA A;  1XG8 A;  1ST9 A;  2MZC A;  1V58 A;  3A2X A;  1W89 A;  5IQY A;  3SBC A;  4O7H A;  5D8I A;  3ZVJ A;  2L6C A;  4LL1 B;  1TK5 B;  5H5R A;  1U88 A;  4IW9 A;  1XXU A;  3CRT A;  3JCM L;  1ZGN A;  1OC8 A;  5J9C A;  5FHI A;  4CW9 A;  5IOX A;  4Z2U A;  4FIW A;  3EPT A;  3GV1 A;  5F07 A;  3CTG A;  5GAP D;  2X8H A;  2C3Q A;  2VLU A;  4I2U A;  3VI7 A;  1EP7 A;  3ZRE A;  4BVY A;  3N5O A;  5CO3 A;  2HRF A;  4PNG A;  2IMD A;  2B1K A;  2B5E A;  2GSS A;  1ILO A;  1FG4 A;  5F05 A;  2YJH A;  4PUF C;  3VK9 A;  4ID0 A;  2HLS A;  4KW6 A;  1Y6E A;  1I5G A;  4OCF A;  2WDU A;  1K0C A;  4HU9 A;  1OYJ A;  3HVX A;  4F03 A;  1PD2 1;  4O92 A;  3F4S A;  4ZB6 A;  5AGY A;  1NM3 A;  1CQH A;  3GL5 A;  5HR3 A;  2H73 A;  2IIY A;  2JSY A;  1PQN A;  1ACV A;  3IXR A;  4ILF A;  4IKH A;  3CTF A;  3IPZ A;  2IMF A;  4HS1 A;  2O85 A;  1TDI A;  1B8X A;  1HYU A;  3A5I A;  4O5Q A;  2A4V A;  1OE7 A;  2DMM A;  3FK8 A;  1K0O A;  3ME8 A;  2C0E A;  2LQQ A;  2M72 A;  2DML A;  3L4N A;  4PX1 A;  2IJY A;  3RHC A;  3GKM A;  2MBS A;  4HDE A;  2GVP A;  3IHQ A;  2H74 A;  1PX7 A;  2IMK A;  2V1M A;  3V1W A;  1A0F A;  3SWL A;  4MF5 A;  1GLP A;  2VLT A;  1S3D A;  1GSU A;  1EZK A;  4GTU A;  2YAN A;  4AJ8 A;  2NPB A;  4OO5 A;  3FR6 A;  1SL1 B;  3QAG A;  4OWY A;  4AGS A;  2ZUP A;  2V41 A;  3FZ5 A;  4EIP A;  2HXK A;  3MIX A;  1TOF A;  2GTU A;  3TJK A;  5B8A A;  4ECJ A;  4HSC X;  4BL7 B;  2RM6 A;  1R26 A;  1DE2 A;  3TRQ A;  2FD3 A;  1XWA A;  2VL2 A;  3QD9 A;  5G1L A;  1TK8 B;  3RDW A;  5ABR A;  4RUV A;  3BD2 A;  2REM A;  1T8E B;  3KGK A;  4X0X A;  2H01 A;  4Z2T A;  3L9U A;  1E6B A;  1PFO A;  3ZIT A;  3ZL5 A;  4O32 A;  3W8S A;  2C80 A;  1K0M A;  4KB3 A;  3GSS A;  3MSZ A;  3D21 A;  3ZFB A;  2H0G A;  3GX8 A;  2I4A A;  3LFL A;  3LXZ A;  1GSF A;  1SK0 A;  1F3B A;  2Z9S A;  5CRW A;  1UN2 A;  1U6T A;  6GSV A;  1XOB A;  4MF6 A;  4BWS A;  2MBT A;  5A5K A;  2OAC A;  3O6T A;  3GUR A;  2B5X A;  3MWH A;  4DSS B;  5ECN B;  5F06 A;  1S3R A;  1TW9 A;  3TUE A;  2O87 A;  1W4V A;  3QFA C;  1OVN A;  2DLX A;  3KEB A;  1DE1 A;  5DJM A;  5FT3 A;  2GQK A;  2A2P A;  2CVK A;  2RUF A;  1X9W B;  1PKW A;  2E2M A;  3VWV A;  2YV7 A;  3H4K A;  4BIK A;  2GS3 A;  5B7C A;  2EIR A;  4KCE A;  4EF0 A;  1AUC A;  1Z5Y E;  4XRD A;  1OC3 A;  5DQY A;  3TGZ A;  1C72 A;  3ZIV A;  4AF2 A;  3HY2 A;  3DML A;  3QAW A;  3TKS A;  1T4Z A;  1SYR A;  2HRA A;  3BCI A;  4YAV A;  4V1A p;  2OAD A;  5CRG A;  4KF9 A;  1TRV A;  2K9F A;  2CVB A;  3LEF A;  4NHZ A;  3GA4 A;  3F8U A;  1OC9 A;  4RQR A;  5IMA A;  1J0F A;  1UVZ A;  2H0I A;  3UEM A;  3APO A;  3LXT A;  1ZYQ B;  2WJU A;  4MH3 A;  1GSQ A;  2YJ7 A;  2F51 A;  4GST A;  1PSQ A;  2MMZ A;  3RAZ A;  5D96 A;  3ISO A;  1J9B A;  4NMU A;  5GAN D;  1JZR A;  4PXO A;  3F3R A;  2H1A A;  1Z9H A;  5DCH A;  3QCP A;  4X4J A;  4MDC A;  3HVS A;  4IBP A;  3CYN A;  4TN8 A;  2YCD A;  3FRC A;  4IP6 A;  3GH6 A;  1X5C A;  4OCE A;  4Z2R A;  2V6K A;  2VOC A;  4CY6 A;  1BJX A;  3HJM A;  3CSJ A;  2WRT A;  3HD5 A;  4IEL A;  3LOR A;  2LRT A;  2YZH A;  3EE2 A;  3ZVJ D;  5CP1 A;  2HSY A;  1G6W A;  3RPN A;  5AIX A;  5AN1 A;  3TKR A;  3Q6O A;  1T7P B;  3UL3 A;  1YQ1 A;  3Q74 A;  4J57 E;  2YWO A;  1K0B A;  4JED A;  2H71 A;  5D73 A;  5IMF A;  2GZY A;  3VWU A;  4GQC A;  3F4R A;  1JZD A;  1M2B A;  4G2E A;  3BBY A;  2CZ2 A;  2LST A;  4N10 A;  2FWG A;  3RBT A;  4Z7X A;  3FZA A;  1TRW A;  1GUK A;  2KOK A;  3LWA A;  3CSI A;  3KP9 A;  1M3I A;  3UJ1 A;  1YF0 A;  5ID2 A;  3FMW A;  2N5F A;  3HKR A;  4I2T A;  4KND A;  3VPT A;  2R4V A;  4FYC A;  3FHK A;  3EIN A;  2FWE A;  2RM5 A;  