1XWAA

Drospohila thioredoxin, oxidized, p41212
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
AAAAAMVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Electron transport
total genus 35
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwaA00
2NPBA 3GURA 1XWGA 1W4VA 1TTZA 2CVKA 1WIKA 3GNJA 1PGTA 4O7HA 1K0OA 5D93A 1ZGNA 3BD2A 3C1RA 4POBA 2LRTA 2DMMA 2WGRA 2VLVA 3C73A 3DVWA 4POKA 5COHA 4L5OA 1GSDA 3EINA 5B8BA 2VLTA 5ID2A 2C0FA 2R37A 1SKSB 2DMLA 4IBPA 4IP1A 4IW9A 2Z9SA 4NWYA 5CO3A 2H01A 2KOKA 3VFIA 4ECBA 2B7JA 6GSWA 4Q5QA 2NVLA 3E3EA 3IAS2 2YV9A 1R4WA 3Q19A 2CZ2A 2VD0A 3TKPA 3W6GA 2IMDA 4HEA2 2WZ9A 3DRNA 2V2GA 3H4KA 4MZBA 2I9HA 5G1KA 3A2VA 1F3AA 4IHUA 1ERVA 3KTLA 3RDWA 3IAM2 2REMA 4X1UA 2H75A 4MH3A 1ZYEA 2P5QA 1F9MA 1DBYA 4PURA 17GSA 4ZB6A 3ERGA 4MJBA 4OO5A 1DE1A 1GWCA 1TU7A 3VI5A 4KDYA 3GV1A 22GSA 3QAWA 4MCUA 5EVOA 4YQUA 1Y25A 5JWQB 3LWAA 2YP6A 3C1SA 3PGTA 4X0XA 3FRCA 2IMFA 1O85A 2I1UA 9GSSA 2LV3A 1Z6MA 4LL4B 1TRSA 2VCZA 3HVXA 1U3IA 4GSTA 2L59A 2H6ZA 2ES7A 3GFKA 2X8GA 3DMLA 3WT1A 2AUVA 3GKXA 1F6MC 4OMVA 2RUEA 2OE1A 4WR5A 3BCIA 1S3DA 3FR3A 5IMZA 3TJBA 4RI6A 1PX7A 3CTGA 2V41A 3QR6A 2LJRA 2MZCA 2F51A 2VIMA 2GSQA 3U5RE 1MD3A 1K0NA 2MBSA 4CDOA 1ST9A 5JCWA 1TJDA 2FA4A 3IC4A 3J7Yk 3HYPA 4ISDA 4QL7A 1ZYQB 3HVVA 14GSA 1PQNA 2C8UA 2HXKA 1EEMA 2HYXA 3EC3A 1J08A 2XC2A 2YZUA 3Q74A 1GSFA 4NV5A 3GKKA 2YWIA 3G7IA 2ZNMA 1GSUA 2H71A 4GF0A 5J9CA 1M9AA 2LQQA 4JU5A 1EEJA 3KM6A 1HNCA 3D22A 3FZ4A 1W89A 5DALA 4K7NA 1O7UA 1T3BA 4TR1A 3US3A 3ERWA 4K8MA 5CRWA 1VF2A 1B4PA 3NIVA 3UVHA 2I4AA 4L0UA 4NAXA 1GSYA 2GZYA 3A3TA 4PUAA 3DIEA 2I81A 2H1BA 1Q4JA 4L8EA 3L9UA 4QQ7A 1GLQA 3ZITA 4ID0A 2OADA 2O89A 1XVWA 3TRXA 4TOPA 1A23A 1MDKA 18GSA 2CVDA 4XHMA 1MDIA 2MMOA 2WFCA 4HS1A 5JWOB 3D4MA 2JSYA 1PN9A 4MPGA 5B6MA 1FW1A 5GAPD 4OCEA 4V2MA 3APSA 1T4ZA 5G30A 3W8JA 1AQWA 2JZSA 20GSA 2C80A 4I6XA 4MP4A 2JZRA 5G5EA 11GSA 1FO5A 1SJ6A 1ZMAA 2H0GA 5AN1A 3EU3A 3G9BA 2MYGA 3FK8A 2EIRA 1RQMA 1OE7A 1ZOFA 4FO5A 1AQVA 5LD0A 2HLSA 3VI7A 5A4VA 1GSQA 1AC1A 1OVNA 3DYRA 4MDCA 5KEJA 1OKDA 2R2JA 1X5CA 1SJZA 3D5JA 3FZ9A 3IA1A 3KIJA 4Q5RA 1ACVA 3IHQA 2DIYA 1PX6A 2L57A 2VOCA 3KCMA 4XRDA 2R4VA 2XPEA 1TDIA 4XTSA 3VLNA 4I2TA 3I43A 3KMNA 4XCSA 5ECPB 1G7OA 4ZBDA 2L4CA 1X0RA 2WRTA 1TXXA 3M1GA 2CQ9A 2VCVA 3A2XA 5IM9A 4HQZA 1K0CA 1HNAA 2YWOA 3GTUB 1Z7RA 2I3YA 3LYKA 2GQLA 1SJIA 3TJKA 2WDUA 4WBJA 5G31A 1Z9HA 2JSZA 2YOIA 1SYRA 2JU5A 5DALB 19GSA 4KDXA 2CZ3A 2V1MA 2VM2A 2H6XA 3NOFA 4TR1B 4HZ4A 5JCGA 2HSYA 5DDLA 6GSYA 1F3BA 4I8BA 3G7YA 2CA8A 2R3XA 1X5EA 1FAAA 2PERA 3QFAC 1G6WA 4DSSB 3F6DA 1M7TA 4O32A 2JADA 1YQ1A 4BL7A 2JZTA 1MDJA 3GRXA 4WF4A 2FWEA 4ULXA 2HFDA 1K3OA 2H30A 4JR4A 1TW9A 3GKMA 3LGCA 4IELA 4V2LA 3EU4A 2A4VA 4HDEA 3VPTA 3M3MA 3AY8A 2DLXA 2AYTA 2M80A 3ZVJA 2OA7A 4AJ8A 4RI7A 5D96A 2H19A 5DAKB 4K7IA 3J7Yb 5JWRB 4GCIA 3N9JA 1K0MA 4KW6A 3LG6A 5CP1A 1O81A 4HU7A 1V58A 5CNWA 3QAVA 1Y6EA 4NHZA 4TW5A 1DSBA 2CV4A 4ZB8A 1A2LA 5HFIA 3KP9A 3TKSE 1J9BA 2LRNA 4OCFA 3QMXA 4XS1A 1XWKA 3MWHA 4G19A 4IS0A 1YJ6A 3EE2A 2ON5A 2LTKA 3A2WA 2H1GA 4N0VA 1OC9B 1TI1A 1T7PB 2BJXA 1XZOA 3I6AA 4MF6A 2X8CA 1C72A 4HUAA 1XCCA 4ZXGA 1H4OA 1XIYA 4OFTA 5B8AA 5D73A 5IO0A 3ED3A 3IK9A 4HQSA 2YWMA 1N2AA 2FCHA 3LEFA 3IK7A 4O92A 4TXVA 4KGIA 2AJQB 1MTCA 5L71A 1SK2A 2E7PA 4IQ1A 1SL1B 3SWLA 2LUSA 4MJAA 5AIVA 2K8VA 1R26A 3UVTA 1GULA 1MD4A 1N8JA 1OAZA 1EWXA 1ZL9A 3VWUA 6GSVA 2DJKA 1JLVA 2H1AA 4LLRA 4LMWA 4TVEA 1TOFA 3TDGA 2N5FA 1GSEA 3Q18A 3KZQA 2H74A 5ELAA 4MZWA 1QQ2A 3CBUA 4D73B 5IMAA 4MZCA 4TR4A 3IPZA 2GDRA 4BPYA 5KN0A 2PVOC 3TCOA 3F9UA 1SU9A 4FYCA 2O87A 1ILOA 1YDKA 4J56E 1QUWA 2LNSA 2HT9A 3FZ5A 3TB2A 3FYGA 1SL2B 4GQFA 1QGVA 3N5OA 3UMAA 1XW5A 1K0DA 1XOBA 4GSSA 2MMAA 2CVBA 1PRXA 5DVBA 2R6KA 2QGVA 3GUSA 1A8LA 3M9JA 5FHIA 2GSTA 4F82A 3O3TA 1XFLA 4TKYA 3ZZXA 3E0UA 3TKSC 1KTEA 2P31A 4JE1A 1JZOA 1JLWA 3EMPA 3QAGA 3ZIVA 3F4TA 1WMJA 4I97A 5GSTA 4PNFA 4XS6A 2EIOA 2KLXA 4K0NA 3C8EA 2PN8A 1Z6NA 5F06A 3P2AA 5D9WA 2OACA 4WEYA 3TOUA 1PL1A 3TRQA 1AQXA 4WXTA 1XPVA 5HQPA 3ZL5A 2DIZA 2H72A 2L4QA 4XS4B 1ZZYA 4IGJA 1KBNA 1GH2A 1GL8A 3H79A 1TK0B 2HSHA 3TJGA 1S3CA 1HQOA 5ECHB 4EE0A 3LJRA 1HNBA 2XHFA 4OFMA 1WWJA 4HOJA 3H8QA 2GLRA 4GRFA 3I69A 2B1LA 1URMA 4HZ2A 2LSTA 4J57E 5ECMB 1FB6A 2AV4A 4JEDA 5C04A 1FG4A 3DD3A 3GX0A 1GNWA 4BVYA 3WT2A 5IO2A 3ZREA 3VWVA 3GSSA 1HD2A 3FR9A 2B1KA 1M9BA 1OYJA 3TJFA 3P8WA 2IMKA 4IJIA 1ERTA 1O6JA 1X9WB 3D21A 2LRCA 2FD3A 1GUMA 4TRXA 1PMTA 1HYUA 3F4SA 1GRXA 4MA9A 4JZQA 2VL9A 1QFNA 4N10A 4LA1A 3DEXA 4DSQA 3G7JA 4XRAA 1Z3EA 3GN3A 2HZEB 3KH7A 5IIZA 2B7KA 3MAKA 1CQHA 3HVSA 1WJKA 4NXIA 1FVKA 2WULA 3FHKA 3F8UA 3LQ7A 4AJ6A 3GTUA 1SKWB 4PGTA 4KX4A 4ACSA 4LL1B 1YZXA 1PD21 1E2YA 2OBKA 4JRRA 2LEGA 1RK4A 6GSSA 3M8NA 1UVZA 1O73A 2FWGA 3TKRA 3DKSA 1OC8A 2FGXA 1ERUA 2GT5A 2L5OA 5EY6A 2B3SA 2J23A 6GSUA 4DSSA 4OD7A 1PA3A 4ZL8A 2OJLA 5ECSA 1M2BA 4ECJA 1SD9A 4FIWA 2KUCA 3DGQA 2GTUA 3ZVJD 3KEBA 2AHEA 1JZWA 2C0EA 4G9HA 2C0GA 4KSMA 4AGSA 4GSNA 2PUKC 2X64A 4EUYA 4F2IA 5CREA 3CXGA 3P7XA 1R5PA 4QL9A 3KXOA 3CSHA 1Q98A 1B48A 2WS2A 1IYHA 2ZUPA 2IMEA 1G7EA 4K0GA 1WE0A 3IV4A 3I9V2 1WRYA 2HNLA 3L9VA 5KN1A 5DAKA 5IMVA 4MMMA 4N30A 2TRCP 4GWRA 3ME7A 3JCML 2E2GA 4KA0A 2NDOA 2M46A 4ZIJA 5J9BA 5J3RA 2H70A 3VPQA 5IQYA 2PU9C 4CW9A 3KH9A 2E0QA 1LU4A 1M99A 3UARA 5LNKe 2DJ0A 4EF0A 4KH7A 1U6TA 1PKWA 4EKZA 1BG5A 1UN2A 2JACA 3EMXA 2VL3A 2O7KA 1AUCA 3PH9A 2N5AA 1YY7A 1NM3A 2H73A 2HE3A 3UEMA 1OC9A 16GSA 4ILFA 4GQCA 2HZFA 4ZB9A 5ECQB 1X9SB 5HFGA 2IFQB 1R5AA 5CYYA 1WOUA 1B9YC 4LMVA 5ECKB 2C3NA 1OC3A 1NSWA 3HXSA 5J41A 4FYUA 2DSAA 1EGOA 4AJ7A 3FW2A 3GX8A 3MDKA 4V2NA 2BMXA 1XXUA 3CRUA 3LXTA 4IQAA 3F0IA 12GSA 1M0UA 2VCXA 3EYTA 3KJYA 3CTFA 1JZRA 1TK5B 1ABAA 2YN1A 3R2QA 4PNGA 1SENA 4D73A 2FUG2 4I2UA 3KD0A 3O76A 2YZHA 1BAYA 3ZTLA 1S3AA 2ALBA 1NHOA 1AW9A 1O8WA 1TRWA 3HJMA 2V6KA 5AGYA 3F4RA 2GZZA 4ML6A 5EL8A 3D6IA 4ECCA 1A2MA 1YF1A 2PGTA 1V57A 1YEPA 3L4NA 2P0GA 1V2AA 2YPMA 3ZMLA 4WF5A 2YJHA 4GLTA 2XPDA 4JBBA 1J0FA 4KB3A 1T8EB 1XWBA 5H5QA 2RIIA 2IWTA 3KTBA 1SD8A 4H86A 3TGZA 3WGDA 3VWWA 4EXJA 3GH6A 4HJMA 3DWVA 5HR0A 2C0DA 3L0HA 4MK3A 2EIQA 4EDYA 1ML6A 2G2QA 2H1DA 4KE3A 2H66A 3HHVA 1GTBA 2FA8A 5HR2A 2L5LA 3LSZA 2DJ3A 1B4QA 5A5KA 1NHYA 2GT6A 4EC0A 4XS4A 1TU8A 4PX1A 4MPFA 1DE2A 2GQKA 2JL4A 2PMTA 3F63A 1AAZA 5CRHA 3FKFA 4OFNA 3H1NA 3V1WA 1FHEA 3OR5A 3EVIA 4I5QA 1SK0A 3WGXA 4EDZA 3ERFA 1U87A 1M2AA 3GH9A 4F03A 5IMDA 1K0BA 1R7HA 4N0ZA 2K18A 3HJPA 3WYWA 1YF0A 3HKRA 1FB0A 3LYPA 3LFLA 1GTUA 2NTOA 3UBLA 3VURA 5B6NA 3M0FA 4V1Ag 2K8SA 1KNGA 3FZAA 3APOA 1UA5A 3C7MA 5IPHA 2YNXA 5IMCA 3WD6A 4YH2A 1IYIA 5GSSA 4GXZA 3ZIJA 2H0HA 4EO3A 1SKRB 3SBCA 3LORA 4YAPA 4ZL7A 4TN8A 3UOMA 1PSQA 2K9FA 1NW2A 2RM5A 4F0BA 2A2SA 2HZEA 3S9FA 2FWFA 4ZBAA 3BJ5A 4G2EA 3LXZA 5IPGA 2GZPA 1JFUA 1EP8A 3RHCA 2LQOA 4Q5FA 3M9KA 4E8EA 2IIYA 2MBTA 2QKEA 1GTAA 4PUFC 2LS5A 2WJUA 5HFKA 3RPNA 2IMIA 1EV9A 1XVQA 3E9JB 2CT6A 1AXDA 3KMOA 5ELGA 1PKZA 1EGRA 2RM6A 3TJJA 2G0FA 1GUHA 4P3YB 4KCAA 1VF4A 2PPTA 4PQ1A 2PBJA 4BVXA 1I9DA 1PL2A 1A0RP 1TRUA 1EOGA 5INYA 4O5RA 2MMZA 1KEBA 2DJ1A 5CAXA 1VF3A 5ENUA 3CMIA 3ISOA 4G10A 2VM1A 4TXOA 3K8NA 1A8YA 4IVFA 4KSOA 1TKDB 1THOA 1G0TA 1K3YA 3GYKA 4RQRA 2CX3A 2GSSA 4F9ZA 4MF5A 1QMVA 1K3LA 2H76A 1XW6A 3IRAA 1JZDA 1EOHA 1X5DA 4DSRA 2H0IA 1VGLA 5G5FA 1QK8A 1BQ7A 1XWAA 4L0WA 2NBSA 10GSA 2V6OA 3UJ1A 3ZFBA 2FHEA 2O85A 1B9XC 3HY2A 4FH8A 1TK8B 3F6FA 3QDNA 3RBTA 3Q6OA 2E2MA 2EC4A 5DJLA 4IJ3A 1ZCPA 1T1VA 2OBIA 3QCPA 1YEXA 4HI7A 4GTUA 3VK9A 2IFQA 4POLA 1F2EA 2DC5A 1RW1A 5A4UA 2GS3A 1V98A 5F05A 2MMNA 3QPMA 2O8VB 2YANA 4N11A 3GIXA 5IMFA 4TR0A 3TKQA 5J5NA 2AB6A 7GSSA 4POMA 4ZL9A 3NZNA 5AISA 5ABRA 5KN3A 5CRGA 2DJ2A 3IBHA 5F07A 4OO4A 1VF1A 2VL2C 2A2RA 1TI3A 1TP9A 5DQYA 4RUVA 1THXA 1FOVA 4OWYA 3IE3A 3BOAA 2WB9A 2CAQA 5H5RA 2LJAA 3TOTA 1XOAA 1ON4A 2H6YA 1B8XA 2F9SA 3IXRA 3DXBA 1EZKA 4KUNA 4IKHA 2IN3A 5A4WA 4HU9A 1MEKA 4BA7A 2N5BA 4AF2A 5ID2B 4IP6A 3DVXA 3ZRDA 1I5GA 1EV4A 3EURA 5LCZA 4WR4A 1SL0B 1JHBA 2IPAA 3HZ4A 5D9TA 5E59A 2GQMA 5JCUA 1UC7A 6GSTA 1U88A 4HJ2A 4RQXA 4TXOB 2CX4A 1WPIA 2YWNA 1QXHA 1BX9A 1VRSD 1E6BA 4DEJA 4V1Ap 1GSSA 3HDCA 1V40A 5ECIB 5AIXA 1K0AA 3C71A 1X9MB 5D8IA 1OKTA 3UAPA 4PXOA 5G2ZA 3UBKA 2C3TA 4MABA 2GVPA 3F3RA 4Q5NA 1DUGA 4MF7A 3ZMKA 4X43A 3ZYWA 1XW9A 4NHWA 2IJYA 2FY6A 4NPBA 1BYEA 2KP2A 1ERWA 2C3QA 3MNGA 3U6VA 3UL3A 1XWCA 5B7CA 2QC7A 5EPFA 3FR6A 3ME8A 1H75A 3EWLA 4J2FA 2H8LA 1Z5YE 2GGTA 4JR6A 1GTIA 5DCGA 5FT3A 1TRVA 2PVQA 5D9XA 2L6CA 4BWSA 2HRFA 1GNEA 3KP8A 4XIHA 2RUFA 3FY7A 1CQGA 3GA4A 1M2DA 4MJEA 4L5LA 4PQIA 2R5GA 5IOXA 1USBA 3BBYA 2M72A 4DVCA 3GHAA 5DQSA 3MSZA 3PR8A 1LBKA 5E4WA 2VLUA 5J4UA 2HRNA 3GL5A 3CSIA 5IOWA 3GKNA 2D2ZA 2ON7A 3F3QA 1A24A 2F3MA 3GSTA 2B5XA 2X99A 1FVJA 3O6TA 3RPPA 2FNOA 3TUEA 3L78A 2LKUA 3FEUA 4KDUA 2VUPA 1A0FA 5G1LA 2OE0A 3IR4A 1T00A 3TRPA 2ZCTA 2C4JA 4ZILA 5D9VA 5C00A 2OE3A 3TKSA 3HD5A 3QFBC 1F37A 2C1YA 4IN0A 4ML1A 2XBIA 4EL1A 2VCTA 2XBQA 4BWQA 4KNDA 2FWHA 4KAEA 5F8BA 4KCEA 1G6YA 2V32A 3RHBA 4CHSA 2QSIA 2VCQA 1XBSA 1Z7PA 4K6XA 4K9ZA 1A2JA 4MJCA 2TIRA 3H93A 2IL3A 2K6VA 4K7OA 4TR3A 2VO4A 5DJMA 2TRXA 1GP1A 2J9HA 1GUKA 4MH2A 3IOSA 2YJ7A 3CSJA 3QD9A 4E8HA 2F8FA 5KN2A 1BJXA 1EP7A 1GLPA 3VWXA 1SYXA 5FWGA 4NV2A 2KHPA 1O8XA 3D0ZA 1U3AA 2B5EA 2LNTA 3CYNA 1BEDA 2GSRA 4MLYA 1V9WA 2DJJA 3HZ8A 5ECRB 3A5WA 2VD1A 3IDVA 3UIWA 3HCZA 4PQHA 4EVMA 5HR3A 5H5SA 1AIUA 6GSXA 2B5YA 1WP0A 3GL3A 4WETA 5DBQA 1OE8A 4Z7XA 4K2DA 2VAFA 3QOUA 3D4TA 2L6DA 4FYBA 4ZBBA 3ZLPA 2KP1A 3RAZA 3GMFA 4WKWA 3ZFLA 2DBCA 2VCWA 1YKAA 13GSA 2AAWA 2BTOT 3W8SA 2X8HA 2YCDA 2YV7A 4NMUA 3P90A 1SK1A 5ECOB 4YAVA 3CRTA 1T4YA 3PINA 2LJKA 4ECIA 3KGKA 2FLSA 5CRDA 2CAIA 5HR1A 5ECLB 3HA9A 2WCIA 2VL2A 8GSSA 3HJOA 1YKCA 4K1FA 5ECNB 2P5RA 4WBRD 2B6MA 2RLIA 3WGEA 5F0GA 4YQMA 5GAND 4F0CA 2HI7A 5GZZB 3L9SA 5DCHA 1LJRA 2OKAA 2PWJA 4YQVA 3APQA 3BCKA 2F8AA
