2K6VA

Solution structures of apo sco1 protein from thermus thermophilus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
GAMHTFYGTRLLNPKPVDFALEGPQGPVRLSQFQDKVVLLFFGFTRCPDVCPTTLLALKRAYEKLPPKAQERVQVIFVSVDPERDPPEVADRYAKAFHPSFLGLSGSPEAVREAAQTFGVFYQKSQYRGPGEYLVDHTATTFVVKEGRLVLLYSPDKAEATDRVVADLQALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putative cytochrome c oxidase assembly protein
publication title Mechanism of Cu(A) assembly.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 54
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02630 SCO1-SenC SCO1/SenC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2k6vA00
22GSA 4PQHA 4J56E 2IMDA 3DMLA 1AQWA 2GSSA 5DBQA 4XCSA 3EMPA 3GHAA 2GT6A 4YQVA 4ILFA 4NWYA 3IA1A 1T1VA 4ZB8A 4WF4A 1FB0A 2KHPA 3KZQA 5G1KA 3F9UA 2CZ2A 2HRNA 2GQMA 5G1LA 5DVBA 1UN2A 4ZXGA 4MCUA 2CVBA 2H76A 4E8EA 1T00A 5AIVA 4TR0A 3TDGA 3SWLA 4OFTA 1HNBA 14GSA 5DAKB 1A2LA 3ZREA 3CSHA 3GFKA 3M9KA 2MZCA 3ERWA 4KA0A 1ZMAA 5EVOA 1O85A 2IJYA 3TKSC 2HE3A 2PBJA 1K3LA 2HI7A 3UEMA 3LYPA 4RQRA 3M9JA 3DIEA 4L8EA 3QFBC 4TR1B 1T4YA 1MTCA 1IYIA 2XBQA 5B7CA 1SD9A 3FRCA 5ABRA 1R26A 5JCUA 5J9CA 1WPIA 3TOTA 2LTKA 1R4WA 1M9AA 1GP1A 3GKNA 3BCKA 1RQMA 6GSYA 2GTUA 1GTBA 3BBYA 4X43A 1F9MA 2H8LA 3C7MA 2JL4A 1HQOA 2BTOT 6GSSA 5JWOB 4HDEA 1AIUA 3F3RA 4JEDA 4OFMA 1EV4A 1WE0A 2YCDA 1BQ7A 2YJHA 1ERVA 2HSHA 1VGLA 3RBTA 2MMZA 4F0CA 2IMFA 3LFLA 4K9ZA 3L9VA 2VCQA 3DYRA 1Y25A 4XRDA 2XHFA 4NMUA 5A4UA 4K7IA 1SK1A 2LJRA 5HFGA 4F03A 1YEXA 4ML1A 4G2EA 5HR3A 3LSZA 4V2MA 4HUAA 3ZMKA 2B7JA 3LEFA 2YPMA 1ZL9A 2H0GA 5FWGA 2H19A 4GTUA 4K0GA 2H70A 1XWAA 1TKDB 3QFAC 1U3IA 4AGSA 4OFNA 3TKSA 2X64A 1EOHA 1B48A 1PSQA 2PERA 1DBYA 2IFQA 5ECIB 5HR1A 4ZL7A 4MA9A 3TOUA 3IV4A 4YQMA 3CXGA 5JCGA 3KMOA 3D5JA 4ZILA 2M72A 1USBA 4ECBA 2H74A 4LA1A 1OC8A 2LEGA 3M1GA 2CVDA 2V41A 2F3MA 1PKZA 1FG4A 1GTUA 5H5QA 4I97A 1K3OA 3H8QA 4PQ1A 2XPDA 4CHSA 1OYJA 1YY7A 3WT2A 1WIKA 2E2GA 5D93A 4KCEA 3EC3A 3ME8A 1V9WA 3TRQA 1QGVA 3VLNA 2C3QA 1OKTA 1SKSB 5ENUA 1TRWA 3IC4A 1THOA 2CAIA 1F6MC 2LRNA 2JZSA 2IMKA 1UVZA 3NOFA 4LLRA 2LQQA 4NHWA 3APSA 2C1YA 2PN8A 1V2AA 3E3EA 1Z6NA 5E59A 3V1WA 4GSNA 1M2BA 4DSQA 1I9DA 3C1RA 1ZOFA 2IIYA 2DJJA 2K8SA 2LRCA 1SYRA 1ZYEA 4XRAA 3D0ZA 3MDKA 1ERWA 4GF0A 3ED3A 3GURA 1OVNA 4FO5A 2JSYA 2H6ZA 3HHVA 1GLQA 1F3BA 3TRPA 3HVXA 1M2DA 1U3AA 4ZBBA 2VOCA 1TU7A 5ECRB 5HQPA 2VCXA 3WYWA 3KCMA 4K6XA 4OO4A 3L9UA 1BG5A 3HYPA 3PR8A 3ZTLA 4V2NA 1XW6A 2GZPA 5DDLA 4HZ2A 2YWOA 4IP6A 5AGYA 2VL2C 1GUMA 2HZFA 1ERTA 8GSSA 1GNEA 1YJ6A 2RIIA 4WBJA 3GX0A 2C0EA 2F9SA 1URMA 3FR3A 2OADA 2YP6A 2H6XA 1PL2A 5L71A 2RLIA 4TVEA 3KJYA 5FT3A 1I5GA 3QDNA 3IAS2 1X0RA 1XIYA 2JADA 4KAEA 5IO0A 4E8HA 2HLSA 3CTGA 1O8WA 3DWVA 1YEPA 4TR4A 1K0CA 4Q5RA 1ZGNA 2C0GA 3HD5A 4JU5A 4O92A 3HVSA 3EU3A 3WGEA 4ECIA 3G9BA 3LYKA 4IQAA 1M9BA 3HKRA 1NHOA 3ZZXA 4IKHA 6GSWA 1R5AA 3FW2A 2M80A 3EINA 4WR5A 2K9FA 4BA7A 4ECJA 4V1Ag 7GSSA 3ZRDA 4N11A 4BWQA 5B8AA 2HT9A 4EUYA 2AJQB 5DAKA 3UAPA 2RM5A 1T4ZA 2VL2A 2VCWA 4MK3A 3PINA 3LQ7A 1E6BA 1M99A 1TU8A 1V40A 2GSTA 1BEDA 4IHUA 1W4VA 3U6VA 4BVYA 2OBIA 2B7KA 3ERGA 3GMFA 4WKWA 2IMIA 4HEA2 5F0GA 1A23A 1PA3A 4O7HA 3G7IA 3BCIA 5ECPB 4WR4A 2GLRA 4OCEA 3IPZA 4MPGA 2KP1A 4MPFA 2A2SA 5F06A 5IPHA 2CAQA 2OE1A 1PMTA 2YJ7A 2I81A 4KDUA 3EYTA 2M46A 2WULA 2GZZA 4WBRD 3DEXA 3BJ5A 2AB6A 4JE1A 2YZUA 5IMAA 3P8WA 4EE0A 4I2UA 5GAPD 1A24A 1AQXA 1XXUA 2JU5A 1TRUA 1NSWA 1SL2B 4FYUA 2HZEB 5A4WA 1U88A 3KD0A 5B6MA 2DJ2A 3H93A 5KN2A 1SK2A 1TJDA 1X9MB 3VI7A 2LKUA 2FY6A 2H6YA 2MMOA 1GULA 3LG6A 1OE7A 1AUCA 4MJAA 2KLXA 5HR0A 3TJKA 4GRFA 2FUG2 3UL3A 3IOSA 1LBKA 1PRXA 4RI6A 5D9WA 2E0QA 4K2DA 2VAFA 4POKA 5CRWA 1PKWA 3TJBA 2VL3A 4ZB6A 1XWBA 4I2TA 1E2YA 1GSEA 1R5PA 1N8JA 1TRVA 2HXKA 4Q5FA 5KN1A 1RW1A 1PX6A 1TOFA 2O85A 5ELGA 4XS1A 2YOIA 3A3TA 4F9ZA 2N5FA 2V32A 3M8NA 4EXJA 4FIWA 6GSXA 1Z5YE 2H0HA 1XWCA 2H75A 3N9JA 1Y6EA 4LMVA 2GGTA 1GUKA 1WWJA 2C0DA 3KMNA 5CRHA 3TKPA 1JLWA 2BMXA 5ECOB 2H1DA 2OJLA 4IQ1A 1TDIA 5D73A 2J23A 11GSA 2AAWA 2EIOA 1TK0B 1SD8A 3F4SA 1GSDA 2YV9A 3D4MA 2N5BA 5H5SA 1MD4A 1S3CA 1SKRB 4G19A 1Z6MA 5ECQB 4L0WA 2VCVA 5EL8A 4HU7A 1O7UA 2H72A 3KP8A 2V2GA 2G2QA 3FR9A 3TJFA 5ECNB 2H1GA 4GQCA 4K7OA 3D21A 3MWHA 3EMXA 3VURA 2GZYA 4TXOB 1GSSA 2L59A 5IIZA 4J2FA 4V2LA 3MNGA 3F6DA 1B9YC 4ACSA 4HZ4A 1XW5A 3I43A 3CRTA 1Z9HA 1M0UA 2QSIA 4MDCA 2DMLA 1QMVA 3GL5A 1K0AA 4DSRA 1GSFA 1SJZA 3FZAA 2H66A 3PGTA 5IMZA 3DKSA 3IBHA 10GSA 1HNAA 1S3AA 3ZMLA 1DE1A 5GZZB 2PVOC 3TJGA 1XWKA 5ECMB 1MEKA 1U87A 3UBKA 4EF0A 2YWIA 3ZIVA 2AV4A 1XCCA 2LV3A 1HNCA 1ML6A 4O32A 1V57A 5F05A 6GSVA 5GSTA 3GSSA 3QAGA 1TK8B 2F8FA 5FHIA 2B6MA 3HZ8A 4RI7A 2VCTA 1O73A 3FZ5A 1Z7RA 2H0IA 1YF0A 2DMMA 4I5QA 4GXZA 4HS1A 1RK4A 2WDUA 2FGXA 4POBA 4JRRA 1BAYA 3UJ1A 2X99A 5J3RA 5GSSA 1EP7A 4F2IA 4N10A 3O6TA 4LMWA 3GRXA 4JBBA 4V1Ap 1PD21 4DVCA 3HDCA 2LJAA 4QQ7A 1GSQA 3IHQA 3IR4A 1XOBA 2H73A 3DVXA 5HFIA 3F8UA 3CSJA 4K8MA 4PUAA 16GSA 2A4VA 2F51A 3I69A 3UVHA 2R37A 2H1AA 2CZ3A 5G2ZA 4KE3A 2LQOA 3DXBA 2YV7A 2HRFA 3A2WA 1OC9B 2YNXA 1K0OA 3IAM2 1PX7A 4Z7XA 5IMVA 1O81A 5CO3A 4K7NA 3W6GA 4MJEA 4KSOA 5IMFA 4HQZA 3Q6OA 4BVXA 4EO3A 2MYGA 2KOKA 2WGRA 1X5EA 1JZDA 1VRSD 3F4TA 5DJMA 1TRSA 5D9VA 1TI1A 5ECLB 5H5RA 2B1LA 2HZEA 3D22A 1X9WB 3ZFBA 1G7EA 2V6KA 1FOVA 2CVKA 2QKEA 5B6NA 3AY8A 1O6JA 4NV2A 4MH2A 3KEBA 5JWQB 3CRUA 4YH2A 1O8XA 2PVQA 4O5RA 3IE3A 4IN0A 4KB3A 3Q18A 5AN1A 1EEJA 1DUGA 3Q74A 1B4QA 4ID0A 4L0UA 2YANA 2D2ZA 4NAXA 4DEJA 3ME7A 1UC7A 1ACVA 3US3A 3BD2A 4POLA 1LU4A 2PWJA 2NBSA 2K18A 2FA4A 4ISDA 3HJOA 1NW2A 3FK8A 3LORA 3TGZA 1CQGA 2LNSA 2WCIA 4PNGA 2O7KA 2IL3A 1ON4A 2IPAA 2QC7A 1YF1A 5DQSA 3HVVA 3NZNA 1WMJA 2IWTA 2AYTA 5JWRB 3N5OA 3HZ4A 1SJIA 3VI5A 1AXDA 1PGTA 3F63A 2C0FA 5GAND 3ERFA 2FD3A 2MMAA 3RPPA 2I3YA 3LWAA 5IOXA 4HJ2A 2YZHA 2C8UA 4CDOA 2FCHA 4N0ZA 4EL1A 3GV1A 5A5KA 3R2QA 2J9HA 2FWFA 3GKKA 1K3YA 4ULXA 1AQVA 2VCZA 2JACA 5ID2B 2DJ1A 4FYCA 2EIRA 3KM6A 3APOA 4TXOA 4WETA 4ZL9A 2L4CA 3KTBA 3M3MA 3CMIA 3SBCA 3FR6A 20GSA 2CT6A 1KBNA 4MABA 4KDXA 5LCZA 2VM2A 1DE2A 2TIRA 3ZITA 3QAVA 4IGJA 2DLXA 2H1BA 3L4NA 3IDVA 2I9HA 2MMNA 1WJKA 4MMMA 5D9TA 4ZBDA 1G6WA 4G10A 2HYXA 1IYHA 1ABAA 2YWMA 3FEUA 3O76A 1R7HA 3QR6A 1GSYA 5G5FA 1F3AA 3LGCA 1X5DA 1J0FA 1SKWB 3FZ4A 4TXVA 4ZL8A 3APQA 2LJKA 3CYNA 3GH9A 4QL7A 2NDOA 2CQ9A 4H86A 3KTLA 3ZL5A 3A5WA 5AIXA 3FZ9A 4I8BA 4IJ3A 5DJLA 5HFKA 1FVKA 3WGDA 4XS4B 4BPYA 1OAZA 3BOAA 1YQ1A 4J57E 18GSA 3P7XA 3HJPA 2XPEA 1GL8A 2FHEA 3ZFLA 2NTOA 2GQKA 3DRNA 4Q5NA 2ES7A 3D4TA 2L6CA 2K6VA 3P2AA 3IRAA 3VWXA 2WFCA 2GQLA 3GIXA 3GX8A 3GYKA 4K0NA 2FWHA 4PUFC 2ZCTA 4JR6A 1VF3A 5A4VA 2TRXA 1WOUA 3FY7A 3HA9A 3HCZA 1FHEA 4KX4A 5F07A 2L5OA 3LXZA 1SK0A 2KP2A 3ZVJD 3L78A 1ERUA 2VD0A 5LD0A 2PPTA 4XTSA 3CSIA 3WD6A 1G7OA 4L5OA 2B3SA 2DIZA 1EV9A 2XC2A 3GUSA 3EWLA 5INYA 3LXTA 3KP9A 1Q4JA 3D6IA 4Q5QA 1OC9A 3TKSE 1HD2A 2H01A 1TI3A 5IM9A 4KDYA 1VF4A 5DQYA 3QD9A 2LRTA 2NVLA 3F4RA 5IOWA 1Q98A 5IPGA 4GQFA 2GVPA 4IJIA 2I1UA 3QPMA 3C71A 3H79A 3DGQA 3FYGA 5DALB 3K8NA 3HY2A 2GT5A 1VF1A 1BYEA 1GNWA 3EU4A 4EDYA 1X5CA 4TR3A 1U6TA 5IO2A 4YQUA 5F8BA 4KW6A 5EY6A 3UIWA 1EOGA 4L5LA 4HU9A 1GWCA 4KNDA 3VFIA 1KEBA 4MLYA 1S3DA 1JZWA 2NPBA 1J08A 1GUHA 4FYBA 3A2XA 2GSQA 4POMA 3O3TA 2ZNMA 4GWRA 2PU9C 4TRXA 1DSBA 4G9HA 5J4UA 1BJXA 2V1MA 5D96A 1MD3A 1XWGA 2DC5A 1M2AA 3VWWA 2XBIA 3A2VA 2WB9A 1SENA 2C4JA 1M7TA 2VL9A 2PGTA 3GNJA 4ECCA 1JFUA 4BL7A 1TK5B 4IP1A 1ZZYA 2ON5A 2ON7A 2HNLA 4TKYA 4OO5A 4WXTA 1XFLA 4KSMA 1PQNA 3G7YA 3KIJA 1FVJA 1SYXA 4GSTA 3ZLPA 1K0MA 2FLSA 1FB6A 2R4VA 2TRCP 3QAWA 4X0XA 3GH6A 1TTZA 2X8CA 4ZB9A 2CX3A 3JCML 4DSSB 1XBSA 2GSRA 3CTFA 2DBCA 2YWNA 1EGRA 4X1UA 3IK7A 3GKMA 1EEMA 2DJ3A 2CA8A 3TCOA 2Z9SA 3WGXA 3TKRA 5CP1A 2AUVA 3QOUA 2VLUA 4HOJA 1T8EB 3VWVA 1FO5A 2WJUA 3TRXA 3PH9A 1GLPA 1K0DA 2FWGA 1KNGA 2B5XA 4IVFA 4PGTA 1YKCA 4ZIJA 4IBPA 5CRDA 1F37A 1JHBA 3ZYWA 5DCHA 4GCIA 2X8GA 4JZQA 4AF2A 1THXA 1XVQA 5ID2A 2R5GA 1FAAA 3EURA 4KUNA 4LL4B 3I6AA 1A8LA 5ECKB 3VK9A 2R3XA 3ZVJA 4ML6A 1XOAA 4XHMA 4OMVA 2E2MA 3G7JA 3M0FA 3VPQA 1HYUA 1EP8A 2L6DA 9GSSA 4AJ6A 3F3QA 3EVIA 2R2JA 4WF5A 1UA5A 4EVMA 3TJJA 5CNWA 5B8BA 1A2JA 2DIYA 4HQSA 4PX1A 3GTUB 2QGVA 4OWYA 3GKXA 4OCFA 4EC0A 2JZTA 1QFNA 1WP0A 1FW1A 1OKDA 3KH7A 2C80A 1B4PA 1B9XC 1Z3EA 1ST9A 2LS5A 3J7Yk 3HXSA 1ZCPA 5J9BA 2JSZA 2CX4A 2OACA 4XS4A 4QL9A 5IQYA 4MZCA 2VLVA 1NM3A 1CQHA 4N0VA 5IMCA 2L57A 1G6YA 2REMA 1G0TA 1GTIA 3FKFA 5IMDA 12GSA 5G31A 2N5AA 3L0HA 4P3YB 3U5RE 4D73B 1NHYA 1SJ6A 3UOMA 2RUFA 1B8XA 2O8VB 1Z7PA 3L9SA 4FH8A 1EZKA 2EC4A 2P31A 2R6KA 1V58A 3EE2A 3H4KA 2PMTA 3IXRA 2B5YA 2A2RA 2VLTA 1SL1B 2OE0A 4N30A 2H30A 3FHKA 4XS6A 5COHA 1KTEA 3KH9A 4LL1B 2P5RA 1QUWA 5EPFA 5AISA 2JZRA 3RPNA 1AAZA 1J9BA 3C73A 3F6FA 3QCPA 2HFDA 4IELA 5CREA 1GTAA 4MJCA 3J7Yb 4CW9A 5G5EA 2OE3A 2O89A 2C3TA 2V6OA 2K8VA 2B1KA 2LUSA 4AJ7A 1A2MA 1JLVA 4MZWA 5DALA 4HI7A 2MBSA 4KH7A 5LNKe 3W8JA 1OE8A 4MF7A 1QK8A 5D9XA 3MAKA 2VM1A 3UVTA 1SU9A 2F8AA 2VUPA 2B5EA 2MBTA 3C8EA 4RUVA 5JCWA 5ECHB 3RHBA 2YN1A 1H4OA 2LNTA 3GN3A 4MF6A 4EDZA 1JZOA 1GSUA 4PXOA 2HSYA 4NPBA 1EWXA 4NV5A 1T7PB 4KGIA 1W89A 3C1SA 3H1NA 1TXXA 1SL0B 6GSTA 4XIHA 4IW9A 3RAZA 5CYYA 3GA4A 4F0BA 1C72A 1F2EA 1VF2A 1AC1A 5ELAA 3UARA 19GSA 1ZYQB 2VO4A 3W8SA 3NIVA 1YDKA 1XPVA 5G30A 1MDKA 2FA8A 1TW9A 4GSSA 1XZOA 5J5NA 4MZBA 3MSZA 3E9JB 4TN8A 3TKQA 2AHEA 2LSTA 3ISOA 4MJBA 4MP4A 2RM6A 4GLTA 1JZRA 1YKAA 1A0FA 1PL1A 3RDWA 13GSA 3KXOA 3HJMA 2IFQB 3Q19A 4PURA 3QMXA 4DSSA 3E0UA 5ECSA 5J41A 1K0BA 2ALBA 4AJ8A 3UMAA 4TR1A 4MF5A 1EGOA 5C00A 1V98A 3TB2A 2DJ0A 3I9V2 1WRYA 3CBUA 1A8YA 4PQIA 3TUEA 4NXIA 4YAPA 4I6XA 3DD3A 2GDRA 2G0FA 1QQ2A 2CV4A 4RQXA 1MDJA 2OA7A 2RUEA 1QXHA 4KCAA 1MDIA 3ZIJA 2IN3A 4HJMA 5KEJA 2WZ9A 1GRXA 1ILOA 2EIQA 4YAVA 1N2AA 2DSAA 2L4QA 4WEYA 2O87A 3WT1A 2KUCA 2VIMA 2WS2A 5D8IA 2DJKA 1K0NA 3GSTA 3GL3A 1OC3A 3P90A 3VWUA 5HR2A 1T3BA 2P5QA 3VPTA 2FNOA 2L5LA 1GH2A 4NHZA 3S9FA 5KN3A 17GSA 3GTUA 2C3NA 4ZBAA 4TOPA 4MH3A 2P0GA 3UBLA 3KGKA 2ZUPA 4PNFA 4K1FA 1LJRA 3F0IA 5E4WA 2H71A 1X9SB 2OKAA 2E7PA 3DVWA 1A0RP 2WRTA 1TP9A 2OBKA 2PUKC 2GS3A 1XW9A 1XVWA 5DCGA 5CRGA 1AW9A 2VD1A 3OR5A 5KN0A 3LJRA 4JR4A 4OD7A 4TW5A 1PN9A 4BWSA 2BJXA 1BX9A 4IS0A 2X8HA 1YZXA 2IMEA 6GSUA 5CAXA 4D73A 2FWEA 4F82A 3IK9A 4EKZA 1H75A 5C04A 2I4AA 3RHCA