2X49 A;  3C71 A;  3IDV A;  1M0U A;  1O6J A;  1THO A;  4OD7 A;  4Q5F A;  1K3O A;  2B1L A;  4XCS A;  3ZTL A;  2K6V A;  4XS4 B;  1PKZ A;  1JLW A;  2LEG A;  2DKH A;  2IN3 A;  1A23 A;  4XRA A;  1BX9 A;  2ALB A;  3F6F A;  1QFN A;  4GLT A;  2L5L A;  5HQP A;  2P31 A;  3A2V A;  2CA8 A;  2IFQ B;  2O8V B;  4PGT A;  5J3R A;  4DSR A;  2DJ3 A;  1GTB A;  3GKN A;  4L5O A;  3TOU A;  3W8J A;  4G9H A;  2C3T A;  3TKQ A;  4CHS A;  1ZL9 A;  3HZ4 A;  3APQ A;  1AW9 A;  1GNW A;  3K8N A;  1O73 A;  2B3S A;  4Q5Q A;  5ECL B;  1M2D A;  1XWK A;  4NHW A;  3D4M A;  4XHM A;  1TU7 A;  1VF1 A;  2H0H A;  3US3 A;  4D73 B;  4HJM A;  3W6G A;  4WBJ A;  4K7O A;  5J4U A;  1X5E A;  2CZ3 A;  4KSM A;  5IO0 A;  3KMN A;  3E0U A;  3IHG A;  3KP8 A;  3C73 A;  4WR4 A;  3CBU A;  1SJI A;  3RHB A;  3HZ8 A;  1KTE A;  3TJB A;  1WMJ A;  4OO4 A;  1T4Y A;  4HZ2 A;  3F0I A;  3QPM A;  2VCV A;  3FR9 A;  3KH7 A;  3PGT A;  1GTI A;  4WR5 A;  1TP9 A;  3TJF A;  3H93 A;  3UAP A;  3LW9 A;  3WT2 A;  4ZB9 A;  5INY A;  1BG5 A;  1QGV A;  2DJJ A;  5DAL A;  4K0N A;  3ZIJ A;  4GSS A;  4E8E A;  4RI6 A;  3M8N A;  4WET A;  1GWC A;  1EOG A;  4ACS A;  1HQO A;  1K0D A;  5ECR B;  1SKR B;  3HDC A;  4TR4 A;  3J7Y b;  2F9S A;  13GS A;  2OBI A;  2HI7 A;  1SL2 B;  2H70 A;  3CXG A;  4IGJ A;  5ECI B;  2H8L A;  2X8G A;  3M9K A;  2R0G A;  5JCG A;  1ERW A;  4TR1 A;  2FA4 A;  3P7X A;  4WKW A;  2DJ2 A;  10GS A;  2KHP A;  3WT1 A;  1TI3 A;  5DDL A;  4EUY A;  3GL3 A;  3J7Y k;  3C8E A;  1JFU A;  3QFB C;  9GSS A;  3IC8 A;  1Z3E A;  3ZLP A;  1XIY A;  3IV4 A;  1E2Y A;  2EIO A;  2PVO C;  2GZZ A;  8GSS A;  3EMP A;  1NHY A;  1F9M A;  2PN8 A;  1WOU A;  3ME7 A;  1KBN A;  4YKF A;  2VIM A;  1K3Y A;  3CSH A;  1Z6N A;  4N0V A;  3UIW A;  4NPB A;  4G0L A;  4KH7 A;  2F3M A;  1XOA A;  2VCW A;  3BCK A;  5AIV A;  1U87 A;  2IME A;  4JZQ A;  4DSQ A;  3P8W A;  1FO5 A;  4BPY A;  4TXO B;  1WIK A;  3GTU B;  3M9J A;  1TTZ A;  2QGV A;  3F4T A;  3TJJ A;  2QKE A;  2C0G A;  4EL1 A;  3HVV A;  2A2R A;  2F8F A;  2NDO A;  2RUE A;  2DSA A;  2AAW A;  3HXS A;  1WWJ A;  4ZIL A;  4X1U A;  5JWO B;  5A4W A;  4V2M A;  2FLS A;  1SK1 A;  3IAM 2;  2GST A;  20GS A;  3DD3 A;  5IOW A;  1XVW A;  2B7J A;  4BVX A;  1GSD A;  1TI1 A;  4MPG A;  2L57 A;  3D0Z A;  5BRT A;  4K0G A;  5B8B A;  3IBH A;  1Y25 A;  3FYG A;  2J23 A;  5B6M A;  2OE0 A;  4JR6 A;  2BMX A;  4L0W A;  4KDY A;  2YWM A;  1S3A A;  4IN0 A;  4GSN A;  5G5E A;  4G10 A;  4EC0 A;  4L0U A;  3L0H A;  3VFI A;  2ES7 A;  5H5S A;  2MMA A;  3R3E A;  1MD3 A;  3KIJ A;  2I9H A;  1XWG A;  4RQX A;  5ELG A;  2HZE B;  6GSX A;  6GSS A;  3M0F A;  2C0D A;  3LJR A;  1ZYN A;  1A2J A;  4RI7 A;  3QR6 A;  3D6I A;  4XS4 A;  5G1K A;  2A4H A;  3GFK A;  3MAK A;  4K7I A;  4WBR D;  1TU8 A;  3KTL A;  4MPF A;  1MEK A;  5DAK B;  3FZ4 A;  2IFQ A;  2PBJ A;  2K8S A;  4ICY A;  3VWW A;  3F63 A;  5A4U A;  4KDU A;  3GN3 A;  2GGT A;  4YAP A;  1AXD A;  6GSU A;  2XBI A;  4TXV A;  4MK3 A;  3I6A A;  2XHF A;  5ECS A;  1AQW A;  1R4W A;  1V98 A;  4N11 A;  4J2F A;  2XC2 A;  2AV4 A;  4GF0 A;  2ZCT A;  1NSW A;  3HHV A;  3UBL A;  2LTK A;  3H1N A;  2K8V A;  1G0T A;  3ZRD A;  3C1R A;  5DBQ A;  2HYX A;  3EUR A;  4GXZ A;  2FWH A;  2X99 A;  3TJG A;  4MF7 A;  5D9V A;  2GZP A;  3PH9 A;  3QDN A;  1B4Q A;  3HJP A;  3D5J A;  3GMF A;  2H30 A;  5D9T A;  1K0A A;  1T00 A;  1YEP A;  3LYK A;  5EL8 A;  3P2A A;  3EU3 A;  17GS A;  4IVF A;  2DC5 A;  2O7K A;  2E2G A;  3M3M A;  2HSH A;  2I81 A;  4LA1 A;  5G30 A;  4HQZ A;  2JU5 A;  5G2Z A;  2CX4 A;  1RW1 A;  1KNG A;  1GRX A;  2LJK A;  1Z6M A;  1PN0 A;  1WJK A;  1M3J A;  4KA0 A;  