chains in the Genus database with same CATH superfamily
2NPBA 3GURA 1XWGA 1W4VA 1TTZA 2CVKA 1WIKA 3GNJA 1PGTA 4O7HA 1K0OA 5D93A 1ZGNA 3BD2A 3C1RA 4POBA 2LRTA 2DMMA 3FMWA 2WGRA 2VLVA 3C73A 3DVWA 4POKA 5COHA 4L5OA 1GSDA 3EINA 5B8BA 2VLTA 5ID2A 4Z2UA 2C0FA 2R37A 1SKSB 4HSCX 2DMLA 4IBPA 4IP1A 4IW9A 2Z9SA 4BL7B 3IHGA 4NWYA 5CO3A 2H01A 2KOKA 3VFIA 4ECBA 2B7JA 6GSWA 4Q5QA 2NVLA 3E3EA 3IAS2 2YV9A 1R4WA 3Q19A 2CZ2A 2VD0A 3TKPA 3W6GA 2IMDA 4HEA2 2WZ9A 3DRNA 2V2GA 3H4KA 4MZBA 2I9HA 5KOXA 5G1KA 3A2VA 1F3AA 4IHUA 1ERVA 3KTLA 3RDWA 3IAM2 2REMA 4X1UA 5KOWA 2H75A 4MH3A 1ZYEA 2P5QA 1F9MA 1DBYA 4PURA 17GSA 4ZB6A 3ERGA 4MJBA 4OO5A 1DE1A 1GWCA 1TU7A 3VI5A 4KDYA 3GV1A 22GSA 3QAWA 4MCUA 5EVOA 4YQUA 1Y25A 5JWQB 3LWAA 2YP6A 3C1SA 3PGTA 4X0XA 3FRCA 2IMFA 1O85A 2I1UA 9GSSA 2LV3A 1Z6MA 4LL4B 1TRSA 2VCZA 3HVXA 1U3IA 4GSTA 2L59A 2H6ZA 2ES7A 3GFKA 2X8GA 3DMLA 3WT1A 2AUVA 3GKXA 1F6MC 4OMVA 2RUEA 2OE1A 4WR5A 3BCIA 1S3DA 3FR3A 5IMZA 3TJBA 4RI6A 1PX7A 3CTGA 2V41A 3QR6A 2LJRA 2MZCA 2F51A 2VIMA 2GSQA 3U5RE 1MD3A 1K0NA 2MBSA 4CDOA 1ST9A 5JCWA 1TJDA 2FA4A 3IC4A 3J7Yk 3IC8A 3HYPA 4ISDA 4QL7A 1ZYQB 3HVVA 3A5IA 14GSA 1PQNA 2C8UA 2HXKA 1EEMA 2HYXA 3EC3A 4CY8A 1J08A 2XC2A 4K5SA 2YZUA 3Q74A 1GSFA 4NV5A 3GKKA 2YWIA 3G7IA 2ZNMA 1GSUA 2H71A 4GF0A 5J9CA 2DKIA 1M9AA 2LQQA 4JU5A 1EEJA 3KM6A 1HNCA 3D22A 3FZ4A 1W89A 5DALA 4K7NA 1O7UA 1T3BA 4TR1A 3US3A 3ERWA 4K8MA 5CRWA 1VF2A 1B4PA 3NIVA 3UVHA 2I4AA 4L0UA 4NAXA 1GSYA 2GZYA 3A3TA 4PUAA 3DIEA 2I81A 2H1BA 1Q4JA 4L8EA 3L9UA 4QQ7A 1GLQA 1XG8A 3ZITA 4ID0A 2OADA 2O89A 1XVWA 3TRXA 4TOPA 1A23A 1MDKA 18GSA 2CVDA 4XHMA 1MDIA 2MMOA 2WFCA 4HS1A 5JWOB 3D4MA 2JSYA 1PN9A 4MPGA 5B6MA 1FW1A 5GAPD 4OCEA 4V2MA 3APSA 1T4ZA 5G30A 3W8JA 1AQWA 2JZSA 20GSA 2C80A 4I6XA 4MP4A 2JZRA 4K2XA 5G5EA 11GSA 1FO5A 1SJ6A 1ZMAA 2H0GA 5AN1A 3EU3A 3G9BA 2MYGA 3FK8A 2EIRA 1RQMA 1OE7A 1ZOFA 4FO5A 1AQVA 5LD0A 2HLSA 3VI7A 5A4VA 1GSQA 1AC1A 3PPUA 1OVNA 3DYRA 4MDCA 5KEJA 1OKDA 2R2JA 1X5CA 1SJZA 3D5JA 3FZ9A 3IA1A 3KIJA 4Q5RA 1ACVA 3IHQA 2DIYA 1PX6A 2L57A 2VOCA 3KCMA 4XRDA 2R4VA 2XPEA 1TDIA 4XTSA 3VLNA 4I2TA 3I43A 3KMNA 4XCSA 5ECPB 1G7OA 4ZBDA 2L4CA 1X0RA 2WRTA 1TXXA 4BIKA 3M1GA 2CQ9A 2VCVA 3A2XA 5IM9A 4HQZA 1K0CA 1HNAA 2YWOA 3GTUB 1Z7RA 2I3YA 3LYKA 1PFOA 2GQLA 1SJIA 3TJKA 2WDUA 4WBJA 5G31A 1Z9HA 2JSZA 2YOIA 1SYRA 2JU5A 2V1MA 19GSA 4KDXA 2CZ3A 2VM2A 3NOFA 2H6XA 5DALB 4TR1B 4HZ4A 5JCGA 2HSYA 5DDLA 4Z2RA 6GSYA 1F3BA 4I8BA 3G7YA 2CA8A 2R3XA 1X5EA 1FAAA 2PERA 3QFAC 1G6WA 4DSSB 3F6DA 1M7TA 2R0CA 4O32A 2JADA 1YQ1A 4BL7A 2JZTA 1MDJA 3GRXA 2QA2A 4WF4A 2FWEA 4ULXA 2HFDA 1K3OA 2H30A 4JR4A 1TW9A 3GKMA 3LGCA 4IELA 4V2LA 3EU4A 2A4VA 4HDEA 3VPTA 3M3MA 5BRTA 3AY8A 2DLXA 1ZYPA 2AYTA 2M80A 3ZVJA 2OA7A 4AJ8A 4RI7A 5D96A 2H19A 5DAKB 4K7IA 3J7Yb 5JWRB 4GCIA 3N9JA 1K0MA 4KW6A 3LG6A 5CP1A 1O81A 4HU7A 1V58A 5CNWA 3QAVA 1Y6EA 4NHZA 4TW5A 1DSBA 2CV4A 3EPTA 4ZB8A 1A2LA 5HFIA 3KP9A 3TKSE 1J9BA 2LRNA 4OCFA 3QMXA 4XS1A 1XWKA 3MWHA 4G19A 4IS0A 1YJ6A 3EE2A 2ON5A 2LTKA 3A2WA 2H1GA 4N0VA 1OC9B 1TI1A 1T7PB 2BJXA 1XZOA 3I6AA 4MF6A 2X8CA 1C72A 4HUAA 1XCCA 4ZXGA 1H4OA 1XIYA 4OFTA 5B8AA 2DKHA 5D73A 5IO0A 3ED3A 3IK9A 4HQSA 3R3EA 2YWMA 1N2AA 2FCHA 3LEFA 3IK7A 4O92A 4TXVA 4KGIA 2AJQB 1MTCA 5L71A 1SK2A 2E7PA 4IQ1A 1SL1B 3SWLA 2LUSA 4MJAA 5AIVA 2K8VA 1R26A 1FOHA 1GULA 3UVTA 1MD4A 1N8JA 1OAZA 1EWXA 1ZL9A 3VWUA 6GSVA 2DJKA 1JLVA 2H1AA 4LLRA 4LMWA 4TVEA 1TOFA 3TDGA 2N5FA 1GSEA 3Q18A 3KZQA 2H74A 5ELAA 4MZWA 1QQ2A 3CBUA 4D73B 5IMAA 4MZCA 4TR4A 3IPZA 2GDRA 4BPYA 5KN0A 2PVOC 3TCOA 3F9UA 1SU9A 4FYCA 2O87A 1ILOA 1YDKA 4J56E 1QUWA 2LNSA 2HT9A 3FZ5A 3TB2A 3FYGA 1SL2B 4GQFA 1QGVA 3N5OA 3UMAA 1XW5A 1K0DA 1XOBA 4GSSA 2MMAA 2CVBA 1PRXA 5DVBA 2R6KA 2QGVA 3GUSA 1A8LA 3M9JA 5FHIA 2GSTA 4F82A 3O3TA 1XFLA 4TKYA 3ZZXA 3E0UA 3TKSC 1KTEA 2P31A 4JE1A 1JZOA 1JLWA 3EMPA 3QAGA 3ZIVA 3F4TA 1WMJA 4I97A 5GSTA 4PNFA 4XS6A 2EIOA 2KLXA 4K0NA 3C8EA 2PN8A 1Z6NA 5F06A 1S3RA 3P2AA 5D9WA 2OACA 4WEYA 3TOUA 1PL1A 3TRQA 1AQXA 2X49A 4WXTA 1XPVA 5HQPA 3ZL5A 2DIZA 2H72A 2L4QA 4XS4B 1ZZYA 4IGJA 1KBNA 1GH2A 1GL8A 3H79A 5BMUA 1TK0B 2HSHA 3TJGA 1S3CA 1HQOA 5ECHB 4EE0A 3LJRA 1HNBA 2XHFA 4OFMA 1WWJA 4HOJA 3H8QA 2GLRA 4GRFA 3I69A 2B1LA 1URMA 4HZ2A 2LSTA 4J57E 5ECMB 1FB6A 2AV4A 4JEDA 5C04A 1FG4A 3DD3A 3GX0A 1GNWA 4BVYA 3WT2A 5IO2A 1ZYNA 3ZREA 3VWVA 3GSSA 1HD2A 3FR9A 2B1KA 1M9BA 1OYJA 2QA1A 3TJFA 3P8WA 2IMKA 4IJIA 1ERTA 1O6JA 1X9WB 3D21A 2LRCA 2FD3A 1GUMA 4TRXA 1PMTA 1HYUA 3F4SA 1GRXA 4MA9A 4JZQA 2VL9A 1QFNA 4N10A 4LA1A 3DEXA 4DSQA 3G7JA 4XRAA 1Z3EA 3GN3A 2HZEB 3KH7A 5IIZA 2B7KA 3MAKA 1CQHA 3HVSA 1WJKA 4NXIA 1FVKA 2WULA 3FHKA 3F8UA 3LQ7A 4AJ6A 3GTUA 1SKWB 4PGTA 4KX4A 4ACSA 3MYDA 4LL1B 1YZXA 1PD21 1E2YA 2OBKA 4JRRA 2LEGA 1RK4A 6GSSA 3M8NA 1UVZA 1O73A 4YKFA 2FWGA 3TKRA 3DKSA 1OC8A 2FGXA 1ERUA 2GT5A 2L5OA 5EY6A 2B3SA 2J23A 6GSUA 4DSSA 4OD7A 1PA3A 4ZL8A 2OJLA 5ECSA 1M2BA 4ECJA 1SD9A 4PTSA 4FIWA 2KUCA 3DGQA 2GTUA 3ZVJD 3KEBA 2AHEA 1JZWA 2C0EA 4G9HA 2C0GA 4KSMA 4AGSA 4GSNA 2PUKC 2X64A 4EUYA 4F2IA 5CREA 3CXGA 3P7XA 4EIPA 1R5PA 4QL9A 3KXOA 3CSHA 1Q98A 1B48A 2WS2A 1IYHA 2ZUPA 2IMEA 1G7EA 4K0GA 1WE0A 3IV4A 3I9V2 1WRYA 2HNLA 3L9VA 5KN1A 4A5PA 5DAKA 5IMVA 4MMMA 4N30A 2TRCP 4GWRA 3ME7A 3JCML 2E2GA 4KA0A 2NDOA 2M46A 4ZIJA 5J9BA 5J3RA 2H70A 3VPQA 5IQYA 2PU9C 4CW9A 3KH9A 2E0QA 1LU4A 1M99A 3UARA 1M3IA 5LNKe 2DJ0A 4EF0A 4KH7A 1U6TA 1PKWA 4EKZA 4BVYB 1BG5A 1UN2A 2JACA 3EMXA 2VL3A 2O7KA 1AUCA 3PH9A 2N5AA 1YY7A 1NM3A 2H73A 2HE3A 2A2PA 1OC9A 3UEMA 16GSA 4ILFA 4GQCA 2HZFA 4ZB9A 5ECQB 3MIXA 1X9SB 5HFGA 2IFQB 1R5AA 5CYYA 1WOUA 1B9YC 4LMVA 5ECKB 2C3NA 1OC3A 1NSWA 3HXSA 5J41A 4FYUA 2DSAA 1EGOA 4AJ7A 3FW2A 3GX8A 3MDKA 4V2NA 2BMXA 1XXUA 3CRUA 3LXTA 4IQAA 3F0IA 12GSA 1M0UA 2VCXA 3EYTA 3KJYA 3CTFA 1JZRA 1TK5B 1ABAA 2YN1A 3R2QA 4PNGA 1SENA 4D73A 2FUG2 4I2UA 3KD0A 3O76A 2YZHA 1BAYA 3ZTLA 1S3AA 2ALBA 1NHOA 1AW9A 1O8WA 1TRWA 3HJMA 2V6KA 5AGYA 3F4RA 2GZZA 4ML6A 5EL8A 3D6IA 4ECCA 1A2MA 1YF1A 2PGTA 2UZ8A 1V57A 1YEPA 3L4NA 2P0GA 1V2AA 2YPMA 3ZMLA 4WF5A 3CQFA 2YJHA 4GLTA 2XPDA 4JBBA 1J0FA 4KB3A 1T8EB 1XWBA 5H5QA 2RIIA 2IWTA 3KTBA 1SD8A 4H86A 3TGZA 3WGDA 3VWWA 4EXJA 3GH6A 4HJMA 3DWVA 5HR0A 2C0DA 3L0HA 4MK3A 2EIQA 4EDYA 1ML6A 2G2QA 2H1DA 4KE3A 2H66A 3HHVA 1GTBA 2FA8A 5HR2A 2L5LA 3LSZA 2DJ3A 1B4QA 5A5KA 1NHYA 2GT6A 4EC0A 4XS4A 1TU8A 4PX1A 4MPFA 1DE2A 2GQKA 2JL4A 2PMTA 3F63A 1AAZA 5CRHA 3FKFA 4OFNA 3H1NA 3V1WA 1FHEA 3OR5A 3EVIA 4I5QA 1SK0A 3WGXA 4EDZA 3ERFA 1U87A 1M2AA 3GH9A 4F03A 5IMDA 1K0BA 1R7HA 4N0ZA 2K18A 3HJPA 3WYWA 1YF0A 4USSA 3HKRA 1FB0A 3LYPA 4G0LA 3LFLA 1GTUA 2NTOA 3UBLA 3VURA 5B6NA 3M0FA 4V1Ag 2K8SA 1KNGA 3FZAA 3APOA 1UA5A 3C7MA 2HRKA 5IPHA 2YNXA 5IMCA 3WD6A 4YH2A 1IYIA 5GSSA 4GXZA 3ZIJA 2H0HA 4EO3A 1SKRB 3SBCA 3LORA 4CY6A 4YAPA 4ZL7A 4TN8A 3UOMA 1PSQA 2K9FA 1NW2A 2RM5A 4F0BA 2A2SA 2HZEA 3S9FA 2FWFA 4ZBAA 3BJ5A 4G2EA 3LXZA 5IPGA 2GZPA 1JFUA 1EP8A 3RHCA 2LQOA 4Q5FA 3M9KA 4E8EA 2IIYA 2MBTA 2QKEA 1GTAA 4PUFC 2LS5A 2WJUA 5HFKA 3RPNA 2IMIA 1EV9A 1XVQA 3E9JB 2CT6A 1AXDA 3KMOA 5ELGA 1PKZA 1EGRA 2RM6A 3TJJA 2G0FA 1GUHA 4P3YB 4KCAA 1VF4A 1PN0A 2PPTA 4PQ1A 2PBJA 4BVXA 1I9DA 1PL2A 1A0RP 1TRUA 1EOGA 5INYA 4O5RA 2MMZA 1KEBA 2DJ1A 5CAXA 1VF3A 5ENUA 2HRAA 3CMIA 3ISOA 4G10A 2VM1A 4TXOA 3K8NA 1A8YA 4IVFA 4KSOA 1TKDB 1THOA 1G0TA 1K3YA 3GYKA 4RQRA 2CX3A 2GSSA 4F9ZA 4MF5A 1QMVA 1K3LA 2H76A 1XW6A 3IRAA 1JZDA 1EOHA 1X5DA 4DSRA 2H0IA 1VGLA 5G5FA 1QK8A 1BQ7A 4K5RA 1XWAA 4L0WA 2NBSA 10GSA 2V6OA 3UJ1A 3ZFBA 2FHEA 2O85A 1B9XC 3HY2A 4FH8A 1TK8B 3F6FA 3QDNA 3RBTA 3Q6OA 2E2MA 2EC4A 5DJLA 4IJ3A 1ZCPA 1T1VA 2OBIA 3QCPA 1YEXA 4HI7A 4GTUA 3VK9A 2IFQA 4POLA 1F2EA 2DC5A 1RW1A 5A4UA 4G0KA 2GS3A 1V98A 5F05A 4KF9A 2MMNA 3QPMA 2O8VB 2YANA 4N11A 3GIXA 5IMFA 4TR0A 3TKQA 5J5NA 2AB6A 7GSSA 4POMA 4ZL9A 3NZNA 5AISA 5ABRA 5KN3A 5CRGA 2DJ2A 3IBHA 5F07A 4OO4A 1VF1A 4X4JA 2VL2C 2A2RA 1TI3A 1TP9A 5DQYA 4RUVA 1THXA 1FOVA 4OWYA 3IE3A 3BOAA 2WB9A 2CAQA 5H5RA 2LJAA 3TOTA 1XOAA 1ON4A 2H6YA 1B8XA 2F9SA 3IXRA 3DXBA 4G0IA 1EZKA 4KUNA 4IKHA 2IN3A 5A4WA 4HU9A 1MEKA 4BA7A 2N5BA 4AF2A 4BVXB 5ID2B 4IP6A 3DVXA 3ZRDA 1I5GA 1EV4A 3EURA 5LCZA 4WR4A 1SL0B 1JHBA 2IPAA 3HZ4A 5D9TA 5E59A 2GQMA 5JCUA 1UC7A 6GSTA 2R0PA 1U88A 4HJ2A 4RQXA 4TXOB 2CX4A 1WPIA 2YWNA 1QXHA 1BX9A 1VRSD 1E6BA 4DEJA 4V1Ap 1GSSA 3HDCA 1V40A 5ECIB 5AIXA 1K0AA 4O5QA 3C71A 1X9MB 5D8IA 4FQUA 1OKTA 3UAPA 4PXOA 5G2ZA 3UBKA 2C3TA 4MABA 2GVPA 3F3RA 4Q5NA 1DUGA 4MF7A 3ZMKA 4X43A 3ZYWA 1XW9A 4NHWA 2IJYA 2FY6A 4NPBA 1BYEA 2KP2A 1ERWA 2C3QA 3MNGA 3U6VA 3UL3A 1XWCA 5B7CA 4EIQA 4Z2TA 2QC7A 5EPFA 3FR6A 3ME8A 1H75A 4MNNA 3EWLA 4J2FA 2H8LA 1Z5YE 2GGTA 4JR6A 1GTIA 5DCGA 5FT3A 1TRVA 2PVQA 5D9XA 2L6CA 4BWSA 2HRFA 1GNEA 3KP8A 4XIHA 2RUFA 3FY7A 1CQGA 3GA4A 1M2DA 4MJEA 4L5LA 4PQIA 2R5GA 5IOXA 1USBA 3BBYA 2M72A 4DVCA 3GHAA 5DQSA 3MSZA 3PR8A 1LBKA 5E4WA 2VLUA 5J4UA 2HRNA 3GL5A 3CSIA 5IOWA 3GKNA 2D2ZA 2ON7A 3F3QA 1A24A 2F3MA 3GSTA 2B5XA 2X99A 1FVJA 3O6TA 3RPPA 2FNOA 3TUEA 3L78A 2LKUA 3FEUA 4KDUA 2VUPA 1A0FA 5G1LA 2OE0A 3IR4A 1T00A 3TRPA 2ZCTA 2C4JA 4ZILA 5D9VA 5C00A 2OE3A 3TKSA 3HD5A 3QFBC 1F37A 2C1YA 4IN0A 4ML1A 2XBIA 4EL1A 2VCTA 2XBQA 4BWQA 4KNDA 2FWHA 4KAEA 5F8BA 4KCEA 1G6YA 2V32A 3RHBA 4CHSA 2QSIA 2VCQA 1XBSA 1Z7PA 4K6XA 4K9ZA 1A2JA 4MJCA 2TIRA 3H93A 2IL3A 2K6VA 4K7OA 4TR3A 2VO4A 5DJMA 2TRXA 1GP1A 2J9HA 1GUKA 4MH2A 3IOSA 2YJ7A 3CSJA 3QD9A 4E8HA 2F8FA 5KN2A 4YKGA 1M3JA 1BJXA 1EP7A 1GLPA 3VWXA 1SYXA 5FWGA 4NV2A 2KHPA 1O8XA 3D0ZA 1U3AA 2B5EA 2LNTA 3CYNA 1BEDA 2GSRA 4MLYA 1V9WA 2DJJA 3HZ8A 5ECRB 3A5WA 2R0GA 2VD1A 3IDVA 3UIWA 3HCZA 4PQHA 4EVMA 5HR3A 5H5SA 1AIUA 6GSXA 2B5YA 1WP0A 3GL3A 4WETA 5DBQA 1OE8A 4Z7XA 4K2DA 2VAFA 3QOUA 3D4TA 2L6DA 4FYBA 4ZBBA 3ZLPA 4ICYA 2HSMA 2KP1A 3RAZA 3GMFA 4WKWA 4O5UA 2X4AA 3ZFLA 2DBCA 2VCWA 3HVNA 1YKAA 13GSA 2AAWA 2BTOT 3W8SA 2X8HA 2YCDA 2YV7A 4NMUA 3P90A 1SK1A 3CRTA 1T4YA 4YAVA 5ECOB 3PINA 2LJKA 4ECIA 3KGKA 2FLSA 5CRDA 2CAIA 5HR1A 5ECLB 3HA9A 2WCIA 2VL2A 8GSSA 3HJOA 1YKCA 4K1FA 5ECNB 2P5RA 4WBRD 2B6MA 2A4HA 2RLIA 3WGEA 3LW9A 5F0GA 4YQMA 5GAND 4F0CA 2HI7A 5GZZB 3L9SA 5DCHA 1LJRA 2OKAA 2PWJA 4YQVA 3APQA 3BCKA 2F8AA