chains in the Genus database with same CATH superfamily
4YKFA 22GSA 4PQHA 4J56E 2IMDA 3DMLA 1AQWA 2GSSA 5DBQA 4XCSA 3EMPA 3GHAA 2GT6A 4YQVA 4ILFA 4NWYA 3IA1A 1T1VA 4ZB8A 4WF4A 1FB0A 2KHPA 3KZQA 5G1KA 3F9UA 2CZ2A 2HRNA 2GQMA 5G1LA 5DVBA 1UN2A 4ZXGA 4MCUA 2CVBA 2H76A 4E8EA 1T00A 5AIVA 4TR0A 3TDGA 3SWLA 4OFTA 1HNBA 14GSA 5DAKB 1A2LA 3ZREA 3CSHA 3GFKA 3M9KA 2MZCA 1PFOA 3ERWA 4KA0A 1ZMAA 5EVOA 1O85A 2IJYA 3TKSC 2HE3A 2PBJA 1K3LA 2HI7A 3UEMA 4BVYB 3LYPA 4MNNA 3M9JA 4RQRA 3DIEA 4L8EA 3QFBC 4TR1B 1T4YA 1MTCA 1IYIA 2XBQA 5B7CA 1SD9A 3FRCA 5ABRA 1R26A 5JCUA 5J9CA 1WPIA 3TOTA 2LTKA 1R4WA 1M9AA 1GP1A 3GKNA 3BCKA 1RQMA 6GSYA 2GTUA 1GTBA 3BBYA 4X43A 1F9MA 2H8LA 3C7MA 2JL4A 1HQOA 2BTOT 6GSSA 5JWOB 4HDEA 1AIUA 3F3RA 4JEDA 4OFMA 1EV4A 1WE0A 3IHGA 2YCDA 1BQ7A 2YJHA 1ERVA 2HSHA 1VGLA 3RBTA 2MMZA 4F0CA 2IMFA 3LFLA 4K9ZA 3L9VA 2VCQA 3DYRA 4PTSA 1Y25A 4XRDA 2XHFA 4NMUA 5A4UA 4K7IA 1SK1A 2LJRA 5HFGA 4F03A 1YEXA 4ML1A 4G2EA 5HR3A 3LSZA 4V2MA 4HUAA 3ZMKA 2B7JA 3LEFA 1FOHA 2YPMA 1ZL9A 2H0GA 5FWGA 2H19A 4GTUA 4K0GA 2H70A 1XWAA 1TKDB 3QFAC 1U3IA 4AGSA 4OFNA 3TKSA 2X64A 1EOHA 1B48A 1PSQA 1M3IA 2PERA 1DBYA 2IFQA 5ECIB 5HR1A 4ZL7A 4MA9A 3TOUA 3IV4A 4YQMA 3CXGA 5JCGA 3KMOA 3D5JA 4ZILA 2M72A 1USBA 4ECBA 2H74A 4LA1A 1OC8A 2LEGA 3M1GA 2CVDA 2V41A 2F3MA 1PKZA 1FG4A 1GTUA 5H5QA 4I97A 1K3OA 3H8QA 4PQ1A 2XPDA 4CHSA 1OYJA 1YY7A 3WT2A 1WIKA 2E2GA 5D93A 4KCEA 3EC3A 3ME8A 1V9WA 3TRQA 1QGVA 3VLNA 2C3QA 1OKTA 1SKSB 5ENUA 1TRWA 3IC4A 1THOA 2CAIA 1F6MC 2LRNA 2JZSA 2IMKA 1UVZA 3NOFA 4LLRA 2LQQA 4NHWA 3APSA 2C1YA 2PN8A 1V2AA 3E3EA 1Z6NA 5E59A 3V1WA 4GSNA 1M2BA 4DSQA 1I9DA 3C1RA 1ZOFA 4CY8A 2IIYA 2DJJA 2K8SA 2LRCA 1SYRA 1ZYEA 4XRAA 3D0ZA 3MDKA 1ERWA 4GF0A 3ED3A 3GURA 1OVNA 4FO5A 2JSYA 2R0GA 2H6ZA 3HHVA 1GLQA 1F3BA 3TRPA 3HVXA 1M2DA 1U3AA 4ZBBA 2VOCA 1TU7A 5ECRB 5HQPA 2VCXA 3WYWA 3KCMA 4K6XA 3A5IA 4OO4A 3L9UA 1BG5A 3HYPA 3PR8A 3ZTLA 4V2NA 1XW6A 2GZPA 5DDLA 4HZ2A 2YWOA 4IP6A 5AGYA 2VL2C 1GUMA 2HZFA 1ERTA 8GSSA 1GNEA 1YJ6A 2RIIA 4WBJA 3GX0A 2C0EA 2F9SA 1URMA 3FR3A 2OADA 2YP6A 2H6XA 1PL2A 5L71A 2RLIA 4EIPA 4TVEA 3KJYA 5FT3A 1I5GA 3QDNA 3IAS2 1X0RA 1XIYA 2JADA 4KAEA 5IO0A 4E8HA 2HLSA 3CTGA 1O8WA 3DWVA 1YEPA 4TR4A 1K0CA 4Q5RA 1ZGNA 2C0GA 3HD5A 4JU5A 4O92A 3HVSA 3EU3A 3WGEA 4ECIA 3G9BA 2A2PA 3LYKA 4IQAA 1M9BA 3HKRA 1NHOA 3ZZXA 4IKHA 6GSWA 1R5AA 3FW2A 2M80A 3EINA 4WR5A 2K9FA 4BA7A 4ECJA 4V1Ag 2HRAA 7GSSA 3ZRDA 4N11A 4BWQA 5B8AA 2HT9A 4EUYA 2AJQB 5DAKA 3UAPA 2RM5A 1T4ZA 2VL2A 2VCWA 4MK3A 3PINA 3LQ7A 1E6BA 1M99A 1TU8A 1V40A 2GSTA 1BEDA 4IHUA 1W4VA 3U6VA 4BVYA 2OBIA 2B7KA 3ERGA 3GMFA 4WKWA 2IMIA 4HEA2 5F0GA 1A23A 1PA3A 4O7HA 3G7IA 3BCIA 5ECPB 4WR4A 1S3RA 2GLRA 4OCEA 3IPZA 4MPGA 2KP1A 4MPFA 2A2SA 5F06A 5IPHA 2CAQA 2OE1A 1PMTA 2YJ7A 2I81A 4KDUA 3EYTA 2M46A 2WULA 2GZZA 4WBRD 3DEXA 3BJ5A 2AB6A 2R0PA 4JE1A 2YZUA 5IMAA 3P8WA 4EE0A 4I2UA 5GAPD 1A24A 1AQXA 1XXUA 2JU5A 1TRUA 1NSWA 1SL2B 4FYUA 2HZEB 5A4WA 1U88A 3KD0A 5B6MA 2DJ2A 3H93A 5KN2A 1SK2A 1TJDA 1X9MB 3VI7A 2LKUA 4KF9A 2FY6A 2H6YA 2MMOA 1GULA 3LG6A 1OE7A 1AUCA 4MJAA 4BIKA 2KLXA 2UZ8A 5HR0A 3TJKA 4GRFA 2FUG2 3UL3A 3IOSA 1LBKA 1PRXA 4RI6A 5D9WA 2E0QA 4K2DA 2VAFA 4POKA 5CRWA 1PKWA 3TJBA 2VL3A 4ZB6A 1XWBA 4K5SA 4I2TA 4EIQA 1E2YA 1GSEA 1R5PA 1N8JA 1TRVA 2HXKA 4Q5FA 5KN1A 1RW1A 1PX6A 1TOFA 2O85A 5ELGA 4XS1A 2YOIA 3A3TA 4F9ZA 2N5FA 2V32A 3M8NA 4EXJA 4FIWA 6GSXA 1Z5YE 2H0HA 1XWCA 2H75A 3N9JA 1Y6EA 4LMVA 2GGTA 1GUKA 1WWJA 2C0DA 3KMNA 5CRHA 3TKPA 1JLWA 2BMXA 5ECOB 2H1DA 2OJLA 4IQ1A 1TDIA 5D73A 2J23A 11GSA 2AAWA 2EIOA 1TK0B 1SD8A 5BRTA 3F4SA 1GSDA 2YV9A 3D4MA 2N5BA 5H5SA 1MD4A 1S3CA 1SKRB 4G19A 1Z6MA 5ECQB 4L0WA 2VCVA 5EL8A 4HU7A 1O7UA 2H72A 3KP8A 2V2GA 2G2QA 3FR9A 3TJFA 5ECNB 4G0LA 2H1GA 4GQCA 4K7OA 3D21A 3MWHA 3EMXA 3VURA 2GZYA 4TXOB 1GSSA 2L59A 5IIZA 4J2FA 4V2LA 3MNGA 3F6DA 1B9YC 5KOWA 2HRKA 1ZYNA 4ACSA 4HZ4A 1XW5A 3I43A 3CRTA 4CY6A 1Z9HA 1M0UA 2QSIA 4MDCA 2DMLA 1QMVA 3GL5A 1K0AA 4DSRA 1GSFA 1SJZA 3FZAA 2H66A 3PGTA 5IMZA 3DKSA 3IBHA 10GSA 1HNAA 1S3AA 3ZMLA 1DE1A 5GZZB 3CQFA 2PVOC 3TJGA 1XWKA 5ECMB 1MEKA 1U87A 3UBKA 4EF0A 2YWIA 3ZIVA 2AV4A 1XCCA 2LV3A 1HNCA 1ML6A 4O32A 1V57A 3MIXA 5F05A 6GSVA 5BMUA 5GSTA 3GSSA 3QAGA 1TK8B 2F8FA 5FHIA 2B6MA 3HZ8A 4RI7A 2VCTA 1O73A 3FZ5A 1Z7RA 2H0IA 1YF0A 2DMMA 4I5QA 4GXZA 4HS1A 1RK4A 2WDUA 2FGXA 4POBA 4JRRA 1BAYA 3UJ1A 2X99A 5J3RA 5GSSA 1EP7A 4F2IA 4N10A 3O6TA 4LMWA 3GRXA 4JBBA 4V1Ap 1PD21 4DVCA 3HDCA 2LJAA 4QQ7A 1GSQA 3IHQA 3IR4A 1XOBA 2H73A 3DVXA 5HFIA 3F8UA 3CSJA 4K8MA 4PUAA 16GSA 2A4VA 2F51A 3I69A 3UVHA 2R37A 2H1AA 2CZ3A 5G2ZA 4KE3A 4A5PA 2LQOA 3DXBA 2YV7A 2HRFA 3A2WA 1OC9B 2YNXA 1K0OA 3IAM2 1PX7A 4Z7XA 5IMVA 1O81A 5CO3A 4K7NA 3W6GA 4MJEA 4KSOA 5IMFA 4HQZA 3Q6OA 4BVXA 4EO3A 2MYGA 2KOKA 2WGRA 4Z2TA 1X5EA 1JZDA 1VRSD 3F4TA 5DJMA 1TRSA 5D9VA 1TI1A 5ECLB 5H5RA 2B1LA 2HZEA 3D22A 1X9WB 3ZFBA 1G7EA 2V6KA 1FOVA 2CVKA 2QKEA 5B6NA 3AY8A 1O6JA 4NV2A 4MH2A 3KEBA 5JWQB 3CRUA 4YH2A 1O8XA 2PVQA 3LW9A 2QA2A 4O5RA 3IE3A 4IN0A 4KB3A 3Q18A 5AN1A 1EEJA 1DUGA 1PN0A 3Q74A 1B4QA 4ID0A 4L0UA 2YANA 2D2ZA 4NAXA 4DEJA 3ME7A 1UC7A 1ACVA 3US3A 3BD2A 4BL7B 4POLA 1LU4A 2PWJA 2NBSA 2K18A 2FA4A 4ISDA 3HJOA 1NW2A 3FK8A 3LORA 3TGZA 1XG8A 1CQGA 2LNSA 2WCIA 4PNGA 2O7KA 2IL3A 1ON4A 2IPAA 2QC7A 1YF1A 5DQSA 3HVVA 2DKHA 3NZNA 1WMJA 2IWTA 2AYTA 5JWRB 3N5OA 3HZ4A 1SJIA 4ICYA 3VI5A 1AXDA 1PGTA 3F63A 2C0FA 5GAND 3ERFA 2FD3A 2MMAA 3RPPA 2I3YA 3LWAA 5IOXA 4O5QA 4HJ2A 2YZHA 2C8UA 4CDOA 2FCHA 4N0ZA 4EL1A 3GV1A 5A5KA 3R2QA 2J9HA 2FWFA 3GKKA 1K3YA 4ULXA 1AQVA 2VCZA 2JACA 5ID2B 2DJ1A 4FYCA 2EIRA 3KM6A 3APOA 4TXOA 4WETA 4ZL9A 2L4CA 3KTBA 3M3MA 3CMIA 3SBCA 3FR6A 20GSA 2CT6A 1KBNA 4MABA 4KDXA 5LCZA 2VM2A 1DE2A 2TIRA 3ZITA 3QAVA 4IGJA 2DLXA 2H1BA 3L4NA 3IDVA 2I9HA 2MMNA 4O5UA 1WJKA 4MMMA 5D9TA 4ZBDA 1G6WA 4G10A 2HYXA 1IYHA 1ABAA 2YWMA 3FEUA 3O76A 1R7HA 3QR6A 1GSYA 4K5RA 1F3AA 5G5FA 3LGCA 1X5DA 1J0FA 1SKWB 3FZ4A 4TXVA 4ZL8A 3APQA 2LJKA 3CYNA 3GH9A 4QL7A 2NDOA 2CQ9A 3R3EA 4H86A 3KTLA 3ZL5A 3A5WA 5AIXA 3FZ9A 4I8BA 4IJ3A 2A4HA 5DJLA 4BVXB 5HFKA 1FVKA 3WGDA 4XS4B 2R0CA 4BPYA 1OAZA 3BOAA 1YQ1A 4J57E 18GSA 3P7XA 3HJPA 2XPEA 1GL8A 2FHEA 3ZFLA 2NTOA 2GQKA 3DRNA 4Q5NA 2ES7A 3D4TA 2L6CA 2K6VA 3P2AA 3IRAA 3VWXA 2WFCA 4YKGA 2GQLA 3GIXA 3GX8A 3GYKA 4K0NA 2FWHA 4PUFC 2ZCTA 4JR6A 1VF3A 5A4VA 2TRXA 1WOUA 3FY7A 3HA9A 3HCZA 1FHEA 4KX4A 5F07A 2L5OA 3LXZA 1SK0A 2KP2A 3ZVJD 4X4JA 3L78A 1ERUA 2VD0A 5LD0A 2PPTA 4XTSA 3CSIA 3WD6A 1G7OA 4L5OA 2B3SA 2DIZA 1EV9A 2XC2A 3GUSA 3EWLA 5INYA 3LXTA 3KP9A 1Q4JA 3D6IA 4Q5QA 1OC9A 3TKSE 1HD2A 2H01A 1TI3A 5IM9A 4KDYA 1VF4A 5DQYA 3QD9A 2LRTA 2NVLA 3F4RA 5IOWA 1Q98A 5IPGA 4GQFA 2GVPA 4IJIA 2I1UA 3QPMA 3C71A 3PPUA 3H79A 3DGQA 3FYGA 5DALB 3K8NA 3HY2A 2GT5A 1VF1A 1BYEA 1GNWA 3EU4A 4EDYA 1X5CA 4TR3A 1U6TA 5IO2A 4YQUA 5F8BA 4KW6A 5EY6A 3UIWA 1EOGA 4L5LA 4Z2RA 4HSCX 4HU9A 1GWCA 4KNDA 3VFIA 1KEBA 4MLYA 1S3DA 1JZWA 2NPBA 1J08A 1GUHA 4FYBA 3A2XA 2GSQA 4POMA 3O3TA 2ZNMA 4GWRA 2PU9C 4TRXA 1DSBA 4G9HA 5J4UA 1BJXA 2V1MA 5D96A 1MD3A 1XWGA 2DC5A 1M2AA 3VWWA 2XBIA 3A2VA 2WB9A 1SENA 2C4JA 1M7TA 2VL9A 2PGTA 3GNJA 4ECCA 1JFUA 2X49A 4BL7A 1TK5B 4IP1A 3HVNA 1ZZYA 2ON5A 2ON7A 2HNLA 4TKYA 1ZYPA 4OO5A 4WXTA 4FQUA 1XFLA 4KSMA 1PQNA 3G7YA 3KIJA 1FVJA 1SYXA 4GSTA 3ZLPA 1K0MA 2FLSA 4G0IA 1FB6A 2R4VA 2TRCP 3QAWA 4X0XA 3GH6A 1TTZA 2X8CA 4ZB9A 2CX3A 3JCML 4DSSB 1XBSA 2GSRA 3CTFA 2DBCA 2YWNA 1EGRA 4X1UA 3IK7A 3GKMA 1EEMA 2DJ3A 2CA8A 3TCOA 2Z9SA 3WGXA 3TKRA 5CP1A 2AUVA 3QOUA 2VLUA 4HOJA 1T8EB 3VWVA 1FO5A 2WJUA 3TRXA 3PH9A 1GLPA 1K0DA 2FWGA 1KNGA 2B5XA 4IVFA 2QA1A 4PGTA 1YKCA 4ZIJA 4IBPA 5CRDA 1F37A 1JHBA 3ZYWA 5DCHA 4GCIA 2X8GA 4JZQA 4AF2A 1THXA 1XVQA 5ID2A 2R5GA 1FAAA 3EURA 4KUNA 4LL4B 3I6AA 1A8LA 5ECKB 3VK9A 2R3XA 3ZVJA 4ML6A 1XOAA 4XHMA 4OMVA 2E2MA 3G7JA 3M0FA 3VPQA 1HYUA 1EP8A 2L6DA 4Z2UA 9GSSA 4AJ6A 3F3QA 3EVIA 2R2JA 4WF5A 1UA5A 4EVMA 3TJJA 5CNWA 5B8BA 3EPTA 3IC8A 1A2JA 2DIYA 4HQSA 4PX1A 3GTUB 2QGVA 4OWYA 3GKXA 2HSMA 4OCFA 4EC0A 2JZTA 1QFNA 1WP0A 1FW1A 1OKDA 3KH7A 2C80A 1B4PA 1B9XC 1Z3EA 1M3JA 1ST9A 2LS5A 3J7Yk 3HXSA 1ZCPA 5J9BA 2JSZA 2CX4A 2OACA 4XS4A 4QL9A 5IQYA 4MZCA 2VLVA 1NM3A 1CQHA 4N0VA 5IMCA 2L57A 1G6YA 2REMA 1G0TA 1GTIA 3FKFA 5IMDA 12GSA 5G31A 2N5AA 3L0HA 4P3YB 3U5RE 4D73B 1NHYA 1SJ6A 3UOMA 2RUFA 1B8XA 2O8VB 1Z7PA 3L9SA 4FH8A 1EZKA 2EC4A 2P31A 2R6KA 1V58A 3EE2A 3H4KA 2PMTA 3IXRA 2B5YA 2A2RA 2VLTA 1SL1B 2OE0A 3FMWA 2H30A 4N30A 3FHKA 4XS6A 5COHA 1KTEA 3KH9A 4LL1B 2P5RA 1QUWA 5EPFA 5AISA 2JZRA 3RPNA 1AAZA 