1XWAA

Drospohila thioredoxin, oxidized, p41212
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
AAAAAMVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 35
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwaA00
4K1FA 1HQOA 4PNFA 2KUCA 5D8IA 2WRTA 2F51A 1XWCA 4YH2A 2C1YA 2GSQA 3NOFA 3UL3A 1DBYA 3CRTA 3O76A 5DJMA 1YY7A 1G6WA 1NM3A 2WGRA 4EDYA 4HZ2A 3FK8A 3MWHA 1AIUA 3M3MA 1X0RA 2JSZA 1VF3A 4NPBA 3DRNA 4E8HA 3GNJA 1VF1A 2LJKA 2PPTA 3KTLA 4N0VA 2VOCA 3IV4A 1JLWA 4DVCA 1GRXA 4LL1B 1JZWA 5HR0A 4G2EA 4FYBA 6GSTA 3F0IA 4QQ7A 4K7OA 2B5YA 2V32A 4POMA 3APOA 2K8VA 4PUFC 2DJJA 4MK3A 1GTAA 1PN9A 4TVEA 1F37A 2WCIA 4V2NA 3L78A 1ZCPA 1F3AA 3VLNA 2CZ2A 4TOPA 3FEUA 2AB6A 13GSA 2A4VA 3LYKA 5H5QA 4RUVA 1XWAA 3EE2A 5G1KA 3IPZA 2H70A 5ECQB 2X8GA 2YZUA 3KH7A 4V2LA 3VI7A 1U6TA 2HFDA 4HI7A 3IAM2 4HJ2A 3GX8A 1PL1A 1THXA 4KGIA 5D9TA 5LCZA 3D4MA 4KAEA 1TXXA 2QC7A 3ERWA 3QFAC 3D0ZA 1AQVA 3EU4A 1UA5A 1ZMAA 1E6BA 1UN2A 4JEDA 4QL7A 2YCDA 4N30A 1V58A 2K6VA 4TR4A 3P7XA 3TCOA 4KB3A 1Q4JA 1LJRA 2H66A 4DSRA 4OMVA 4AF2A 4GSSA 2VAFA 1K0NA 1A8YA 1T7PB 2O85A 1EEJA 1G6YA 5ELGA 4J2FA 2LNTA 3R2QA 4PQHA 3EWLA 2YJ7A 3LYPA 3HVXA 4LMWA 1XPVA 2QKEA 4TR3A 2YPMA 2V1MA 4L5LA 2HSYA 1GTUA 1X5CA 3WT1A 2VM2A 1FG4A 2J9HA 1OAZA 2VD0A 3UARA 3VPTA 1GSFA 2ES7A 4POBA 2DIZA 1J9BA 4RQXA 4KA0A 1OKTA 2E0QA 3DGQA 5KN1A 2GT5A 3F4RA 2AJQB 1MDIA 2AYTA 2VL2A 4JE1A 6GSXA 4WF4A 2VCTA 1A24A 3LJRA 4P3YB 1PRXA 2YJHA 2IN3A 3F8UA 1WRYA 5IOWA 2NPBA 1XXUA 2VCVA 1V2AA 2LQQA 5KN0A 1PKWA 5KN2A 4PQ1A 2LNSA 2L5LA 3D4TA 4BL7A 4MP4A 1HNAA 3TUEA 2DJ0A 5IMFA 2YWMA 5ECNB 2FWFA 4GCIA 4ECCA 5G5FA 1C72A 11GSA 4KCAA 2GGTA 2LUSA 3GKKA 4DSQA 3APQA 3H4KA 2YANA 1XIYA 3H8QA 