chains in the Genus database with same CATH topology
2NPBA 3GURA 1XWGA 1W4VA 1TTZA 2CVKA 1WIKA 3GNJA 1PGTA 4O7HA 1K0OA 5D93A 1ZGNA 3BD2A 3C1RA 4POBA 2LRTA 2DMMA 3FMWA 2WGRA 2VLVA 3C73A 3DVWA 4POKA 5COHA 4L5OA 1GSDA 3EINA 5B8BA 2VLTA 5ID2A 4Z2UA 2C0FA 2R37A 1SKSB 2DMLA 4IBPA 4IP1A 4IW9A 2Z9SA 4BL7B 3IHGA 4NWYA 5CO3A 2H01A 2KOKA 3VFIA 4ECBA 2B7JA 6GSWA 4Q5QA 2NVLA 3E3EA 3IAS2 2YV9A 1R4WA 3Q19A 2CZ2A 2VD0A 3TKPA 3W6GA 2IMDA 4HEA2 2WZ9A 3DRNA 2V2GA 3H4KA 4MZBA 2I9HA 5KOXA 5G1KA 3A2VA 1F3AA 4IHUA 1ERVA 3KTLA 3RDWA 3IAM2 2REMA 4X1UA 5KOWA 2H75A 4MH3A 1ZYEA 2P5QA 1F9MA 1DBYA 4PURA 17GSA 4ZB6A 3ERGA 4MJBA 4OO5A 1DE1A 1GWCA 1TU7A 3VI5A 4KDYA 3GV1A 22GSA 3QAWA 4MCUA 5EVOA 4YQUA 1Y25A 5JWQB 3LWAA 2YP6A 3C1SA 3PGTA 4X0XA 3FRCA 2IMFA 1O85A 2I1UA 9GSSA 2LV3A 1Z6MA 4LL4B 1TRSA 2VCZA 3HVXA 1U3IA 4GSTA 2L59A 2H6ZA 2ES7A 3GFKA 2X8GA 3DMLA 3WT1A 2AUVA 3GKXA 1F6MC 4OMVA 2RUEA 2OE1A 4WR5A 3BCIA 1S3DA 3FR3A 5IMZA 3TJBA 4RI6A 1PX7A 3CTGA 2V41A 3QR6A 2LJRA 2MZCA 2F51A 2VIMA 2GSQA 3U5RE 1MD3A 1K0NA 2MBSA 4CDOA 1ST9A 5JCWA 1TJDA 2FA4A 3IC4A 3J7Yk 3IC8A 3HYPA 4ISDA 4QL7A 1ZYQB 3HVVA 3A5IA 14GSA 1PQNA 2C8UA 2HXKA 1EEMA 2HYXA 3EC3A 4CY8A 1J08A 2XC2A 4K5SA 2YZUA 3Q74A 1GSFA 4NV5A 3GKKA 2YWIA 3G7IA 2ZNMA 1GSUA 2H71A 4GF0A 5J9CA 2DKIA 1M9AA 2LQQA 4JU5A 1EEJA 3KM6A 1HNCA 3D22A 3FZ4A 1W89A 5DALA 4K7NA 1O7UA 1T3BA 4TR1A 3US3A 3ERWA 4K8MA 5CRWA 1VF2A 1B4PA 3NIVA 3UVHA 2I4AA 4L0UA 4NAXA 1GSYA 2GZYA 3A3TA 4PUAA 3DIEA 2I81A 2H1BA 1Q4JA 4L8EA 3L9UA 4QQ7A 1GLQA 3ZITA 4ID0A 2OADA 2O89A 1XVWA 3TRXA 4TOPA 1A23A 1MDKA 18GSA 2CVDA 4XHMA 1MDIA 2MMOA 2WFCA 4HS1A 5JWOB 3D4MA 2JSYA 1PN9A 4MPGA 5B6MA 1FW1A 5GAPD 4OCEA 4V2MA 3APSA 1T4ZA 5G30A 3W8JA 1AQWA 2JZSA 20GSA 2C80A 4I6XA 4MP4A 2JZRA 4K2XA 5G5EA 11GSA 1FO5A 1SJ6A 1ZMAA 2H0GA 5AN1A 3EU3A 3G9BA 2MYGA 3FK8A 2EIRA 1RQMA 1OE7A 1ZOFA 4FO5A 1AQVA 5LD0A 2HLSA 3VI7A 5A4VA 1GSQA 1AC1A 3PPUA 1OVNA 3DYRA 4MDCA 5KEJA 1OKDA 2R2JA 1X5CA 1SJZA 3D5JA 3FZ9A 3IA1A 3KIJA 4Q5RA 1ACVA 3IHQA 2DIYA 1PX6A 2L57A 2VOCA 3KCMA 4XRDA 2R4VA 2XPEA 1TDIA 4XTSA 3VLNA 4I2TA 3I43A 3KMNA 4XCSA 5ECPB 1G7OA 4ZBDA 2L4CA 1X0RA 2WRTA 1TXXA 3M1GA 2CQ9A 2VCVA 3A2XA 5IM9A 4HQZA 1K0CA 1HNAA 2YWOA 3GTUB 1Z7RA 2I3YA 3LYKA 2GQLA 1SJIA 3TJKA 2WDUA 4WBJA 5G31A 1Z9HA 2JSZA 2YOIA 1SYRA 2JU5A 2V1MA 19GSA 4KDXA 2CZ3A 2VM2A 3NOFA 2H6XA 5DALB 4TR1B 4HZ4A 5JCGA 2HSYA 5DDLA 4Z2RA 6GSYA 1F3BA 4I8BA 3G7YA 2CA8A 2R3XA 1X5EA 1FAAA 2PERA 3QFAC 1G6WA 4DSSB 3F6DA 1M7TA 2R0CA 4O32A 2JADA 1YQ1A 4BL7A 2JZTA 1MDJA 3GRXA 2QA2A 4WF4A 2FWEA 4ULXA 2HFDA 1K3OA 2H30A 4JR4A 1TW9A 3GKMA 3LGCA 4IELA 4V2LA 3EU4A 2A4VA 4HDEA 3VPTA 3M3MA 5BRTA 3AY8A 2DLXA 1ZYPA 2AYTA 2M80A 3ZVJA 2OA7A 4AJ8A 4RI7A 5D96A 2H19A 5DAKB 4K7IA 3J7Yb 5JWRB 4GCIA 3N9JA 1K0MA 4KW6A 3LG6A 5CP1A 1O81A 4HU7A 1V58A 5CNWA 3QAVA 1Y6EA 4NHZA 4TW5A 1DSBA 2CV4A 3EPTA 4ZB8A 1A2LA 5HFIA 3KP9A 3TKSE 1J9BA 2LRNA 4OCFA 3QMXA 4XS1A 1XWKA 3MWHA 4G19A 4IS0A 1YJ6A 3EE2A 2ON5A 2LTKA 3A2WA 2H1GA 4N0VA 1OC9B 1TI1A 1T7PB 2BJXA 1XZOA 3I6AA 4MF6A 2X8CA 1C72A 4HUAA 1XCCA 4ZXGA 1H4OA 1XIYA 4OFTA 5B8AA 2DKHA 5D73A 5IO0A 3ED3A 3IK9A 4HQSA 3R3EA 2YWMA 1N2AA 2FCHA 3LEFA 3IK7A 4O92A 4TXVA 4KGIA 2AJQB 1MTCA 5L71A 1SK2A 2E7PA 4IQ1A 1SL1B 3SWLA 2LUSA 4MJAA 5AIVA 2K8VA 1R26A 1FOHA 1GULA 3UVTA 1MD4A 1N8JA 1OAZA 1EWXA 1ZL9A 3VWUA 6GSVA 2DJKA 1JLVA 2H1AA 4LLRA 4LMWA 4TVEA 1TOFA 3TDGA 2N5FA 1GSEA 3Q18A 3KZQA 2H74A 5ELAA 4MZWA 1QQ2A 3CBUA 4D73B 5IMAA 4MZCA 4TR4A 3IPZA 2GDRA 4BPYA 5KN0A 2PVOC 3TCOA 3F9UA 1SU9A 4FYCA 2O87A 1ILOA 1YDKA 4J56E 1QUWA 2LNSA 2HT9A 3FZ5A 3TB2A 3FYGA 1SL2B 4GQFA 1QGVA 3N5OA 3UMAA 1XW5A 1K0DA 1XOBA 4GSSA 2MMAA 2CVBA 1PRXA 5DVBA 2R6KA 2QGVA 3GUSA 1A8LA 3M9JA 5FHIA 2GSTA 4F82A 3O3TA 1XFLA 4TKYA 3ZZXA 3E0UA 3TKSC 1KTEA 2P31A 4JE1A 1JZOA 1JLWA 3EMPA 3QAGA 3ZIVA 3F4TA 1WMJA 4I97A 5GSTA 4PNFA 4XS6A 2EIOA 2KLXA 4K0NA 3C8EA 2PN8A 1Z6NA 5F06A 3P2AA 5D9WA 2OACA 4WEYA 3TOUA 1PL1A 3TRQA 1AQXA 2X49A 4WXTA 1XPVA 5HQPA 3ZL5A 2DIZA 2H72A 2L4QA 4XS4B 1ZZYA 4IGJA 1KBNA 1GH2A 1GL8A 3H79A 5BMUA 1TK0B 2HSHA 3TJGA 1S3CA 1HQOA 5ECHB 4EE0A 3LJRA 1HNBA 2XHFA 4OFMA 1WWJA 4HOJA 3H8QA 2GLRA 4GRFA 3I69A 2B1LA 1URMA 4HZ2A 2LSTA 4J57E 5ECMB 1FB6A 2AV4A 4JEDA 5C04A 1FG4A 3DD3A 3GX0A 1GNWA 4BVYA 3WT2A 5IO2A 1ZYNA 3ZREA 3VWVA 3GSSA 1HD2A 3FR9A 2B1KA 1M9BA 1OYJA 2QA1A 3TJFA 3P8WA 2IMKA 4IJIA 1ERTA 1O6JA 1X9WB 3D21A 2LRCA 2FD3A 1GUMA 4TRXA 1PMTA 1HYUA 3F4SA 1GRXA 4MA9A 4JZQA 2VL9A 1QFNA 4N10A 4LA1A 3DEXA 4DSQA 3G7JA 4XRAA 1Z3EA 3GN3A 2HZEB 3KH7A 5IIZA 2B7KA 3MAKA 1CQHA 3HVSA 1WJKA 4NXIA 1FVKA 2WULA 3FHKA 3F8UA 3LQ7A 4AJ6A 3GTUA 1SKWB 4PGTA 4KX4A 4ACSA 3MYDA 4LL1B 1YZXA 1PD21 1E2YA 2OBKA 4JRRA 2LEGA 1RK4A 6GSSA 3M8NA 1UVZA 1O73A 4YKFA 2FWGA 3TKRA 3DKSA 1OC8A 2FGXA 1ERUA 2GT5A 2L5OA 5EY6A 2B3SA 2J23A 6GSUA 4DSSA 4OD7A 1PA3A 4ZL8A 2OJLA 5ECSA 1M2BA 4ECJA 1SD9A 4PTSA 4FIWA 2KUCA 3DGQA 2GTUA 3ZVJD 3KEBA 2AHEA 1JZWA 2C0EA 4G9HA 2C0GA 4KSMA 4AGSA 4GSNA 2PUKC 2X64A 4EUYA 4F2IA 5CREA 3CXGA 3P7XA 4EIPA 1R5PA 4QL9A 3KXOA 3CSHA 1Q98A 1B48A 2WS2A 1IYHA 2ZUPA 2IMEA 1G7EA 4K0GA 1WE0A 3IV4A 3I9V2 1WRYA 2HNLA 3L9VA 5KN1A 4A5PA 5DAKA 5IMVA 4MMMA 4N30A 2TRCP 4GWRA 3ME7A 3JCML 2E2GA 4KA0A 2NDOA 2M46A 4ZIJA 5J9BA 5J3RA 2H70A 3VPQA 5IQYA 2PU9C 4CW9A 3KH9A 2E0QA 1LU4A 1M99A 3UARA 5LNKe 2DJ0A 4EF0A 4KH7A 1U6TA 1PKWA 4EKZA 4BVYB 1BG5A 1UN2A 2JACA 3EMXA 2VL3A 2O7KA 1AUCA 3PH9A 2N5AA 1YY7A 1NM3A 2H73A 2HE3A 2A2PA 1OC9A 3UEMA 16GSA 4ILFA 4GQCA 2HZFA 4ZB9A 5ECQB 3MIXA 1X9SB 5HFGA 2IFQB 1R5AA 5CYYA 1WOUA 1B9YC 4LMVA 5ECKB 2C3NA 1OC3A 1NSWA 3HXSA 5J41A 4FYUA 2DSAA 1EGOA 4AJ7A 3FW2A 3GX8A 3MDKA 4V2NA 2BMXA 1XXUA 3CRUA 3LXTA 4IQAA 3F0IA 12GSA 1M0UA 2VCXA 3EYTA 3KJYA 3CTFA 1JZRA 1TK5B 1ABAA 2YN1A 3R2QA 4PNGA 1SENA 4D73A 2FUG2 4I2UA 3KD0A 3O76A 2YZHA 1BAYA 3ZTLA 1S3AA 2ALBA 1NHOA 1AW9A 1O8WA 1TRWA 3HJMA 2V6KA 5AGYA 3F4RA 2GZZA 4ML6A 5EL8A 3D6IA 4ECCA 1A2MA 1YF1A 2PGTA 2UZ8A 1V57A 1YEPA 3L4NA 2P0GA 1V2AA 2YPMA 3ZMLA 4WF5A 2YJHA 4GLTA 2XPDA 4JBBA 1J0FA 4KB3A 1T8EB 1XWBA 5H5QA 2RIIA 2IWTA 3KTBA 1SD8A 4H86A 3TGZA 3WGDA 3VWWA 4EXJA 3GH6A 4HJMA 3DWVA 5HR0A 2C0DA 3L0HA 4MK3A 2EIQA 4EDYA 1ML6A 2G2QA 2H1DA 4KE3A 2H66A 3HHVA 1GTBA 2FA8A 5HR2A 2L5LA 3LSZA 2DJ3A 1B4QA 5A5KA 1NHYA 2GT6A 4EC0A 4XS4A 1TU8A 4PX1A 4MPFA 1DE2A 2GQKA 2JL4A 2PMTA 3F63A 1AAZA 5CRHA 3FKFA 4OFNA 3H1NA 3V1WA 1FHEA 3OR5A 3EVIA 4I5QA 1SK0A 3WGXA 4EDZA 3ERFA 1U87A 1M2AA 3GH9A 4F03A 5IMDA 1K0BA 1R7HA 4N0ZA 2K18A 3HJPA 3WYWA 1YF0A 4USSA 3HKRA 1FB0A 3LYPA 4G0LA 3LFLA 1GTUA 2NTOA 3UBLA 3VURA 5B6NA 3M0FA 4V1Ag 2K8SA 1KNGA 3FZAA 3APOA 1UA5A 3C7MA 2HRKA 5IPHA 2YNXA 5IMCA 3WD6A 4YH2A 1IYIA 5GSSA 4GXZA 3ZIJA 2H0HA 4EO3A 1SKRB 3SBCA 3LORA 4CY6A 4YAPA 4ZL7A 4TN8A 3UOMA 1PSQA 2K9FA 1NW2A 2RM5A 4F0BA 2A2SA 2HZEA 3S9FA 2FWFA 4ZBAA 3BJ5A 4G2EA 3LXZA 5IPGA 2GZPA 1JFUA 1EP8A 3RHCA 2LQOA 4Q5FA 3M9KA 4E8EA 2IIYA 2MBTA 2QKEA 1GTAA 4PUFC 2LS5A 2WJUA 5HFKA 3RPNA 2IMIA 1EV9A 1XVQA 3E9JB 2CT6A 1AXDA 3KMOA 5ELGA 1PKZA 1EGRA 2RM6A 3TJJA 2G0FA 1GUHA 4P3YB 4KCAA 1VF4A 1PN0A 2PPTA 4PQ1A 2PBJA 4BVXA 1I9DA 1PL2A 1A0RP 1TRUA 1EOGA 5INYA 4O5RA 2MMZA 1KEBA 2DJ1A 5CAXA 1VF3A 5ENUA 2HRAA 3CMIA 3ISOA 4G10A 2VM1A 4TXOA 3K8NA 1A8YA 4IVFA 4KSOA 1TKDB 1THOA 1G0TA 1K3YA 3GYKA 4RQRA 2CX3A 2GSSA 4F9ZA 4MF5A 1QMVA 1K3LA 2H76A 1XW6A 3IRAA 1JZDA 1EOHA 1X5DA 4DSRA 2H0IA 1VGLA 5G5FA 1QK8A 1BQ7A 4K5RA 1XWAA 4L0WA 2NBSA 10GSA 2V6OA 3UJ1A 3ZFBA 2FHEA 2O85A 1B9XC 3HY2A 4FH8A 1TK8B 3F6FA 3QDNA 3RBTA 3Q6OA 2E2MA 2EC4A 5DJLA 4IJ3A 1ZCPA 1T1VA 2OBIA 3QCPA 1YEXA 4HI7A 4GTUA 3VK9A 2IFQA 4POLA 1F2EA 2DC5A 1RW1A 5A4UA 4G0KA 2GS3A 1V98A 5F05A 4KF9A 2MMNA 3QPMA 2O8VB 2YANA 4N11A 3GIXA 5IMFA 4TR0A 3TKQA 5J5NA 2AB6A 7GSSA 4POMA 4ZL9A 3NZNA 5AISA 5ABRA 5KN3A 5CRGA 2DJ2A 3IBHA 5F07A 4OO4A 1VF1A 4X4JA 2VL2C 2A2RA 1TI3A 1TP9A 5DQYA 4RUVA 1THXA 1FOVA 4OWYA 3IE3A 3BOAA 2WB9A 2CAQA 5H5RA 2LJAA 3TOTA 1XOAA 1ON4A 2H6YA 1B8XA 2F9SA 3IXRA 3DXBA 4G0IA 1EZKA 4KUNA 4IKHA 2IN3A 5A4WA 4HU9A 1MEKA 4BA7A 2N5BA 4AF2A 4BVXB 5ID2B 4IP6A 3DVXA 