1J9BA 3C73A 3F6FA 3QCPA 2HFDA 4G0KA 4IELA 5CREA 1GTAA 4MJCA 3J7Yb 4CW9A 5G5EA 2OE3A 2O89A 2C3TA 2V6OA 2K8VA 2B1KA 2LUSA 4AJ7A 1A2MA 1JLVA 2DKIA 4MZWA 5DALA 4HI7A 2MBSA 4KH7A 5LNKe 3W8JA 1OE8A 4MF7A 1QK8A 5D9XA 3MAKA 2VM1A 3UVTA 1SU9A 2F8AA 2VUPA 2B5EA 2MBTA 3C8EA 4RUVA 5JCWA 5ECHB 3RHBA 2YN1A 1H4OA 2LNTA 3GN3A 4MF6A 4EDZA 1JZOA 1GSUA 4PXOA 2HSYA 4NPBA 1EWXA 4NV5A 1T7PB 4KGIA 1W89A 3C1SA 3H1NA 1TXXA 1SL0B 6GSTA 4XIHA 4IW9A 3RAZA 5CYYA 3GA4A 4F0BA 1C72A 1F2EA 1VF2A 1AC1A 5ELAA 3UARA 19GSA 1ZYQB 2VO4A 3W8SA 3NIVA 1YDKA 1XPVA 5G30A 1MDKA 2FA8A 1TW9A 4GSSA 1XZOA 5J5NA 4MZBA 3MSZA 3E9JB 4TN8A 3TKQA 2AHEA 2LSTA 3MYDA 3ISOA 4MJBA 4MP4A 2RM6A 4GLTA 1JZRA 1YKAA 1A0FA 1PL1A 3RDWA 13GSA 3KXOA 3HJMA 2IFQB 3Q19A 4PURA 3QMXA 4DSSA 3E0UA 5ECSA 5J41A 1K0BA 2ALBA 4AJ8A 3UMAA 4TR1A 4MF5A 1EGOA 5C00A 1V98A 3TB2A 2DJ0A 3I9V2 1WRYA 3CBUA 1A8YA 4PQIA 3TUEA 4NXIA 4YAPA 4I6XA 3DD3A 2GDRA 2G0FA 1QQ2A 2CV4A 4RQXA 1MDJA 2OA7A 2RUEA 1QXHA 4KCAA 1MDIA 3ZIJA 2IN3A 4HJMA 5KEJA 4USSA 2WZ9A 1GRXA 1ILOA 2EIQA 4YAVA 1N2AA 2DSAA 2L4QA 4WEYA 2O87A 3WT1A 2KUCA 2VIMA 2WS2A 5D8IA 2DJKA 1K0NA 3GSTA 3GL3A 1OC3A 3P90A 3VWUA 5HR2A 2X4AA 1T3BA 2P5QA 3VPTA 2FNOA 2L5LA 1GH2A 4NHZA 3S9FA 5KN3A 17GSA 3GTUA 2C3NA 4ZBAA 4TOPA 4MH3A 2P0GA 5KOXA 3UBLA 3KGKA 2ZUPA 4PNFA 4K1FA 1LJRA 3F0IA 5E4WA 4K2XA 2H71A 1X9SB 2OKAA 2E7PA 3DVWA 1A0RP 2WRTA 1TP9A 2OBKA 2PUKC 2GS3A 1XW9A 1XVWA 5DCGA 5CRGA 1AW9A 2VD1A 3OR5A 5KN0A 3LJRA 4JR4A 4OD7A 4TW5A 1PN9A 4BWSA 2BJXA 1BX9A 4IS0A 2X8HA 1YZXA 2IMEA 6GSUA 5CAXA 4D73A 2FWEA 4F82A 3IK9A 4EKZA 1H75A 5C04A 2I4AA 3RHCA
chains in the Genus database with same CATH topology
4YKFA 22GSA 4PQHA 4J56E 2IMDA 3DMLA 1AQWA 2GSSA 5DBQA 4XCSA 3EMPA 3GHAA 2GT6A 4YQVA 4ILFA 4NWYA 3IA1A 1T1VA 4ZB8A 4WF4A 1FB0A 2KHPA 3KZQA 5G1KA 3F9UA 2CZ2A 2HRNA 2GQMA 5G1LA 5DVBA 1UN2A 4ZXGA 4MCUA 2CVBA 2H76A 4E8EA 1T00A 5AIVA 4TR0A 3TDGA 3SWLA 4OFTA 1HNBA 14GSA 5DAKB 1A2LA 3ZREA 3CSHA 3GFKA 3M9KA 2MZCA 3ERWA 4KA0A 1ZMAA 5EVOA 1O85A 2IJYA 3TKSC 2HE3A 2PBJA 1K3LA 2HI7A 3UEMA 4BVYB 3LYPA 4MNNA 3M9JA 4RQRA 3DIEA 4L8EA 3QFBC 4TR1B 1T4YA 1MTCA 1IYIA 2XBQA 5B7CA 1SD9A 3FRCA 5ABRA 1R26A 5JCUA 5J9CA 1WPIA 3TOTA 2LTKA 1R4WA 1M9AA 1GP1A 3GKNA 3BCKA 1RQMA 6GSYA 2GTUA 1GTBA 3BBYA 4X43A 1F9MA 2H8LA 3C7MA 2JL4A 1HQOA 2BTOT 6GSSA 5JWOB 4HDEA 1AIUA 3F3RA 4JEDA 4OFMA 1EV4A 1WE0A 3IHGA 2YCDA 1BQ7A 2YJHA 1ERVA 2HSHA 1VGLA 3RBTA 2MMZA 4F0CA 2IMFA 3LFLA 4K9ZA 3L9VA 2VCQA 3DYRA 4PTSA 1Y25A 4XRDA 2XHFA 4NMUA 5A4UA 4K7IA 1SK1A 2LJRA 5HFGA 4F03A 1YEXA 4ML1A 4G2EA 5HR3A 3LSZA 4V2MA 4HUAA 3ZMKA 2B7JA 3LEFA 1FOHA 2YPMA 1ZL9A 2H0GA 5FWGA 2H19A 4GTUA 4K0GA 2H70A 1XWAA 1TKDB 3QFAC 1U3IA 4AGSA 4OFNA 3TKSA 2X64A 1EOHA 1B48A 1PSQA 2PERA 1DBYA 2IFQA 5ECIB 5HR1A 4ZL7A 4MA9A 3TOUA 3IV4A 4YQMA 3CXGA 5JCGA 3KMOA 3D5JA 4ZILA 2M72A 1USBA 4ECBA 2H74A 4LA1A 1OC8A 2LEGA 3M1GA 2CVDA 2V41A 2F3MA 1PKZA 1FG4A 1GTUA 5H5QA 4I97A 1K3OA 3H8QA 4PQ1A 2XPDA 4CHSA 1OYJA 1YY7A 3WT2A 1WIKA 2E2GA 5D93A 4KCEA 3EC3A 3ME8A 1V9WA 3TRQA 1QGVA 3VLNA 2C3QA 1OKTA 1SKSB 5ENUA 1TRWA 3IC4A 1THOA 2CAIA 1F6MC 2LRNA 2JZSA 2IMKA 1UVZA 3NOFA 4LLRA 2LQQA 4NHWA 3APSA 2C1YA 2PN8A 1V2AA 3E3EA 1Z6NA 5E59A 3V1WA 4GSNA 1M2BA 4DSQA 1I9DA 3C1RA 1ZOFA 4CY8A 2IIYA 2DJJA 2K8SA 2LRCA 1SYRA 1ZYEA 4XRAA 3D0ZA 3MDKA 1ERWA 4GF0A 3ED3A 3GURA 1OVNA 4FO5A 2JSYA 2R0GA 2H6ZA 3HHVA 1GLQA 1F3BA 3TRPA 3HVXA 1M2DA 1U3AA 4ZBBA 2VOCA 1TU7A 5ECRB 5HQPA 2VCXA 3WYWA 3KCMA 4K6XA 3A5IA 4OO4A 3L9UA 1BG5A 3HYPA 3PR8A 3ZTLA 4V2NA 1XW6A 2GZPA 5DDLA 4HZ2A 2YWOA 4IP6A 5AGYA 2VL2C 1GUMA 2HZFA 1ERTA 8GSSA 1GNEA 1YJ6A 2RIIA 4WBJA 3GX0A 2C0EA 2F9SA 1URMA 3FR3A 2OADA 2YP6A 2H6XA 1PL2A 5L71A 2RLIA 4EIPA 4TVEA 3KJYA 5FT3A 1I5GA 3QDNA 3IAS2 1X0RA 1XIYA 2JADA 4KAEA 5IO0A 4E8HA 2HLSA 3CTGA 1O8WA 3DWVA 1YEPA 4TR4A 1K0CA 4Q5RA 1ZGNA 2C0GA 3HD5A 4JU5A 4O92A 3HVSA 3EU3A 3WGEA 4ECIA 3G9BA 2A2PA 3LYKA 4IQAA 1M9BA 3HKRA 1NHOA 3ZZXA 4IKHA 6GSWA 1R5AA 3FW2A 2M80A 3EINA 4WR5A 2K9FA 4BA7A 4ECJA 4V1Ag 2HRAA 7GSSA 3ZRDA 4N11A 4BWQA 5B8AA 2HT9A 4EUYA 2AJQB 5DAKA 3UAPA 2RM5A 1T4ZA 2VL2A 2VCWA 4MK3A 3PINA 3LQ7A 1E6BA 1M99A 1TU8A 1V40A 2GSTA 1BEDA 4IHUA 1W4VA 3U6VA 4BVYA 2OBIA 2B7KA 3ERGA 3GMFA 4WKWA 2IMIA 4HEA2 5F0GA 1A23A 1PA3A 4O7HA 3G7IA 3BCIA 5ECPB 4WR4A 2GLRA 4OCEA 3IPZA 4MPGA 2KP1A 4MPFA 2A2SA 5F06A 5IPHA 2CAQA 2OE1A 1PMTA 2YJ7A 2I81A 4KDUA 3EYTA 2M46A 2WULA 2GZZA 4WBRD 3DEXA 3BJ5A 2AB6A 2R0PA 4JE1A 2YZUA 5IMAA 3P8WA 4EE0A 4I2UA 5GAPD 1A24A 1AQXA 1XXUA 2JU5A 1TRUA 1NSWA 1SL2B 4FYUA 2HZEB 5A4WA 1U88A 3KD0A 5B6MA 2DJ2A 3H93A 5KN2A 1SK2A 1TJDA 1X9MB 3VI7A 2LKUA 4KF9A 2FY6A 2H6YA 2MMOA 1GULA 3LG6A 1OE7A 1AUCA 4MJAA 2KLXA 2UZ8A 5HR0A 3TJKA 4GRFA 2FUG2 3UL3A 3IOSA 1LBKA 1PRXA 4RI6A 5D9WA 2E0QA 4K2DA 2VAFA 4POKA 5CRWA 1PKWA 3TJBA 2VL3A 4ZB6A 1XWBA 4K5SA 4I2TA 4EIQA 1E2YA 1GSEA 1R5PA 1N8JA 1TRVA 2HXKA 4Q5FA 5KN1A 1RW1A 1PX6A 1TOFA 2O85A 5ELGA 4XS1A 2YOIA 3A3TA 4F9ZA 2N5FA 2V32A 3M8NA 4EXJA 4FIWA 6GSXA 1Z5YE 2H0HA 1XWCA 2H75A 3N9JA 1Y6EA 4LMVA 2GGTA 1GUKA 1WWJA 2C0DA 3KMNA 5CRHA 3TKPA 1JLWA 2BMXA 5ECOB 2H1DA 2OJLA 4IQ1A 1TDIA 5D73A 2J23A 11GSA 2AAWA 2EIOA 1TK0B 1SD8A 5BRTA 3F4SA 1GSDA 2YV9A 3D4MA 2N5BA 5H5SA 1MD4A 1S3CA 1SKRB 4G19A 1Z6MA 5ECQB 4L0WA 2VCVA 5EL8A 4HU7A 1O7UA 2H72A 3KP8A 2V2GA 2G2QA 3FR9A 3TJFA 5ECNB 4G0LA 2H1GA 4GQCA 4K7OA 3D21A 3MWHA 3EMXA 3VURA 2GZYA 4TXOB 1GSSA 2L59A 5IIZA 4J2FA 4V2LA 3MNGA 3F6DA 1B9YC 5KOWA 2HRKA 1ZYNA 4ACSA 4HZ4A 1XW5A 3I43A 3CRTA 4CY6A 1Z9HA 1M0UA 2QSIA 4MDCA 2DMLA 1QMVA 3GL5A 1K0AA 4DSRA 1GSFA 1SJZA 3FZAA 2H66A 3PGTA 5IMZA 3DKSA 3IBHA 10GSA 1HNAA 1S3AA 3ZMLA 1DE1A 5GZZB 2PVOC 3TJGA 1XWKA 5ECMB 1MEKA 1U87A 3UBKA 4EF0A 2YWIA 3ZIVA 2AV4A 1XCCA 2LV3A 1HNCA 1ML6A 4O32A 1V57A 3MIXA 5F05A 6GSVA 5BMUA 5GSTA 3GSSA 3QAGA 1TK8B 2F8FA 5FHIA 2B6MA 3HZ8A 4RI7A 2VCTA 1O73A 3FZ5A 1Z7RA 2H0IA 1YF0A 2DMMA 4I5QA 4GXZA 4HS1A 1RK4A 2WDUA 2FGXA 4POBA 4JRRA 1BAYA 3UJ1A 2X99A 5J3RA 5GSSA 1EP7A 4F2IA 4N10A 3O6TA 4LMWA 3GRXA 4JBBA 4V1Ap 1PD21 4DVCA 3HDCA 2LJAA 4QQ7A 1GSQA 3IHQA 3IR4A 1XOBA 2H73A 3DVXA 5HFIA 3F8UA 3CSJA 4K8MA 4PUAA 16GSA 2A4VA 2F51A 3I69A 3UVHA 2R37A 2H1AA 2CZ3A 5G2ZA 4KE3A 4A5PA 2LQOA 3DXBA 2YV7A 2HRFA 3A2WA 1OC9B 2YNXA 1K0OA 3IAM2 1PX7A 4Z7XA 5IMVA 1O81A 5CO3A 4K7NA 3W6GA 4MJEA 4KSOA 5IMFA 4HQZA 3Q6OA 4BVXA 4EO3A 2MYGA 2KOKA 2WGRA 4Z2TA 1X5EA 1JZDA 1VRSD 3F4TA 5DJMA 1TRSA 5D9VA 1TI1A 5ECLB 5H5RA 2B1LA 2HZEA 3D22A 1X9WB 3ZFBA 1G7EA 2V6KA 1FOVA 2CVKA 2QKEA 5B6NA 3AY8A 1O6JA 4NV2A 4MH2A 3KEBA 5JWQB 3CRUA 4YH2A 1O8XA 2PVQA 3LW9A 2QA2A 4O5RA 3IE3A 4IN0A 4KB3A 3Q18A 5AN1A 1EEJA 1DUGA 1PN0A 3Q74A 1B4QA 4ID0A 4L0UA 2YANA 2D2ZA 4NAXA 4DEJA 3ME7A 1UC7A 1ACVA 3US3A 3BD2A 4BL7B 4POLA 1LU4A 2PWJA 2NBSA 2K18A 2FA4A 4ISDA 3HJOA 1NW2A 3FK8A 3LORA 3TGZA 1CQGA 2LNSA 2WCIA 4PNGA 2O7KA 2IL3A 1ON4A 2IPAA 2QC7A 1YF1A 5DQSA 3HVVA 2DKHA 3NZNA 1WMJA 2IWTA 2AYTA 5JWRB 3N5OA 3HZ4A 1SJIA 4ICYA 3VI5A 1AXDA 1PGTA 3F63A 2C0FA 5GAND 3ERFA 2FD3A 2MMAA 3RPPA 2I3YA 3LWAA 5IOXA 4O5QA 4HJ2A 2YZHA 2C8UA 4CDOA 2FCHA 4N0ZA 4EL1A 3GV1A 5A5KA 3R2QA 2J9HA 2FWFA 3GKKA 1K3YA 4ULXA 1AQVA 2VCZA 2JACA 5ID2B 2DJ1A 4FYCA 2EIRA 3KM6A 3APOA 4TXOA 4WETA 4ZL9A 2L4CA 3KTBA 3M3MA 3CMIA 3SBCA 3FR6A 20GSA 2CT6A 1KBNA 4MABA 4KDXA 5LCZA 2VM2A 1DE2A 2TIRA 3ZITA 3QAVA 4IGJA 2DLXA 2H1BA 3L4NA 3IDVA 2I9HA 2MMNA 4O5UA 1WJKA 4MMMA 5D9TA 4ZBDA 1G6WA 4G10A 2HYXA 1IYHA 1ABAA 2YWMA 3FEUA 3O76A 1R7HA 3QR6A 1GSYA 4K5RA 1F3AA 5G5FA 3LGCA 1X5DA 1J0FA 1SKWB 3FZ4A 4TXVA 4ZL8A 3APQA 2LJKA 3CYNA 3GH9A 4QL7A 2NDOA 2CQ9A 3R3EA 4H86A 3KTLA 3ZL5A 3A5WA 5AIXA 3FZ9A 4I8BA 4IJ3A 2A4HA 5DJLA 4BVXB 5HFKA 1FVKA 3WGDA 4XS4B 2R0CA 4BPYA 1OAZA 3BOAA 1YQ1A 4J57E 18GSA 3P7XA 3HJPA 2XPEA 1GL8A 2FHEA 3ZFLA 2NTOA 2GQKA 3DRNA 4Q5NA 2ES7A 3D4TA 2L6CA 2K6VA 3P2AA 3IRAA 3VWXA 2WFCA 4YKGA 2GQLA 3GIXA 3GX8A 3GYKA 4K0NA 2FWHA 4PUFC 2ZCTA 4JR6A 1VF3A 5A4VA 2TRXA 1WOUA 3FY7A 3HA9A 3HCZA 1FHEA 4KX4A 5F07A 2L5OA 3LXZA 1SK0A 2KP2A 3ZVJD 4X4JA 3L78A 1ERUA 2VD0A 5LD0A 2PPTA 4XTSA 3CSIA 3WD6A 1G7OA 4L5OA 2B3SA 2DIZA 1EV9A 2XC2A 3GUSA 3EWLA 5INYA 3LXTA 3KP9A 1Q4JA 3D6IA 4Q5QA 1OC9A 3TKSE 1HD2A 2H01A 1TI3A 5IM9A 4KDYA 1VF4A 5DQYA 3QD9A 2LRTA 2NVLA 3F4RA 5IOWA 1Q98A 5IPGA 4GQFA 2GVPA 4IJIA 2I1UA 3QPMA 3C71A 3PPUA 3H79A 3DGQA 3FYGA 5DALB 3K8NA 3HY2A 2GT5A 1VF1A 1BYEA 1GNWA 3EU4A 4EDYA 1X5CA 4TR3A 1U6TA 5IO2A 4YQUA 5F8BA 4KW6A 5EY6A 3UIWA 1EOGA 4L5LA 4Z2RA 4HU9A 1GWCA 4KNDA 3VFIA 1KEBA 4MLYA 1S3DA 1JZWA 2NPBA 1J08A 1GUHA 4FYBA 3A2XA 2GSQA 4POMA 3O3TA 2ZNMA 4GWRA 2PU9C 4TRXA 1DSBA 4G9HA 5J4UA 1BJXA 2V1MA 5D96A 1MD3A 1XWGA 2DC5A 1M2AA 3VWWA 2XBIA 3A2VA 2WB9A 1SENA 2C4JA 1M7TA 2VL9A 2PGTA 3GNJA 4ECCA 1JFUA 2X49A 4BL7A 1TK5B 4IP1A 1ZZYA 2ON5A 2ON7A 2HNLA 4TKYA 1ZYPA 4OO5A 4WXTA 4FQUA 1XFLA 4KSMA 1PQNA 3G7YA 3KIJA 1FVJA 1SYXA 4GSTA 3ZLPA 1K0MA 2FLSA 4G0IA 1FB6A 2R4VA 2TRCP 3QAWA 4X0XA 3GH6A 1TTZA 2X8CA 4ZB9A 2CX3A 3JCML 4DSSB 1XBSA 2GSRA 3CTFA 2DBCA 2YWNA 1EGRA 4X1UA 3IK7A 3GKMA 1EEMA 2DJ3A 2CA8A 3TCOA 2Z9SA 3WGXA 3TKRA 5CP1A 2AUVA 3QOUA 2VLUA 4HOJA 1T8EB 3VWVA 1FO5A 2WJUA 3TRXA 3PH9A 1GLPA 1K0DA 2FWGA 1KNGA 2B5XA 4IVFA 2QA1A 4PGTA 1YKCA 4ZIJA 4IBPA 5CRDA 1F37A 1JHBA 3ZYWA 5DCHA 4GCIA 2X8GA 4JZQA 4AF2A 1THXA 1XVQA 5ID2A 2R5GA 1FAAA 3EURA 4KUNA 4LL4B 3I6AA 1A8LA 5ECKB 3VK9A 2R3XA 3ZVJA 4ML6A 1XOAA 4XHMA 4OMVA 2E2MA 3G7JA 3M0FA 3VPQA 1HYUA 1EP8A 2L6DA 4Z2UA 9GSSA 4AJ6A 