5EVOA 3ED3A 5ELAA 3WGDA 2PUKC 2FNOA 4GRFA 3FZAA 2FWEA 1QFNA 1S3CA 2QSIA 4RQRA 3O6TA 2P31A 2DIYA 2FCHA 1K0CA 3K8NA 4WETA 1T8EB 1ZOFA 2YOIA 5CRHA 1UC7A 4KDYA 1QXHA 3BBYA 4OO4A 3HCZA 2XBQA 5IMDA 1Z5YE 1EGRA 2H1AA 5ID2A 4QL9A 5IMVA 2H30A 5JCGA 3LXTA 2X8CA 3M8NA 1GLQA 3TJBA 1J0FA 4BVYA 4OFMA 1J08A 4TXOA 3UVHA 5G30A 4KW6A 3C73A 3IRAA 5CAXA 2OBIA 2REMA 3ZRDA 2LS5A 3LORA 1VF4A 1O6JA 6GSYA 2JU5A 1K3YA 2ON5A 4TXVA 2DJKA 2KHPA 5C04A 4TW5A 4HOJA 4NV5A 3E9JB 3DEXA 4XS6A 4IKHA 1SKSB 1V98A 1BJXA 1MDJA 1GULA 2MMOA 4BWQA 2B1LA 2GDRA 3GUSA 2AV4A 2PWJA 2VLVA 5HR1A 4TKYA 4F0BA 1PGTA 1PMTA 2CX3A 4GQCA 1PA3A 1BQ7A 2G2QA 1EEMA 5B6MA 1SK1A 3TOTA 2N5AA 3ISOA 2BTOT 3LQ7A 3D21A 1JZOA 3U5RE 2H1BA 2HZFA 1SD9A 5CRGA 4TR1B 2VM1A 4TN8A 3TRQA 5IO2A 2XBIA 5CYYA 1ABAA 1TTZA 5EY6A 3ZIJA 3L0HA 3NZNA 4KX4A 3FRCA 5B8BA 3KMOA 2GSRA 2YWIA 1OE8A 3KIJA 5AIXA 1XWBA 1EV4A 2F8FA 4CDOA 1X9WB 2H71A 4JZQA 4TRXA 1NW2A 1XW9A 5ECIB 4KUNA 3BJ5A 3VK9A 3LWAA 5FHIA 2I81A 2LRCA 3KCMA 1AC1A 1FO5A 1OC9A 3KMNA 5IQYA 4X1UA 4MABA 3IAS2 1EOHA 4CW9A 1KTEA 1SJZA 4LLRA 5IPHA 1ILOA 2L5OA 3UJ1A 1I9DA 2E2GA 4YQUA 3IC4A 3QD9A 3MNGA 3G7IA 1WOUA 2KLXA 2L57A 2NTOA 2H73A 2D2ZA 2FUG2 3ME7A 2JZSA 1UVZA 3TJKA 2GLRA 3NIVA 3SBCA 3ZVJD 3TJGA 4EKZA 1O8XA 1YF0A 5A4WA 2IMKA 4MJEA 5DQYA 5KN3A 2FA8A 3C7MA 3O3TA 2HXKA 3ZFLA 4K0GA 4GXZA 2G0FA 4IN0A 4XS4B 5FWGA 4IHUA 4AJ7A 2YZHA 2BMXA 3LG6A 1T00A 1U87A 1N8JA 2V6OA 4N0ZA 1XWKA 1W89A 5COHA 2HI7A 1B48A 2IWTA 3UAPA 4RI6A 1R5AA 1PSQA 2EIRA 2IFQA 3GL3A 3GIXA 4ZBDA 2MMNA 3GSSA 4XHMA 3GN3A 4DEJA 1XOAA 3ZREA 3HD5A 4MLYA 1SYRA 4PUAA 2YNXA 3GTUA 4PXOA 4ZB6A 2C3QA 3ZFBA 3HXSA 4LMVA 3FZ4A 3IBHA 5CRWA 2IMFA 4YAPA 4DSSB 2CVDA 3I69A 4KCEA 1XVWA 