3ZRDA 1I5GA 1EV4A 3EURA 5LCZA 4WR4A 1SL0B 1JHBA 2IPAA 3HZ4A 5D9TA 5E59A 2GQMA 5JCUA 1UC7A 6GSTA 2R0PA 1U88A 4HJ2A 4RQXA 4TXOB 2CX4A 1WPIA 2YWNA 1QXHA 1BX9A 1VRSD 1E6BA 4DEJA 4V1Ap 1GSSA 3HDCA 1V40A 5ECIB 5AIXA 1K0AA 4O5QA 3C71A 1X9MB 5D8IA 4FQUA 1OKTA 3UAPA 4PXOA 5G2ZA 3UBKA 2C3TA 4MABA 2GVPA 3F3RA 4Q5NA 1DUGA 4MF7A 3ZMKA 4X43A 3ZYWA 1XW9A 4NHWA 2IJYA 2FY6A 4NPBA 1BYEA 2KP2A 1ERWA 2C3QA 3MNGA 3U6VA 3UL3A 1XWCA 5B7CA 4EIQA 4Z2TA 2QC7A 5EPFA 3FR6A 3ME8A 1H75A 4MNNA 3EWLA 4J2FA 2H8LA 1Z5YE 2GGTA 4JR6A 1GTIA 5DCGA 5FT3A 1TRVA 2PVQA 5D9XA 2L6CA 4BWSA 2HRFA 1GNEA 3KP8A 4XIHA 2RUFA 3FY7A 1CQGA 3GA4A 1M2DA 4MJEA 4L5LA 4PQIA 2R5GA 5IOXA 1USBA 3BBYA 2M72A 4DVCA 3GHAA 5DQSA 3MSZA 3PR8A 1LBKA 5E4WA 2VLUA 5J4UA 2HRNA 3GL5A 3CSIA 5IOWA 3GKNA 2D2ZA 2ON7A 3F3QA 1A24A 2F3MA 3GSTA 2B5XA 2X99A 1FVJA 3O6TA 3RPPA 2FNOA 3TUEA 3L78A 2LKUA 3FEUA 4KDUA 2VUPA 1A0FA 5G1LA 2OE0A 3IR4A 1T00A 3TRPA 2ZCTA 2C4JA 4ZILA 5D9VA 5C00A 2OE3A 3TKSA 3HD5A 3QFBC 1F37A 2C1YA 4IN0A 4ML1A 2XBIA 4EL1A 2VCTA 2XBQA 4BWQA 4KNDA 2FWHA 4KAEA 5F8BA 4KCEA 1G6YA 2V32A 3RHBA 4CHSA 2QSIA 2VCQA 1XBSA 1Z7PA 4K6XA 4K9ZA 1A2JA 4MJCA 2TIRA 3H93A 2IL3A 2K6VA 4K7OA 4TR3A 2VO4A 5DJMA 2TRXA 1GP1A 2J9HA 1GUKA 4MH2A 3IOSA 2YJ7A 3CSJA 3QD9A 4E8HA 2F8FA 5KN2A 4YKGA 1BJXA 1EP7A 1GLPA 3VWXA 1SYXA 5FWGA 4NV2A 2KHPA 1O8XA 3D0ZA 1U3AA 2B5EA 2LNTA 3CYNA 1BEDA 2GSRA 4MLYA 1V9WA 2DJJA 3HZ8A 5ECRB 3A5WA 2R0GA 2VD1A 3IDVA 3UIWA 3HCZA 4PQHA 4EVMA 5HR3A 5H5SA 1AIUA 6GSXA 2B5YA 1WP0A 3GL3A 4WETA 5DBQA 1OE8A 4Z7XA 4K2DA 2VAFA 3QOUA 3D4TA 2L6DA 4FYBA 4ZBBA 3ZLPA 4ICYA 2HSMA 2KP1A 3RAZA 3GMFA 4WKWA 4O5UA 2X4AA 3ZFLA 2DBCA 2VCWA 1YKAA 13GSA 2AAWA 2BTOT 3W8SA 2X8HA 2YCDA 2YV7A 4NMUA 3P90A 1SK1A 3CRTA 4YAVA 1T4YA 5ECOB 3PINA 2LJKA 4ECIA 3KGKA 2FLSA 5CRDA 2CAIA 5HR1A 5ECLB 3HA9A 2WCIA 2VL2A 8GSSA 3HJOA 1YKCA 4K1FA 5ECNB 2P5RA 4WBRD 2B6MA 2A4HA 2RLIA 3WGEA 3LW9A 5F0GA 4YQMA 5GAND 4F0CA 2HI7A 5GZZB 3L9SA 5DCHA 1LJRA 2OKAA 2PWJA 4YQVA 3APQA 3BCKA 2F8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPB A;  3GUR A;  1XWG A;  1W4V A;  1TTZ A;  2CVK A;  1WIK A;  3GNJ A;  1PGT A;  4O7H A;  1K0O A;  5D93 A;  1ZGN A;  3BD2 A;  3C1R A;  4POB A;  2LRT A;  2DMM A;  2WGR A;  2VLV A;  3C73 A;  3DVW A;  4POK A;  5COH A;  4L5O A;  1GSD A;  3EIN A;  5B8B A;  2VLT A;  5ID2 A;  2C0F A;  2R37 A;  1SKS B;  2DML A;  4IBP A;  4IP1 A;  4IW9 A;  2Z9S A;  4NWY A;  5CO3 A;  2H01 A;  2KOK A;  3VFI A;  4ECB A;  2B7J A;  6GSW A;  4Q5Q A;  2NVL A;  3E3E A;  3IAS 2;  2YV9 A;  1R4W A;  3Q19 A;  2CZ2 A;  2VD0 A;  3TKP A;  3W6G A;  2IMD A;  4HEA 2;  2WZ9 A;  3DRN A;  2V2G A;  3H4K A;  4MZB A;  2I9H A;  5G1K A;  3A2V A;  1F3A A;  4IHU A;  1ERV A;  3KTL A;  3RDW A;  3IAM 2;  2REM A;  4X1U A;  2H75 A;  4MH3 A;  1ZYE A;  2P5Q A;  1F9M A;  1DBY A;  4PUR A;  17GS A;  4ZB6 A;  3ERG A;  4MJB A;  4OO5 A;  1DE1 A;  1GWC A;  1TU7 A;  3VI5 A;  4KDY A;  3GV1 A;  22GS A;  3QAW A;  4MCU A;  5EVO A;  4YQU A;  1Y25 A;  5JWQ B;  3LWA A;  2YP6 A;  3C1S A;  3PGT A;  4X0X A;  3FRC A;  2IMF A;  1O85 A;  2I1U A;  9GSS A;  2LV3 A;  1Z6M A;  4LL4 B;  1TRS A;  2VCZ A;  3HVX A;  1U3I A;  4GST A;  2L59 A;  2H6Z A;  2ES7 A;  3GFK A;  2X8G A;  3DML A;  3WT1 A;  2AUV A;  3GKX A;  1F6M C;  4OMV A;  2RUE A;  2OE1 A;  4WR5 A;  3BCI A;  1S3D A;  3FR3 A;  5IMZ A;  3TJB A;  4RI6 A;  1PX7 A;  3CTG A;  2V41 A;  3QR6 A;  2LJR A;  2MZC A;  2F51 A;  2VIM A;  2GSQ A;  3U5R E;  1MD3 A;  1K0N A;  2MBS A;  4CDO A;  1ST9 A;  5JCW A;  1TJD A;  2FA4 A;  3IC4 A;  3J7Y k;  3HYP A;  4ISD A;  4QL7 A;  1ZYQ B;  3HVV A;  14GS A;  1PQN A;  2C8U A;  2HXK A;  1EEM A;  2HYX A;  3EC3 A;  1J08 A;  2XC2 A;  2YZU A;  3Q74 A;  1GSF A;  4NV5 A;  3GKK A;  2YWI A;  3G7I A;  2ZNM A;  1GSU A;  2H71 A;  4GF0 A;  5J9C A;  1M9A A;  2LQQ A;  4JU5 A;  1EEJ A;  3KM6 A;  1HNC A;  3D22 A;  3FZ4 A;  1W89 A;  5DAL A;  4K7N A;  1O7U A;  1T3B A;  4TR1 A;  3US3 A;  3ERW A;  4K8M A;  5CRW A;  1VF2 A;  1B4P A;  3NIV A;  3UVH A;  2I4A A;  4L0U A;  4NAX A;  1GSY A;  2GZY A;  3A3T A;  4PUA A;  3DIE A;  2I81 A;  2H1B A;  1Q4J A;  4L8E A;  3L9U A;  4QQ7 A;  1GLQ A;  3ZIT A;  4ID0 A;  2OAD A;  2O89 A;  1XVW A;  3TRX A;  4TOP A;  1A23 A;  1MDK A;  18GS A;  2CVD A;  4XHM A;  1MDI A;  2MMO A;  2WFC A;  4HS1 A;  5JWO B;  3D4M A;  2JSY A;  1PN9 A;  4MPG A;  5B6M A;  1FW1 A;  5GAP D;  4OCE A;  4V2M A;  3APS A;  1T4Z A;  5G30 A;  3W8J A;  1AQW A;  2JZS A;  20GS A;  2C80 A;  4I6X A;  4MP4 A;  2JZR A;  5G5E A;  11GS A;  1FO5 A;  1SJ6 A;  1ZMA A;  2H0G A;  5AN1 A;  3EU3 A;  3G9B A;  2MYG A;  3FK8 A;  2EIR A;  1RQM A;  1OE7 A;  1ZOF A;  4FO5 A;  1AQV A;  5LD0 A;  2HLS A;  3VI7 A;  5A4V A;  1GSQ A;  1AC1 A;  1OVN A;  3DYR A;  4MDC A;  5KEJ A;  1OKD A;  2R2J A;  1X5C A;  1SJZ A;  3D5J A;  3FZ9 A;  3IA1 A;  3KIJ A;  4Q5R A;  1ACV A;  3IHQ A;  2DIY A;  1PX6 A;  2L57 A;  2VOC A;  3KCM A;  4XRD A;  2R4V A;  2XPE A;  1TDI A;  4XTS A;  3VLN A;  4I2T A;  3I43 A;  3KMN A;  4XCS A;  5ECP B;  1G7O A;  4ZBD A;  2L4C A;  1X0R A;  2WRT A;  1TXX A;  3M1G A;  2CQ9 A;  2VCV A;  3A2X A;  5IM9 A;  4HQZ A;  1K0C A;  1HNA A;  2YWO A;  3GTU B;  1Z7R A;  2I3Y A;  3LYK A;  2GQL A;  1SJI A;  3TJK A;  2WDU A;  4WBJ A;  5G31 A;  1Z9H A;  2JSZ A;  2YOI A;  1SYR A;  2JU5 A;  5DAL B;  19GS A;  4KDX A;  2CZ3 A;  2V1M A;  2VM2 A;  2H6X A;  3NOF A;  4TR1 B;  4HZ4 A;  5JCG A;  2HSY A;  5DDL A;  6GSY A;  1F3B A;  4I8B A;  3G7Y A;  2CA8 A;  2R3X A;  1X5E A;  1FAA A;  2PER A;  3QFA C;  1G6W A;  4DSS B;  3F6D A;  1M7T A;  4O32 A;  2JAD A;  1YQ1 A;  4BL7 A;  2JZT A;  1MDJ A;  3GRX A;  4WF4 A;  2FWE A;  4ULX A;  2HFD A;  1K3O A;  2H30 A;  4JR4 A;  1TW9 A;  3GKM A;  3LGC A;  4IEL A;  4V2L A;  3EU4 A;  2A4V A;  4HDE A;  3VPT A;  3M3M A;  3AY8 A;  2DLX A;  2AYT A;  2M80 A;  3ZVJ A;  2OA7 A;  4AJ8 A;  4RI7 A;  5D96 A;  2H19 A;  5DAK B;  4K7I A;  3J7Y b;  5JWR B;  4GCI A;  3N9J A;  1K0M A;  4KW6 A;  3LG6 A;  5CP1 A;  1O81 A;  4HU7 A;  1V58 A;  5CNW A;  3QAV A;  1Y6E A;  4NHZ A;  4TW5 A;  1DSB A;  2CV4 A;  4ZB8 A;  1A2L A;  5HFI A;  3KP9 A;  3TKS E;  1J9B A;  2LRN A;  4OCF A;  3QMX A;  4XS1 A;  1XWK A;  3MWH A;  4G19 A;  4IS0 A;  1YJ6 A;  3EE2 A;  2ON5 A;  2LTK A;  3A2W A;  2H1G A;  4N0V A;  1OC9 B;  1TI1 A;  1T7P B;  2BJX A;  1XZO A;  3I6A A;  4MF6 A;  2X8C A;  1C72 A;  4HUA A;  1XCC A;  4ZXG A;  1H4O A;  1XIY A;  4OFT A;  5B8A A;  5D73 A;  5IO0 A;  3ED3 A;  3IK9 A;  4HQS A;  2YWM A;  1N2A A;  2FCH A;  3LEF A;  3IK7 A;  4O92 A;  4TXV A;  4KGI A;  2AJQ B;  1MTC A;  5L71 A;  1SK2 A;  2E7P A;  4IQ1 A;  1SL1 B;  3SWL A;  2LUS A;  4MJA A;  5AIV A;  2K8V A;  1R26 A;  3UVT A;  1GUL A;  1MD4 A;  1N8J A;  1OAZ A;  1EWX A;  1ZL9 A;  3VWU A;  6GSV A;  2DJK A;  1JLV A;  2H1A A;  4LLR A;  4LMW A;  4TVE A;  1TOF A;  3TDG A;  2N5F A;  1GSE A;  3Q18 A;  3KZQ A;  2H74 A;  5ELA A;  4MZW A;  1QQ2 A;  3CBU A;  4D73 B;  5IMA A;  4MZC A;  4TR4 A;  3IPZ A;  2GDR A;  4BPY A;  5KN0 A;  2PVO C;  3TCO A;  3F9U A;  1SU9 A;  4FYC A;  2O87 A;  1ILO A;  1YDK A;  4J56 E;  1QUW A;  2LNS A;  2HT9 A;  3FZ5 A;  3TB2 A;  3FYG A;  1SL2 B;  4GQF A;  1QGV A;  3N5O A;  3UMA A;  1XW5 A;  1K0D A;  1XOB A;  4GSS A;  2MMA A;  2CVB A;  1PRX A;  5DVB A;  2R6K A;  2QGV A;  3GUS A;  1A8L A;  3M9J A;  5FHI A;  2GST A;  4F82 A;  3O3T A;  1XFL A;  4TKY A;  3ZZX A;  3E0U A;  3TKS C;  1KTE A;  2P31 A;  4JE1 A;  1JZO A;  1JLW A;  3EMP A;  3QAG A;  3ZIV A;  3F4T A;  1WMJ A;  4I97 A;  5GST A;  4PNF A;  4XS6 A;  2EIO A;  2KLX A;  4K0N A;  3C8E A;  2PN8 A;  1Z6N A;  5F06 A;  3P2A A;  5D9W A;  2OAC A;  4WEY A;  3TOU A;  1PL1 A;  3TRQ A;  1AQX A;  4WXT A;  1XPV A;  5HQP A;  3ZL5 A;  2DIZ A;  2H72 A;  2L4Q A;  4XS4 B;  1ZZY A;  4IGJ A;  1KBN A;  1GH2 A;  1GL8 A;  3H79 A;  1TK0 B;  2HSH A;  3TJG A;  1S3C A;  1HQO A;  5ECH B;  4EE0 A;  3LJR A;  1HNB A;  2XHF A;  4OFM A;  1WWJ A;  4HOJ A;  3H8Q A;  2GLR A;  4GRF A;  3I69 A;  2B1L A;  1URM A;  4HZ2 A;  2LST A;  4J57 E;  5ECM B;  1FB6 A;  2AV4 A;  4JED A;  5C04 A;  1FG4 A;  3DD3 A;  3GX0 A;  1GNW A;  4BVY A;  3WT2 A;  5IO2 A;  3ZRE A;  3VWV A;  3GSS A;  1HD2 A;  3FR9 A;  2B1K A;  1M9B A;  1OYJ A;  3TJF A;  3P8W A;  2IMK A;  4IJI A;  1ERT A;  1O6J A;  1X9W B;  3D21 A;  2LRC A;  2FD3 A;  1GUM A;  4TRX A;  1PMT A;  1HYU A;  3F4S A;  1GRX A;  4MA9 A;  4JZQ A;  2VL9 A;  1QFN A;  4N10 A;  4LA1 A;  3DEX A;  4DSQ A;  3G7J A;  4XRA A;  1Z3E A;  3GN3 A;  2HZE B;  3KH7 A;  5IIZ A;  2B7K A;  3MAK A;  1CQH A;  3HVS A;  1WJK A;  4NXI A;  1FVK A;  2WUL A;  3FHK A;  3F8U A;  3LQ7 A;  4AJ6 A;  3GTU A;  1SKW B;  4PGT A;  4KX4 A;  4ACS A;  4LL1 B;  1YZX A;  1PD2 1;  1E2Y A;  2OBK A;  4JRR A;  2LEG A;  1RK4 A;  6GSS A;  3M8N A;  1UVZ A;  1O73 A;  2FWG A;  3TKR A;  3DKS A;  1OC8 A;  2FGX A;  1ERU A;  2GT5 A;  2L5O A;  5EY6 A;  2B3S A;  2J23 A;  6GSU A;  4DSS A;  4OD7 A;  1PA3 A;  4ZL8 A;  2OJL A;  5ECS A;  1M2B A;  4ECJ A;  1SD9 A;  4FIW A;  2KUC A;  3DGQ A;  2GTU A;  3ZVJ D;  3KEB A;  2AHE A;  1JZW A;  2C0E A;  4G9H A;  2C0G A;  4KSM A;  4AGS A;  4GSN A;  2PUK C;  2X64 A;  4EUY A;  4F2I A;  5CRE A;  3CXG A;  3P7X A;  1R5P A;  4QL9 A;  3KXO A;  3CSH A;  1Q98 A;  1B48 A;  2WS2 A;  1IYH A;  2ZUP A;  2IME A;  1G7E A;  4K0G A;  1WE0 A;  