3F3QA 3EVIA 2R2JA 4WF5A 1UA5A 4EVMA 3TJJA 5CNWA 5B8BA 3EPTA 3IC8A 1A2JA 2DIYA 4HQSA 4PX1A 3GTUB 2QGVA 4OWYA 3GKXA 2HSMA 4OCFA 4EC0A 2JZTA 1QFNA 1WP0A 1FW1A 1OKDA 3KH7A 2C80A 1B4PA 1B9XC 1Z3EA 1ST9A 2LS5A 3J7Yk 3HXSA 1ZCPA 5J9BA 2JSZA 2CX4A 2OACA 4XS4A 4QL9A 5IQYA 4MZCA 2VLVA 1NM3A 1CQHA 4N0VA 5IMCA 2L57A 1G6YA 2REMA 1G0TA 1GTIA 3FKFA 5IMDA 12GSA 5G31A 2N5AA 3L0HA 4P3YB 3U5RE 4D73B 1NHYA 1SJ6A 3UOMA 2RUFA 1B8XA 2O8VB 1Z7PA 3L9SA 4FH8A 1EZKA 2EC4A 2P31A 2R6KA 1V58A 3EE2A 3H4KA 2PMTA 3IXRA 2B5YA 2A2RA 2VLTA 1SL1B 2OE0A 3FMWA 2H30A 4N30A 3FHKA 4XS6A 5COHA 1KTEA 3KH9A 4LL1B 2P5RA 1QUWA 5EPFA 5AISA 2JZRA 3RPNA 1AAZA 1J9BA 3C73A 3F6FA 3QCPA 2HFDA 4G0KA 4IELA 5CREA 1GTAA 4MJCA 3J7Yb 4CW9A 5G5EA 2OE3A 2O89A 2C3TA 2V6OA 2K8VA 2B1KA 2LUSA 4AJ7A 1A2MA 1JLVA 2DKIA 4MZWA 5DALA 4HI7A 2MBSA 4KH7A 5LNKe 3W8JA 1OE8A 4MF7A 1QK8A 5D9XA 3MAKA 2VM1A 3UVTA 1SU9A 2F8AA 2VUPA 2B5EA 2MBTA 3C8EA 4RUVA 5JCWA 5ECHB 3RHBA 2YN1A 1H4OA 2LNTA 3GN3A 4MF6A 4EDZA 1JZOA 1GSUA 4PXOA 2HSYA 4NPBA 1EWXA 4NV5A 1T7PB 4KGIA 1W89A 3C1SA 3H1NA 1TXXA 1SL0B 6GSTA 4XIHA 4IW9A 3RAZA 5CYYA 3GA4A 4F0BA 1C72A 1F2EA 1VF2A 1AC1A 5ELAA 3UARA 19GSA 1ZYQB 2VO4A 3W8SA 3NIVA 1YDKA 1XPVA 5G30A 1MDKA 2FA8A 1TW9A 4GSSA 1XZOA 5J5NA 4MZBA 3MSZA 3E9JB 4TN8A 3TKQA 2AHEA 2LSTA 3MYDA 3ISOA 4MJBA 4MP4A 2RM6A 4GLTA 1JZRA 1YKAA 1A0FA 1PL1A 3RDWA 13GSA 3KXOA 3HJMA 2IFQB 3Q19A 4PURA 3QMXA 4DSSA 3E0UA 5ECSA 5J41A 1K0BA 2ALBA 4AJ8A 3UMAA 4TR1A 4MF5A 1EGOA 5C00A 1V98A 3TB2A 2DJ0A 3I9V2 1WRYA 3CBUA 1A8YA 4PQIA 3TUEA 4NXIA 4YAPA 4I6XA 3DD3A 2GDRA 2G0FA 1QQ2A 2CV4A 4RQXA 1MDJA 2OA7A 2RUEA 1QXHA 4KCAA 1MDIA 3ZIJA 2IN3A 4HJMA 5KEJA 4USSA 2WZ9A 1GRXA 1ILOA 2EIQA 4YAVA 1N2AA 2DSAA 2L4QA 4WEYA 2O87A 3WT1A 2KUCA 2VIMA 2WS2A 5D8IA 2DJKA 1K0NA 3GSTA 3GL3A 1OC3A 3P90A 3VWUA 5HR2A 2X4AA 1T3BA 2P5QA 3VPTA 2FNOA 2L5LA 1GH2A 4NHZA 3S9FA 5KN3A 17GSA 3GTUA 2C3NA 4ZBAA 4TOPA 4MH3A 2P0GA 5KOXA 3UBLA 3KGKA 2ZUPA 4PNFA 4K1FA 1LJRA 3F0IA 5E4WA 4K2XA 2H71A 1X9SB 2OKAA 2E7PA 3DVWA 1A0RP 2WRTA 1TP9A 2OBKA 2PUKC 2GS3A 1XW9A 1XVWA 5DCGA 5CRGA 1AW9A 2VD1A 3OR5A 5KN0A 3LJRA 4JR4A 4OD7A 4TW5A 1PN9A 4BWSA 2BJXA 1BX9A 4IS0A 2X8HA 1YZXA 2IMEA 6GSUA 5CAXA 4D73A 2FWEA 4F82A 3IK9A 4EKZA 1H75A 5C04A 2I4AA 3RHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 22GS A;  4PQH A;  4J56 E;  2IMD A;  3DML A;  1AQW A;  2GSS A;  5DBQ A;  4XCS A;  3EMP A;  3GHA A;  2GT6 A;  4YQV A;  4ILF A;  4NWY A;  3IA1 A;  1T1V A;  4ZB8 A;  4WF4 A;  1FB0 A;  2KHP A;  3KZQ A;  5G1K A;  3F9U A;  2CZ2 A;  2HRN A;  2GQM A;  5G1L A;  5DVB A;  1UN2 A;  4ZXG A;  4MCU A;  2CVB A;  2H76 A;  4E8E A;  1T00 A;  5AIV A;  4TR0 A;  3TDG A;  3SWL A;  4OFT A;  1HNB A;  14GS A;  5DAK B;  1A2L A;  3ZRE A;  3CSH A;  3GFK A;  3M9K A;  2MZC A;  3ERW A;  4KA0 A;  1ZMA A;  5EVO A;  1O85 A;  2IJY A;  3TKS C;  2HE3 A;  2PBJ A;  1K3L A;  2HI7 A;  3UEM A;  3LYP A;  4RQR A;  3M9J A;  3DIE A;  4L8E A;  3QFB C;  4TR1 B;  1T4Y A;  1MTC A;  1IYI A;  2XBQ A;  5B7C A;  1SD9 A;  3FRC A;  5ABR A;  1R26 A;  5JCU A;  5J9C A;  1WPI A;  3TOT A;  2LTK A;  1R4W A;  1M9A A;  1GP1 A;  3GKN A;  3BCK A;  1RQM A;  6GSY A;  2GTU A;  1GTB A;  3BBY A;  4X43 A;  1F9M A;  2H8L A;  3C7M A;  2JL4 A;  1HQO A;  2BTO T;  6GSS A;  5JWO B;  4HDE A;  1AIU A;  3F3R A;  4JED A;  4OFM A;  1EV4 A;  1WE0 A;  2YCD A;  1BQ7 A;  2YJH A;  1ERV A;  2HSH A;  1VGL A;  3RBT A;  2MMZ A;  4F0C A;  2IMF A;  3LFL A;  4K9Z A;  3L9V A;  2VCQ A;  3DYR A;  1Y25 A;  4XRD A;  2XHF A;  4NMU A;  5A4U A;  4K7I A;  1SK1 A;  2LJR A;  5HFG A;  4F03 A;  1YEX A;  4ML1 A;  4G2E A;  5HR3 A;  3LSZ A;  4V2M A;  4HUA A;  3ZMK A;  2B7J A;  3LEF A;  2YPM A;  1ZL9 A;  2H0G A;  5FWG A;  2H19 A;  4GTU A;  4K0G A;  2H70 A;  1XWA A;  1TKD B;  3QFA C;  1U3I A;  4AGS A;  4OFN A;  3TKS A;  2X64 A;  1EOH A;  1B48 A;  1PSQ A;  2PER A;  1DBY A;  2IFQ A;  5ECI B;  5HR1 A;  4ZL7 A;  4MA9 A;  3TOU A;  3IV4 A;  4YQM A;  3CXG A;  5JCG A;  3KMO A;  3D5J A;  4ZIL A;  2M72 A;  1USB A;  4ECB A;  2H74 A;  4LA1 A;  1OC8 A;  2LEG A;  3M1G A;  2CVD A;  2V41 A;  2F3M A;  1PKZ A;  1FG4 A;  1GTU A;  5H5Q A;  4I97 A;  1K3O A;  3H8Q A;  4PQ1 A;  2XPD A;  4CHS A;  1OYJ A;  1YY7 A;  3WT2 A;  1WIK A;  2E2G A;  5D93 A;  4KCE A;  3EC3 A;  3ME8 A;  1V9W A;  3TRQ A;  1QGV A;  3VLN A;  2C3Q A;  1OKT A;  1SKS B;  5ENU A;  1TRW A;  3IC4 A;  1THO A;  2CAI A;  1F6M C;  2LRN A;  2JZS A;  2IMK A;  1UVZ A;  3NOF A;  4LLR A;  2LQQ A;  4NHW A;  3APS A;  2C1Y A;  2PN8 A;  1V2A A;  3E3E A;  1Z6N A;  5E59 A;  3V1W A;  4GSN A;  1M2B A;  4DSQ A;  1I9D A;  3C1R A;  1ZOF A;  2IIY A;  2DJJ A;  2K8S A;  2LRC A;  1SYR A;  1ZYE A;  4XRA A;  3D0Z A;  3MDK A;  1ERW A;  4GF0 A;  3ED3 A;  3GUR A;  1OVN A;  4FO5 A;  2JSY A;  2H6Z A;  3HHV A;  1GLQ A;  1F3B A;  3TRP A;  3HVX A;  1M2D A;  1U3A A;  4ZBB A;  2VOC A;  1TU7 A;  5ECR B;  5HQP A;  2VCX A;  3WYW A;  3KCM A;  4K6X A;  4OO4 A;  3L9U A;  1BG5 A;  3HYP A;  3PR8 A;  3ZTL A;  4V2N A;  1XW6 A;  2GZP A;  5DDL A;  4HZ2 A;  2YWO A;  4IP6 A;  5AGY A;  2VL2 C;  1GUM A;  2HZF A;  1ERT A;  8GSS A;  1GNE A;  1YJ6 A;  2RII A;  4WBJ A;  3GX0 A;  2C0E A;  2F9S A;  1URM A;  3FR3 A;  2OAD A;  2YP6 A;  2H6X A;  1PL2 A;  5L71 A;  2RLI A;  4TVE A;  3KJY A;  5FT3 A;  1I5G A;  3QDN A;  3IAS 2;  1X0R A;  1XIY A;  2JAD A;  4KAE A;  5IO0 A;  4E8H A;  2HLS A;  3CTG A;  1O8W A;  3DWV A;  1YEP A;  4TR4 A;  1K0C A;  4Q5R A;  1ZGN A;  2C0G A;  3HD5 A;  4JU5 A;  4O92 A;  3HVS A;  3EU3 A;  3WGE A;  4ECI A;  3G9B A;  3LYK A;  4IQA A;  1M9B A;  3HKR A;  1NHO A;  3ZZX A;  4IKH A;  6GSW A;  1R5A A;  3FW2 A;  2M80 A;  3EIN A;  4WR5 A;  2K9F A;  4BA7 A;  4ECJ A;  4V1A g;  7GSS A;  3ZRD A;  4N11 A;  4BWQ A;  5B8A A;  2HT9 A;  4EUY A;  2AJQ B;  5DAK A;  3UAP A;  2RM5 A;  1T4Z A;  2VL2 A;  2VCW A;  4MK3 A;  3PIN A;  3LQ7 A;  1E6B A;  1M99 A;  1TU8 A;  1V40 A;  2GST A;  1BED A;  4IHU A;  1W4V A;  3U6V A;  4BVY A;  2OBI A;  2B7K A;  3ERG A;  3GMF A;  4WKW A;  2IMI A;  4HEA 2;  5F0G A;  1A23 A;  1PA3 A;  4O7H A;  3G7I A;  3BCI A;  5ECP B;  4WR4 A;  2GLR A;  4OCE A;  3IPZ A;  4MPG A;  2KP1 A;  4MPF A;  2A2S A;  5F06 A;  5IPH A;  2CAQ A;  2OE1 A;  1PMT A;  2YJ7 A;  2I81 A;  4KDU A;  3EYT A;  2M46 A;  2WUL A;  2GZZ A;  4WBR D;  3DEX A;  3BJ5 A;  2AB6 A;  4JE1 A;  2YZU A;  5IMA A;  3P8W A;  4EE0 A;  4I2U A;  5GAP D;  1A24 A;  1AQX A;  1XXU A;  2JU5 A;  1TRU A;  1NSW A;  1SL2 B;  4FYU A;  2HZE B;  5A4W A;  1U88 A;  3KD0 A;  5B6M A;  2DJ2 A;  3H93 A;  5KN2 A;  1SK2 A;  1TJD A;  1X9M B;  3VI7 A;  2LKU A;  2FY6 A;  2H6Y A;  2MMO A;  1GUL A;  3LG6 A;  1OE7 A;  1AUC A;  4MJA A;  2KLX A;  5HR0 A;  3TJK A;  4GRF A;  2FUG 2;  3UL3 A;  3IOS A;  1LBK A;  1PRX A;  4RI6 A;  5D9W A;  2E0Q A;  4K2D A;  2VAF A;  4POK A;  5CRW A;  1PKW A;  3TJB A;  2VL3 A;  4ZB6 A;  1XWB A;  4I2T A;  1E2Y A;  1GSE A;  1R5P A;  1N8J A;  1TRV A;  2HXK A;  4Q5F A;  5KN1 A;  1RW1 A;  1PX6 A;  1TOF A;  2O85 A;  5ELG A;  4XS1 A;  2YOI A;  3A3T A;  4F9Z A;  2N5F A;  2V32 A;  3M8N A;  4EXJ A;  4FIW A;  6GSX A;  1Z5Y E;  2H0H A;  1XWC A;  2H75 A;  3N9J A;  1Y6E A;  4LMV A;  2GGT A;  1GUK A;  1WWJ A;  2C0D A;  3KMN A;  5CRH A;  3TKP A;  1JLW A;  2BMX A;  5ECO B;  2H1D A;  2OJL A;  4IQ1 A;  1TDI A;  5D73 A;  2J23 A;  11GS A;  2AAW A;  2EIO A;  1TK0 B;  1SD8 A;  3F4S A;  1GSD A;  2YV9 A;  3D4M A;  2N5B A;  5H5S A;  1MD4 A;  1S3C A;  1SKR B;  4G19 A;  1Z6M A;  5ECQ B;  4L0W A;  2VCV A;  5EL8 A;  4HU7 A;  1O7U A;  2H72 A;  3KP8 A;  2V2G A;  2G2Q A;  3FR9 A;  3TJF A;  5ECN B;  2H1G A;  4GQC A;  4K7O A;  3D21 A;  3MWH A;  3EMX A;  3VUR A;  2GZY A;  4TXO B;  1GSS A;  2L59 A;  5IIZ A;  4J2F A;  4V2L A;  3MNG A;  3F6D A;  1B9Y C;  4ACS A;  4HZ4 A;  1XW5 A;  3I43 A;  3CRT A;  1Z9H A;  1M0U A;  2QSI A;  4MDC A;  2DML A;  1QMV A;  3GL5 A;  1K0A A;  4DSR A;  1GSF A;  1SJZ A;  3FZA A;  2H66 A;  3PGT A;  5IMZ A;  3DKS A;  3IBH A;  10GS A;  1HNA A;  1S3A A;  3ZML A;  1DE1 A;  5GZZ B;  2PVO C;  3TJG A;  1XWK A;  5ECM B;  1MEK A;  1U87 A;  3UBK A;  4EF0 A;  2YWI A;  3ZIV A;  2AV4 A;  1XCC A;  2LV3 A;  1HNC A;  1ML6 A;  4O32 A;  1V57 A;  5F05 A;  6GSV A;  5GST A;  3GSS A;  3QAG A;  1TK8 B;  2F8F A;  5FHI A;  2B6M A;  3HZ8 A;  4RI7 A;  2VCT A;  1O73 A;  3FZ5 A;  1Z7R A;  2H0I A;  1YF0 A;  2DMM A;  4I5Q A;  4GXZ A;  4HS1 A;  1RK4 A;  2WDU A;  2FGX A;  4POB A;  4JRR A;  1BAY A;  3UJ1 A;  2X99 A;  5J3R A;  5GSS A;  1EP7 A;  4F2I A;  4N10 A;  3O6T A;  4LMW A;  3GRX A;  4JBB A;  4V1A p;  1PD2 1;  4DVC A;  3HDC A;  2LJA A;  4QQ7 A;  1GSQ A;  3IHQ A;  3IR4 A;  1XOB A;  2H73 A;  3DVX A;  5HFI A;  3F8U A;  3CSJ A;  4K8M A;  4PUA A;  16GS A;  2A4V A;  2F51 A;  3I69 A;  3UVH A;  2R37 A;  2H1A A;  2CZ3 A;  5G2Z A;  4KE3 A;  2LQO A;  3DXB A;  2YV7 A;  2HRF A;  3A2W A;  1OC9 B;  2YNX A;  1K0O A;  3IAM 2;  1PX7 A;  4Z7X A;  5IMV A;  1O81 A;  5CO3 A;  4K7N A;  3W6G A;  4MJE A;  4KSO A;  5IMF A;  4HQZ A;  3Q6O A;  4BVX A;  4EO3 A;  2MYG A;  2KOK A;  2WGR A;  1X5E A;  1JZD A;  1VRS D;  3F4T A;  5DJM A;  1TRS A;  5D9V A;  1TI1 A;  5ECL B;  5H5R A;  2B1L A;  2HZE A;  3D22 A;  1X9W B;  3ZFB A;  1G7E A;  2V6K A;  1FOV A;  2CVK A;  2QKE A;  5B6N A;  3AY8 A;  1O6J A;  4NV2 A;  4MH2 A;  3KEB A;  5JWQ B;  3CRU A;  4YH2 A;  1O8X A;  2PVQ A;  4O5R A;  3IE3 