2HRFA 3I43A 3QAVA 3GH6A 2OE0A 2L4QA 3APSA 4XIHA 3QFBC 2I1UA 3F4TA 2CQ9A 5DJLA 4HEA2 5J3RA 1R5PA 4N10A 5DAKB 1Z6NA 4JR6A 4FYUA 4WR5A 1B9YC 2HZEB 2DJ2A 2O8VB 1K0BA 1TKDB 1FAAA 2WS2A 1X9MB 1M9AA 5DCGA 1FOVA 3JCML 4WEYA 2CAIA 3UOMA 10GSA 3EURA 2VLUA 3F3RA 4NXIA 5IPGA 1OKDA 4EF0A 2M46A 4F0CA 3UIWA 2DBCA 1TI3A 4Q5RA 2VD1A 3FZ9A 4K8MA 3U6VA 4KE3A 3QAWA 2PU9C 1PKZA 3DKSA 1XOBA 5G5EA 2EC4A 3IR4A 5GAND 2EIQA 4XRAA 4O92A 1AUCA 2L59A 3M9JA 1YF1A 1XFLA 3DXBA 3GRXA 2VIMA 2LJAA 1SD8A 3QAGA 2LTKA 4ECIA 3G7YA 1A2MA 1EZKA 2QGVA 2XC2A 5DALA 4E8EA 3J7Yb 3E3EA 1A23A 1WPIA 4GSNA 1K0DA 3GSTA 2H1DA 3HVVA 1OE7A 2C80A 3EU3A 4I2TA 4I97A 4WXTA 1R7HA 5ECSA 2H6XA 1XW5A 4YAVA 1O85A 5ECLB 3WGXA 4EE0A 1GWCA 1A2JA 5GSTA 4GLTA 3FKFA 5HQPA 5B8AA 2R37A 1RQMA 1I5GA 2HE3A 2H0HA 1YJ6A 3HA9A 1GLPA 1O8WA 1BAYA 5HR2A 1TU7A 3PR8A 1ZZYA 5JWRB 4NWYA 4MMMA 3HYPA 2VL3A 4ZB8A 5GAPD 2XPDA 2C4JA 3EMXA 3A2VA 1A0FA 2V2GA 1ACVA 2TIRA 1ERTA 3US3A 2GS3A 2MZCA 4WBRD 2L6CA 3TB2A 1Q98A 5IIZA 3M0FA 1EV9A 4EC0A 3ZITA 3IDVA 5EL8A 4D73A 4BA7A 5B6NA 2MBTA 2WFCA 4F2IA 1XCCA 1SL2B 7GSSA 5IM9A 2H0GA 2GZYA 5DVBA 1Y25A 3VWUA 1MTCA 3AY8A 1WIKA 2YP6A 2R4VA 2VLTA 2C0EA 2H6YA 1F9MA 4ACSA 2MMZA 3DIEA 4ZBBA 1K0MA 3GH9A 2GZZA 3TDGA 4HU9A 2HLSA 3D22A 2J23A 4IJIA 3GL5A 1AAZA 1ML6A 3QDNA 2JL4A 4XRDA 16GSA 3ERGA 3HVSA 3GV1A 1QUWA 3PGTA 1IYIA 4IELA 1YEPA 3KP8A 3S9FA 3L9VA 2B5EA 4AJ6A 1XVQA 5D93A 2AAWA 1TW9A 3LEFA 1SL0B 3ME8A 5LNKe 3VWVA 2JZTA 3IOSA 2C3NA 3M9KA 2MMAA 4ZL9A 2R2JA 1RK4A 3HZ8A 1LU4A 1BG5A 2LRTA 5H5RA 4PNGA 1GTBA 1O73A 2CAQA 1M2AA 1QK8A 4MZCA 5LD0A 3GKXA 1SYXA 2B6MA 2V6KA 2VL2C 1OYJA 1MDKA 2FHEA 3G9BA 1GSDA 8GSSA 3KTBA 4KH7A 3L9UA 5IMAA 4TR0A 1XWGA 3UBKA 1GUMA 