3IV4 A;  3I9V 2;  1WRY A;  2HNL A;  3L9V A;  5KN1 A;  5DAK A;  5IMV A;  4MMM A;  4N30 A;  2TRC P;  4GWR A;  3ME7 A;  3JCM L;  2E2G A;  4KA0 A;  2NDO A;  2M46 A;  4ZIJ A;  5J9B A;  5J3R A;  2H70 A;  3VPQ A;  5IQY A;  2PU9 C;  4CW9 A;  3KH9 A;  2E0Q A;  1LU4 A;  1M99 A;  3UAR A;  5LNK e;  2DJ0 A;  4EF0 A;  4KH7 A;  1U6T A;  1PKW A;  4EKZ A;  1BG5 A;  1UN2 A;  2JAC A;  3EMX A;  2VL3 A;  2O7K A;  1AUC A;  3PH9 A;  2N5A A;  1YY7 A;  1NM3 A;  2H73 A;  2HE3 A;  3UEM A;  1OC9 A;  16GS A;  4ILF A;  4GQC A;  2HZF A;  4ZB9 A;  5ECQ B;  1X9S B;  5HFG A;  2IFQ B;  1R5A A;  5CYY A;  1WOU A;  1B9Y C;  4LMV A;  5ECK B;  2C3N A;  1OC3 A;  1NSW A;  3HXS A;  5J41 A;  4FYU A;  2DSA A;  1EGO A;  4AJ7 A;  3FW2 A;  3GX8 A;  3MDK A;  4V2N A;  2BMX A;  1XXU A;  3CRU A;  3LXT A;  4IQA A;  3F0I A;  12GS A;  1M0U A;  2VCX A;  3EYT A;  3KJY A;  3CTF A;  1JZR A;  1TK5 B;  1ABA A;  2YN1 A;  3R2Q A;  4PNG A;  1SEN A;  4D73 A;  2FUG 2;  4I2U A;  3KD0 A;  3O76 A;  2YZH A;  1BAY A;  3ZTL A;  1S3A A;  2ALB A;  1NHO A;  1AW9 A;  1O8W A;  1TRW A;  3HJM A;  2V6K A;  5AGY A;  3F4R A;  2GZZ A;  4ML6 A;  5EL8 A;  3D6I A;  4ECC A;  1A2M A;  1YF1 A;  2PGT A;  1V57 A;  1YEP A;  3L4N A;  2P0G A;  1V2A A;  2YPM A;  3ZML A;  4WF5 A;  2YJH A;  4GLT A;  2XPD A;  4JBB A;  1J0F A;  4KB3 A;  1T8E B;  1XWB A;  5H5Q A;  2RII A;  2IWT A;  3KTB A;  1SD8 A;  4H86 A;  3TGZ A;  3WGD A;  3VWW A;  4EXJ A;  3GH6 A;  4HJM A;  3DWV A;  5HR0 A;  2C0D A;  3L0H A;  4MK3 A;  2EIQ A;  4EDY A;  1ML6 A;  2G2Q A;  2H1D A;  4KE3 A;  2H66 A;  3HHV A;  1GTB A;  2FA8 A;  5HR2 A;  2L5L A;  3LSZ A;  2DJ3 A;  1B4Q A;  5A5K A;  1NHY A;  2GT6 A;  4EC0 A;  4XS4 A;  1TU8 A;  4PX1 A;  4MPF A;  1DE2 A;  2GQK A;  2JL4 A;  2PMT A;  3F63 A;  1AAZ A;  5CRH A;  3FKF A;  4OFN A;  3H1N A;  3V1W A;  1FHE A;  3OR5 A;  3EVI A;  4I5Q A;  1SK0 A;  3WGX A;  4EDZ A;  3ERF A;  1U87 A;  1M2A A;  3GH9 A;  4F03 A;  5IMD A;  1K0B A;  1R7H A;  4N0Z A;  2K18 A;  3HJP A;  3WYW A;  1YF0 A;  3HKR A;  1FB0 A;  3LYP A;  3LFL A;  1GTU A;  2NTO A;  3UBL A;  3VUR A;  5B6N A;  3M0F A;  4V1A g;  2K8S A;  1KNG A;  3FZA A;  3APO A;  1UA5 A;  3C7M A;  5IPH A;  2YNX A;  5IMC A;  3WD6 A;  4YH2 A;  1IYI A;  5GSS A;  4GXZ A;  3ZIJ A;  2H0H A;  4EO3 A;  1SKR B;  3SBC A;  3LOR A;  4YAP A;  4ZL7 A;  4TN8 A;  3UOM A;  1PSQ A;  2K9F A;  1NW2 A;  2RM5 A;  4F0B A;  2A2S A;  2HZE A;  3S9F A;  2FWF A;  4ZBA A;  3BJ5 A;  4G2E A;  3LXZ A;  5IPG A;  2GZP A;  1JFU A;  1EP8 A;  3RHC A;  2LQO A;  4Q5F A;  3M9K A;  4E8E A;  2IIY A;  2MBT A;  2QKE A;  1GTA A;  4PUF C;  2LS5 A;  2WJU A;  5HFK A;  3RPN A;  2IMI A;  1EV9 A;  1XVQ A;  3E9J B;  2CT6 A;  1AXD A;  3KMO A;  5ELG A;  1PKZ A;  1EGR A;  2RM6 A;  3TJJ A;  2G0F A;  1GUH A;  4P3Y B;  4KCA A;  1VF4 A;  2PPT A;  4PQ1 A;  2PBJ A;  4BVX A;  1I9D A;  1PL2 A;  1A0R P;  1TRU A;  1EOG A;  5INY A;  4O5R A;  2MMZ A;  1KEB A;  2DJ1 A;  5CAX A;  1VF3 A;  5ENU A;  3CMI A;  3ISO A;  4G10 A;  2VM1 A;  4TXO A;  3K8N A;  1A8Y A;  4IVF A;  4KSO A;  1TKD B;  1THO A;  1G0T A;  1K3Y A;  3GYK A;  4RQR A;  2CX3 A;  2GSS A;  4F9Z A;  4MF5 A;  1QMV A;  1K3L A;  2H76 A;  1XW6 A;  3IRA A;  1JZD A;  1EOH A;  1X5D A;  4DSR A;  2H0I A;  1VGL A;  5G5F A;  1QK8 A;  1BQ7 A;  1XWA A;  4L0W A;  2NBS A;  10GS A;  2V6O A;  3UJ1 A;  3ZFB A;  2FHE A;  2O85 A;  1B9X C;  3HY2 A;  4FH8 A;  1TK8 B;  3F6F A;  3QDN A;  3RBT A;  3Q6O A;  2E2M A;  2EC4 A;  5DJL A;  4IJ3 A;  1ZCP A;  1T1V A;  2OBI A;  3QCP A;  1YEX A;  4HI7 A;  4GTU A;  3VK9 A;  2IFQ A;  4POL A;  1F2E A;  2DC5 A;  1RW1 A;  5A4U A;  2GS3 A;  1V98 A;  5F05 A;  2MMN A;  3QPM A;  2O8V B;  2YAN A;  4N11 A;  3GIX A;  5IMF A;  4TR0 A;  3TKQ A;  5J5N A;  2AB6 A;  7GSS A;  4POM A;  4ZL9 A;  3NZN A;  5AIS A;  5ABR A;  5KN3 A;  5CRG A;  2DJ2 A;  3IBH A;  5F07 A;  4OO4 A;  1VF1 A;  2VL2 C;  2A2R A;  1TI3 A;  1TP9 A;  5DQY A;  4RUV A;  1THX A;  1FOV A;  4OWY A;  3IE3 A;  3BOA A;  2WB9 A;  2CAQ A;  5H5R A;  2LJA A;  3TOT A;  1XOA A;  1ON4 A;  2H6Y A;  1B8X A;  2F9S A;  3IXR A;  3DXB A;  1EZK A;  4KUN A;  4IKH A;  2IN3 A;  5A4W A;  4HU9 A;  1MEK A;  4BA7 A;  2N5B A;  4AF2 A;  5ID2 B;  4IP6 A;  3DVX A;  3ZRD A;  1I5G A;  1EV4 A;  3EUR A;  5LCZ A;  4WR4 A;  1SL0 B;  1JHB A;  2IPA A;  3HZ4 A;  5D9T A;  5E59 A;  2GQM A;  5JCU A;  1UC7 A;  6GST A;  1U88 A;  4HJ2 A;  4RQX A;  4TXO B;  2CX4 A;  1WPI A;  2YWN A;  1QXH A;  1BX9 A;  1VRS D;  1E6B A;  4DEJ A;  4V1A p;  1GSS A;  3HDC A;  1V40 A;  5ECI B;  5AIX A;  1K0A A;  3C71 A;  1X9M B;  5D8I A;  1OKT A;  3UAP A;  4PXO A;  5G2Z A;  3UBK A;  2C3T A;  4MAB A;  2GVP A;  3F3R A;  4Q5N A;  1DUG A;  4MF7 A;  3ZMK A;  4X43 A;  3ZYW A;  1XW9 A;  4NHW A;  2IJY A;  2FY6 A;  4NPB A;  1BYE A;  2KP2 A;  1ERW A;  2C3Q A;  3MNG A;  3U6V A;  3UL3 A;  1XWC A;  5B7C A;  2QC7 A;  5EPF A;  3FR6 A;  3ME8 A;  1H75 A;  3EWL A;  4J2F A;  2H8L A;  1Z5Y E;  2GGT A;  4JR6 A;  1GTI A;  5DCG A;  5FT3 A;  1TRV A;  2PVQ A;  5D9X A;  2L6C A;  4BWS A;  2HRF A;  1GNE A;  3KP8 A;  4XIH A;  2RUF A;  3FY7 A;  1CQG A;  3GA4 A;  1M2D A;  4MJE A;  4L5L A;  4PQI A;  2R5G A;  5IOX A;  1USB A;  3BBY A;  2M72 A;  4DVC A;  3GHA A;  5DQS A;  3MSZ A;  3PR8 A;  1LBK A;  5E4W A;  2VLU A;  5J4U A;  2HRN A;  3GL5 A;  3CSI A;  5IOW A;  3GKN A;  2D2Z A;  2ON7 A;  3F3Q A;  1A24 A;  2F3M A;  3GST A;  2B5X A;  2X99 A;  1FVJ A;  3O6T A;  3RPP A;  2FNO A;  3TUE A;  3L78 A;  2LKU A;  3FEU A;  4KDU A;  2VUP A;  1A0F A;  5G1L A;  2OE0 A;  3IR4 A;  1T00 A;  3TRP A;  2ZCT A;  2C4J A;  4ZIL A;  5D9V A;  5C00 A;  2OE3 A;  3TKS A;  3HD5 A;  3QFB C;  1F37 A;  2C1Y A;  4IN0 A;  4ML1 A;  2XBI A;  4EL1 A;  2VCT A;  2XBQ A;  4BWQ A;  4KND A;  2FWH A;  4KAE A;  5F8B A;  4KCE A;  1G6Y A;  2V32 A;  3RHB A;  4CHS A;  2QSI A;  2VCQ A;  1XBS A;  1Z7P A;  4K6X A;  4K9Z A;  1A2J A;  4MJC A;  2TIR A;  3H93 A;  2IL3 A;  2K6V A;  4K7O A;  4TR3 A;  2VO4 A;  5DJM A;  2TRX A;  1GP1 A;  2J9H A;  1GUK A;  4MH2 A;  3IOS A;  2YJ7 A;  3CSJ A;  3QD9 A;  4E8H A;  2F8F A;  5KN2 A;  1BJX A;  1EP7 A;  1GLP A;  3VWX A;  1SYX A;  5FWG A;  4NV2 A;  2KHP A;  1O8X A;  3D0Z A;  1U3A A;  2B5E A;  2LNT A;  3CYN A;  1BED A;  2GSR A;  4MLY A;  1V9W A;  2DJJ A;  3HZ8 A;  5ECR B;  3A5W A;  2VD1 A;  3IDV A;  3UIW A;  3HCZ A;  4PQH A;  4EVM A;  5HR3 A;  5H5S A;  1AIU A;  6GSX A;  2B5Y A;  1WP0 A;  3GL3 A;  4WET A;  5DBQ A;  1OE8 A;  4Z7X A;  4K2D A;  2VAF A;  3QOU A;  3D4T A;  2L6D A;  4FYB A;  4ZBB A;  3ZLP A;  2KP1 A;  3RAZ A;  3GMF A;  4WKW A;  3ZFL A;  2DBC A;  2VCW A;  1YKA A;  13GS A;  2AAW A;  2BTO T;  3W8S A;  2X8H A;  2YCD A;  2YV7 A;  4NMU A;  3P90 A;  1SK1 A;  5ECO B;  4YAV A;  3CRT A;  1T4Y A;  3PIN A;  2LJK A;  4ECI A;  3KGK A;  2FLS A;  5CRD A;  2CAI A;  5HR1 A;  5ECL B;  3HA9 A;  2WCI A;  2VL2 A;  8GSS A;  3HJO A;  1YKC A;  4K1F A;  5ECN B;  2P5R A;  4WBR D;  2B6M A;  2RLI A;  3WGE A;  5F0G A;  4YQM A;  5GAN D;  4F0C A;  2HI7 A;  5GZZ B;  3L9S A;  5DCH A;  1LJR A;  2OKA A;  2PWJ A;  4YQV A;  3APQ A;  3BCK A;  2F8A A; 
#chains in the Genus database with same CATH topology
 2NPB A;  3GUR A;  1XWG A;  1W4V A;  1TTZ A;  2CVK A;  1WIK A;  3GNJ A;  1PGT A;  4O7H A;  1K0O A;  5D93 A;  1ZGN A;  3BD2 A;  3C1R A;  4POB A;  2LRT A;  2DMM A;  3FMW A;  2WGR A;  2VLV A;  3C73 A;  3DVW A;  4POK A;  5COH A;  4L5O A;  1GSD A;  3EIN A;  5B8B A;  2VLT A;  5ID2 A;  4Z2U A;  2C0F A;  2R37 A;  1SKS B;  4HSC X;  2DML A;  4IBP A;  4IP1 A;  4IW9 A;  2Z9S A;  4BL7 B;  3IHG A;  4NWY A;  5CO3 A;  2H01 A;  2KOK A;  3VFI A;  4ECB A;  2B7J A;  6GSW A;  4Q5Q A;  2NVL A;  3E3E A;  3IAS 2;  2YV9 A;  1R4W A;  3Q19 A;  2CZ2 A;  2VD0 A;  3TKP A;  3W6G A;  2IMD A;  4HEA 2;  2WZ9 A;  3DRN A;  2V2G A;  3H4K A;  4MZB A;  2I9H A;  5KOX A;  5G1K A;  3A2V A;  1F3A A;  4IHU A;  1ERV A;  3KTL A;  3RDW A;  3IAM 2;  2REM A;  4X1U A;  5KOW A;  2H75 A;  4MH3 A;  1ZYE A;  2P5Q A;  1F9M A;  1DBY A;  4PUR A;  17GS A;  4ZB6 A;  3ERG A;  4MJB A;  4OO5 A;  1DE1 A;  1GWC A;  1TU7 A;  3VI5 A;  4KDY A;  3GV1 A;  22GS A;  3QAW A;  4MCU A;  5EVO A;  4YQU A;  1Y25 A;  5JWQ B;  3LWA A;  2YP6 A;  3C1S A;  3PGT A;  4X0X A;  3FRC A;  2IMF A;  1O85 A;  2I1U A;  9GSS A;  2LV3 A;  1Z6M A;  4LL4 B;  1TRS A;  2VCZ A;  3HVX A;  1U3I A;  4GST A;  2L59 A;  2H6Z A;  2ES7 A;  3GFK A;  2X8G A;  3DML A;  3WT1 A;  2AUV A;  3GKX A;  1F6M C;  4OMV A;  2RUE A;  2OE1 A;  4WR5 A;  3BCI A;  1S3D A;  3FR3 A;  5IMZ A;  3TJB A;  4RI6 A;  1PX7 A;  3CTG A;  2V41 A;  3QR6 A;  2LJR A;  2MZC A;  2F51 A;  2VIM A;  2GSQ A;  3U5R E;  1MD3 A;  1K0N A;  2MBS A;  4CDO A;  1ST9 A;  5JCW A;  1TJD A;  2FA4 A;  3IC4 A;  3J7Y k;  3IC8 A;  3HYP A;  4ISD A;  4QL7 A;  1ZYQ B;  3HVV A;  3A5I A;  14GS A;  1PQN A;  2C8U A;  2HXK A;  1EEM A;  2HYX A;  3EC3 A;  4CY8 A;  1J08 A;  2XC2 A;  4K5S A;  2YZU A;  3Q74 A;  1GSF A;  4NV5 A;  3GKK A;  2YWI A;  3G7I A;  2ZNM A;  1GSU A;  2H71 A;  4GF0 A;  5J9C A;  2DKI A;  1M9A A;  2LQQ A;  4JU5 A;  1EEJ A;  3KM6 A;  1HNC A;  3D22 A;  3FZ4 A;  1W89 A;  5DAL A;  4K7N A;  1O7U A;  1T3B A;  4TR1 A;  3US3 A;  3ERW A;  4K8M A;  5CRW A;  1VF2 A;  1B4P A;  3NIV A;  3UVH A;  2I4A A;  4L0U A;  4NAX A;  1GSY A;  2GZY A;  3A3T A;  4PUA A;  3DIE