A;  4IN0 A;  4KB3 A;  3Q18 A;  5AN1 A;  1EEJ A;  1DUG A;  3Q74 A;  1B4Q A;  4ID0 A;  4L0U A;  2YAN A;  2D2Z A;  4NAX A;  4DEJ A;  3ME7 A;  1UC7 A;  1ACV A;  3US3 A;  3BD2 A;  4POL A;  1LU4 A;  2PWJ A;  2NBS A;  2K18 A;  2FA4 A;  4ISD A;  3HJO A;  1NW2 A;  3FK8 A;  3LOR A;  3TGZ A;  1CQG A;  2LNS A;  2WCI A;  4PNG A;  2O7K A;  2IL3 A;  1ON4 A;  2IPA A;  2QC7 A;  1YF1 A;  5DQS A;  3HVV A;  3NZN A;  1WMJ A;  2IWT A;  2AYT A;  5JWR B;  3N5O A;  3HZ4 A;  1SJI A;  3VI5 A;  1AXD A;  1PGT A;  3F63 A;  2C0F A;  5GAN D;  3ERF A;  2FD3 A;  2MMA A;  3RPP A;  2I3Y A;  3LWA A;  5IOX A;  4HJ2 A;  2YZH A;  2C8U A;  4CDO A;  2FCH A;  4N0Z A;  4EL1 A;  3GV1 A;  5A5K A;  3R2Q A;  2J9H A;  2FWF A;  3GKK A;  1K3Y A;  4ULX A;  1AQV A;  2VCZ A;  2JAC A;  5ID2 B;  2DJ1 A;  4FYC A;  2EIR A;  3KM6 A;  3APO A;  4TXO A;  4WET A;  4ZL9 A;  2L4C A;  3KTB A;  3M3M A;  3CMI A;  3SBC A;  3FR6 A;  20GS A;  2CT6 A;  1KBN A;  4MAB A;  4KDX A;  5LCZ A;  2VM2 A;  1DE2 A;  2TIR A;  3ZIT A;  3QAV A;  4IGJ A;  2DLX A;  2H1B A;  3L4N A;  3IDV A;  2I9H A;  2MMN A;  1WJK A;  4MMM A;  5D9T A;  4ZBD A;  1G6W A;  4G10 A;  2HYX A;  1IYH A;  1ABA A;  2YWM A;  3FEU A;  3O76 A;  1R7H A;  3QR6 A;  1GSY A;  5G5F A;  1F3A A;  3LGC A;  1X5D A;  1J0F A;  1SKW B;  3FZ4 A;  4TXV A;  4ZL8 A;  3APQ A;  2LJK A;  3CYN A;  3GH9 A;  4QL7 A;  2NDO A;  2CQ9 A;  4H86 A;  3KTL A;  3ZL5 A;  3A5W A;  5AIX A;  3FZ9 A;  4I8B A;  4IJ3 A;  5DJL A;  5HFK A;  1FVK A;  3WGD A;  4XS4 B;  4BPY A;  1OAZ A;  3BOA A;  1YQ1 A;  4J57 E;  18GS A;  3P7X A;  3HJP A;  2XPE A;  1GL8 A;  2FHE A;  3ZFL A;  2NTO A;  2GQK A;  3DRN A;  4Q5N A;  2ES7 A;  3D4T A;  2L6C A;  2K6V A;  3P2A A;  3IRA A;  3VWX A;  2WFC A;  2GQL A;  3GIX A;  3GX8 A;  3GYK A;  4K0N A;  2FWH A;  4PUF C;  2ZCT A;  4JR6 A;  1VF3 A;  5A4V A;  2TRX A;  1WOU A;  3FY7 A;  3HA9 A;  3HCZ A;  1FHE A;  4KX4 A;  5F07 A;  2L5O A;  3LXZ A;  1SK0 A;  2KP2 A;  3ZVJ D;  3L78 A;  1ERU A;  2VD0 A;  5LD0 A;  2PPT A;  4XTS A;  3CSI A;  3WD6 A;  1G7O A;  4L5O A;  2B3S A;  2DIZ A;  1EV9 A;  2XC2 A;  3GUS A;  3EWL A;  5INY A;  3LXT A;  3KP9 A;  1Q4J A;  3D6I A;  4Q5Q A;  1OC9 A;  3TKS E;  1HD2 A;  2H01 A;  1TI3 A;  5IM9 A;  4KDY A;  1VF4 A;  5DQY A;  3QD9 A;  2LRT A;  2NVL A;  3F4R A;  5IOW A;  1Q98 A;  5IPG A;  4GQF A;  2GVP A;  4IJI A;  2I1U A;  3QPM A;  3C71 A;  3H79 A;  3DGQ A;  3FYG A;  5DAL B;  3K8N A;  3HY2 A;  2GT5 A;  1VF1 A;  1BYE A;  1GNW A;  3EU4 A;  4EDY A;  1X5C A;  4TR3 A;  1U6T A;  5IO2 A;  4YQU A;  5F8B A;  4KW6 A;  5EY6 A;  3UIW A;  1EOG A;  4L5L A;  4HU9 A;  1GWC A;  4KND A;  3VFI A;  1KEB A;  4MLY A;  1S3D A;  1JZW A;  2NPB A;  1J08 A;  1GUH A;  4FYB A;  3A2X A;  2GSQ A;  4POM A;  3O3T A;  2ZNM A;  4GWR A;  2PU9 C;  4TRX A;  1DSB A;  4G9H A;  5J4U A;  1BJX A;  2V1M A;  5D96 A;  1MD3 A;  1XWG A;  2DC5 A;  1M2A A;  3VWW A;  2XBI A;  3A2V A;  2WB9 A;  1SEN A;  2C4J A;  1M7T A;  2VL9 A;  2PGT A;  3GNJ A;  4ECC A;  1JFU A;  4BL7 A;  1TK5 B;  4IP1 A;  1ZZY A;  2ON5 A;  2ON7 A;  2HNL A;  4TKY A;  4OO5 A;  4WXT A;  1XFL A;  4KSM A;  1PQN A;  3G7Y A;  3KIJ A;  1FVJ A;  1SYX A;  4GST A;  3ZLP A;  1K0M A;  2FLS A;  1FB6 A;  2R4V A;  2TRC P;  3QAW A;  4X0X A;  3GH6 A;  1TTZ A;  2X8C A;  4ZB9 A;  2CX3 A;  3JCM L;  4DSS B;  1XBS A;  2GSR A;  3CTF A;  2DBC A;  2YWN A;  1EGR A;  4X1U A;  3IK7 A;  3GKM A;  1EEM A;  2DJ3 A;  2CA8 A;  3TCO A;  2Z9S A;  3WGX A;  3TKR A;  5CP1 A;  2AUV A;  3QOU A;  2VLU A;  4HOJ A;  1T8E B;  3VWV A;  1FO5 A;  2WJU A;  3TRX A;  3PH9 A;  1GLP A;  1K0D A;  2FWG A;  1KNG A;  2B5X A;  4IVF A;  4PGT A;  1YKC A;  4ZIJ A;  4IBP A;  5CRD A;  1F37 A;  1JHB A;  3ZYW A;  5DCH A;  4GCI A;  2X8G A;  4JZQ A;  4AF2 A;  1THX A;  1XVQ A;  5ID2 A;  2R5G A;  1FAA A;  3EUR A;  4KUN A;  4LL4 B;  3I6A A;  1A8L A;  5ECK B;  3VK9 A;  2R3X A;  3ZVJ A;  4ML6 A;  1XOA A;  4XHM A;  4OMV A;  2E2M A;  3G7J A;  3M0F A;  3VPQ A;  1HYU A;  1EP8 A;  2L6D A;  9GSS A;  4AJ6 A;  3F3Q A;  3EVI A;  2R2J A;  4WF5 A;  1UA5 A;  4EVM A;  3TJJ A;  5CNW A;  5B8B A;  1A2J A;  2DIY A;  4HQS A;  4PX1 A;  3GTU B;  2QGV A;  4OWY A;  3GKX A;  4OCF A;  4EC0 A;  2JZT A;  1QFN A;  1WP0 A;  1FW1 A;  1OKD A;  3KH7 A;  2C80 A;  1B4P A;  1B9X C;  1Z3E A;  1ST9 A;  2LS5 A;  3J7Y k;  3HXS A;  1ZCP A;  5J9B A;  2JSZ A;  2CX4 A;  2OAC A;  4XS4 A;  4QL9 A;  5IQY A;  4MZC A;  2VLV A;  1NM3 A;  1CQH A;  4N0V A;  5IMC A;  2L57 A;  1G6Y A;  2REM A;  1G0T A;  1GTI A;  3FKF A;  5IMD A;  12GS A;  5G31 A;  2N5A A;  3L0H A;  4P3Y B;  3U5R E;  4D73 B;  1NHY A;  1SJ6 A;  3UOM A;  2RUF A;  1B8X A;  2O8V B;  1Z7P A;  3L9S A;  4FH8 A;  1EZK A;  2EC4 A;  2P31 A;  2R6K A;  1V58 A;  3EE2 A;  3H4K A;  2PMT A;  3IXR A;  2B5Y A;  2A2R A;  2VLT A;  1SL1 B;  2OE0 A;  4N30 A;  2H30 A;  3FHK A;  4XS6 A;  5COH A;  1KTE A;  3KH9 A;  4LL1 B;  2P5R A;  1QUW A;  5EPF A;  5AIS A;  2JZR A;  3RPN A;  1AAZ A;  1J9B A;  3C73 A;  3F6F A;  3QCP A;  2HFD A;  4IEL A;  5CRE A;  1GTA A;  4MJC A;  3J7Y b;  4CW9 A;  5G5E A;  2OE3 A;  2O89 A;  2C3T A;  2V6O A;  2K8V A;  2B1K A;  2LUS A;  4AJ7 A;  1A2M A;  1JLV A;  4MZW A;  5DAL A;  4HI7 A;  2MBS A;  4KH7 A;  5LNK e;  3W8J A;  1OE8 A;  4MF7 A;  1QK8 A;  5D9X A;  3MAK A;  2VM1 A;  3UVT A;  1SU9 A;  2F8A A;  2VUP A;  2B5E A;  2MBT A;  3C8E A;  4RUV A;  5JCW A;  5ECH B;  3RHB A;  2YN1 A;  1H4O A;  2LNT A;  3GN3 A;  4MF6 A;  4EDZ A;  1JZO A;  1GSU A;  4PXO A;  2HSY A;  4NPB A;  1EWX A;  4NV5 A;  1T7P B;  4KGI A;  1W89 A;  3C1S A;  3H1N A;  1TXX A;  1SL0 B;  6GST A;  4XIH A;  4IW9 A;  3RAZ A;  5CYY A;  3GA4 A;  4F0B A;  1C72 A;  1F2E A;  1VF2 A;  1AC1 A;  5ELA A;  3UAR A;  19GS A;  1ZYQ B;  2VO4 A;  3W8S A;  3NIV A;  1YDK A;  1XPV A;  5G30 A;  1MDK A;  2FA8 A;  1TW9 A;  4GSS A;  1XZO A;  5J5N A;  4MZB A;  3MSZ A;  3E9J B;  4TN8 A;  3TKQ A;  2AHE A;  2LST A;  3ISO A;  4MJB A;  4MP4 A;  2RM6 A;  4GLT A;  1JZR A;  1YKA A;  1A0F A;  1PL1 A;  3RDW A;  13GS A;  3KXO A;  3HJM A;  2IFQ B;  3Q19 A;  4PUR A;  3QMX A;  4DSS A;  3E0U A;  5ECS A;  5J41 A;  1K0B A;  2ALB A;  4AJ8 A;  3UMA A;  4TR1 A;  4MF5 A;  1EGO A;  5C00 A;  1V98 A;  3TB2 A;  2DJ0 A;  3I9V 2;  1WRY A;  3CBU A;  1A8Y A;  4PQI A;  3TUE A;  4NXI A;  4YAP A;  4I6X A;  3DD3 A;  2GDR A;  2G0F A;  1QQ2 A;  2CV4 A;  4RQX A;  1MDJ A;  2OA7 A;  2RUE A;  1QXH A;  4KCA A;  1MDI A;  3ZIJ A;  2IN3 A;  4HJM A;  5KEJ A;  2WZ9 A;  1GRX A;  1ILO A;  2EIQ A;  4YAV A;  1N2A A;  2DSA A;  2L4Q A;  4WEY A;  2O87 A;  3WT1 A;  2KUC A;  2VIM A;  2WS2 A;  5D8I A;  2DJK A;  1K0N A;  3GST A;  3GL3 A;  1OC3 A;  3P90 A;  3VWU A;  5HR2 A;  1T3B A;  2P5Q A;  3VPT A;  2FNO A;  2L5L A;  1GH2 A;  4NHZ A;  3S9F A;  5KN3 A;  17GS A;  3GTU A;  2C3N A;  4ZBA A;  4TOP A;  4MH3 A;  2P0G A;  3UBL A;  3KGK A;  2ZUP A;  4PNF A;  4K1F A;  1LJR A;  3F0I A;  5E4W A;  2H71 A;  1X9S B;  2OKA A;  2E7P A;  3DVW A;  1A0R P;  2WRT A;  1TP9 A;  2OBK A;  2PUK C;  2GS3 A;  1XW9 A;  1XVW A;  5DCG A;  5CRG A;  1AW9 A;  2VD1 A;  3OR5 A;  5KN0 A;  3LJR A;  4JR4 A;  4OD7 A;  4TW5 A;  1PN9 A;  4BWS A;  2BJX A;  1BX9 A;  4IS0 A;  2X8H A;  1YZX A;  2IME A;  6GSU A;  5CAX A;  4D73 A;  2FWE A;  4F82 A;  3IK9 A;  4EKZ A;  1H75 A;  5C04 A;  2I4A A;  3RHC A; 
#chains in the Genus database with same CATH topology
 4YKF A;  22GS A;  4PQH A;  4J56 E;  2IMD A;  3DML A;  1AQW A;  2GSS A;  5DBQ A;  4XCS A;  3EMP A;  3GHA A;  2GT6 A;  4YQV A;  4ILF A;  4NWY A;  3IA1 A;  1T1V A;  4ZB8 A;  4WF4 A;  1FB0 A;  2KHP A;  3KZQ A;  5G1K A;  3F9U A;  2CZ2 A;  2HRN A;  2GQM A;  5G1L A;  5DVB A;  1UN2 A;  4ZXG A;  4MCU A;  2CVB A;  2H76 A;  4E8E A;  1T00 A;  5AIV A;  4TR0 A;  3TDG A;  3SWL A;  4OFT A;  1HNB A;  14GS A;  5DAK B;  1A2L A;  3ZRE A;  3CSH A;  3GFK A;  3M9K A;  2MZC A;  1PFO A;  3ERW A;  4KA0 A;  1ZMA A;  5EVO A;  1O85 A;  2IJY A;  3TKS C;  2HE3 A;  2PBJ A;  1K3L A;  2HI7 A;  3UEM A;  4BVY B;  3LYP A;  4MNN A;  3M9J A;  4RQR A;  3DIE A;  4L8E A;  3QFB C;  4TR1 B;  1T4Y A;  1MTC A;  1IYI A;  2XBQ A;  5B7C A;  1SD9 A;  3FRC A;  5ABR A;  1R26 A;  5JCU A;  5J9C A;  1WPI A;  3TOT A;  2LTK A;  1R4W A;  1M9A A;  1GP1 A;  3GKN A;  3BCK A;  1RQM A;  6GSY A;  2GTU A;  1GTB A;  3BBY A;  4X43 A;  1F9M A;  2H8L A;  3C7M A;  2JL4 A;  1HQO A;  2BTO T;  6GSS A;  5JWO B;  4HDE A;  1AIU A;  3F3R A;  4JED A;  4OFM A;  1EV4 A;  1WE0 A;  3IHG A;  2YCD A;  1BQ7 A;  2YJH A;  1ERV A;  2HSH A;  1VGL A;  3RBT A;  2MMZ A;  4F0C A;  2IMF A;  3LFL A;  4K9Z A;  3L9V A;  2VCQ A;  3DYR A;  4PTS A;  1Y25 A;  4XRD A;  2XHF A;  4NMU A;  5A4U A;  4K7I A;  1SK1 A;  2LJR A;  5HFG A;  4F03 A;  1YEX A;  4ML1 A;  4G2E A;  5HR3 A;  3LSZ A;  4V2M A;  4HUA A;  3ZMK A;  2B7J A;  3LEF A;  1FOH A;  2YPM A;  1ZL9 A;  2H0G A;  5FWG A;  2H19 A;  4GTU A;  4K0G A;  2H70 A;  1XWA A;  1TKD B;  3QFA C;  1U3I A;  4AGS A;  4OFN A;  3TKS A;  2X64 A;  1EOH A;  1B48 A;  1PSQ A;  1M3I A;  2PER A;  1DBY A;  2IFQ A;  5ECI B;  5HR1 A;  4ZL7 A;  4MA9 A;  3TOU A;  3IV4 A;  4YQM A;  3CXG A;  5JCG A;  3KMO A;  3D5J A;  4ZIL A;  2M72 A;  1USB A;  4ECB A;  2H74 A;  4LA1 A;  1OC8 A;  2LEG A;  3M1G A;  2CVD A;  2V41 A;  2F3M A;  1PKZ A;  1FG4 A;  1GTU A;  5H5Q A;  4I97 A;  1K3O A;  3H8Q A;  4PQ1 A;  2XPD A;  4CHS A;  1OYJ A;  1YY7 A;  3WT2 