2H8LA 4OO5A 2IJYA 4NMUA 3LSZA 2RLIA 5HR3A 4MF7A 4EDZA 3IK7A 5IOXA 5G31A 4K7IA 3Q6OA 3ZMLA 5JWOB 1X5DA 4BPYA 5F8BA 2B3SA 3M1GA 12GSA 1ON4A 3TKSA 3C1SA 3I6AA 5C00A 2OACA 4JRRA 1T4YA 4EL1A 3VI5A 2PVQA 2YWNA 5AN1A 2R6KA 1ERUA 3RHCA 4LA1A 3OR5A 4MH3A 1TRSA 1GNWA 3GKMA 5H5SA 3ZZXA 1M9BA 4MZWA 1ERVA 4OFNA 3F9UA 3RBTA 5F06A 2E2MA 5IMCA 1NSWA 4XS4A 3FHKA 4L5OA 2HNLA 2GSTA 3N9JA 2VCWA 1WMJA 1YKAA 1A2LA 4OD7A 2WJUA 4IQ1A 3E0UA 4MF5A 2XHFA 3TKSE 2O7KA 1ZYQB 5HFKA 5IMZA 3EMPA 3FR9A 2OE3A 3GYKA 3DYRA 4MF6A 4X0XA 4FIWA 3D5JA 2V41A 2MBSA 2HYXA 4IW9A 4G19A 2VCXA 4X43A 1YKCA 22GSA 1CQGA 3ZVJA 2CVBA 1GSSA 3KGKA 1FW1A 4MJCA 5INYA 1TOFA 2K18A 3H93A 3CRUA 4NV2A 3N5OA 3KJYA 3BCIA 1O81A 2BJXA 3IHQA 1FHEA 3A2WA 1USBA 3HHVA 5ENUA 3KEBA 2ZNMA 4GSTA 3F3QA 1SK2A 2PMTA 3J7Yk 2H72A 2GQMA 1M2DA 1V9WA 4IBPA 1GSEA 4O5RA 1BX9A 3EC3A 4OCFA 2DC5A 5ABRA 2IIYA 2IMEA 3TKRA 1TRWA 3H79A 2R5GA 2PERA 1TP9A 4IQAA 2VUPA 3FZ5A 1SKRB 3QCPA 4L0UA 3I9V2 2GT6A 14GSA 3CSIA 3TRPA 1SK0A 4Q5QA 2NBSA 5DCHA 5ID2B 2M72A 2I3YA 3C8EA 2OA7A 3L4NA 5EPFA 2YN1A 5F07A 4MZBA 4ZXGA 6GSUA 3F63A 1GL8A 3ZYWA 5J9BA 1A8LA 3F6DA 1F6MC 2H74A 4TXOB 3ZMKA 3GKNA 1KNGA 1X5EA 5ECRB 2VO4A 4GTUA 1HD2A 3WD6A 2LSTA 4N11A 4GF0A 5CP1A 1A0RP 3A5WA 5AISA 1N2AA 3A2XA 3W8JA 2H76A 3FW2A 3QR6A 2NVLA 2JZRA 1E2YA 4RI7A 1B9XC 1H4OA 4ML1A 1DSBA 2MYGA 1R26A 4WKWA 4FYCA 5DQSA 2L6DA 1TU8A 1EWXA 4MJAA 1LBKA 2LQOA 2X64A 1H75A 2H01A 2I9HA 1F3BA 1B8XA 1XW6A 4IJ3A 5CRDA 3P2AA 3G7JA 3IXRA 1VRSD 4V1Ag 4CHSA 1GSQA 3ERFA 2B7JA 3D6IA 4ID0A 3DVWA 1T3BA 5ECPB 1VGLA 3RPPA 1GNEA 4H86A 4V2MA 2KOKA 4MPGA 2HT9A 3Q18A 3FY7A 5J4UA 4G10A 3VWWA 2KP1A 1SL1B 4ILFA 3RAZA 2LEGA 2XPEA 5D96A 3DVXA 17GSA 3PINA 3GFKA 