1XWB A;  3HYP A;  1T1V A;  1ERT A;  3NOF A;  3WYW A;  2H19 A;  1VF3 A;  4KCA A;  2M46 A;  2R0C A;  4MLY A;  22GS A;  2H66 A;  1TJD A;  1V9W A;  4IHU A;  1YF1 A;  4FYU A;  2WUL A;  2G2Q A;  1AQX A;  2GDR A;  1LJR A;  4HQS A;  2FNO A;  4ZBB A;  1WE0 A;  1SL0 B;  1M9A A;  4HI7 A;  4V2L A;  4K2X A;  4AJ6 A;  5E4W A;  2DKI A;  5ECQ B;  3GHA A;  5GZZ B;  4LMV A;  2H75 A;  1JZO A;  2O89 A;  2TRC P;  1CQG A;  1WPI A;  1XCC A;  5E59 A;  3PIN A;  4GWR A;  4K9Z A;  3WD6 A;  2FWF A;  2WGR A;  5L71 A;  3UVH A;  2AB6 A;  5DJL A;  3KH9 A;  4N30 A;  2GQL A;  4X43 A;  2K18 A;  1KEB A;  1TRU A;  4TOP A;  2VL9 A;  3TRP A;  1A0R P;  2XBQ A;  3GYK A;  5JWQ B;  4YKG A;  2R5G A;  4WF4 A;  16GS A;  3R2Q A;  4TXO A;  3GTU A;  4KUN A;  5ECM B;  3FEU A;  19GS A;  2RLI A;  3ZML A;  3WGX A;  5JCU A;  4YQM A;  3ZZX A;  3MNG A;  4EDZ A;  3DRN A;  4MZC A;  5KN1 A;  2AYT A;  1Z7R A;  3F6D A;  1MD4 A;  2R3X A;  2FHE A;  2C3N A;  2DIZ A;  3IRA A;  1B48 A;  1PL1 A;  3TCO A;  2V32 A;  5CRH A;  4K5R A;  2WCI A;  2WB9 A;  2N5B A;  1XBS A;  1X5D A;  2VL2 C;  4MNN A;  4KAE A;  2H6X A;  2V2G A;  2CAQ A;  2GT6 A;  4HUA A;  4AJ7 A;  3L9S A;  3KZQ A;  4EIQ A;  2PWJ A;  3GIX A;  4MJC A;  1JHB A;  1GP1 A;  3A2W A;  3AY8 A;  3FY7 A;  4MJB A;  4ML1 A;  1ZCP A;  2TRX A;  4IJ3 A;  2LQO A;  3CMI A;  2FCH A;  1K0N A;  5ECP B;  1XW6 A;  3CRU A;  1M99 A;  2DJK A;  2OE1 A;  1MDJ A;  1TK0 B;  1DSB A;  5IIZ A;  1H4O A;  2VUP A;  3TKP A;  5IPH A;  1VRS D;  1G7E A;  4LLR A;  2HZE A;  2OKA A;  1M2A A;  1XW5 A;  3UBK A;  1IYI A;  4QL9 A;  5AIS A;  2YZU A;  2H1D A;  1GSY A;  3D4T A;  1GUL A;  2E0Q A;  3A5W A;  4I6X A;  4HZ4 A;  5CRD A;  1GSS A;  1FHE A;  2B7K A;  4JR4 A;  5G31 A;  3A3T A;  4ZBD A;  5DAK A;  3G7J A;  2F8A A;  3U6V A;  4K5S A;  3NZN A;  4K1F A;  3Q18 A;  2GLR A;  2H1G A;  1O8W A;  4PQI A;  4BL7 A;  1FOV A;  1N8J A;  3HJO A;  1YZX A;  4ZXG A;  3WGE A;  1Q4J A;  2HZF A;  3FKF A;  3H79 A;  4ZL9 A;  1VGL A;  2VLV A;  4ZB8 A;  1N2A A;  1BAY A;  3TKS C;  4MP4 A;  1O85 A;  5GSS A;  3E9J B;  5DQS A;  3EU4 A;  4DVC A;  2WS2 A;  3LYP A;  2CV4 A;  5IMZ A;  3ZYW A;  4V2N A;  2YOI A;  1NW2 A;  1SU9 A;  4IQ1 A;  2VCZ A;  4HEA 2;  1UC7 A;  2CQ9 A;  4HOJ A;  2R37 A;  3Q19 A;  5EY6 A;  4DSS A;  1FVK A;  1A2M A;  1FVJ A;  1PL2 A;  1ON4 A;  3OR5 A;  2R2J A;  3VWX A;  3I69 A;  4ZBA A;  3EYT A;  4E8H A;  3MYD A;  1HNA A;  2AUV A;  2AHE A;  2OA7 A;  1FAA A;  1U3A A;  4MJA A;  2P5Q A;  4IP1 A;  3BJ5 A;  1OKT A;  4CY8 A;  3TKS E;  2R0P A;  4ECC A;  2JZR A;  3KCM A;  2DJ0 A;  2LRN A;  1PMT A;  1A2L A;  1YKC A;  3O76 A;  1O81 A;  2CT6 A;  2FY6 A;  1H75 A;  2NTO A;  3GH9 A;  4LL4 B;  1HNC A;  1EV4 A;  2LKU A;  2JZT A;  4NV2 A;  4F82 A;  2I3Y A;  4ML6 A;  4OFN A;  2JAD A;  4OMV A;  2WZ9 A;  1GTU A;  4JE1 A;  5KEJ A;  5ENU A;  4K8M A;  4USS A;  4G19 A;  1QMV A;  3LQ7 A;  2IMI A;  3ERW A;  2L59 A;  5ELA A;  4WF5 A;  1ZYE A;  4TR3 A;  5HR1 A;  2LNT A;  1ERV A;  2KLX A;  1HD2 A;  4QQ7 A;  3E3E A;  2OJL A;  2IL3 A;  4MA9 A;  3VLN A;  1OKD A;  4G0I A;  2GSR A;  2GSQ A;  2GT5 A;  3S9F A;  2LRC A;  4PNF A;  4POB A;  3ZFL A;  3PPU A;  14GS A;  5KOW A;  2YWN A;  3DKS A;  4NV5 A;  1V57 A;  4Q5R A;  5FWG A;  5DCG A;  2PMT A;  1URM A;  2KP2 A;  1EGR A;  2HE3 A;  4NAX A;  2VCX A;  2PER A;  1G7O A;  5A4V A;  2JAC A;  1PX6 A;  4K7N A;  1XVQ A;  4MCU A;  4TW5 A;  2C1Y A;  1EEJ A;  1MDK A;  5ID2 B;  4MJE A;  1AIU A;  1MDI A;  2PVQ A;  1GNE A;  3IA1 A;  1Z7P A;  2JZS A;  2L4C A;  3N9J A;  2QC7 A;  1HNB A;  1IYH A;  2QA2 A;  1XZO A;  4G0K A;  1GH2 A;  5LCZ A;  