A;  1WIK A;  2E2G A;  5D93 A;  4KCE A;  3EC3 A;  3ME8 A;  1V9W A;  3TRQ A;  1QGV A;  3VLN A;  2C3Q A;  1OKT A;  1SKS B;  5ENU A;  1TRW A;  3IC4 A;  1THO A;  2CAI A;  1F6M C;  2LRN A;  2JZS A;  2IMK A;  1UVZ A;  3NOF A;  4LLR A;  2LQQ A;  4NHW A;  3APS A;  2C1Y A;  2PN8 A;  1V2A A;  3E3E A;  1Z6N A;  5E59 A;  3V1W A;  4GSN A;  1M2B A;  4DSQ A;  1I9D A;  3C1R A;  1ZOF A;  4CY8 A;  2IIY A;  2DJJ A;  2K8S A;  2LRC A;  1SYR A;  1ZYE A;  4XRA A;  3D0Z A;  3MDK A;  1ERW A;  4GF0 A;  3ED3 A;  3GUR A;  1OVN A;  4FO5 A;  2JSY A;  2R0G A;  2H6Z A;  3HHV A;  1GLQ A;  1F3B A;  3TRP A;  3HVX A;  1M2D A;  1U3A A;  4ZBB A;  2VOC A;  1TU7 A;  5ECR B;  5HQP A;  2VCX A;  3WYW A;  3KCM A;  4K6X A;  3A5I A;  4OO4 A;  3L9U A;  1BG5 A;  3HYP A;  3PR8 A;  3ZTL A;  4V2N A;  1XW6 A;  2GZP A;  5DDL A;  4HZ2 A;  2YWO A;  4IP6 A;  5AGY A;  2VL2 C;  1GUM A;  2HZF A;  1ERT A;  8GSS A;  1GNE A;  1YJ6 A;  2RII A;  4WBJ A;  3GX0 A;  2C0E A;  2F9S A;  1URM A;  3FR3 A;  2OAD A;  2YP6 A;  2H6X A;  1PL2 A;  5L71 A;  2RLI A;  4EIP A;  4TVE A;  3KJY A;  5FT3 A;  1I5G A;  3QDN A;  3IAS 2;  1X0R A;  1XIY A;  2JAD A;  4KAE A;  5IO0 A;  4E8H A;  2HLS A;  3CTG A;  1O8W A;  3DWV A;  1YEP A;  4TR4 A;  1K0C A;  4Q5R A;  1ZGN A;  2C0G A;  3HD5 A;  4JU5 A;  4O92 A;  3HVS A;  3EU3 A;  3WGE A;  4ECI A;  3G9B A;  2A2P A;  3LYK A;  4IQA A;  1M9B A;  3HKR A;  1NHO A;  3ZZX A;  4IKH A;  6GSW A;  1R5A A;  3FW2 A;  2M80 A;  3EIN A;  4WR5 A;  2K9F A;  4BA7 A;  4ECJ A;  4V1A g;  2HRA A;  7GSS A;  3ZRD A;  4N11 A;  4BWQ A;  5B8A A;  2HT9 A;  4EUY A;  2AJQ B;  5DAK A;  3UAP A;  2RM5 A;  1T4Z A;  2VL2 A;  2VCW A;  4MK3 A;  3PIN A;  3LQ7 A;  1E6B A;  1M99 A;  1TU8 A;  1V40 A;  2GST A;  1BED A;  4IHU A;  1W4V A;  3U6V A;  4BVY A;  2OBI A;  2B7K A;  3ERG A;  3GMF A;  4WKW A;  2IMI A;  4HEA 2;  5F0G A;  1A23 A;  1PA3 A;  4O7H A;  3G7I A;  3BCI A;  5ECP B;  4WR4 A;  1S3R A;  2GLR A;  4OCE A;  3IPZ A;  4MPG A;  2KP1 A;  4MPF A;  2A2S A;  5F06 A;  5IPH A;  2CAQ A;  2OE1 A;  1PMT A;  2YJ7 A;  2I81 A;  4KDU A;  3EYT A;  2M46 A;  2WUL A;  2GZZ A;  4WBR D;  3DEX A;  3BJ5 A;  2AB6 A;  2R0P A;  4JE1 A;  2YZU A;  5IMA A;  3P8W A;  4EE0 A;  4I2U A;  5GAP D;  1A24 A;  1AQX A;  1XXU A;  2JU5 A;  1TRU A;  1NSW A;  1SL2 B;  4FYU A;  2HZE B;  5A4W A;  1U88 A;  3KD0 A;  5B6M A;  2DJ2 A;  3H93 A;  5KN2 A;  1SK2 A;  1TJD A;  1X9M B;  3VI7 A;  2LKU A;  4KF9 A;  2FY6 A;  2H6Y A;  2MMO A;  1GUL A;  3LG6 A;  1OE7 A;  1AUC A;  4MJA A;  4BIK A;  2KLX A;  2UZ8 A;  5HR0 A;  3TJK A;  4GRF A;  2FUG 2;  3UL3 A;  3IOS A;  1LBK A;  1PRX A;  4RI6 A;  5D9W A;  2E0Q A;  4K2D A;  2VAF A;  4POK A;  5CRW A;  1PKW A;  3TJB A;  2VL3 A;  4ZB6 A;  1XWB A;  4K5S A;  4I2T A;  4EIQ A;  1E2Y A;  1GSE A;  1R5P A;  1N8J A;  1TRV A;  2HXK A;  4Q5F A;  5KN1 A;  1RW1 A;  1PX6 A;  1TOF A;  2O85 A;  5ELG A;  4XS1 A;  2YOI A;  3A3T A;  4F9Z A;  2N5F A;  2V32 A;  3M8N A;  4EXJ A;  4FIW A;  6GSX A;  1Z5Y E;  2H0H A;  1XWC A;  2H75 A;  3N9J A;  1Y6E A;  4LMV A;  2GGT A;  1GUK A;  1WWJ A;  2C0D A;  3KMN A;  5CRH A;  3TKP A;  1JLW A;  2BMX A;  5ECO B;  2H1D A;  2OJL A;  4IQ1 A;  1TDI A;  5D73 A;  2J23 A;  11GS A;  2AAW A;  2EIO A;  1TK0 B;  1SD8 A;  5BRT A;  3F4S A;  1GSD A;  2YV9 A;  3D4M A;  2N5B A;  5H5S A;  1MD4 A;  1S3C A;  1SKR B;  4G19 A;  1Z6M A;  5ECQ B;  4L0W A;  2VCV A;  5EL8 A;  4HU7 A;  1O7U A;  2H72 A;  3KP8 A;  2V2G A;  2G2Q A;  3FR9 A;  3TJF A;  5ECN B;  4G0L A;  2H1G A;  4GQC A;  4K7O A;  3D21 A;  3MWH A;  3EMX A;  3VUR A;  2GZY A;  4TXO B;  1GSS A;  2L59 A;  5IIZ A;  4J2F A;  4V2L A;  3MNG A;  3F6D A;  1B9Y C;  5KOW A;  2HRK A;  1ZYN A;  4ACS A;  4HZ4 A;  1XW5 A;  3I43 A;  3CRT A;  4CY6 A;  1Z9H A;  1M0U A;  2QSI A;  4MDC A;  2DML A;  1QMV A;  3GL5 A;  1K0A A;  4DSR A;  1GSF A;  1SJZ A;  3FZA A;  2H66 A;  3PGT A;  5IMZ A;  3DKS A;  3IBH A;  10GS A;  1HNA A;  1S3A A;  3ZML A;  1DE1 A;  5GZZ B;  3CQF A;  2PVO C;  3TJG A;  1XWK A;  5ECM B;  1MEK A;  1U87 A;  3UBK A;  4EF0 A;  2YWI A;  3ZIV A;  2AV4 A;  1XCC A;  2LV3 A;  1HNC A;  1ML6 A;  4O32 A;  1V57 A;  3MIX A;  5F05 A;  6GSV A;  5BMU A;  5GST A;  3GSS A;  3QAG A;  1TK8 B;  2F8F A;  5FHI A;  2B6M A;  3HZ8 A;  4RI7 A;  2VCT A;  1O73 A;  3FZ5 A;  1Z7R A;  2H0I A;  1YF0 A;  2DMM A;  4I5Q A;  4GXZ A;  4HS1 A;  1RK4 A;  2WDU A;  2FGX A;  4POB A;  4JRR A;  1BAY A;  3UJ1 A;  2X99 A;  5J3R A;  5GSS A;  1EP7 A;  4F2I A;  4N10 A;  3O6T A;  4LMW A;  3GRX A;  4JBB A;  4V1A p;  1PD2 1;  4DVC A;  3HDC A;  2LJA A;  4QQ7 A;  1GSQ A;  3IHQ A;  3IR4 A;  1XOB A;  2H73 A;  3DVX A;  5HFI A;  3F8U A;  3CSJ A;  4K8M A;  4PUA A;  16GS A;  2A4V A;  2F51 A;  3I69 A;  3UVH A;  2R37 A;  2H1A A;  2CZ3 A;  5G2Z A;  4KE3 A;  4A5P A;  2LQO A;  3DXB A;  2YV7 A;  2HRF A;  3A2W A;  1OC9 B;  2YNX A;  1K0O A;  3IAM 2;  1PX7 A;  4Z7X A;  5IMV A;  1O81 A;  5CO3 A;  4K7N A;  3W6G A;  4MJE A;  4KSO A;  5IMF A;  4HQZ A;  3Q6O A;  4BVX A;  4EO3 A;  2MYG A;  2KOK A;  2WGR A;  4Z2T A;  1X5E A;  1JZD A;  1VRS D;  3F4T A;  5DJM A;  1TRS A;  5D9V A;  1TI1 A;  5ECL B;  5H5R A;  2B1L A;  2HZE A;  3D22 A;  1X9W B;  3ZFB A;  1G7E A;  2V6K A;  1FOV A;  2CVK A;  2QKE A;  5B6N A;  3AY8 A;  1O6J A;  4NV2 A;  4MH2 A;  3KEB A;  5JWQ B;  3CRU A;  4YH2 A;  1O8X A;  2PVQ A;  3LW9 A;  2QA2 A;  4O5R A;  3IE3 A;  4IN0 A;  4KB3 A;  3Q18 A;  5AN1 A;  1EEJ A;  1DUG A;  1PN0 A;  3Q74 A;  1B4Q A;  4ID0 A;  4L0U A;  2YAN A;  2D2Z A;  4NAX A;  4DEJ A;  3ME7 A;  1UC7 A;  1ACV A;  3US3 A;  3BD2 A;  4BL7 B;  4POL A;  1LU4 A;  2PWJ A;  2NBS A;  2K18 A;  2FA4 A;  4ISD A;  3HJO A;  1NW2 A;  3FK8 A;  3LOR A;  3TGZ A;  1XG8 A;  1CQG A;  2LNS A;  2WCI A;  4PNG A;  2O7K A;  2IL3 A;  1ON4 A;  2IPA A;  2QC7 A;  1YF1 A;  5DQS A;  3HVV A;  2DKH A;  3NZN A;  1WMJ A;  2IWT A;  2AYT A;  5JWR B;  3N5O A;  3HZ4 A;  1SJI A;  4ICY A;  3VI5 A;  1AXD A;  1PGT A;  3F63 A;  2C0F A;  5GAN D;  3ERF A;  2FD3 A;  2MMA A;  3RPP A;  2I3Y A;  3LWA A;  5IOX A;  4O5Q A;  4HJ2 A;  2YZH A;  2C8U A;  4CDO A;  2FCH A;  4N0Z A;  4EL1 A;  3GV1 A;  5A5K A;  3R2Q A;  2J9H A;  2FWF A;  3GKK A;  1K3Y A;  4ULX A;  1AQV A;  2VCZ A;  2JAC A;  5ID2 B;  2DJ1 A;  4FYC A;  2EIR A;  3KM6 A;  3APO A;  4TXO A;  4WET A;  4ZL9 A;  2L4C A;  3KTB A;  3M3M A;  3CMI A;  3SBC A;  3FR6 A;  20GS A;  2CT6 A;  1KBN A;  4MAB A;  4KDX A;  5LCZ A;  2VM2 A;  1DE2 A;  2TIR A;  3ZIT A;  3QAV A;  4IGJ A;  2DLX A;  2H1B A;  3L4N A;  3IDV A;  2I9H A;  2MMN A;  4O5U A;  1WJK A;  4MMM A;  5D9T A;  4ZBD A;  1G6W A;  4G10 A;  2HYX A;  1IYH A;  1ABA A;  2YWM A;  3FEU A;  3O76 A;  1R7H A;  3QR6 A;  1GSY A;  4K5R A;  1F3A A;  5G5F A;  3LGC A;  1X5D A;  1J0F A;  1SKW B;  3FZ4 A;  4TXV A;  4ZL8 A;  3APQ A;  2LJK A;  3CYN A;  3GH9 A;  4QL7 A;  2NDO A;  2CQ9 A;  3R3E A;  4H86 A;  3KTL A;  3ZL5 A;  3A5W A;  5AIX A;  3FZ9 A;  4I8B A;  4IJ3 A;  2A4H A;  5DJL A;  4BVX B;  5HFK A;  1FVK A;  3WGD A;  4XS4 B;  2R0C A;  4BPY A;  1OAZ A;  3BOA A;  1YQ1 A;  4J57 E;  18GS A;  3P7X A;  3HJP A;  2XPE A;  1GL8 A;  2FHE A;  3ZFL A;  2NTO A;  2GQK A;  3DRN A;  4Q5N A;  2ES7 A;  3D4T A;  2L6C A;  2K6V A;  3P2A A;  3IRA A;  3VWX A;  2WFC A;  4YKG A;  2GQL A;  3GIX A;  3GX8 A;  3GYK A;  4K0N A;  2FWH A;  4PUF C;  2ZCT A;  4JR6 A;  1VF3 A;  5A4V A;  2TRX A;  1WOU A;  3FY7 A;  3HA9 A;  3HCZ A;  1FHE A;  4KX4 A;  5F07 A;  2L5O A;  3LXZ A;  1SK0 A;  2KP2 A;  3ZVJ D;  4X4J A;  3L78 A;  1ERU A;  2VD0 A;  5LD0 A;  2PPT A;  4XTS A;  3CSI A;  3WD6 A;  1G7O A;  4L5O A;  2B3S A;  2DIZ A;  1EV9 A;  2XC2 A;  3GUS A;  3EWL A;  5INY A;  3LXT A;  3KP9 A;  1Q4J A;  3D6I A;  4Q5Q A;  1OC9 A;  3TKS E;  1HD2 A;  2H01 A;  1TI3 A;  5IM9 A;  4KDY A;  1VF4 A;  5DQY A;  3QD9 A;  2LRT A;  2NVL A;  3F4R A;  5IOW A;  1Q98 A;  5IPG A;  4GQF A;  2GVP A;  4IJI A;  2I1U A;  3QPM A;  3C71 A;  3PPU A;  3H79 A;  3DGQ A;  3FYG A;  5DAL B;  3K8N A;  3HY2 A;  2GT5 A;  1VF1 A;  1BYE A;  1GNW A;  3EU4 A;  4EDY A;  1X5C A;  4TR3 A;  1U6T A;  5IO2 A;  4YQU A;  5F8B A;  4KW6 A;  5EY6 A;  3UIW A;  1EOG A;  4L5L A;  4Z2R A;  4HSC X;  4HU9 A;  1GWC A;  4KND A;  3VFI A;  1KEB A;  4MLY A;  1S3D A;  1JZW A;  2NPB A;  1J08 A;  1GUH A;  4FYB A;  3A2X A;  2GSQ A;  4POM A;  3O3T A;  2ZNM A;  4GWR A;  2PU9 C;  4TRX A;  1DSB A;  4G9H A;  5J4U A;  1BJX A;  2V1M A;  5D96 A;  1MD3 A;  1XWG A;  2DC5 A;  1M2A A;  3VWW A;  2XBI A;  3A2V A;  2WB9 A;  1SEN A;  2C4J A;  1M7T A;  2VL9 A;  2PGT A;  3GNJ A;  4ECC A;  1JFU A;  2X49 A;  4BL7 A;  1TK5 B;  4IP1 A;  3HVN A;  1ZZY A;  2ON5 A;  2ON7 A;  2HNL A;  4TKY A;  1ZYP A;  4OO5 A;  4WXT A;  4FQU A;  1XFL A;  4KSM A;  1PQN A;  3G7Y A;  3KIJ A;  1FVJ A;  1SYX A;  4GST A;  3ZLP A;  1K0M A;  2FLS A;  4G0I A;  1FB6 A;  2R4V A;  2TRC P;  3QAW A;  4X0X A;  3GH6 A;  1TTZ A;  2X8C A;  4ZB9 A;  2CX3 A;  3JCM L;  4DSS B;  1XBS A;  2GSR A;  3CTF A;  2DBC A;  2YWN A;  1EGR A;  4X1U A;  3IK7 A;  3GKM A;  1EEM A;  2DJ3 A;  2CA8 A;  3TCO A;  2Z9S A;  3WGX A;  3TKR A;  5CP1 A;  2AUV A;  3QOU A;  2VLU A;  4HOJ A;  1T8E B;  3VWV A;  1FO5 A;  2WJU A;  3TRX A;  3PH9 A;  1GLP A;  1K0D A;  2FWG A;  1KNG A;  2B5X A;  4IVF A;  2QA1 A;  4PGT A;  1YKC A;  4ZIJ A;  4IBP A;  5CRD A;  1F37 A;  1JHB A;  3ZYW A;  5DCH A;  4GCI A;  2X8G A;  4JZQ A;  4AF2 