1PQNA 3HJOA 18GSA 4I8BA 4MH2A 5JCWA 1K0AA 3GURA 4HDEA 4F9ZA 3WYWA 5D9WA 2WULA 2FY6A 4PURA 3P90A 2FGXA 4Q5NA 3GX0A 1GUKA 1MEKA 3UBLA 4KNDA 1TJDA 4AGSA 1K3LA 2CA8A 3KXOA 4F82A 4WF5A 2RIIA 5FT3A 3F6FA 4L0WA 4OFTA 1OC9B 4G9HA 2X99A 1FB6A 4HQZA 4AJ8A 2CVKA 1WP0A 3VWXA 1TRUA 2YV7A 2P5QA 4V1Ap 3LXZA 2F3MA 1JFUA 4KSOA 1WE0A 5L71A 2FWGA 4ZBAA 4HS1A 3RPNA 4ZL7A 2WZ9A 2GSSA 2C0GA 1JZRA 1Z9HA 2RUFA 4F03A 5E59A 1V40A 1U3AA 3SWLA 5ECKB 2A2SA 3QMXA 1DUGA 5D73A 2NDOA 1GUHA 1TRVA 2A2RA 2DJ1A 1TI1A 3L9SA 1ZGNA 4HZ4A 5A4UA 2VCZA 2IL3A 1GP1A 4EVMA 6GSWA 5CREA 1KBNA 2CT6A 2M80A 1B4PA 1B4QA 5JCUA 2R3XA 3UVTA 1X9SB 4K7NA 4EUYA 4HUAA 2OE1A 2IFQB 3HZ4A 1AQWA 4Q5FA 4JU5A 2C3TA 4XS1A 3TKPA 1VF2A 1AW9A 4JR4A 5E4WA 3RDWA 4EXJA 3TJJA 2RUEA 3FYGA 5ECHB 2GTUA 3EYTA 5F05A 1XZOA 3W6GA 4JBBA 5CO3A 1T1VA 3RHBA 3GTUB 3QOUA 4BVXA 3WT2A 4I2UA 1YZXA 3MSZA 1U3IA 4K2DA 4GWRA 4NHWA 1TDIA 5AGYA 4HJMA 2OJLA 1FVJA 1Z3EA 1K0OA 3LFLA 1XBSA 2HRNA 5F0GA 1MD4A 2LV3A 3DMLA 2VCQA 4PX1A 1DE2A 3EVIA 1AXDA 1OC3A 1R4WA 4K6XA 1ST9A 1Z7RA 6GSVA 3FR3A 1Y6EA 2F9SA 3DWVA 4POKA 3ZL5A 3HJPA 3QPMA 3P8WA 3ZLPA 1OVNA 2DMLA 3PH9A 2YWOA 1PX6A 5DBQA 4HQSA 6GSSA 1RW1A 1EP8A 1S3AA 4TR1A 2E7PA 1ERWA 1BYEA 4I5QA 3HDCA 3C71A 5KEJA 3Q19A 1PD21 3WGEA 4IS0A 1TK8B 1YEXA 5ECOB 3KP9A 2B7KA 3EINA 2ALBA 4GQFA 4L8EA 1JZDA 2ZCTA 2Z9SA 1SENA 1QQ2A 3IE3A 3UMAA 3KD0A 4LL4B 4FH8A 2H6ZA 5DALB 3VPQA 5DDLA 2X8HA 4ZL8A 1GSYA 1W4VA 19GSA 4MJBA 1F2EA 2CV4A 3GMFA 1HYUA 2ZUPA 5HFGA 1S3DA 5GZZB 2FWHA 4MPFA 2GQKA 1EP7A 4IVFA 2LJRA 3V1WA 2FA4A 4Z7XA 3VFIA 5J41A 1T4ZA 1YDKA 2F8AA 2YV9A 2O87A 2JACA 3LGCA 4MA9A 1DE1A 2CX4A 2IPAA 3CMIA 1BEDA 1G7OA 3CSHA 1ZYEA 1WWJA 1NHYA 5D9XA 3BOAA 4ULXA 3HY2A 