5F0G A;  2HRN A;  5LD0 A;  2EC4 A;  4EE0 A;  1A24 A;  2E7P A;  1R7H A;  1GLQ A;  1A8Y A;  1TKD B;  2ZNM A;  1M7T A;  4FYB A;  1A8L A;  3CQF A;  1EV9 A;  3GUS A;  1I9D A;  5CNW A;  5HFG A;  3O3T A;  4IS0 A;  2MMO A;  3DGQ A;  1ERU A;  5EPF A;  1NHO A;  3IK9 A;  4I8B A;  4EVM A;  5HR2 A;  2FUG 2;  5KN0 A;  1U3I A;  2ON5 A;  5H5Q A;  2BJX A;  4ZL8 A;  4WEY A;  2LNS A;  1SJ6 A;  4ULX A;  5CAX A;  2TIR A;  1ZYP A;  3QOU A;  2IPA A;  3C7M A;  3HA9 A;  11GS A;  2YNX A;  3APS A;  5ECH B;  1EGO A;  1ZZY A;  4GRF A;  1X9M B;  2XPD A;  2P0G A;  4D73 A;  1FB6 A;  2VCQ A;  1RK4 A;  3FW2 A;  1GUH A;  2HT9 A;  3NIV A;  5KOX A;  2CX3 A;  5J5N A;  1OAZ A;  3TRX A;  4HU7 A;  2I1U A;  2HRK A;  2H1B A;  4TR0 A;  5J41 A;  3FR3 A;  2V6O A;  2L4Q A;  1SD9 A;  1QUW A;  3GNJ A;  5JWR B;  1DBY A;  1AQV A;  2BTO T;  3H8Q A;  4NXI A;  5ECK B;  4I5Q A;  2AJQ B;  2B6M A;  4BA7 A;  3KXO A;  1V40 A;  3D22 A;  2HNL A;  1F2E A;  5DAL B;  2L6D A;  4MMM A;  3GX0 A;  3DVX A;  1J08 A;  2H72 A;  2KUC A;  4FO5 A;  3MDK A;  3TB2 A;  4EKZ A;  1T3B A;  4JBB A;  4ISD A;  1MTC A;  3QMX A;  4YQU A;  1VF2 A;  4XTS A;  4KX4 A;  4ECB A;  1K3L A;  3IOS A;  2R6K A;  1GTA A;  3KMO A;  3PR8 A;  2CAI A;  4TR1 B;  2JSZ A;  3KD0 A;  5C00 A;  1SD8 A;  1S3C A;  4K6X A;  1B9X C;  3EWL A;  2N5A A;  3C1S A;  1RQM A;  2M80 A;  2H6Z A;  1B9Y C;  1DUG A;  2LJR A;  2YV9 A;  4LMW A;  2MYG A;  1Q98 A;  4XS6 A;  4GCI A;  5D93 A;  5IM9 A;  3IAS 2;  5J9B A;  1YY7 A;  1WRY A;  2LV3 A;  5IMV A;  1O7U A;  3G9B A;  1JZW A;  1AAZ A;  3L78 A;  5IPG A;  2MMN A;  1M9B A;  2D2Z A;  2VL3 A;  2H76 A;  3BOA A;  5ECO B;  3I9V 2;  1G6Y A;  3GST A;  1ML6 A;  1F37 A;  4POK A;  2YPM A;  3DEX A;  3UOM A;  1EP8 A;  3IK7 A;  4OFM A;  3VPQ A;  1ABA A;  4P3Y B;  2VAF A;  4BVY B;  4BWQ A;  4KSO A;  2VM1 A;  2UZ8 A;  5BMU A;  1BED A;  4MAB A;  4HJ2 A;  1PA3 A;  2C0F A;  2VD0 A;  4IQA A;  2VM2 A;  4PQ1 A;  1LBK A;  1VF4 A;  1QQ2 A;  3RPP A;  5G5F A;  1YEX A;  3UVT A;  2OBK A;  4J56 E;  4F0C A;  3WGD A;  3QAV A;  1F3A A;  3GKX A;  2KP1 A;  4QL7 A;  2C8U A;  2CVD A;  3I43 A;  2PUK C;  4XS1 A;  4BVX B;  2HSM A;  1UA5 A;  3GRX A;  4TRX A;  18GS A;  5F8B A;  3U5R E;  4TVE A;  5D9X A;  4Q5N A;  1EOH A;  2NBS A;  12GS A;  1TXX A;  1PGT A;  4KDX A;  5CRE A;  1BQ7 A;  4I97 A;  4OFT A;  3M1G A;  2L5O A;  1XFL A;  5LNK e;  3F3Q A;  4POL A;  1QK8 A;  4XIH A;  2QA1 A;  2C4J A;  4PUA A;  2X64 A;  2IWT A;  4V1A g;  3ZMK A;  4L8E A;  1BYE A;  1FOH A;  3FZ9 A;  5CYY A;  2YP6 A;  4EDY A;  1EEM A;  3EVI A;  2X8C A;  2VD1 A;  2OE3 A;  2NVL A;  3KJY A;  2P5R A;  5EVO A;  4MZW A;  2GQM A;  3LSZ A;  1PN9 A;  1USB A;  3ERF A;  4YQV A;  1SK2 A;  4YH2 A;  5COH A;  5IMC A;  3TOT A;  2JL4 A;  3DWV A;  4DEJ A;  1X9S B;  3DYR A;  2DIY A;  1F6M C;  4FH8 A;  4JRR A;  4PUR A;  3L9V A;  4IJI A;  3VUR A;  5IMD A;  7GSS A;  3P90 A;  2G0F A;  4H86 A;  4TKY A;  2XPE A;  2LS5 A;  4O5U A;  2RII A;  3ED3 A;  5JCW A;  1XPV A;  1JLV A;  2QSI A;  3ERG A;  1YDK A;  3EMX A;  4A5P A;  3IC4 A;  3EC3 A; 
#chains in the Genus database with same CATH homology