A;  1THX A;  1XVQ A;  5ID2 A;  2R5G A;  1FAA A;  3EUR A;  4KUN A;  4LL4 B;  3I6A A;  1A8L A;  5ECK B;  3VK9 A;  2R3X A;  3ZVJ A;  4ML6 A;  1XOA A;  4XHM A;  4OMV A;  2E2M A;  3G7J A;  3M0F A;  3VPQ A;  1HYU A;  1EP8 A;  2L6D A;  4Z2U A;  9GSS A;  4AJ6 A;  3F3Q A;  3EVI A;  2R2J A;  4WF5 A;  1UA5 A;  4EVM A;  3TJJ A;  5CNW A;  5B8B A;  3EPT A;  3IC8 A;  1A2J A;  2DIY A;  4HQS A;  4PX1 A;  3GTU B;  2QGV A;  4OWY A;  3GKX A;  2HSM A;  4OCF A;  4EC0 A;  2JZT A;  1QFN A;  1WP0 A;  1FW1 A;  1OKD A;  3KH7 A;  2C80 A;  1B4P A;  1B9X C;  1Z3E A;  1M3J A;  1ST9 A;  2LS5 A;  3J7Y k;  3HXS A;  1ZCP A;  5J9B A;  2JSZ A;  2CX4 A;  2OAC A;  4XS4 A;  4QL9 A;  5IQY A;  4MZC A;  2VLV A;  1NM3 A;  1CQH A;  4N0V A;  5IMC A;  2L57 A;  1G6Y A;  2REM A;  1G0T A;  1GTI A;  3FKF A;  5IMD A;  12GS A;  5G31 A;  2N5A A;  3L0H A;  4P3Y B;  3U5R E;  4D73 B;  1NHY A;  1SJ6 A;  3UOM A;  2RUF A;  1B8X A;  2O8V B;  1Z7P A;  3L9S A;  4FH8 A;  1EZK A;  2EC4 A;  2P31 A;  2R6K A;  1V58 A;  3EE2 A;  3H4K A;  2PMT A;  3IXR A;  2B5Y A;  2A2R A;  2VLT A;  1SL1 B;  2OE0 A;  3FMW A;  2H30 A;  4N30 A;  3FHK A;  4XS6 A;  5COH A;  1KTE A;  3KH9 A;  4LL1 B;  2P5R A;  1QUW A;  5EPF A;  5AIS A;  2JZR A;  3RPN A;  1AAZ A;  1J9B A;  3C73 A;  3F6F A;  3QCP A;  2HFD A;  4G0K A;  4IEL A;  5CRE A;  1GTA A;  4MJC A;  3J7Y b;  4CW9 A;  5G5E A;  2OE3 A;  2O89 A;  2C3T A;  2V6O A;  2K8V A;  2B1K A;  2LUS A;  4AJ7 A;  1A2M A;  1JLV A;  2DKI A;  4MZW A;  5DAL A;  4HI7 A;  2MBS A;  4KH7 A;  5LNK e;  3W8J A;  1OE8 A;  4MF7 A;  1QK8 A;  5D9X A;  3MAK A;  2VM1 A;  3UVT A;  1SU9 A;  2F8A A;  2VUP A;  2B5E A;  2MBT A;  3C8E A;  4RUV A;  5JCW A;  5ECH B;  3RHB A;  2YN1 A;  1H4O A;  2LNT A;  3GN3 A;  4MF6 A;  4EDZ A;  1JZO A;  1GSU A;  4PXO A;  2HSY A;  4NPB A;  1EWX A;  4NV5 A;  1T7P B;  4KGI A;  1W89 A;  3C1S A;  3H1N A;  1TXX A;  1SL0 B;  6GST A;  4XIH A;  4IW9 A;  3RAZ A;  5CYY A;  3GA4 A;  4F0B A;  1C72 A;  1F2E A;  1VF2 A;  1AC1 A;  5ELA A;  3UAR A;  19GS A;  1ZYQ B;  2VO4 A;  3W8S A;  3NIV A;  1YDK A;  1XPV A;  5G30 A;  1MDK A;  2FA8 A;  1TW9 A;  4GSS A;  1XZO A;  5J5N A;  4MZB A;  3MSZ A;  3E9J B;  4TN8 A;  3TKQ A;  2AHE A;  2LST A;  3MYD A;  3ISO A;  4MJB A;  4MP4 A;  2RM6 A;  4GLT A;  1JZR A;  1YKA A;  1A0F A;  1PL1 A;  3RDW A;  13GS A;  3KXO A;  3HJM A;  2IFQ B;  3Q19 A;  4PUR A;  3QMX A;  4DSS A;  3E0U A;  5ECS A;  5J41 A;  1K0B A;  2ALB A;  4AJ8 A;  3UMA A;  4TR1 A;  4MF5 A;  1EGO A;  5C00 A;  1V98 A;  3TB2 A;  2DJ0 A;  3I9V 2;  1WRY A;  3CBU A;  1A8Y A;  4PQI A;  3TUE A;  4NXI A;  4YAP A;  4I6X A;  3DD3 A;  2GDR A;  2G0F A;  1QQ2 A;  2CV4 A;  4RQX A;  1MDJ A;  2OA7 A;  2RUE A;  1QXH A;  4KCA A;  1MDI A;  3ZIJ A;  2IN3 A;  4HJM A;  5KEJ A;  4USS A;  2WZ9 A;  1GRX A;  1ILO A;  2EIQ A;  4YAV A;  1N2A A;  2DSA A;  2L4Q A;  4WEY A;  2O87 A;  3WT1 A;  2KUC A;  2VIM A;  2WS2 A;  5D8I A;  2DJK A;  1K0N A;  3GST A;  3GL3 A;  1OC3 A;  3P90 A;  3VWU A;  5HR2 A;  2X4A A;  1T3B A;  2P5Q A;  3VPT A;  2FNO A;  2L5L A;  1GH2 A;  4NHZ A;  3S9F A;  5KN3 A;  17GS A;  3GTU A;  2C3N A;  4ZBA A;  4TOP A;  4MH3 A;  2P0G A;  5KOX A;  3UBL A;  3KGK A;  2ZUP A;  4PNF A;  4K1F A;  1LJR A;  3F0I A;  5E4W A;  4K2X A;  2H71 A;  1X9S B;  2OKA A;  2E7P A;  3DVW A;  1A0R P;  2WRT A;  1TP9 A;  2OBK A;  2PUK C;  2GS3 A;  1XW9 A;  1XVW A;  5DCG A;  5CRG A;  1AW9 A;  2VD1 A;  3OR5 A;  5KN0 A;  3LJR A;  4JR4 A;  4OD7 A;  4TW5 A;  1PN9 A;  4BWS A;  2BJX A;  1BX9 A;  4IS0 A;  2X8H A;  1YZX A;  2IME A;  6GSU A;  5CAX A;  4D73 A;  2FWE A;  4F82 A;  3IK9 A;  4EKZ A;  1H75 A;  5C04 A;  2I4A A;  3RHC A; 
#chains in the Genus database with same CATH homology
 4YKF A;  22GS A;  4PQH A;  4J56 E;  2IMD A;  3DML A;  1AQW A;  2GSS A;  5DBQ A;  4XCS A;  3EMP A;  3GHA A;  2GT6 A;  4YQV A;  4ILF A;  4NWY A;  3IA1 A;  1T1V A;  4ZB8 A;  4WF4 A;  1FB0 A;  2KHP A;  3KZQ A;  5G1K A;  3F9U A;  2CZ2 A;  2HRN A;  2GQM A;  5G1L A;  5DVB A;  1UN2 A;  4ZXG A;  4MCU A;  2CVB A;  2H76 A;  4E8E A;  1T00 A;  5AIV A;  4TR0 A;  3TDG A;  3SWL A;  4OFT A;  1HNB A;  14GS A;  5DAK B;  1A2L A;  3ZRE A;  3CSH A;  3GFK A;  3M9K A;  2MZC A;  3ERW A;  4KA0 A;  1ZMA A;  5EVO A;  1O85 A;  2IJY A;  3TKS C;  2HE3 A;  2PBJ A;  1K3L A;  2HI7 A;  3UEM A;  4BVY B;  3LYP A;  4MNN A;  3M9J A;  4RQR A;  3DIE A;  4L8E A;  3QFB C;  4TR1 B;  1T4Y A;  1MTC A;  1IYI A;  2XBQ A;  5B7C A;  1SD9 A;  3FRC A;  5ABR A;  1R26 A;  5JCU A;  5J9C A;  1WPI A;  3TOT A;  2LTK A;  1R4W A;  1M9A A;  1GP1 A;  3GKN A;  3BCK A;  1RQM A;  6GSY A;  2GTU A;  1GTB A;  3BBY A;  4X43 A;  1F9M A;  2H8L A;  3C7M A;  2JL4 A;  1HQO A;  2BTO T;  6GSS A;  5JWO B;  4HDE A;  1AIU A;  3F3R A;  4JED A;  4OFM A;  1EV4 A;  1WE0 A;  3IHG A;  2YCD A;  1BQ7 A;  2YJH A;  1ERV A;  2HSH A;  1VGL A;  3RBT A;  2MMZ A;  4F0C A;  2IMF A;  3LFL A;  4K9Z A;  3L9V A;  2VCQ A;  3DYR A;  4PTS A;  1Y25 A;  4XRD A;  2XHF A;  4NMU A;  5A4U A;  4K7I A;  1SK1 A;  2LJR A;  5HFG A;  4F03 A;  1YEX A;  4ML1 A;  4G2E A;  5HR3 A;  3LSZ A;  4V2M A;  4HUA A;  3ZMK A;  2B7J A;  3LEF A;  1FOH A;  2YPM A;  1ZL9 A;  2H0G A;  5FWG A;  2H19 A;  4GTU A;  4K0G A;  2H70 A;  1XWA A;  1TKD B;  3QFA C;  1U3I A;  4AGS A;  4OFN A;  3TKS A;  2X64 A;  1EOH A;  1B48 A;  1PSQ A;  2PER A;  1DBY A;  2IFQ A;  5ECI B;  5HR1 A;  4ZL7 A;  4MA9 A;  3TOU A;  3IV4 A;  4YQM A;  3CXG A;  5JCG A;  3KMO A;  3D5J A;  4ZIL A;  2M72 A;  1USB A;  4ECB A;  2H74 A;  4LA1 A;  1OC8 A;  2LEG A;  3M1G A;  2CVD A;  2V41 A;  2F3M A;  1PKZ A;  1FG4 A;  1GTU A;  5H5Q A;  4I97 A;  1K3O A;  3H8Q A;  4PQ1 A;  2XPD A;  4CHS A;  1OYJ A;  1YY7 A;  3WT2 A;  1WIK A;  2E2G A;  5D93 A;  4KCE A;  3EC3 A;  3ME8 A;  1V9W A;  3TRQ A;  1QGV A;  3VLN A;  2C3Q A;  1OKT A;  1SKS B;  5ENU A;  1TRW A;  3IC4 A;  1THO A;  2CAI A;  1F6M C;  2LRN A;  2JZS A;  2IMK A;  1UVZ A;  3NOF A;  4LLR A;  2LQQ A;  4NHW A;  3APS A;  2C1Y A;  2PN8 A;  1V2A A;  3E3E A;  1Z6N A;  5E59 A;  3V1W A;  4GSN A;  1M2B A;  4DSQ A;  1I9D A;  3C1R A;  1ZOF A;  4CY8 A;  2IIY A;  2DJJ A;  2K8S A;  2LRC A;  1SYR A;  1ZYE A;  4XRA A;  3D0Z A;  3MDK A;  1ERW A;  4GF0 A;  3ED3 A;  3GUR A;  1OVN A;  4FO5 A;  2JSY A;  2R0G A;  2H6Z A;  3HHV A;  1GLQ A;  1F3B A;  3TRP A;  3HVX A;  1M2D A;  1U3A A;  4ZBB A;  2VOC A;  1TU7 A;  5ECR B;  5HQP A;  2VCX A;  3WYW A;  3KCM A;  4K6X A;  3A5I A;  4OO4 A;  3L9U A;  1BG5 A;  3HYP A;  3PR8 A;  3ZTL A;  4V2N A;  1XW6 A;  2GZP A;  5DDL A;  4HZ2 A;  2YWO A;  4IP6 A;  5AGY A;  2VL2 C;  1GUM A;  2HZF A;  1ERT A;  8GSS A;  1GNE A;  1YJ6 A;  2RII A;  4WBJ A;  3GX0 A;  2C0E A;  2F9S A;  1URM A;  3FR3 A;  2OAD A;  2YP6 A;  2H6X A;  1PL2 A;  5L71 A;  2RLI A;  4EIP A;  4TVE A;  3KJY A;  5FT3 A;  1I5G A;  3QDN A;  3IAS 2;  1X0R A;  1XIY A;  2JAD A;  4KAE A;  5IO0 A;  4E8H A;  2HLS A;  3CTG A;  1O8W A;  3DWV A;  1YEP A;  4TR4 A;  1K0C A;  4Q5R A;  1ZGN A;  2C0G A;  3HD5 A;  4JU5 A;  4O92 A;  3HVS A;  3EU3 A;  3WGE A;  4ECI A;  3G9B A;  2A2P A;  3LYK A;  4IQA A;  1M9B A;  3HKR A;  1NHO A;  3ZZX A;  4IKH A;  6GSW A;  1R5A A;  3FW2 A;  2M80 A;  3EIN A;  4WR5 A;  2K9F A;  4BA7 A;  4ECJ A;  4V1A g;  2HRA A;  7GSS A;  3ZRD A;  4N11 A;  4BWQ A;  5B8A A;  2HT9 A;  4EUY A;  2AJQ B;  5DAK A;  3UAP A;  2RM5 A;  1T4Z A;  2VL2 A;  2VCW A;  4MK3 A;  3PIN A;  3LQ7 A;  1E6B A;  1M99 A;  1TU8 A;  1V40 A;  2GST A;  1BED A;  4IHU A;  1W4V A;  3U6V A;  4BVY A;  2OBI A;  2B7K A;  3ERG A;  3GMF A;  4WKW A;  2IMI A;  4HEA 2;  5F0G A;  1A23 A;  1PA3 A;  4O7H A;  3G7I A;  3BCI A;  5ECP B;  4WR4 A;  2GLR A;  4OCE A;  3IPZ A;  4MPG A;  2KP1 A;  4MPF A;  2A2S A;  5F06 A;  5IPH A;  2CAQ A;  2OE1 A;  1PMT A;  2YJ7 A;  2I81 A;  4KDU A;  3EYT A;  2M46 A;  2WUL A;  2GZZ A;  4WBR D;  3DEX A;  3BJ5 A;  2AB6 A;  2R0P A;  4JE1 A;  2YZU A;  5IMA A;  3P8W A;  4EE0 A;  4I2U A;  5GAP D;  1A24 A;  1AQX A;  1XXU A;  2JU5 A;  1TRU A;  1NSW A;  1SL2 B;  4FYU A;  2HZE B;  5A4W A;  1U88 A;  3KD0 A;  5B6M A;  2DJ2 A;  3H93 A;  5KN2 A;  1SK2 A;  1TJD A;  1X9M B;  3VI7 A;  2LKU A;  4KF9 A;  2FY6 A;  2H6Y A;  2MMO A;  1GUL A;  3LG6 A;  1OE7 A;  1AUC A;  4MJA A;  2KLX A;  2UZ8 A;  5HR0 A;  3TJK A;  4GRF A;  2FUG 2;  3UL3 A;  3IOS A;  1LBK A;  1PRX A;  4RI6 A;  5D9W A;  2E0Q A;  4K2D A;  2VAF A;  4POK A;  5CRW A;  1PKW A;  3TJB A;  2VL3 A;  4ZB6 A;  1XWB A;  4K5S A;  4I2T A;  4EIQ A;  1E2Y A;  1GSE A;  1R5P A;  1N8J A;  1TRV A;  2HXK A;  4Q5F A;  5KN1 A;  1RW1 A;  1PX6 A;  1TOF A;  2O85 A;  5ELG A;  4XS1 A;  2YOI A;  3A3T A;  4F9Z A;  2N5F A;  2V32 A;  3M8N A;  4EXJ A;  4FIW A;  6GSX A;  1Z5Y E;  2H0H A;  1XWC A;  2H75 A;  3N9J A;  1Y6E A;  4LMV A;  2GGT A;  1GUK A;  1WWJ A;  2C0D A;  3KMN A;  5CRH A;  3TKP A;  1JLW A;  2BMX A;  5ECO B;  2H1D A;  2OJL A;  4IQ1 A;  1TDI A;  5D73 A;  2J23 A;  11GS A;  2AAW A;  2EIO A;  1TK0 B;  1SD8 A;  5BRT A;  3F4S A;  1GSD A;  2YV9 A;  3D4M A;  2N5B A;  5H5S A;  1MD4 A;  1S3C A;  1SKR B;  4G19 A;  1Z6M A;  5ECQ B;  4L0W A;  2VCV A;  5EL8 A;  4HU7 A;  1O7U A;  2H72 A;  3KP8 A;  2V2G A;  2G2Q A;  3FR9 A;  3TJF A;  5ECN B;  4G0L A;  2H1G A;  4GQC A;  4K7O A;  3D21 A;  3MWH A;  3EMX A;  3VUR A;  2GZY A;  4TXO B;  1GSS A;  2L59 A;  5IIZ A;  4J2F A;  4V2L A;  3MNG A;  3F6D A;  1B9Y C;  5KOW