A;  2I81 A;  2H1B A;  1Q4J A;  4L8E A;  3L9U A;  4QQ7 A;  1GLQ A;  1XG8 A;  3ZIT A;  4ID0 A;  2OAD A;  2O89 A;  1XVW A;  3TRX A;  4TOP A;  1A23 A;  1MDK A;  18GS A;  2CVD A;  4XHM A;  1MDI A;  2MMO A;  2WFC A;  4HS1 A;  5JWO B;  3D4M A;  2JSY A;  1PN9 A;  4MPG A;  5B6M A;  1FW1 A;  5GAP D;  4OCE A;  4V2M A;  3APS A;  1T4Z A;  5G30 A;  3W8J A;  1AQW A;  2JZS A;  20GS A;  2C80 A;  4I6X A;  4MP4 A;  2JZR A;  4K2X A;  5G5E A;  11GS A;  1FO5 A;  1SJ6 A;  1ZMA A;  2H0G A;  5AN1 A;  3EU3 A;  3G9B A;  2MYG A;  3FK8 A;  2EIR A;  1RQM A;  1OE7 A;  1ZOF A;  4FO5 A;  1AQV A;  5LD0 A;  2HLS A;  3VI7 A;  5A4V A;  1GSQ A;  1AC1 A;  3PPU A;  1OVN A;  3DYR A;  4MDC A;  5KEJ A;  1OKD A;  2R2J A;  1X5C A;  1SJZ A;  3D5J A;  3FZ9 A;  3IA1 A;  3KIJ A;  4Q5R A;  1ACV A;  3IHQ A;  2DIY A;  1PX6 A;  2L57 A;  2VOC A;  3KCM A;  4XRD A;  2R4V A;  2XPE A;  1TDI A;  4XTS A;  3VLN A;  4I2T A;  3I43 A;  3KMN A;  4XCS A;  5ECP B;  1G7O A;  4ZBD A;  2L4C A;  1X0R A;  2WRT A;  1TXX A;  4BIK A;  3M1G A;  2CQ9 A;  2VCV A;  3A2X A;  5IM9 A;  4HQZ A;  1K0C A;  1HNA A;  2YWO A;  3GTU B;  1Z7R A;  2I3Y A;  3LYK A;  1PFO A;  2GQL A;  1SJI A;  3TJK A;  2WDU A;  4WBJ A;  5G31 A;  1Z9H A;  2JSZ A;  2YOI A;  1SYR A;  2JU5 A;  2V1M A;  19GS A;  4KDX A;  2CZ3 A;  2VM2 A;  3NOF A;  2H6X A;  5DAL B;  4TR1 B;  4HZ4 A;  5JCG A;  2HSY A;  5DDL A;  4Z2R A;  6GSY A;  1F3B A;  4I8B A;  3G7Y A;  2CA8 A;  2R3X A;  1X5E A;  1FAA A;  2PER A;  3QFA C;  1G6W A;  4DSS B;  3F6D A;  1M7T A;  2R0C A;  4O32 A;  2JAD A;  1YQ1 A;  4BL7 A;  2JZT A;  1MDJ A;  3GRX A;  2QA2 A;  4WF4 A;  2FWE A;  4ULX A;  2HFD A;  1K3O A;  2H30 A;  4JR4 A;  1TW9 A;  3GKM A;  3LGC A;  4IEL A;  4V2L A;  3EU4 A;  2A4V A;  4HDE A;  3VPT A;  3M3M A;  5BRT A;  3AY8 A;  2DLX A;  1ZYP A;  2AYT A;  2M80 A;  3ZVJ A;  2OA7 A;  4AJ8 A;  4RI7 A;  5D96 A;  2H19 A;  5DAK B;  4K7I A;  3J7Y b;  5JWR B;  4GCI A;  3N9J A;  1K0M A;  4KW6 A;  3LG6 A;  5CP1 A;  1O81 A;  4HU7 A;  1V58 A;  5CNW A;  3QAV A;  1Y6E A;  4NHZ A;  4TW5 A;  1DSB A;  2CV4 A;  3EPT A;  4ZB8 A;  1A2L A;  5HFI A;  3KP9 A;  3TKS E;  1J9B A;  2LRN A;  4OCF A;  3QMX A;  4XS1 A;  1XWK A;  3MWH A;  4G19 A;  4IS0 A;  1YJ6 A;  3EE2 A;  2ON5 A;  2LTK A;  3A2W A;  2H1G A;  4N0V A;  1OC9 B;  1TI1 A;  1T7P B;  2BJX A;  1XZO A;  3I6A A;  4MF6 A;  2X8C A;  1C72 A;  4HUA A;  1XCC A;  4ZXG A;  1H4O A;  1XIY A;  4OFT A;  5B8A A;  2DKH A;  5D73 A;  5IO0 A;  3ED3 A;  3IK9 A;  4HQS A;  3R3E A;  2YWM A;  1N2A A;  2FCH A;  3LEF A;  3IK7 A;  4O92 A;  4TXV A;  4KGI A;  2AJQ B;  1MTC A;  5L71 A;  1SK2 A;  2E7P A;  4IQ1 A;  1SL1 B;  3SWL A;  2LUS A;  4MJA A;  5AIV A;  2K8V A;  1R26 A;  1FOH A;  1GUL A;  3UVT A;  1MD4 A;  1N8J A;  1OAZ A;  1EWX A;  1ZL9 A;  3VWU A;  6GSV A;  2DJK A;  1JLV A;  2H1A A;  4LLR A;  4LMW A;  4TVE A;  1TOF A;  3TDG A;  2N5F A;  1GSE A;  3Q18 A;  3KZQ A;  2H74 A;  5ELA A;  4MZW A;  1QQ2 A;  3CBU A;  4D73 B;  5IMA A;  4MZC A;  4TR4 A;  3IPZ A;  2GDR A;  4BPY A;  5KN0 A;  2PVO C;  3TCO A;  3F9U A;  1SU9 A;  4FYC A;  2O87 A;  1ILO A;  1YDK A;  4J56 E;  1QUW A;  2LNS A;  2HT9 A;  3FZ5 A;  3TB2 A;  3FYG A;  1SL2 B;  4GQF A;  1QGV A;  3N5O A;  3UMA A;  1XW5 A;  1K0D A;  1XOB A;  4GSS A;  2MMA A;  2CVB A;  1PRX A;  5DVB A;  2R6K A;  2QGV A;  3GUS A;  1A8L A;  3M9J A;  5FHI A;  2GST A;  4F82 A;  3O3T A;  1XFL A;  4TKY A;  3ZZX A;  3E0U A;  3TKS C;  1KTE A;  2P31 A;  4JE1 A;  1JZO A;  1JLW A;  3EMP A;  3QAG A;  3ZIV A;  3F4T A;  1WMJ A;  4I97 A;  5GST A;  4PNF A;  4XS6 A;  2EIO A;  2KLX A;  4K0N A;  3C8E A;  2PN8 A;  1Z6N A;  5F06 A;  1S3R A;  3P2A A;  5D9W A;  2OAC A;  4WEY A;  3TOU A;  1PL1 A;  3TRQ A;  1AQX A;  2X49 A;  4WXT A;  1XPV A;  5HQP A;  3ZL5 A;  2DIZ A;  2H72 A;  2L4Q A;  4XS4 B;  1ZZY A;  4IGJ A;  1KBN A;  1GH2 A;  1GL8 A;  3H79 A;  5BMU A;  1TK0 B;  2HSH A;  3TJG A;  1S3C A;  1HQO A;  5ECH B;  4EE0 A;  3LJR A;  1HNB A;  2XHF A;  4OFM A;  1WWJ A;  4HOJ A;  3H8Q A;  2GLR A;  4GRF A;  3I69 A;  2B1L A;  1URM A;  4HZ2 A;  2LST A;  4J57 E;  5ECM B;  1FB6 A;  2AV4 A;  4JED A;  5C04 A;  1FG4 A;  3DD3 A;  3GX0 A;  1GNW A;  4BVY A;  3WT2 A;  5IO2 A;  1ZYN A;  3ZRE A;  3VWV A;  3GSS A;  1HD2 A;  3FR9 A;  2B1K A;  1M9B A;  1OYJ A;  2QA1 A;  3TJF A;  3P8W A;  2IMK A;  4IJI A;  1ERT A;  1O6J A;  1X9W B;  3D21 A;  2LRC A;  2FD3 A;  1GUM A;  4TRX A;  1PMT A;  1HYU A;  3F4S A;  1GRX A;  4MA9 A;  4JZQ A;  2VL9 A;  1QFN A;  4N10 A;  4LA1 A;  3DEX A;  4DSQ A;  3G7J A;  4XRA A;  1Z3E A;  3GN3 A;  2HZE B;  3KH7 A;  5IIZ A;  2B7K A;  3MAK A;  1CQH A;  3HVS A;  1WJK A;  4NXI A;  1FVK A;  2WUL A;  3FHK A;  3F8U A;  3LQ7 A;  4AJ6 A;  3GTU A;  1SKW B;  4PGT A;  4KX4 A;  4ACS A;  3MYD A;  4LL1 B;  1YZX A;  1PD2 1;  1E2Y A;  2OBK A;  4JRR A;  2LEG A;  1RK4 A;  6GSS A;  3M8N A;  1UVZ A;  1O73 A;  4YKF A;  2FWG A;  3TKR A;  3DKS A;  1OC8 A;  2FGX A;  1ERU A;  2GT5 A;  2L5O A;  5EY6 A;  2B3S A;  2J23 A;  6GSU A;  4DSS A;  4OD7 A;  1PA3 A;  4ZL8 A;  2OJL A;  5ECS A;  1M2B A;  4ECJ A;  1SD9 A;  4PTS A;  4FIW A;  2KUC A;  3DGQ A;  2GTU A;  3ZVJ D;  3KEB A;  2AHE A;  1JZW A;  2C0E A;  4G9H A;  2C0G A;  4KSM A;  4AGS A;  4GSN A;  2PUK C;  2X64 A;  4EUY A;  4F2I A;  5CRE A;  3CXG A;  3P7X A;  4EIP A;  1R5P A;  4QL9 A;  3KXO A;  3CSH A;  1Q98 A;  1B48 A;  2WS2 A;  1IYH A;  2ZUP A;  2IME A;  1G7E A;  4K0G A;  1WE0 A;  3IV4 A;  3I9V 2;  1WRY A;  2HNL A;  3L9V A;  5KN1 A;  4A5P A;  5DAK A;  5IMV A;  4MMM A;  4N30 A;  2TRC P;  4GWR A;  3ME7 A;  3JCM L;  2E2G A;  4KA0 A;  2NDO A;  2M46 A;  4ZIJ A;  5J9B A;  5J3R A;  2H70 A;  3VPQ A;  5IQY A;  2PU9 C;  4CW9 A;  3KH9 A;  2E0Q A;  1LU4 A;  1M99 A;  3UAR A;  1M3I A;  5LNK e;  2DJ0 A;  4EF0 A;  4KH7 A;  1U6T A;  1PKW A;  4EKZ A;  4BVY B;  1BG5 A;  1UN2 A;  2JAC A;  3EMX A;  2VL3 A;  2O7K A;  1AUC A;  3PH9 A;  2N5A A;  1YY7 A;  1NM3 A;  2H73 A;  2HE3 A;  2A2P A;  1OC9 A;  3UEM A;  16GS A;  4ILF A;  4GQC A;  2HZF A;  4ZB9 A;  5ECQ B;  3MIX A;  1X9S B;  5HFG A;  2IFQ B;  1R5A A;  5CYY A;  1WOU A;  1B9Y C;  4LMV A;  5ECK B;  2C3N A;  1OC3 A;  1NSW A;  3HXS A;  5J41 A;  4FYU A;  2DSA A;  1EGO A;  4AJ7 A;  3FW2 A;  3GX8 A;  3MDK A;  4V2N A;  2BMX A;  1XXU A;  3CRU A;  3LXT A;  4IQA A;  3F0I A;  12GS A;  1M0U A;  2VCX A;  3EYT A;  3KJY A;  3CTF A;  1JZR A;  1TK5 B;  1ABA A;  2YN1 A;  3R2Q A;  4PNG A;  1SEN A;  4D73 A;  2FUG 2;  4I2U A;  3KD0 A;  3O76 A;  2YZH A;  1BAY A;  3ZTL A;  1S3A A;  2ALB A;  1NHO A;  1AW9 A;  1O8W A;  1TRW A;  3HJM A;  2V6K A;  5AGY A;  3F4R A;  2GZZ A;  4ML6 A;  5EL8 A;  3D6I A;  4ECC A;  1A2M A;  1YF1 A;  2PGT A;  2UZ8 A;  1V57 A;  1YEP A;  3L4N A;  2P0G A;  1V2A A;  2YPM A;  3ZML A;  4WF5 A;  3CQF A;  2YJH A;  4GLT A;  2XPD A;  4JBB A;  1J0F A;  4KB3 A;  1T8E B;  1XWB A;  5H5Q A;  2RII A;  2IWT A;  3KTB A;  1SD8 A;  4H86 A;  3TGZ A;  3WGD A;  3VWW A;  4EXJ A;  3GH6 A;  4HJM A;  3DWV A;  5HR0 A;  2C0D A;  3L0H A;  4MK3 A;  2EIQ A;  4EDY A;  1ML6 A;  2G2Q A;  2H1D A;  4KE3 A;  2H66 A;  3HHV A;  1GTB A;  2FA8 A;  5HR2 A;  2L5L A;  3LSZ A;  2DJ3 A;  1B4Q A;  5A5K A;  1NHY A;  2GT6 A;  4EC0 A;  4XS4 A;  1TU8 A;  4PX1 A;  4MPF A;  1DE2 A;  2GQK A;  2JL4 A;  2PMT A;  3F63 A;  1AAZ A;  5CRH A;  3FKF A;  4OFN A;  3H1N A;  3V1W A;  1FHE A;  3OR5 A;  3EVI A;  4I5Q A;  1SK0 A;  3WGX A;  4EDZ A;  3ERF A;  1U87 A;  1M2A A;  3GH9 A;  4F03 A;  5IMD A;  1K0B A;  1R7H A;  4N0Z A;  2K18 A;  3HJP A;  3WYW A;  1YF0 A;  4USS A;  3HKR A;  1FB0 A;  3LYP A;  4G0L A;  3LFL A;  1GTU A;  2NTO A;  3UBL A;  3VUR A;  5B6N A;  3M0F A;  4V1A g;  2K8S A;  1KNG A;  3FZA A;  3APO A;  1UA5 A;  3C7M A;  2HRK A;  5IPH A;  2YNX A;  5IMC A;  3WD6 A;  4YH2 A;  1IYI A;  5GSS A;  4GXZ A;  3ZIJ A;  2H0H A;  4EO3 A;  1SKR B;  3SBC A;  3LOR A;  4CY6 A;  4YAP A;  4ZL7 A;  4TN8 A;  3UOM A;  1PSQ A;  2K9F A;  1NW2 A;  2RM5 A;  4F0B A;  2A2S A;  2HZE A;  3S9F A;  2FWF A;  4ZBA A;  3BJ5 A;  4G2E A;  3LXZ A;  5IPG A;  2GZP A;  1JFU A;  1EP8 A;  3RHC A;  2LQO A;  4Q5F A;  3M9K A;  4E8E A;  2IIY A;  2MBT A;  2QKE A;  1GTA A;  4PUF C;  2LS5 A;  2WJU A;  5HFK A;  3RPN A;  2IMI A;  1EV9 A;  1XVQ A;  3E9J B;  2CT6 A;  1AXD A;  3KMO A;  5ELG A;  1PKZ A;  1EGR A;  2RM6 A;  3TJJ A;  2G0F A;  1GUH A;  4P3Y B;  4KCA A;  1VF4 A;  1PN0 A;  2PPT A;  4PQ1 A;  2PBJ A;  4BVX A;  1I9D A;  1PL2 A;  1A0R P;  1TRU A;  1EOG A;  5INY A;  4O5R A;  2MMZ A;  1KEB A;  2DJ1 A;  5CAX A;  1VF3 A;  5ENU A;  2HRA A;  3CMI A;  3ISO A;  4G10 A;  2VM1 A;  4TXO A;  3K8N A;  1A8Y A;  4IVF A;  4KSO A;  1TKD B;  1THO A;  1G0T A;  1K3Y A;  3GYK A;  4RQR A;  2CX3 A;  2GSS A;  4F9Z A;  4MF5 A;  1QMV A;  1K3L A;  2H76 A;  1XW6 A;  3IRA A;  1JZD A;  1EOH A;  1X5D A;  4DSR A;  2H0I A;  1VGL A;  5G5F A;  1QK8 A;  1BQ7 A;  4K5R A;  1XWA A;  4L0W A;  2NBS A;  10GS A;  2V6O A;  3UJ1 A;  3ZFB A;  2FHE A;  2O85 A;  1B9X C;  3HY2 A;  4FH8 A;  1TK8 B;  3F6F A;  3QDN A;  3RBT A;  3Q6O A;  2E2M A;  2EC4 A;  5DJL A;  4IJ3 A;  1ZCP A;  1T1V A;  2OBI A;  3QCP A;  1YEX A;  4HI7 A;  4GTU A;  3VK9 A;  2IFQ A;  4POL A;  1F2E A;  2DC5 A;  1RW1 A;  5A4U A;  4G0K A;  2GS3 A;  1V98 A;  5F05 A;  4KF9 A;  2MMN A;  3QPM A;  2O8V B;  2YAN A;  4N11 A;  3GIX A;  