 3VI5 A;  4ECI A;  4KE3 A;  2ON7 A;  2A2S A;  1XWC A;  4N0Z A;  4WXT A;  3IR4 A;  3TDG A;  1GL8 A;  2HFD A;  1ZMA A;  2PPT A;  4ZIJ A;  1SYX A;  4NWY A;  1X0R A;  3IE3 A;  2YN1 A;  1SKS B;  2DBC A;  5GST A;  2FA8 A;  2EIQ A;  4L5L A;  4F9Z A;  1FB0 A;  1EWX A;  4JU5 A;  4F2I A;  1TRS A;  1PRX A;  2VO4 A;  4PTS A;  3LGC A;  5KN2 A;  4FQU A;  1R5P A;  1OE8 A;  3DXB A;  3DIE A;  4O5R A;  3G7Y A;  2DJ1 A;  1GUM A;  4PQH A;  4GQF A;  2LJA A;  1SJZ A;  3UAR A;  1O8X A;  4MH2 A;  2PGT A;  3DVW A;  1WP0 A;  1R5A A;  1B4P A;  5DVB A;  1QXH A;  4EO3 A;  5C04 A;  4K2D A;  1AC1 A;  3KTB A;  6GSY A;  1GSE A;  1FW1 A;  5D9W A;  1SEN A;  1XW9 A;  4CDO A;  2FGX A;  2H6Y A;  3GKK A;  1THX A;  2WFC A;  4POM A;  2YWI A;  6GSW A;  2VCT A;  4F0B A;  3F9U A;  5HFK A;  1YKA A;  6GST A;  5HFI A;  3KM6 A;  2J9H A;  1YJ6 A;  4MZB A;  1SKW B;  3G7I A;  3HCZ A;  2X4A A;  4ZL7 A;  1LU4 A;  2B5Y A;  2LUS A;  1OC9 B;  4EXJ A;  1ZOF A;  5IO2 A;  5B6N A;  1V2A A;  2PU9 C;  3LG6 A;  5HR0 A;  4KGI A;  5KN3 A;  3UMA A;  1ST9 A;  2MZC A;  1V58 A;  3A2X A;  1W89 A;  5IQY A;  3SBC A;  4O7H A;  5D8I A;  3ZVJ A;  2L6C A;  4LL1 B;  1TK5 B;  5H5R A;  1U88 A;  4IW9 A;  1XXU A;  3CRT A;  3JCM L;  1ZGN A;  1OC8 A;  5J9C A;  5FHI A;  4CW9 A;  5IOX A;  4Z2U A;  4FIW A;  3EPT A;  3GV1 A;  5F07 A;  3CTG A;  5GAP D;  2X8H A;  2C3Q A;  2VLU A;  4I2U A;  3VI7 A;  1EP7 A;  3ZRE A;  4BVY A;  3N5O A;  5CO3 A;  2HRF A;  4PNG A;  2IMD A;  2B1K A;  2B5E A;  2GSS A;  1ILO A;  1FG4 A;  5F05 A;  2YJH A;  4PUF C;  3VK9 A;  4ID0 A;  2HLS A;  4KW6 A;  1Y6E A;  1I5G A;  4OCF A;  2WDU A;  1K0C A;  4HU9 A;  1OYJ A;  3HVX A;  4F03 A;  1PD2 1;  4O92 A;  3F4S A;  4ZB6 A;  5AGY A;  1NM3 A;  1CQH A;  3GL5 A;  5HR3 A;  2H73 A;  2IIY A;  2JSY A;  1PQN A;  1ACV A;  3IXR A;  4ILF A;  4IKH A;  3CTF A;  3IPZ A;  2IMF A;  4HS1 A;  2O85 A;  1TDI A;  1B8X A;  1HYU A;  3A5I A;  4O5Q A;  2A4V A;  1OE7 A;  2DMM A;  3FK8 A;  1K0O A;  3ME8 A;  2C0E A;  2LQQ A;  2M72 A;  2DML A;  3L4N A;  4PX1 A;  2IJY A;  3RHC A;  3GKM A;  2MBS A;  4HDE A;  2GVP A;  3IHQ A;  2H74 A;  1PX7 A;  2IMK A;  2V1M A;  3V1W A;  1A0F A;  3SWL A;  4MF5 A;  1GLP A;  2VLT A;  1S3D A;  1GSU A;  1EZK A;  4GTU A;  2YAN A;  4AJ8 A;  2NPB A;  4OO5 A;  3FR6 A;  1SL1 B;  3QAG A;  4OWY A;  4AGS A;  2ZUP A;  2V41 A;  3FZ5 A;  4EIP A;  2HXK A;  3MIX A;  1TOF A;  2GTU A;  3TJK A;  5B8A A;  4ECJ A;  4BL7 B;  2RM6 A;  1R26 A;  1DE2 A;  3TRQ A;  2FD3 A;  1XWA A;  2VL2 A;  3QD9 A;  5G1L A;  1TK8 B;  3RDW A;  5ABR A;  4RUV A;  3BD2 A;  2REM A;  1T8E B;  3KGK A;  4X0X A;  2H01 A;  4Z2T A;  3L9U A;  1E6B A;  3ZIT A;  3ZL5 A;  4O32 A;  3W8S A;  2C80 A;  1K0M A;  4KB3 A;  3GSS A;  3MSZ A;  3D21 A;  3ZFB A;  2H0G A;  3GX8 A;  2I4A A;  3LFL A;  3LXZ A;  1GSF A;  1SK0 A;  1F3B A;  2Z9S A;  5CRW A;  1UN2 A;  1U6T A;  6GSV A;  1XOB A;  4MF6 A;  4BWS A;  2MBT A;  5A5K A;  2OAC A;  3O6T A;  3GUR A;  2B5X A;  3MWH A;  4DSS B;  5ECN B;  5F06 A;  1TW9 A;  3TUE A;  2O87 A;  1W4V A;  3QFA C;  1OVN A;  2DLX A;  3KEB A;  1DE1 A;  5DJM A;  5FT3 A;  2GQK A;  2A2P A;  2CVK A;  2RUF A;  1X9W B;  1PKW A;  2E2M A;  3VWV A;  2YV7 A;  3H4K A;  2GS3 A;  5B7C A;  2EIR A;  4KCE A;  4EF0 A;  1AUC A;  1Z5Y E;  4XRD A;  1OC3 A;  5DQY A;  3TGZ A;  1C72 A;  3ZIV A;  4AF2 A;  3HY2 A;  3DML A;  3QAW A;  3TKS A;  1T4Z A;  1SYR A;  2HRA A;  3BCI A;  4YAV A;  4V1A p;  2OAD A;  5CRG A;  4KF9 A;  1TRV A;  2K9F A;  2CVB A;  3LEF A;  4NHZ A;  3GA4 A;  3F8U A;  1OC9 A;  4RQR A;  5IMA A;  1J0F A;  1UVZ A;  2H0I A;  3UEM A;  3APO A;  3LXT A;  1ZYQ B;  2WJU A;  4MH3 A;  1GSQ A;  2YJ7 A;  2F51 A;  4GST A;  1PSQ A;  2MMZ A;  3RAZ A;  5D96 A;  3ISO A;  1J9B A;  4NMU A;  5GAN D;  1JZR A;  4PXO A;  3F3R A;  2H1A A;  1Z9H A;  5DCH A;  3QCP A;  4X4J A;  4MDC A;  3HVS A;  4IBP A;  3CYN A;  4TN8 A;  2YCD A;  3FRC A;  4IP6 A;  3GH6 A;  1X5C A;  4OCE A;  4Z2R A;  2V6K A;  2VOC A;  4CY6 A;  1BJX A;  3HJM A;  3CSJ A;  2WRT A;  3HD5 A;  4IEL A;  3LOR A;  2LRT A;  2YZH A;  3EE2 A;  3ZVJ D;  5CP1 A;  2HSY A;  