A;  2HRK A;  1ZYN A;  4ACS A;  4HZ4 A;  1XW5 A;  3I43 A;  3CRT A;  4CY6 A;  1Z9H A;  1M0U A;  2QSI A;  4MDC A;  2DML A;  1QMV A;  3GL5 A;  1K0A A;  4DSR A;  1GSF A;  1SJZ A;  3FZA A;  2H66 A;  3PGT A;  5IMZ A;  3DKS A;  3IBH A;  10GS A;  1HNA A;  1S3A A;  3ZML A;  1DE1 A;  5GZZ B;  2PVO C;  3TJG A;  1XWK A;  5ECM B;  1MEK A;  1U87 A;  3UBK A;  4EF0 A;  2YWI A;  3ZIV A;  2AV4 A;  1XCC A;  2LV3 A;  1HNC A;  1ML6 A;  4O32 A;  1V57 A;  3MIX A;  5F05 A;  6GSV A;  5BMU A;  5GST A;  3GSS A;  3QAG A;  1TK8 B;  2F8F A;  5FHI A;  2B6M A;  3HZ8 A;  4RI7 A;  2VCT A;  1O73 A;  3FZ5 A;  1Z7R A;  2H0I A;  1YF0 A;  2DMM A;  4I5Q A;  4GXZ A;  4HS1 A;  1RK4 A;  2WDU A;  2FGX A;  4POB A;  4JRR A;  1BAY A;  3UJ1 A;  2X99 A;  5J3R A;  5GSS A;  1EP7 A;  4F2I A;  4N10 A;  3O6T A;  4LMW A;  3GRX A;  4JBB A;  4V1A p;  1PD2 1;  4DVC A;  3HDC A;  2LJA A;  4QQ7 A;  1GSQ A;  3IHQ A;  3IR4 A;  1XOB A;  2H73 A;  3DVX A;  5HFI A;  3F8U A;  3CSJ A;  4K8M A;  4PUA A;  16GS A;  2A4V A;  2F51 A;  3I69 A;  3UVH A;  2R37 A;  2H1A A;  2CZ3 A;  5G2Z A;  4KE3 A;  4A5P A;  2LQO A;  3DXB A;  2YV7 A;  2HRF A;  3A2W A;  1OC9 B;  2YNX A;  1K0O A;  3IAM 2;  1PX7 A;  4Z7X A;  5IMV A;  1O81 A;  5CO3 A;  4K7N A;  3W6G A;  4MJE A;  4KSO A;  5IMF A;  4HQZ A;  3Q6O A;  4BVX A;  4EO3 A;  2MYG A;  2KOK A;  2WGR A;  4Z2T A;  1X5E A;  1JZD A;  1VRS D;  3F4T A;  5DJM A;  1TRS A;  5D9V A;  1TI1 A;  5ECL B;  5H5R A;  2B1L A;  2HZE A;  3D22 A;  1X9W B;  3ZFB A;  1G7E A;  2V6K A;  1FOV A;  2CVK A;  2QKE A;  5B6N A;  3AY8 A;  1O6J A;  4NV2 A;  4MH2 A;  3KEB A;  5JWQ B;  3CRU A;  4YH2 A;  1O8X A;  2PVQ A;  3LW9 A;  2QA2 A;  4O5R A;  3IE3 A;  4IN0 A;  4KB3 A;  3Q18 A;  5AN1 A;  1EEJ A;  1DUG A;  1PN0 A;  3Q74 A;  1B4Q A;  4ID0 A;  4L0U A;  2YAN A;  2D2Z A;  4NAX A;  4DEJ A;  3ME7 A;  1UC7 A;  1ACV A;  3US3 A;  3BD2 A;  4BL7 B;  4POL A;  1LU4 A;  2PWJ A;  2NBS A;  2K18 A;  2FA4 A;  4ISD A;  3HJO A;  1NW2 A;  3FK8 A;  3LOR A;  3TGZ A;  1CQG A;  2LNS A;  2WCI A;  4PNG A;  2O7K A;  2IL3 A;  1ON4 A;  2IPA A;  2QC7 A;  1YF1 A;  5DQS A;  3HVV A;  2DKH A;  3NZN A;  1WMJ A;  2IWT A;  2AYT A;  5JWR B;  3N5O A;  3HZ4 A;  1SJI A;  4ICY A;  3VI5 A;  1AXD A;  1PGT A;  3F63 A;  2C0F A;  5GAN D;  3ERF A;  2FD3 A;  2MMA A;  3RPP A;  2I3Y A;  3LWA A;  5IOX A;  4O5Q A;  4HJ2 A;  2YZH A;  2C8U A;  4CDO A;  2FCH A;  4N0Z A;  4EL1 A;  3GV1 A;  5A5K A;  3R2Q A;  2J9H A;  2FWF A;  3GKK A;  1K3Y A;  4ULX A;  1AQV A;  2VCZ A;  2JAC A;  5ID2 B;  2DJ1 A;  4FYC A;  2EIR A;  3KM6 A;  3APO A;  4TXO A;  4WET A;  4ZL9 A;  2L4C A;  3KTB A;  3M3M A;  3CMI A;  3SBC A;  3FR6 A;  20GS A;  2CT6 A;  1KBN A;  4MAB A;  4KDX A;  5LCZ A;  2VM2 A;  1DE2 A;  2TIR A;  3ZIT A;  3QAV A;  4IGJ A;  2DLX A;  2H1B A;  3L4N A;  3IDV A;  2I9H A;  2MMN A;  4O5U A;  1WJK A;  4MMM A;  5D9T A;  4ZBD A;  1G6W A;  4G10 A;  2HYX A;  1IYH A;  1ABA A;  2YWM A;  3FEU A;  3O76 A;  1R7H A;  3QR6 A;  1GSY A;  4K5R A;  1F3A A;  5G5F A;  3LGC A;  1X5D A;  1J0F A;  1SKW B;  3FZ4 A;  4TXV A;  4ZL8 A;  3APQ A;  2LJK A;  3CYN A;  3GH9 A;  4QL7 A;  2NDO A;  2CQ9 A;  3R3E A;  4H86 A;  3KTL A;  3ZL5 A;  3A5W A;  5AIX A;  3FZ9 A;  4I8B A;  4IJ3 A;  2A4H A;  5DJL A;  4BVX B;  5HFK A;  1FVK A;  3WGD A;  4XS4 B;  2R0C A;  4BPY A;  1OAZ A;  3BOA A;  1YQ1 A;  4J57 E;  18GS A;  3P7X A;  3HJP A;  2XPE A;  1GL8 A;  2FHE A;  3ZFL A;  2NTO A;  2GQK A;  3DRN A;  4Q5N A;  2ES7 A;  3D4T A;  2L6C A;  2K6V A;  3P2A A;  3IRA A;  3VWX A;  2WFC A;  4YKG A;  2GQL A;  3GIX A;  3GX8 A;  3GYK A;  4K0N A;  2FWH A;  4PUF C;  2ZCT A;  4JR6 A;  1VF3 A;  5A4V A;  2TRX A;  1WOU A;  3FY7 A;  3HA9 A;  3HCZ A;  1FHE A;  4KX4 A;  5F07 A;  2L5O A;  3LXZ A;  1SK0 A;  2KP2 A;  3ZVJ D;  4X4J A;  3L78 A;  1ERU A;  2VD0 A;  5LD0 A;  2PPT A;  4XTS A;  3CSI A;  3WD6 A;  1G7O A;  4L5O A;  2B3S A;  2DIZ A;  1EV9 A;  2XC2 A;  3GUS A;  3EWL A;  5INY A;  3LXT A;  3KP9 A;  1Q4J A;  3D6I A;  4Q5Q A;  1OC9 A;  3TKS E;  1HD2 A;  2H01 A;  1TI3 A;  5IM9 A;  4KDY A;  1VF4 A;  5DQY A;  3QD9 A;  2LRT A;  2NVL A;  3F4R A;  5IOW A;  1Q98 A;  5IPG A;  4GQF A;  2GVP A;  4IJI A;  2I1U A;  3QPM A;  3C71 A;  3PPU A;  3H79 A;  3DGQ A;  3FYG A;  5DAL B;  3K8N A;  3HY2 A;  2GT5 A;  1VF1 A;  1BYE A;  1GNW A;  3EU4 A;  4EDY A;  1X5C A;  4TR3 A;  1U6T A;  5IO2 A;  4YQU A;  5F8B A;  4KW6 A;  5EY6 A;  3UIW A;  1EOG A;  4L5L A;  4Z2R A;  4HU9 A;  1GWC A;  4KND A;  3VFI A;  1KEB A;  4MLY A;  1S3D A;  1JZW A;  2NPB A;  1J08 A;  1GUH A;  4FYB A;  3A2X A;  2GSQ A;  4POM A;  3O3T A;  2ZNM A;  4GWR A;  2PU9 C;  4TRX A;  1DSB A;  4G9H A;  5J4U A;  1BJX A;  2V1M A;  5D96 A;  1MD3 A;  1XWG A;  2DC5 A;  1M2A A;  3VWW A;  2XBI A;  3A2V A;  2WB9 A;  1SEN A;  2C4J A;  1M7T A;  2VL9 A;  2PGT A;  3GNJ A;  4ECC A;  1JFU A;  2X49 A;  4BL7 A;  1TK5 B;  4IP1 A;  1ZZY A;  2ON5 A;  2ON7 A;  2HNL A;  4TKY A;  1ZYP A;  4OO5 A;  4WXT A;  4FQU A;  1XFL A;  4KSM A;  1PQN A;  3G7Y A;  3KIJ A;  1FVJ A;  1SYX A;  4GST A;  3ZLP A;  1K0M A;  2FLS A;  4G0I A;  1FB6 A;  2R4V A;  2TRC P;  3QAW A;  4X0X A;  3GH6 A;  1TTZ A;  2X8C A;  4ZB9 A;  2CX3 A;  3JCM L;  4DSS B;  1XBS A;  2GSR A;  3CTF A;  2DBC A;  2YWN A;  1EGR A;  4X1U A;  3IK7 A;  3GKM A;  1EEM A;  2DJ3 A;  2CA8 A;  3TCO A;  2Z9S A;  3WGX A;  3TKR A;  5CP1 A;  2AUV A;  3QOU A;  2VLU A;  4HOJ A;  1T8E B;  3VWV A;  1FO5 A;  2WJU A;  3TRX A;  3PH9 A;  1GLP A;  1K0D A;  2FWG A;  1KNG A;  2B5X A;  4IVF A;  2QA1 A;  4PGT A;  1YKC A;  4ZIJ A;  4IBP A;  5CRD A;  1F37 A;  1JHB A;  3ZYW A;  5DCH A;  4GCI A;  2X8G A;  4JZQ A;  4AF2 A;  1THX A;  1XVQ A;  5ID2 A;  2R5G A;  1FAA A;  3EUR A;  4KUN A;  4LL4 B;  3I6A A;  1A8L A;  5ECK B;  3VK9 A;  2R3X A;  3ZVJ A;  4ML6 A;  1XOA A;  4XHM A;  4OMV A;  2E2M A;  3G7J A;  3M0F A;  3VPQ A;  1HYU A;  1EP8 A;  2L6D A;  4Z2U A;  9GSS A;  4AJ6 A;  3F3Q A;  3EVI A;  2R2J A;  4WF5 A;  1UA5 A;  4EVM A;  3TJJ A;  5CNW A;  5B8B A;  3EPT A;  3IC8 A;  1A2J A;  2DIY A;  4HQS A;  4PX1 A;  3GTU B;  2QGV A;  4OWY A;  3GKX A;  2HSM A;  4OCF A;  4EC0 A;  2JZT A;  1QFN A;  1WP0 A;  1FW1 A;  1OKD A;  3KH7 A;  2C80 A;  1B4P A;  1B9X C;  1Z3E A;  1ST9 A;  2LS5 A;  3J7Y k;  3HXS A;  1ZCP A;  5J9B A;  2JSZ A;  2CX4 A;  2OAC A;  4XS4 A;  4QL9 A;  5IQY A;  4MZC A;  2VLV A;  1NM3 A;  1CQH A;  4N0V A;  5IMC A;  2L57 A;  1G6Y A;  2REM A;  1G0T A;  1GTI A;  3FKF A;  5IMD A;  12GS A;  5G31 A;  2N5A A;  3L0H A;  4P3Y B;  3U5R E;  4D73 B;  1NHY A;  1SJ6 A;  3UOM A;  2RUF A;  1B8X A;  2O8V B;  1Z7P A;  3L9S A;  4FH8 A;  1EZK A;  2EC4 A;  2P31 A;  2R6K A;  1V58 A;  3EE2 A;  3H4K A;  2PMT A;  3IXR A;  2B5Y A;  2A2R A;  2VLT A;  1SL1 B;  2OE0 A;  3FMW A;  2H30 A;  4N30 A;  3FHK A;  4XS6 A;  5COH A;  1KTE A;  3KH9 A;  4LL1 B;  2P5R A;  1QUW A;  5EPF A;  5AIS A;  2JZR A;  3RPN A;  1AAZ A;  1J9B A;  3C73 A;  3F6F A;  3QCP A;  2HFD A;  4G0K A;  4IEL A;  5CRE A;  1GTA A;  4MJC A;  3J7Y b;  4CW9 A;  5G5E A;  2OE3 A;  2O89 A;  2C3T A;  2V6O A;  2K8V A;  2B1K A;  2LUS A;  4AJ7 A;  1A2M A;  1JLV A;  2DKI A;  4MZW A;  5DAL A;  4HI7 A;  2MBS A;  4KH7 A;  5LNK e;  3W8J A;  1OE8 A;  4MF7 A;  1QK8 A;  5D9X A;  3MAK A;  2VM1 A;  3UVT A;  1SU9 A;  2F8A A;  2VUP A;  2B5E A;  2MBT A;  3C8E A;  4RUV A;  5JCW A;  5ECH B;  3RHB A;  2YN1 A;  1H4O A;  2LNT A;  3GN3 A;  4MF6 A;  4EDZ A;  1JZO A;  1GSU A;  4PXO A;  2HSY A;  4NPB A;  1EWX A;  4NV5 A;  1T7P B;  4KGI A;  1W89 A;  3C1S A;  3H1N A;  1TXX A;  1SL0 B;  6GST A;  4XIH A;  4IW9 A;  3RAZ A;  5CYY A;  3GA4 A;  4F0B A;  1C72 A;  1F2E A;  1VF2 A;  1AC1 A;  5ELA A;  3UAR A;  19GS A;  1ZYQ B;  2VO4 A;  3W8S A;  3NIV A;  1YDK A;  1XPV A;  5G30 A;  1MDK A;  2FA8 A;  1TW9 A;  4GSS A;  1XZO A;  5J5N A;  4MZB A;  3MSZ A;  3E9J B;  4TN8 A;  3TKQ A;  2AHE A;  2LST A;  3MYD A;  3ISO A;  4MJB A;  4MP4 A;  2RM6 A;  4GLT A;  1JZR A;  1YKA A;  1A0F A;  1PL1 A;  3RDW A;  13GS A;  3KXO A;  3HJM A;  2IFQ B;  3Q19 A;  4PUR A;  3QMX A;  4DSS A;  3E0U A;  5ECS A;  5J41 A;  1K0B A;  2ALB A;  4AJ8 A;  3UMA A;  4TR1 A;  4MF5 A;  1EGO A;  5C00 A;  1V98 A;  3TB2 A;  2DJ0 A;  3I9V 2;  1WRY A;  3CBU A;  1A8Y A;  4PQI A;  3TUE A;  4NXI A;  4YAP A;  4I6X A;  3DD3 A;  2GDR A;  2G0F A;  1QQ2 A;  2CV4 A;  4RQX A;  1MDJ A;  2OA7 A;  2RUE A;  1QXH A;  4KCA A;  1MDI A;  3ZIJ A;  2IN3 A;  4HJM A;  5KEJ A;  4USS A;  2WZ9 A;  1GRX A;  1ILO A;  2EIQ A;  4YAV A;  1N2A A;  2DSA A;  2L4Q A;  4WEY A;  2O87 A;  3WT1 A;  2KUC A;  2VIM A;  2WS2 A;  5D8I A;  2DJK A;  1K0N A;  3GST A;  3GL3 A;  1OC3 A;  3P90 A;  3VWU A;  5HR2 A;  2X4A A;  1T3B A;  2P5Q A;  3VPT A;  2FNO A;  2L5L A;  1GH2 A;  4NHZ A;  3S9F A;  5KN3 A;  17GS A;  3GTU A;  2C3N A;  4ZBA A;  4TOP A;  4MH3 A;  2P0G A;  5KOX A;  3UBL A;  3KGK A;  2ZUP A;  4PNF A;  4K1F A;  1LJR A;  3F0I A;  5E4W A;  4K2X A;  2H71 A;  1X9S B;  2OKA A;  2E7P A;  3DVW A;  1A0R P;  2WRT A;  1TP9 A;  2OBK A;  2PUK C;  2GS3 A;  1XW9 A;  1XVW A;  5DCG A;  5CRG A;  1AW9 A;  2VD1 A;  3OR5 A;  5KN0 A;  3LJR A;  4JR4 A;  4OD7 A;  4TW5 A;  1PN9 A;  4BWS A;  2BJX A;  1BX9 A;  4IS0 A;  2X8H A;  1YZX A;  2IME A;  6GSU A;  5CAX A;  4D73 A;  2FWE A;  4F82 A;  3IK9 A;  4EKZ A;  1H75 A;  5C04 A;  2I4A A;  3RHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...