5IMF A;  4TR0 A;  3TKQ A;  5J5N A;  2AB6 A;  7GSS A;  4POM A;  4ZL9 A;  3NZN A;  5AIS A;  5ABR A;  5KN3 A;  5CRG A;  2DJ2 A;  3IBH A;  5F07 A;  4OO4 A;  1VF1 A;  4X4J A;  2VL2 C;  2A2R A;  1TI3 A;  1TP9 A;  5DQY A;  4RUV A;  1THX A;  1FOV A;  4OWY A;  3IE3 A;  3BOA A;  2WB9 A;  2CAQ A;  5H5R A;  2LJA A;  3TOT A;  1XOA A;  1ON4 A;  2H6Y A;  1B8X A;  2F9S A;  3IXR A;  3DXB A;  4G0I A;  1EZK A;  4KUN A;  4IKH A;  2IN3 A;  5A4W A;  4HU9 A;  1MEK A;  4BA7 A;  2N5B A;  4AF2 A;  4BVX B;  5ID2 B;  4IP6 A;  3DVX A;  3ZRD A;  1I5G A;  1EV4 A;  3EUR A;  5LCZ A;  4WR4 A;  1SL0 B;  1JHB A;  2IPA A;  3HZ4 A;  5D9T A;  5E59 A;  2GQM A;  5JCU A;  1UC7 A;  6GST A;  2R0P A;  1U88 A;  4HJ2 A;  4RQX A;  4TXO B;  2CX4 A;  1WPI A;  2YWN A;  1QXH A;  1BX9 A;  1VRS D;  1E6B A;  4DEJ A;  4V1A p;  1GSS A;  3HDC A;  1V40 A;  5ECI B;  5AIX A;  1K0A A;  4O5Q A;  3C71 A;  1X9M B;  5D8I A;  4FQU A;  1OKT A;  3UAP A;  4PXO A;  5G2Z A;  3UBK A;  2C3T A;  4MAB A;  2GVP A;  3F3R A;  4Q5N A;  1DUG A;  4MF7 A;  3ZMK A;  4X43 A;  3ZYW A;  1XW9 A;  4NHW A;  2IJY A;  2FY6 A;  4NPB A;  1BYE A;  2KP2 A;  1ERW A;  2C3Q A;  3MNG A;  3U6V A;  3UL3 A;  1XWC A;  5B7C A;  4EIQ A;  4Z2T A;  2QC7 A;  5EPF A;  3FR6 A;  3ME8 A;  1H75 A;  4MNN A;  3EWL A;  4J2F A;  2H8L A;  1Z5Y E;  2GGT A;  4JR6 A;  1GTI A;  5DCG A;  5FT3 A;  1TRV A;  2PVQ A;  5D9X A;  2L6C A;  4BWS A;  2HRF A;  1GNE A;  3KP8 A;  4XIH A;  2RUF A;  3FY7 A;  1CQG A;  3GA4 A;  1M2D A;  4MJE A;  4L5L A;  4PQI A;  2R5G A;  5IOX A;  1USB A;  3BBY A;  2M72 A;  4DVC A;  3GHA A;  5DQS A;  3MSZ A;  3PR8 A;  1LBK A;  5E4W A;  2VLU A;  5J4U A;  2HRN A;  3GL5 A;  3CSI A;  5IOW A;  3GKN A;  2D2Z A;  2ON7 A;  3F3Q A;  1A24 A;  2F3M A;  3GST A;  2B5X A;  2X99 A;  1FVJ A;  3O6T A;  3RPP A;  2FNO A;  3TUE A;  3L78 A;  2LKU A;  3FEU A;  4KDU A;  2VUP A;  1A0F A;  5G1L A;  2OE0 A;  3IR4 A;  1T00 A;  3TRP A;  2ZCT A;  2C4J A;  4ZIL A;  5D9V A;  5C00 A;  2OE3 A;  3TKS A;  3HD5 A;  3QFB C;  1F37 A;  2C1Y A;  4IN0 A;  4ML1 A;  2XBI A;  4EL1 A;  2VCT A;  2XBQ A;  4BWQ A;  4KND A;  2FWH A;  4KAE A;  5F8B A;  4KCE A;  1G6Y A;  2V32 A;  3RHB A;  4CHS A;  2QSI A;  2VCQ A;  1XBS A;  1Z7P A;  4K6X A;  4K9Z A;  1A2J A;  4MJC A;  2TIR A;  3H93 A;  2IL3 A;  2K6V A;  4K7O A;  4TR3 A;  2VO4 A;  5DJM A;  2TRX A;  1GP1 A;  2J9H A;  1GUK A;  4MH2 A;  3IOS A;  2YJ7 A;  3CSJ A;  3QD9 A;  4E8H A;  2F8F A;  5KN2 A;  4YKG A;  1M3J A;  1BJX A;  1EP7 A;  1GLP A;  3VWX A;  1SYX A;  5FWG A;  4NV2 A;  2KHP A;  1O8X A;  3D0Z A;  1U3A A;  2B5E A;  2LNT A;  3CYN A;  1BED A;  2GSR A;  4MLY A;  1V9W A;  2DJJ A;  3HZ8 A;  5ECR B;  3A5W A;  2R0G A;  2VD1 A;  3IDV A;  3UIW A;  3HCZ A;  4PQH A;  4EVM A;  5HR3 A;  5H5S A;  1AIU A;  6GSX A;  2B5Y A;  1WP0 A;  3GL3 A;  4WET A;  5DBQ A;  1OE8 A;  4Z7X A;  4K2D A;  2VAF A;  3QOU A;  3D4T A;  2L6D A;  4FYB A;  4ZBB A;  3ZLP A;  4ICY A;  2HSM A;  2KP1 A;  3RAZ A;  3GMF A;  4WKW A;  4O5U A;  2X4A A;  3ZFL A;  2DBC A;  2VCW A;  3HVN A;  1YKA A;  13GS A;  2AAW A;  2BTO T;  3W8S A;  2X8H A;  2YCD A;  2YV7 A;  4NMU A;  3P90 A;  1SK1 A;  3CRT A;  1T4Y A;  4YAV A;  5ECO B;  3PIN A;  2LJK A;  4ECI A;  3KGK A;  2FLS A;  5CRD A;  2CAI A;  5HR1 A;  5ECL B;  3HA9 A;  2WCI A;  2VL2 A;  8GSS A;  3HJO A;  1YKC A;  4K1F A;  5ECN B;  2P5R A;  4WBR D;  2B6M A;  2A4H A;  2RLI A;  3WGE A;  3LW9 A;  5F0G A;  4YQM A;  5GAN D;  4F0C A;  2HI7 A;  5GZZ B;  3L9S A;  5DCH A;  1LJR A;  2OKA A;  2PWJ A;  4YQV A;  3APQ A;  3BCK A;  2F8A A; 
#chains in the Genus database with same CATH homology
 2NPB A;  3GUR A;  1XWG A;  1W4V A;  1TTZ A;  2CVK A;  1WIK A;  3GNJ A;  1PGT A;  4O7H A;  1K0O A;  5D93 A;  1ZGN A;  3BD2 A;  3C1R A;  4POB A;  2LRT A;  2DMM A;  3FMW A;  2WGR A;  2VLV A;  3C73 A;  3DVW A;  4POK A;  5COH A;  4L5O A;  1GSD A;  3EIN A;  5B8B A;  2VLT A;  5ID2 A;  4Z2U A;  2C0F A;  2R37 A;  1SKS B;  2DML A;  4IBP A;  4IP1 A;  4IW9 A;  2Z9S A;  4BL7 B;  3IHG A;  4NWY A;  5CO3 A;  2H01 A;  2KOK A;  3VFI A;  4ECB A;  2B7J A;  6GSW A;  4Q5Q A;  2NVL A;  3E3E A;  3IAS 2;  2YV9 A;  1R4W A;  3Q19 A;  2CZ2 A;  2VD0 A;  3TKP A;  3W6G A;  2IMD A;  4HEA 2;  2WZ9 A;  3DRN A;  2V2G A;  3H4K A;  4MZB A;  2I9H A;  5KOX A;  5G1K A;  3A2V A;  1F3A A;  4IHU A;  1ERV A;  3KTL A;  3RDW A;  3IAM 2;  2REM A;  4X1U A;  5KOW A;  2H75 A;  4MH3 A;  1ZYE A;  2P5Q A;  1F9M A;  1DBY A;  4PUR A;  17GS A;  4ZB6 A;  3ERG A;  4MJB A;  4OO5 A;  1DE1 A;  1GWC A;  1TU7 A;  3VI5 A;  4KDY A;  3GV1 A;  22GS A;  3QAW A;  4MCU A;  5EVO A;  4YQU A;  1Y25 A;  5JWQ B;  3LWA A;  2YP6 A;  3C1S A;  3PGT A;  4X0X A;  3FRC A;  2IMF A;  1O85 A;  2I1U A;  9GSS A;  2LV3 A;  1Z6M A;  4LL4 B;  1TRS A;  2VCZ A;  3HVX A;  1U3I A;  4GST A;  2L59 A;  2H6Z A;  2ES7 A;  3GFK A;  2X8G A;  3DML A;  3WT1 A;  2AUV A;  3GKX A;  1F6M C;  4OMV A;  2RUE A;  2OE1 A;  4WR5 A;  3BCI A;  1S3D A;  3FR3 A;  5IMZ A;  3TJB A;  4RI6 A;  1PX7 A;  3CTG A;  2V41 A;  3QR6 A;  2LJR A;  2MZC A;  2F51 A;  2VIM A;  2GSQ A;  3U5R E;  1MD3 A;  1K0N A;  2MBS A;  4CDO A;  1ST9 A;  5JCW A;  1TJD A;  2FA4 A;  3IC4 A;  3J7Y k;  3IC8 A;  3HYP A;  4ISD A;  4QL7 A;  1ZYQ B;  3HVV A;  3A5I A;  14GS A;  1PQN A;  2C8U A;  2HXK A;  1EEM A;  2HYX A;  3EC3 A;  4CY8 A;  1J08 A;  2XC2 A;  4K5S A;  2YZU A;  3Q74 A;  1GSF A;  4NV5 A;  3GKK A;  2YWI A;  3G7I A;  2ZNM A;  1GSU A;  2H71 A;  4GF0 A;  5J9C A;  2DKI A;  1M9A A;  2LQQ A;  4JU5 A;  1EEJ A;  3KM6 A;  1HNC A;  3D22 A;  3FZ4 A;  1W89 A;  5DAL A;  4K7N A;  1O7U A;  1T3B A;  4TR1 A;  3US3 A;  3ERW A;  4K8M A;  5CRW A;  1VF2 A;  1B4P A;  3NIV A;  3UVH A;  2I4A A;  4L0U A;  4NAX A;  1GSY A;  2GZY A;  3A3T A;  4PUA A;  3DIE A;  2I81 A;  2H1B A;  1Q4J A;  4L8E A;  3L9U A;  4QQ7 A;  1GLQ A;  3ZIT A;  4ID0 A;  2OAD A;  2O89 A;  1XVW A;  3TRX A;  4TOP A;  1A23 A;  1MDK A;  18GS A;  2CVD A;  4XHM A;  1MDI A;  2MMO A;  2WFC A;  4HS1 A;  5JWO B;  3D4M A;  2JSY A;  1PN9 A;  4MPG A;  5B6M A;  1FW1 A;  5GAP D;  4OCE A;  4V2M A;  3APS A;  1T4Z A;  5G30 A;  3W8J A;  1AQW A;  2JZS A;  20GS A;  2C80 A;  4I6X A;  4MP4 A;  2JZR A;  4K2X A;  5G5E A;  11GS A;  1FO5 A;  1SJ6 A;  1ZMA A;  2H0G A;  5AN1 A;  3EU3 A;  3G9B A;  2MYG A;  3FK8 A;  2EIR A;  1RQM A;  1OE7 A;  1ZOF A;  4FO5 A;  1AQV A;  5LD0 A;  2HLS A;  3VI7 A;  5A4V A;  1GSQ A;  1AC1 A;  3PPU A;  1OVN A;  3DYR A;  4MDC A;  5KEJ A;  1OKD A;  2R2J A;  1X5C A;  1SJZ A;  3D5J A;  3FZ9 A;  3IA1 A;  3KIJ A;  4Q5R A;  1ACV A;  3IHQ A;  2DIY A;  1PX6 A;  2L57 A;  2VOC A;  3KCM A;  4XRD A;  2R4V A;  2XPE A;  1TDI A;  4XTS A;  3VLN A;  4I2T A;  3I43 A;  3KMN A;  4XCS A;  5ECP B;  1G7O A;  4ZBD A;  2L4C A;  1X0R A;  2WRT A;  1TXX A;  3M1G A;  2CQ9 A;  2VCV A;  3A2X A;  5IM9 A;  4HQZ A;  1K0C A;  1HNA A;  2YWO A;  3GTU B;  1Z7R A;  2I3Y A;  3LYK A;  2GQL A;  1SJI A;  3TJK A;  2WDU A;  4WBJ A;  5G31 A;  1Z9H A;  2JSZ A;  2YOI A;  1SYR A;  2JU5 A;  2V1M A;  19GS A;  4KDX A;  2CZ3 A;  2VM2 A;  3NOF A;  2H6X A;  5DAL B;  4TR1 B;  4HZ4 A;  5JCG A;  2HSY A;  5DDL A;  4Z2R A;  6GSY A;  1F3B A;  4I8B A;  3G7Y A;  2CA8 A;  2R3X A;  1X5E A;  1FAA A;  2PER A;  3QFA C;  1G6W A;  4DSS B;  3F6D A;  1M7T A;  2R0C A;  4O32 A;  2JAD A;  1YQ1 A;  4BL7 A;  2JZT A;  1MDJ A;  3GRX A;  2QA2 A;  4WF4 A;  2FWE A;  4ULX A;  2HFD A;  1K3O A;  2H30 A;  4JR4 A;  1TW9 A;  3GKM A;  3LGC A;  4IEL A;  4V2L A;  3EU4 A;  2A4V A;  4HDE A;  3VPT A;  3M3M A;  5BRT A;  3AY8 A;  2DLX A;  1ZYP A;  2AYT A;  2M80 A;  3ZVJ A;  2OA7 A;  4AJ8 A;  4RI7 A;  5D96 A;  2H19 A;  5DAK B;  4K7I A;  3J7Y b;  5JWR B;  4GCI A;  3N9J A;  1K0M A;  4KW6 A;  3LG6 A;  5CP1 A;  1O81 A;  4HU7 A;  1V58 A;  5CNW A;  3QAV A;  1Y6E A;  4NHZ A;  4TW5 A;  1DSB A;  2CV4 A;  3EPT A;  4ZB8 A;  1A2L A;  5HFI A;  3KP9 A;  3TKS E;  1J9B A;  2LRN A;  4OCF A;  3QMX A;  4XS1 A;  1XWK A;  3MWH A;  4G19 A;  4IS0 A;  1YJ6 A;  3EE2 A;  2ON5 A;  2LTK A;  3A2W A;  2H1G A;  4N0V A;  1OC9 B;  1TI1 A;  1T7P B;  2BJX A;  1XZO A;  3I6A A;  4MF6 A;  2X8C A;  1C72 A;  4HUA A;  1XCC A;  4ZXG A;  1H4O A;  1XIY A;  4OFT A;  5B8A A;  2DKH A;  5D73 A;  5IO0 A;  3ED3 A;  3IK9 A;  4HQS A;  3R3E A;  2YWM A;  1N2A A;  2FCH A;  3LEF A;  3IK7 A;  4O92 A;  4TXV A;  4KGI A;  2AJQ B;  1MTC A;  5L71 A;  1SK2 A;  2E7P A;  4IQ1 A;  1SL1 B;  3SWL A;  2LUS A;  4MJA A;  5AIV A;  2K8V A;  1R26 A;  1FOH A;  1GUL A;  3UVT A;  1MD4 A;  1N8J A;  1OAZ A;  1EWX A;  1ZL9 A;  3VWU A;  6GSV A;  2DJK A;  1JLV A;  2H1A A;  4LLR A;  4LMW A;  4TVE A;  1TOF A;  3TDG A;  2N5F A;  1GSE A;  3Q18 A;  3KZQ A;  2H74 A;  5ELA A;  4MZW A;  1QQ2 A;  3CBU A;  4D73 B;  5IMA A;  4MZC A;  4TR4 A;  3IPZ A;  2GDR A;  4BPY A;  5KN0 A;  2PVO C;  3TCO A;  3F9U A;  1SU9 A;  4FYC A;  2O87 A;  1ILO A;  1YDK A;  4J56 E;  1QUW A;  2LNS A;  2HT9 A;  3FZ5 A;  3TB2 A;  3FYG A;  1SL2 B;  4GQF A;  1QGV A;  3N5O A;  3UMA A;  1XW5 A;  1K0D A;  1XOB A;  4GSS A;  2MMA A;  2CVB A;  1PRX A;  5DVB A;  2R6K A;  2QGV A;  3GUS A;  1A8L A;  3M9J A;  5FHI A;  2GST A;  4F82 A;  3O3T A;  1XFL A;  4TKY A;  3ZZX A;  3E0U A;  3TKS C;  1KTE A;  2P31 A;  4JE1 A;  1JZO A;  1JLW A;  3EMP A;  3QAG A;  3ZIV A;  3F4T A;  1WMJ A;  4I97 A;  5GST A;  4PNF A;  