1G6W A;  3RPN A;  5AIX A;  5AN1 A;  3TKR A;  3Q6O A;  1T7P B;  3UL3 A;  1YQ1 A;  3Q74 A;  4J57 E;  2YWO A;  1K0B A;  4JED A;  2H71 A;  5D73 A;  5IMF A;  2GZY A;  3VWU A;  4GQC A;  3F4R A;  1JZD A;  1M2B A;  4G2E A;  3BBY A;  2CZ2 A;  2LST A;  4N10 A;  2FWG A;  3RBT A;  4Z7X A;  3FZA A;  1TRW A;  1GUK A;  2KOK A;  3LWA A;  3CSI A;  3KP9 A;  3UJ1 A;  1YF0 A;  5ID2 A;  3FMW A;  2N5F A;  3HKR A;  4I2T A;  4KND A;  3VPT A;  2R4V A;  4FYC A;  3FHK A;  3EIN A;  2FWE A;  2RM5 A;  2X49 A;  3C71 A;  3IDV A;  1M0U A;  1O6J A;  1THO A;  4OD7 A;  4Q5F A;  1K3O A;  2B1L A;  4XCS A;  3ZTL A;  2K6V A;  4XS4 B;  1PKZ A;  1JLW A;  2LEG A;  2DKH A;  2IN3 A;  1A23 A;  4XRA A;  1BX9 A;  2ALB A;  3F6F A;  1QFN A;  4GLT A;  2L5L A;  5HQP A;  2P31 A;  3A2V A;  2CA8 A;  2IFQ B;  2O8V B;  4PGT A;  5J3R A;  4DSR A;  2DJ3 A;  1GTB A;  3GKN A;  4L5O A;  3TOU A;  3W8J A;  4G9H A;  2C3T A;  3TKQ A;  4CHS A;  1ZL9 A;  3HZ4 A;  3APQ A;  1AW9 A;  1GNW A;  3K8N A;  1O73 A;  2B3S A;  4Q5Q A;  5ECL B;  1M2D A;  1XWK A;  4NHW A;  3D4M A;  4XHM A;  1TU7 A;  1VF1 A;  2H0H A;  3US3 A;  4D73 B;  4HJM A;  3W6G A;  4WBJ A;  4K7O A;  5J4U A;  1X5E A;  2CZ3 A;  4KSM A;  5IO0 A;  3KMN A;  3E0U A;  3IHG A;  3KP8 A;  3C73 A;  4WR4 A;  3CBU A;  1SJI A;  3RHB A;  3HZ8 A;  1KTE A;  3TJB A;  1WMJ A;  4OO4 A;  1T4Y A;  4HZ2 A;  3F0I A;  3QPM A;  2VCV A;  3FR9 A;  3KH7 A;  3PGT A;  1GTI A;  4WR5 A;  1TP9 A;  3TJF A;  3H93 A;  3UAP A;  3LW9 A;  3WT2 A;  4ZB9 A;  5INY A;  1BG5 A;  1QGV A;  2DJJ A;  5DAL A;  4K0N A;  3ZIJ A;  4GSS A;  4E8E A;  4RI6 A;  3M8N A;  4WET A;  1GWC A;  1EOG A;  4ACS A;  1HQO A;  1K0D A;  5ECR B;  1SKR B;  3HDC A;  4TR4 A;  3J7Y b;  2F9S A;  13GS A;  2OBI A;  2HI7 A;  1SL2 B;  2H70 A;  3CXG A;  4IGJ A;  5ECI B;  2H8L A;  2X8G A;  3M9K A;  2R0G A;  5JCG A;  1ERW A;  4TR1 A;  2FA4 A;  3P7X A;  4WKW A;  2DJ2 A;  10GS A;  2KHP A;  3WT1 A;  1TI3 A;  5DDL A;  4EUY A;  3GL3 A;  3J7Y k;  3C8E A;  1JFU A;  3QFB C;  9GSS A;  3IC8 A;  1Z3E A;  3ZLP A;  1XIY A;  3IV4 A;  1E2Y A;  2EIO A;  2PVO C;  2GZZ A;  8GSS A;  3EMP A;  1NHY A;  1F9M A;  2PN8 A;  1WOU A;  3ME7 A;  1KBN A;  4YKF A;  2VIM A;  1K3Y A;  3CSH A;  1Z6N A;  4N0V A;  3UIW A;  4NPB A;  4G0L A;  4KH7 A;  2F3M A;  1XOA A;  2VCW A;  3BCK A;  5AIV A;  1U87 A;  2IME A;  4JZQ A;  4DSQ A;  3P8W A;  1FO5 A;  4BPY A;  4TXO B;  1WIK A;  3GTU B;  3M9J A;  1TTZ A;  2QGV A;  3F4T A;  3TJJ A;  2QKE A;  2C0G A;  4EL1 A;  3HVV A;  2A2R A;  2F8F A;  2NDO A;  2RUE A;  2DSA A;  2AAW A;  3HXS A;  1WWJ A;  4ZIL A;  4X1U A;  5JWO B;  5A4W A;  4V2M A;  2FLS A;  1SK1 A;  3IAM 2;  2GST A;  20GS A;  3DD3 A;  5IOW A;  1XVW A;  2B7J A;  4BVX A;  1GSD A;  1TI1 A;  4MPG A;  2L57 A;  3D0Z A;  5BRT A;  4K0G A;  5B8B A;  3IBH A;  1Y25 A;  3FYG A;  2J23 A;  5B6M A;  2OE0 A;  4JR6 A;  2BMX A;  4L0W A;  4KDY A;  2YWM A;  1S3A A;  4IN0 A;  4GSN A;  5G5E A;  4G10 A;  4EC0 A;  4L0U A;  3L0H A;  3VFI A;  2ES7 A;  5H5S A;  2MMA A;  3R3E A;  1MD3 A;  3KIJ A;  2I9H A;  1XWG A;  4RQX A;  5ELG A;  2HZE B;  6GSX A;  6GSS A;  3M0F A;  2C0D A;  3LJR A;  1ZYN A;  1A2J A;  4RI7 A;  3QR6 A;  3D6I A;  4XS4 A;  5G1K A;  2A4H A;  3GFK A;  3MAK A;  4K7I A;  4WBR D;  1TU8 A;  3KTL A;  4MPF A;  1MEK A;  5DAK B;  3FZ4 A;  2IFQ A;  2PBJ A;  2K8S A;  4ICY A;  3VWW A;  3F63 A;  5A4U A;  4KDU A;  3GN3 A;  2GGT A;  4YAP A;  1AXD A;  6GSU A;  2XBI A;  4TXV A;  4MK3 A;  3I6A A;  2XHF A;  5ECS A;  1AQW A;  1R4W A;  1V98 A;  4N11 A;  4J2F A;  2XC2 A;  2AV4 A;  4GF0 A;  2ZCT A;  1NSW A;  3HHV A;  3UBL A;  2LTK