5JWQB 2LKUA 2PVOC 4I6XA 4IP1A 1QGVA 2CZ3A 2GZPA 4BWSA 9GSSA 2RM5A 4YQMA 4KDXA 4D73B 2PN8A 3A3TA 2P5RA 3FR6A 2EIOA 4NAXA 4K0NA 1OC8A 4NHZA 3TKSC 2H0IA 4KDUA 5A4VA 1FB0A 4MCUA 3KZQA 1JHBA 4ZIJA 5B7CA 2DLXA 5J5NA 2JADA 1SU9A 1YQ1A 3CYNA 4POLA 4PGTA 5CNWA 2C8UA 1EGOA 3TKQA 1CQHA 5J9CA 2TRXA 2B5XA 2C0DA 1HNBA 4DSSA 4O32A 4J57E 4FO5A 1M2BA 2JSYA 1GH2A 5HFIA 1G7EA 4J56E 1NHOA 2DSAA 4IP6A 3IA1A 3CSJA 3MAKA 2DMMA 2FD3A 2GVPA 3TOUA 4WBJA 4OCEA 5DAKA 1KEBA 2B1KA 5GSSA 1QMVA 4O7HA 2H75A 2HZEA 3HKRA 2OBKA 2H1GA 2LRNA 1M99A 3MDKA 2C0FA 2WDUA 3Q74A 1PL2A 2KP2A 4ML6A 5AIVA 3CXGA 2H19A 1EOGA 2GQLA 1JLVA 1GTIA 1URMA 4XCSA 4ISDA 1O7UA 3CBUA 2WB9A 4YQVA 1AQXA 4EO3A 1V57A 2IMDA 3TRXA 2AHEA 3BCKA 1THOA 20GSA 1FVKA 2TRCP 2K9FA 2OKAA 2FLSA 3TGZA 3KM6A 1SJ6A 1TK5B 3DD3A 2OADA 3KH9A 1ZL9A 3BD2A 5D9VA 1WJKA 3W8SA 3CTGA 1SKWB 4MDCA 5ECMB 1IYHA 1MD3A 2ON7A 2AUVA 3TJFA 2PGTA 4HU7A 1M0UA 3CTFA 3GHAA 2P0GA 3ZTLA 5G1LA 2IMIA 3GA4A 3UEMA 3VURA 1HNCA 1U88A 5IO0A 2K8SA 1SJIA 4ZILA 3F4SA 3ZIVA 2N5BA 1PX7A 4OWYA 2DJ3A 2N5FA 3H1NA 5A5KA 1TK0B 4KSMA 2PBJA 1Z7PA 2RM6A 4XTSA 4IGJA 2HSHA 4WR4A 2I4AA 2L4CA 1GSUA 2O89A 2VL9A 4ZB9A 4ECBA 1M7TA 1Z6MA 1G0TA 5G2ZA 3HJMA 3C1RA 3IK9A 4K9ZA 4PQIA 1K3OA 4ECJA
chains in the Genus database with same CATH superfamily
4K1FA 1HQOA 2HSMA 4PNFA 2KUCA 5D8IA 2WRTA 2F51A 1XWCA 4YH2A 2C1YA 2GSQA 3NOFA 3UL3A 1DBYA 3CRTA 3O76A 5DJMA 1YY7A 1G6WA 1NM3A 2WGRA 4EDYA 4HZ2A 3FK8A 3MWHA 1AIUA 3M3MA 1X0RA 2JSZA 1VF3A 4NPBA 3DRNA 4E8HA 3GNJA 1VF1A 2LJKA 2PPTA 3KTLA 4HSCX 4N0VA 2VOCA 3IV4A 1JLWA 4DVCA 1GRXA 4LL1B 1JZWA 5HR0A 4G2EA 4FYBA 6GSTA 3F0IA 4QQ7A 4K7OA 2B5YA 2V32A 4POMA 3APOA 2K8VA 4PUFC 2DJJA 4MK3A 1GTAA 1PN9A 