4XS6 A;  2EIO A;  2KLX A;  4K0N A;  3C8E A;  2PN8 A;  1Z6N A;  5F06 A;  3P2A A;  5D9W A;  2OAC A;  4WEY A;  3TOU A;  1PL1 A;  3TRQ A;  1AQX A;  2X49 A;  4WXT A;  1XPV A;  5HQP A;  3ZL5 A;  2DIZ A;  2H72 A;  2L4Q A;  4XS4 B;  1ZZY A;  4IGJ A;  1KBN A;  1GH2 A;  1GL8 A;  3H79 A;  5BMU A;  1TK0 B;  2HSH A;  3TJG A;  1S3C A;  1HQO A;  5ECH B;  4EE0 A;  3LJR A;  1HNB A;  2XHF A;  4OFM A;  1WWJ A;  4HOJ A;  3H8Q A;  2GLR A;  4GRF A;  3I69 A;  2B1L A;  1URM A;  4HZ2 A;  2LST A;  4J57 E;  5ECM B;  1FB6 A;  2AV4 A;  4JED A;  5C04 A;  1FG4 A;  3DD3 A;  3GX0 A;  1GNW A;  4BVY A;  3WT2 A;  5IO2 A;  1ZYN A;  3ZRE A;  3VWV A;  3GSS A;  1HD2 A;  3FR9 A;  2B1K A;  1M9B A;  1OYJ A;  2QA1 A;  3TJF A;  3P8W A;  2IMK A;  4IJI A;  1ERT A;  1O6J A;  1X9W B;  3D21 A;  2LRC A;  2FD3 A;  1GUM A;  4TRX A;  1PMT A;  1HYU A;  3F4S A;  1GRX A;  4MA9 A;  4JZQ A;  2VL9 A;  1QFN A;  4N10 A;  4LA1 A;  3DEX A;  4DSQ A;  3G7J A;  4XRA A;  1Z3E A;  3GN3 A;  2HZE B;  3KH7 A;  5IIZ A;  2B7K A;  3MAK A;  1CQH A;  3HVS A;  1WJK A;  4NXI A;  1FVK A;  2WUL A;  3FHK A;  3F8U A;  3LQ7 A;  4AJ6 A;  3GTU A;  1SKW B;  4PGT A;  4KX4 A;  4ACS A;  3MYD A;  4LL1 B;  1YZX A;  1PD2 1;  1E2Y A;  2OBK A;  4JRR A;  2LEG A;  1RK4 A;  6GSS A;  3M8N A;  1UVZ A;  1O73 A;  4YKF A;  2FWG A;  3TKR A;  3DKS A;  1OC8 A;  2FGX A;  1ERU A;  2GT5 A;  2L5O A;  5EY6 A;  2B3S A;  2J23 A;  6GSU A;  4DSS A;  4OD7 A;  1PA3 A;  4ZL8 A;  2OJL A;  5ECS A;  1M2B A;  4ECJ A;  1SD9 A;  4PTS A;  4FIW A;  2KUC A;  3DGQ A;  2GTU A;  3ZVJ D;  3KEB A;  2AHE A;  1JZW A;  2C0E A;  4G9H A;  2C0G A;  4KSM A;  4AGS A;  4GSN A;  2PUK C;  2X64 A;  4EUY A;  4F2I A;  5CRE A;  3CXG A;  3P7X A;  4EIP A;  1R5P A;  4QL9 A;  3KXO A;  3CSH A;  1Q98 A;  1B48 A;  2WS2 A;  1IYH A;  2ZUP A;  2IME A;  1G7E A;  4K0G A;  1WE0 A;  3IV4 A;  3I9V 2;  1WRY A;  2HNL A;  3L9V A;  5KN1 A;  4A5P A;  5DAK A;  5IMV A;  4MMM A;  4N30 A;  2TRC P;  4GWR A;  3ME7 A;  3JCM L;  2E2G A;  4KA0 A;  2NDO A;  2M46 A;  4ZIJ A;  5J9B A;  5J3R A;  2H70 A;  3VPQ A;  5IQY A;  2PU9 C;  4CW9 A;  3KH9 A;  2E0Q A;  1LU4 A;  1M99 A;  3UAR A;  5LNK e;  2DJ0 A;  4EF0 A;  4KH7 A;  1U6T A;  1PKW A;  4EKZ A;  4BVY B;  1BG5 A;  1UN2 A;  2JAC A;  3EMX A;  2VL3 A;  2O7K A;  1AUC A;  3PH9 A;  2N5A A;  1YY7 A;  1NM3 A;  2H73 A;  2HE3 A;  2A2P A;  1OC9 A;  3UEM A;  16GS A;  4ILF A;  4GQC A;  2HZF A;  4ZB9 A;  5ECQ B;  3MIX A;  1X9S B;  5HFG A;  2IFQ B;  1R5A A;  5CYY A;  1WOU A;  1B9Y C;  4LMV A;  5ECK B;  2C3N A;  1OC3 A;  1NSW A;  3HXS A;  5J41 A;  4FYU A;  2DSA A;  1EGO A;  4AJ7 A;  3FW2 A;  3GX8 A;  3MDK A;  4V2N A;  2BMX A;  1XXU A;  3CRU A;  3LXT A;  4IQA A;  3F0I A;  12GS A;  1M0U A;  2VCX A;  3EYT A;  3KJY A;  3CTF A;  1JZR A;  1TK5 B;  1ABA A;  2YN1 A;  3R2Q A;  4PNG A;  1SEN A;  4D73 A;  2FUG 2;  4I2U A;  3KD0 A;  3O76 A;  2YZH A;  1BAY A;  3ZTL A;  1S3A A;  2ALB A;  1NHO A;  1AW9 A;  1O8W A;  1TRW A;  3HJM A;  2V6K A;  5AGY A;  3F4R A;  2GZZ A;  4ML6 A;  5EL8 A;  3D6I A;  4ECC A;  1A2M A;  1YF1 A;  2PGT A;  2UZ8 A;  1V57 A;  1YEP A;  3L4N A;  2P0G A;  1V2A A;  2YPM A;  3ZML A;  4WF5 A;  2YJH A;  4GLT A;  2XPD A;  4JBB A;  1J0F A;  4KB3 A;  1T8E B;  1XWB A;  5H5Q A;  2RII A;  2IWT A;  3KTB A;  1SD8 A;  4H86 A;  3TGZ A;  3WGD A;  3VWW A;  4EXJ A;  3GH6 A;  4HJM A;  3DWV A;  5HR0 A;  2C0D A;  3L0H A;  4MK3 A;  2EIQ A;  4EDY A;  1ML6 A;  2G2Q A;  2H1D A;  4KE3 A;  2H66 A;  3HHV A;  1GTB A;  2FA8 A;  5HR2 A;  2L5L A;  3LSZ A;  2DJ3 A;  1B4Q A;  5A5K A;  1NHY A;  2GT6 A;  4EC0 A;  4XS4 A;  1TU8 A;  4PX1 A;  4MPF A;  1DE2 A;  2GQK A;  2JL4 A;  2PMT A;  3F63 A;  1AAZ A;  5CRH A;  3FKF A;  4OFN A;  3H1N A;  3V1W A;  1FHE A;  3OR5 A;  3EVI A;  4I5Q A;  1SK0 A;  3WGX A;  4EDZ A;  3ERF A;  1U87 A;  1M2A A;  3GH9 A;  4F03 A;  5IMD A;  1K0B A;  1R7H A;  4N0Z A;  2K18 A;  3HJP A;  3WYW A;  1YF0 A;  4USS A;  3HKR A;  1FB0 A;  3LYP A;  4G0L A;  3LFL A;  1GTU A;  2NTO A;  3UBL A;  3VUR A;  5B6N A;  3M0F A;  4V1A g;  2K8S A;  1KNG A;  3FZA A;  3APO A;  1UA5 A;  3C7M A;  2HRK A;  5IPH A;  2YNX A;  5IMC A;  3WD6 A;  4YH2 A;  1IYI A;  5GSS A;  4GXZ A;  3ZIJ A;  2H0H A;  4EO3 A;  1SKR B;  3SBC A;  3LOR A;  4CY6 A;  4YAP A;  4ZL7 A;  4TN8 A;  3UOM A;  1PSQ A;  2K9F A;  1NW2 A;  2RM5 A;  4F0B A;  2A2S A;  2HZE A;  3S9F A;  2FWF A;  4ZBA A;  3BJ5 A;  4G2E A;  3LXZ A;  5IPG A;  2GZP A;  1JFU A;  1EP8 A;  3RHC A;  2LQO A;  4Q5F A;  3M9K A;  4E8E A;  2IIY A;  2MBT A;  2QKE A;  1GTA A;  4PUF C;  2LS5 A;  2WJU A;  5HFK A;  3RPN A;  2IMI A;  1EV9 A;  1XVQ A;  3E9J B;  2CT6 A;  1AXD A;  3KMO A;  5ELG A;  1PKZ A;  1EGR A;  2RM6 A;  3TJJ A;  2G0F A;  1GUH A;  4P3Y B;  4KCA A;  1VF4 A;  1PN0 A;  2PPT A;  4PQ1 A;  2PBJ A;  4BVX A;  1I9D A;  1PL2 A;  1A0R P;  1TRU A;  1EOG A;  5INY A;  4O5R A;  2MMZ A;  1KEB A;  2DJ1 A;  5CAX A;  1VF3 A;  5ENU A;  2HRA A;  3CMI A;  3ISO A;  4G10 A;  2VM1 A;  4TXO A;  3K8N A;  1A8Y A;  4IVF A;  4KSO A;  1TKD B;  1THO A;  1G0T A;  1K3Y A;  3GYK A;  4RQR A;  2CX3 A;  2GSS A;  4F9Z A;  4MF5 A;  1QMV A;  1K3L A;  2H76 A;  1XW6 A;  3IRA A;  1JZD A;  1EOH A;  1X5D A;  4DSR A;  2H0I A;  1VGL A;  5G5F A;  1QK8 A;  1BQ7 A;  4K5R A;  1XWA A;  4L0W A;  2NBS A;  10GS A;  2V6O A;  3UJ1 A;  3ZFB A;  2FHE A;  2O85 A;  1B9X C;  3HY2 A;  4FH8 A;  1TK8 B;  3F6F A;  3QDN A;  3RBT A;  3Q6O A;  2E2M A;  2EC4 A;  5DJL A;  4IJ3 A;  1ZCP A;  1T1V A;  2OBI A;  3QCP A;  1YEX A;  4HI7 A;  4GTU A;  3VK9 A;  2IFQ A;  4POL A;  1F2E A;  2DC5 A;  1RW1 A;  5A4U A;  4G0K A;  2GS3 A;  1V98 A;  5F05 A;  4KF9 A;  2MMN A;  3QPM A;  2O8V B;  2YAN A;  4N11 A;  3GIX A;  5IMF A;  4TR0 A;  3TKQ A;  5J5N A;  2AB6 A;  7GSS A;  4POM A;  4ZL9 A;  3NZN A;  5AIS A;  5ABR A;  5KN3 A;  5CRG A;  2DJ2 A;  3IBH A;  5F07 A;  4OO4 A;  1VF1 A;  4X4J A;  2VL2 C;  2A2R A;  1TI3 A;  1TP9 A;  5DQY A;  4RUV A;  1THX A;  1FOV A;  4OWY A;  3IE3 A;  3BOA A;  2WB9 A;  2CAQ A;  5H5R A;  2LJA A;  3TOT A;  1XOA A;  1ON4 A;  2H6Y A;  1B8X A;  2F9S A;  3IXR A;  3DXB A;  4G0I A;  1EZK A;  4KUN A;  4IKH A;  2IN3 A;  5A4W A;  4HU9 A;  1MEK A;  4BA7 A;  2N5B A;  4AF2 A;  4BVX B;  5ID2 B;  4IP6 A;  3DVX A;  3ZRD A;  1I5G A;  1EV4 A;  3EUR A;  5LCZ A;  4WR4 A;  1SL0 B;  1JHB A;  2IPA A;  3HZ4 A;  5D9T A;  5E59 A;  2GQM A;  5JCU A;  1UC7 A;  6GST A;  2R0P A;  1U88 A;  4HJ2 A;  4RQX A;  4TXO B;  2CX4 A;  1WPI A;  2YWN A;  1QXH A;  1BX9 A;  1VRS D;  1E6B A;  4DEJ A;  4V1A p;  1GSS A;  3HDC A;  1V40 A;  5ECI B;  5AIX A;  1K0A A;  4O5Q A;  3C71 A;  1X9M B;  5D8I A;  4FQU A;  1OKT A;  3UAP A;  4PXO A;  5G2Z A;  3UBK A;  2C3T A;  4MAB A;  2GVP A;  3F3R A;  4Q5N A;  1DUG A;  4MF7 A;  3ZMK A;  4X43 A;  3ZYW A;  1XW9 A;  4NHW A;  2IJY A;  2FY6 A;  4NPB A;  1BYE A;  2KP2 A;  1ERW A;  2C3Q A;  3MNG A;  3U6V A;  3UL3 A;  1XWC A;  5B7C A;  4EIQ A;  4Z2T A;  2QC7 A;  5EPF A;  3FR6 A;  3ME8 A;  1H75 A;  4MNN A;  3EWL A;  4J2F A;  2H8L A;  1Z5Y E;  2GGT A;  4JR6 A;  1GTI A;  5DCG A;  5FT3 A;  1TRV A;  2PVQ A;  5D9X A;  2L6C A;  4BWS A;  2HRF A;  1GNE A;  3KP8 A;  4XIH A;  2RUF A;  3FY7 A;  1CQG A;  3GA4 A;  1M2D A;  4MJE A;  4L5L A;  4PQI A;  2R5G A;  5IOX A;  1USB A;  3BBY A;  2M72 A;  4DVC A;  3GHA A;  5DQS A;  3MSZ A;  3PR8 A;  1LBK A;  5E4W A;  2VLU A;  5J4U A;  2HRN A;  3GL5 A;  3CSI A;  5IOW A;  3GKN A;  2D2Z A;  2ON7 A;  3F3Q A;  1A24 A;  2F3M A;  3GST A;  2B5X A;  2X99 A;  1FVJ A;  3O6T A;  3RPP A;  2FNO A;  3TUE A;  3L78 A;  2LKU A;  3FEU A;  4KDU A;  2VUP A;  1A0F A;  5G1L A;  2OE0 A;  3IR4 A;  1T00 A;  3TRP A;  2ZCT A;  2C4J A;  4ZIL A;  5D9V A;  5C00 A;  2OE3 A;  3TKS A;  3HD5 A;  3QFB C;  1F37 A;  2C1Y A;  4IN0 A;  4ML1 A;  2XBI A;  4EL1 A;  2VCT A;  2XBQ A;  4BWQ A;  4KND A;  2FWH A;  4KAE A;  5F8B A;  4KCE A;  1G6Y A;  2V32 A;  3RHB A;  4CHS A;  2QSI A;  2VCQ A;  1XBS A;  1Z7P A;  4K6X A;  4K9Z A;  1A2J A;  4MJC A;  2TIR A;  3H93 A;  2IL3 A;  2K6V A;  4K7O A;  4TR3 A;  2VO4 A;  5DJM A;  2TRX A;  1GP1 A;  2J9H A;  1GUK A;  4MH2 A;  3IOS A;  2YJ7 A;  3CSJ A;  3QD9 A;  4E8H A;  2F8F A;  5KN2 A;  4YKG A;  1BJX A;  1EP7 A;  1GLP A;  3VWX A;  1SYX A;  5FWG A;  4NV2 A;  2KHP A;  1O8X A;  3D0Z A;  1U3A A;  2B5E A;  2LNT A;  3CYN A;  1BED A;  2GSR A;  4MLY A;  1V9W A;  2DJJ A;  3HZ8 A;  5ECR B;  3A5W A;  2R0G A;  2VD1 A;  3IDV A;  3UIW A;  3HCZ A;  4PQH A;  4EVM A;  5HR3 A;  5H5S A;  1AIU A;  6GSX A;  2B5Y A;  1WP0 A;  3GL3 A;  4WET A;  5DBQ A;  1OE8 A;  4Z7X A;  4K2D A;  2VAF A;  3QOU A;  3D4T A;  2L6D A;  4FYB A;  4ZBB A;  3ZLP A;  4ICY A;  2HSM A;  2KP1 A;  3RAZ A;  3GMF A;  4WKW A;  4O5U A;  2X4A A;  3ZFL A;  2DBC A;  2VCW A;  1YKA A;  13GS A;  2AAW A;  2BTO T;  3W8S A;  2X8H A;  2YCD A;  2YV7 A;  4NMU A;  3P90 A;  1SK1 A;  3CRT A;  4YAV A;  1T4Y A;  5ECO B;  3PIN A;  2LJK A;  4ECI A;  3KGK A;  2FLS A;  5CRD A;  2CAI A;  5HR1 A;  5ECL B;  3HA9 A;  2WCI A;  2VL2 A;  8GSS A;  3HJO A;  1YKC A;  4K1F A;  5ECN B;  2P5R A;  4WBR D;  2B6M A;  2A4H A;  2RLI A;  3WGE A;  3LW9 A;  5F0G A;  4YQM A;  5GAN D;  4F0C A;  2HI7 A;  5GZZ B;  3L9S A;  5DCH A;  1LJR A;  2OKA A;  2PWJ A;  4YQV A;  3APQ A;  3BCK A;  2F8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...