A;  3H1N A;  2K8V A;  1G0T A;  3ZRD A;  3C1R A;  5DBQ A;  2HYX A;  3EUR A;  4GXZ A;  2FWH A;  2X99 A;  3TJG A;  4MF7 A;  5D9V A;  2GZP A;  3PH9 A;  3QDN A;  1B4Q A;  3HJP A;  3D5J A;  3GMF A;  2H30 A;  5D9T A;  1K0A A;  1T00 A;  1YEP A;  3LYK A;  5EL8 A;  3P2A A;  3EU3 A;  17GS A;  4IVF A;  2DC5 A;  2O7K A;  2E2G A;  3M3M A;  2HSH A;  2I81 A;  4LA1 A;  5G30 A;  4HQZ A;  2JU5 A;  5G2Z A;  2CX4 A;  1RW1 A;  1KNG A;  1GRX A;  2LJK A;  1Z6M A;  1PN0 A;  1WJK A;  4KA0 A;  1XWB A;  3HYP A;  1T1V A;  1ERT A;  3NOF A;  3WYW A;  2H19 A;  1VF3 A;  4KCA A;  2M46 A;  2R0C A;  4MLY A;  22GS A;  2H66 A;  1TJD A;  1V9W A;  4IHU A;  1YF1 A;  4FYU A;  2WUL A;  2G2Q A;  1AQX A;  2GDR A;  1LJR A;  4HQS A;  2FNO A;  4ZBB A;  1WE0 A;  1SL0 B;  1M9A A;  4HI7 A;  4V2L A;  4K2X A;  4AJ6 A;  5E4W A;  2DKI A;  5ECQ B;  3GHA A;  5GZZ B;  4LMV A;  2H75 A;  1JZO A;  2O89 A;  2TRC P;  1CQG A;  1WPI A;  1XCC A;  5E59 A;  3PIN A;  4GWR A;  4K9Z A;  3WD6 A;  2FWF A;  2WGR A;  5L71 A;  3UVH A;  2AB6 A;  5DJL A;  3KH9 A;  4N30 A;  2GQL A;  4X43 A;  2K18 A;  1KEB A;  1TRU A;  2VL9 A;  4TOP A;  3TRP A;  1A0R P;  2XBQ A;  3GYK A;  5JWQ B;  4YKG A;  2R5G A;  4WF4 A;  16GS A;  3R2Q A;  4TXO A;  3GTU A;  4KUN A;  5ECM B;  3FEU A;  19GS A;  2RLI A;  3ZML A;  3WGX A;  5JCU A;  4YQM A;  3ZZX A;  3MNG A;  4EDZ A;  3DRN A;  4MZC A;  5KN1 A;  2AYT A;  1Z7R A;  3F6D A;  1MD4 A;  2R3X A;  2FHE A;  2C3N A;  2DIZ A;  3IRA A;  1B48 A;  1PL1 A;  3TCO A;  2V32 A;  5CRH A;  4K5R A;  2WCI A;  2WB9 A;  2N5B A;  1XBS A;  1X5D A;  2VL2 C;  4MNN A;  4KAE A;  2H6X A;  2V2G A;  2CAQ A;  2GT6 A;  4HUA A;  4AJ7 A;  3L9S A;  3KZQ A;  4EIQ A;  2PWJ A;  3GIX A;  4MJC A;  1JHB A;  1GP1 A;  3A2W A;  3AY8 A;  3FY7 A;  4MJB A;  4ML1 A;  1ZCP A;  2TRX A;  4IJ3 A;  2LQO A;  3CMI A;  2FCH A;  1K0N A;  5ECP B;  1XW6 A;  3CRU A;  1M99 A;  2DJK A;  2OE1 A;  1MDJ A;  1TK0 B;  1DSB A;  5IIZ A;  1H4O A;  2VUP A;  3TKP A;  5IPH A;  1VRS D;  1G7E A;  4LLR A;  2HZE A;  2OKA A;  1M2A A;  1XW5 A;  3UBK A;  1IYI A;  4QL9 A;  5AIS A;  2YZU A;  2H1D A;  1GSY A;  3D4T A;  1GUL A;  2E0Q A;  3A5W A;  4I6X A;  4HZ4 A;  5CRD A;  1GSS A;  1FHE A;  2B7K A;  4JR4 A;  5G31 A;  3A3T A;  4ZBD A;  5DAK A;  3G7J A;  2F8A A;  3U6V A;  4K5S A;  3NZN A;  4K1F A;  3Q18 A;  2GLR A;  2H1G A;  1O8W A;  4PQI A;  4BL7 A;  1FOV A;  1N8J A;  3HJO A;  1YZX A;  4ZXG A;  3WGE A;  1Q4J A;  2HZF A;  3FKF A;  3H79 A;  4ZL9 A;  1VGL A;  2VLV A;  4ZB8 A;  1N2A A;  1BAY A;  3TKS C;  4MP4 A;  1O85 A;  5GSS A;  3E9J B;  5DQS A;  3EU4 A;  4DVC A;  2WS2 A;  3LYP A;  2CV4 A;  5IMZ A;  3ZYW A;  4V2N A;  2YOI A;  1NW2 A;  1SU9 A;  4IQ1 A;  2VCZ A;  4HEA 2;  1UC7 A;  2CQ9 A;  4HOJ A;  2R37 A;  3Q19 A;  5EY6 A;  4DSS A;  1FVK A;  1A2M A;  1FVJ A;  1PL2 A;  1ON4 A;  3OR5 A;  2R2J A;  3VWX A;  3I69 A;  4ZBA A;  3EYT A;  4E8H A;  3MYD A;  1HNA A;  2AUV A;  2AHE A;  2OA7 A;  1FAA A;  1U3A A;  4MJA A;  2P5Q A;  4IP1 A;  3BJ5 A;  1OKT A;  4CY8 A;  3TKS E;  2R0P A;  4ECC A;  2JZR A;  3KCM A;  2DJ0 A;  2LRN A;  1PMT A;  1A2L A;  1YKC A;  3O76 A;  1O81 A;  2CT6 A;  2FY6 A;  1H75 A;  2NTO A;  3GH9 A;  4LL4 B;  1HNC A;  1EV4 A;  2LKU A;  2JZT A;  4NV2 A;  4F82 A;  2I3Y A;  4ML6 A;  4OFN A;  2JAD A;  4OMV A;  2WZ9 A;  1GTU A;  4JE1 A;  5KEJ A;  5ENU A;  4K8M A;  4USS A;  4G19 A;  1QMV A;  3LQ7 A;  2IMI A;  3ERW A;  2L59 A;  5ELA A;  4WF5 A;  1ZYE A;  4TR3 A;  5HR1 A;  2LNT A;  1ERV A;  2KLX A;  1HD2 A;  4QQ7 A;  3E3E A;  2OJL A;  2IL3 A;  4MA9 A;  3VLN A;  1OKD A;  4G0I A;  2GSR A;  2GSQ A;  2GT5 A;  3S9F