4TVEA 1F37A 2WCIA 4V2NA 3L78A 1ZCPA 1F3AA 3VLNA 2CZ2A 4TOPA 3FEUA 2AB6A 13GSA 2A4VA 3LYKA 5H5QA 4RUVA 1XWAA 3EE2A 5G1KA 3IPZA 3MYDA 2H70A 5ECQB 2X8GA 2YZUA 3KH7A 4V2LA 3VI7A 1U6TA 2HFDA 4HI7A 3IAM2 4HJ2A 3GX8A 1PL1A 1THXA 4KGIA 5D9TA 5LCZA 3D4MA 4KAEA 1TXXA 2QC7A 3ERWA 3QFAC 3D0ZA 1AQVA 3EU4A 1UA5A 1ZMAA 1E6BA 2X49A 1UN2A 4JEDA 4QL7A 2YCDA 4N30A 1V58A 2K6VA 4TR4A 3P7XA 3TCOA 4KB3A 1Q4JA 1LJRA 2H66A 4DSRA 4OMVA 4AF2A 4GSSA 2VAFA 1K0NA 4A5PA 1A8YA 1T7PB 2O85A 1EEJA 1G6YA 5ELGA 4J2FA 2LNTA 3R2QA 4PQHA 3EWLA 2YJ7A 3LYPA 3HVXA 4LMWA 1XPVA 2QKEA 4TR3A 2YPMA 2V1MA 4L5LA 2HSYA 1GTUA 4Z2TA 1X5CA 3WT1A 2VM2A 1FG4A 2J9HA 1OAZA 2VD0A 3UARA 3VPTA 1GSFA 2ES7A 4POBA 2DIZA 1J9BA 4RQXA 4YKFA 4KA0A 1OKTA 2E0QA 3DGQA 5KN1A 2GT5A 3F4RA 2AJQB 1MDIA 2AYTA 2VL2A 4JE1A 6GSXA 4WF4A 2VCTA 1A24A 3LJRA 4P3YB 1PRXA 2YJHA 2IN3A 3F8UA 4ICYA 1WRYA 5IOWA 2NPBA 1XXUA 2VCVA 1V2AA 2LQQA 5KN0A 1PKWA 5KN2A 4PQ1A 2LNSA 2L5LA 3D4TA 4BL7A 4MP4A 1HNAA 3TUEA 2DJ0A 5IMFA 2YWMA 5ECNB 2FWFA 4GCIA 4ECCA 4K5RA 5G5FA 1C72A 11GSA 4KCAA 2GGTA 2LUSA 3GKKA 4DSQA 3APQA 3H4KA 2YANA 1XIYA 3H8QA 5EVOA 3ED3A 5ELAA 3WGDA 2PUKC 2FNOA 4GRFA 3FZAA 2FWEA 1QFNA 1S3CA 2QSIA 4RQRA 3O6TA 2P31A 2DIYA 2FCHA 1K0CA 3K8NA 4WETA 1T8EB 1ZOFA 2YOIA 5CRHA 1UC7A 4KDYA 1QXHA 3BBYA 4OO4A 3HCZA 2XBQA 5IMDA 1Z5YE 1EGRA 2H1AA 5ID2A 4QL9A 5IMVA 5BRTA 2H30A 5JCGA 3LXTA 2X8CA 3M8NA 1GLQA 3TJBA 1J0FA 4BVYA 4OFMA 1J08A 4TXOA 3UVHA 5G30A 4KW6A 3C73A 3IRAA 5CAXA 3MIXA 2OBIA 2REMA 3ZRDA 2LS5A 3LORA 1VF4A 1O6JA 6GSYA 2JU5A 1K3YA 2ON5A 4TXVA 2DJKA 2KHPA 5C04A 4TW5A 4HOJA 4NV5A 3E9JB 3DEXA 4BVXB 4XS6A 4IKHA 1SKSB 1V98A 1BJXA 1MDJA 1GULA 2MMOA 4BWQA 2B1LA 2GDRA 3GUSA 2AV4A 2PWJA 