A;  2LRC A;  4PNF A;  4POB A;  3ZFL A;  3PPU A;  14GS A;  5KOW A;  2YWN A;  3DKS A;  4NV5 A;  1V57 A;  4Q5R A;  5FWG A;  5DCG A;  2PMT A;  1URM A;  2KP2 A;  1EGR A;  2HE3 A;  4NAX A;  2VCX A;  2PER A;  1G7O A;  5A4V A;  2JAC A;  1PX6 A;  4K7N A;  1XVQ A;  4MCU A;  4TW5 A;  2C1Y A;  1EEJ A;  1MDK A;  5ID2 B;  4MJE A;  1AIU A;  1MDI A;  2PVQ A;  1GNE A;  3IA1 A;  1Z7P A;  2JZS A;  2L4C A;  3N9J A;  2QC7 A;  1HNB A;  1IYH A;  2QA2 A;  1XZO A;  4G0K A;  1GH2 A;  5LCZ A;  5F0G A;  2HRN A;  5LD0 A;  2EC4 A;  4EE0 A;  1A24 A;  2E7P A;  1R7H A;  1GLQ A;  1A8Y A;  1TKD B;  2ZNM A;  1M7T A;  4FYB A;  1A8L A;  1EV9 A;  3GUS A;  1I9D A;  5CNW A;  5HFG A;  3O3T A;  4IS0 A;  2MMO A;  3DGQ A;  1ERU A;  5EPF A;  1NHO A;  3IK9 A;  4I8B A;  4EVM A;  5HR2 A;  2FUG 2;  5KN0 A;  1U3I A;  2ON5 A;  5H5Q A;  2BJX A;  4ZL8 A;  4WEY A;  2LNS A;  1SJ6 A;  4ULX A;  5CAX A;  2TIR A;  1ZYP A;  3QOU A;  2IPA A;  3C7M A;  3HA9 A;  11GS A;  2YNX A;  3APS A;  5ECH B;  1EGO A;  1ZZY A;  4GRF A;  1X9M B;  2XPD A;  2P0G A;  4D73 A;  1FB6 A;  2VCQ A;  1RK4 A;  3FW2 A;  1GUH A;  2HT9 A;  3NIV A;  5KOX A;  2CX3 A;  5J5N A;  1OAZ A;  3TRX A;  4HU7 A;  2I1U A;  2HRK A;  2H1B A;  4TR0 A;  5J41 A;  3FR3 A;  2V6O A;  2L4Q A;  1SD9 A;  1QUW A;  3GNJ A;  5JWR B;  1DBY A;  1AQV A;  2BTO T;  3H8Q A;  4NXI A;  5ECK B;  4I5Q A;  2AJQ B;  2B6M A;  4BA7 A;  3KXO A;  1V40 A;  3D22 A;  2HNL A;  1F2E A;  5DAL B;  2L6D A;  4MMM A;  3GX0 A;  3DVX A;  1J08 A;  2H72 A;  2KUC A;  4FO5 A;  3MDK A;  3TB2 A;  4EKZ A;  1T3B A;  4JBB A;  4ISD A;  1MTC A;  3QMX A;  4YQU A;  1VF2 A;  4XTS A;  4KX4 A;  4ECB A;  1K3L A;  3IOS A;  2R6K A;  1GTA A;  3KMO A;  3PR8 A;  2CAI A;  4TR1 B;  2JSZ A;  3KD0 A;  5C00 A;  1SD8 A;  1S3C A;  4K6X A;  1B9X C;  3EWL A;  2N5A A;  3C1S A;  1RQM A;  2M80 A;  2H6Z A;  1B9Y C;  1DUG A;  2LJR A;  2YV9 A;  4LMW A;  2MYG A;  1Q98 A;  4XS6 A;  4GCI A;  5D93 A;  5IM9 A;  3IAS 2;  5J9B A;  1YY7 A;  1WRY A;  2LV3 A;  5IMV A;  1O7U A;  3G9B A;  1JZW A;  1AAZ A;  3L78 A;  5IPG A;  2MMN A;  1M9B A;  2D2Z A;  2VL3 A;  2H76 A;  3BOA A;  5ECO B;  3I9V 2;  1G6Y A;  3GST A;  1ML6 A;  1F37 A;  4POK A;  2YPM A;  3DEX A;  3UOM A;  1EP8 A;  3IK7 A;  4OFM A;  3VPQ A;  1ABA A;  4P3Y B;  2VAF A;  4BVY B;  4BWQ A;  2VM1 A;  2UZ8 A;  4KSO A;  5BMU A;  1BED A;  4MAB A;  4HJ2 A;  1PA3 A;  2C0F A;  2VD0 A;  4IQA A;  2VM2 A;  4PQ1 A;  1LBK A;  1VF4 A;  1QQ2 A;  3RPP A;  5G5F A;  1YEX A;  3UVT A;  2OBK A;  4J56 E;  4F0C A;  3WGD A;  3QAV A;  1F3A A;  3GKX A;  2KP1 A;  4QL7 A;  2C8U A;  2CVD A;  3I43 A;  2PUK C;  4XS1 A;  4BVX B;  2HSM A;  1UA5 A;  3GRX A;  4TRX A;  18GS A;  5F8B A;  3U5R E;  4TVE A;  5D9X A;  4Q5N A;  1EOH A;  2NBS A;  12GS A;  1TXX A;  1PGT A;  4KDX A;  5CRE A;  1BQ7 A;  4I97 A;  4OFT A;  3M1G A;  2L5O A;  1XFL A;  5LNK e;  3F3Q A;  4POL A;  1QK8 A;  4XIH A;  2QA1 A;  2C4J A;  4PUA A;  2X64 A;  2IWT A;  4V1A g;  3ZMK A;  4L8E A;  1BYE A;  1FOH A;  3FZ9 A;  5CYY A;  2YP6 A;  4EDY A;  1EEM A;  3EVI A;  2X8C A;  2VD1 A;  2OE3 A;  2NVL A;  3KJY A;  2P5R A;  5EVO A;  4MZW A;  2GQM A;  3LSZ A;  1PN9 A;  1USB A;  3ERF A;  4YQV A;  1SK2 A;  4YH2 A;  5COH A;  5IMC A;  3TOT A;  2JL4 A;  3DWV A;  4DEJ A;  1X9S B;  3DYR A;  2DIY A;  1F6M C;  4FH8 A;  4JRR A;  4PUR A;  3L9V A;  4IJI A;  3VUR A;  5IMD A;  7GSS A;  3P90 A;  2G0F A;  4H86 A;  4TKY A;  2XPE A;  2LS5 A;  4O5U A;  2RII A;  3ED3 A;  5JCW A;  1XPV A;  1JLV A;  2QSI A;  3ERG A;  1YDK A;  3EMX A;  4A5P A;  3IC4 A;  3EC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...