2VLVA 5HR1A 4TKYA 4F0BA 1PGTA 1PMTA 2CX3A 4GQCA 1PA3A 1BQ7A 2G2QA 1EEMA 5B6MA 1SK1A 3TOTA 2N5AA 3ISOA 2BTOT 3LQ7A 3D21A 1JZOA 3U5RE 2H1BA 2HZFA 1SD9A 5CRGA 4TR1B 2VM1A 4TN8A 3TRQA 5IO2A 2XBIA 5CYYA 1ABAA 1TTZA 5EY6A 3ZIJA 3L0HA 3NZNA 4KX4A 3FRCA 5B8BA 3KMOA 2GSRA 2YWIA 1OE8A 3KIJA 5AIXA 1XWBA 1EV4A 2F8FA 4CDOA 1X9WB 2H71A 4JZQA 4TRXA 1NW2A 1XW9A 5ECIB 4KUNA 3BJ5A 4G0KA 3VK9A 3LWAA 5FHIA 2I81A 2LRCA 3KCMA 1AC1A 1FO5A 1OC9A 3KMNA 5IQYA 4X1UA 4USSA 4MABA 3IAS2 1EOHA 4CW9A 1KTEA 3A5IA 1SJZA 4LLRA 5IPHA 1ILOA 2L5OA 3UJ1A 1I9DA 2E2GA 4YQUA 3IC4A 3QD9A 3MNGA 3G7IA 1WOUA 2KLXA 2L57A 2NTOA 2H73A 2D2ZA 2FUG2 3ME7A 2JZSA 1UVZA 3TJKA 2GLRA 3NIVA 3SBCA 3ZVJD 3TJGA 4EKZA 1O8XA 1YF0A 5A4WA 2IMKA 4MJEA 5DQYA 5KN3A 2FA8A 3C7MA 3O3TA 2HXKA 3ZFLA 4K0GA 4GXZA 2G0FA 4IN0A 4XS4B 5FWGA 4IHUA 4AJ7A 2YZHA 2BMXA 3LG6A 1T00A 1U87A 1N8JA 2V6OA 4N0ZA 1XWKA 1W89A 5COHA 2HI7A 1B48A 2IWTA 3UAPA 4RI6A 1R5AA 1PSQA 2EIRA 3IC8A 2IFQA 3GL3A 3GIXA 4ZBDA 2MMNA 3GSSA 4XHMA 3GN3A 4DEJA 1XOAA 3ZREA 3HD5A 4MLYA 1SYRA 4PUAA 2YNXA 4FQUA 3GTUA 4PXOA 4ZB6A 2C3QA 5KOXA 3ZFBA 3HXSA 4LMVA 3FZ4A 3IBHA 5CRWA 2IMFA 4YAPA 4DSSB 2CVDA 3I69A 4KCEA 1XVWA 2HRFA 3I43A 3QAVA 3GH6A 2OE0A 2L4QA 3APSA 4XIHA 3QFBC 2I1UA 3F4TA 2CQ9A 5DJLA 4HEA2 5J3RA 1R5PA 4N10A 5DAKB 1Z6NA 4JR6A 4FYUA 4WR5A 1B9YC 2HZEB 3HVNA 2DJ2A 2O8VB 1K0BA 1TKDB 1FAAA 2WS2A 1X9MB 1M9AA 5DCGA 1FOVA 3JCML 4WEYA 2CAIA 3UOMA 10GSA 3EURA 2DKIA 2VLUA 3F3RA 4NXIA 5IPGA 1OKDA 4EF0A 4Z2UA 2M46A 4F0CA 3UIWA 2DBCA 1TI3A 4Q5RA 2VD1A 3FZ9A 4K8MA 3U6VA 4KE3A 4O5QA 3QAWA 2PU9C 1PKZA 3DKSA 1XOBA 5G5EA 2EC4A 3IR4A 5GAND 2EIQA 4XRAA 4O92A 1AUCA 2L59A 3M9JA 1YF1A 1XFLA 3DXBA 3GRXA 2VIMA 2LJAA 1SD8A 3QAGA 2LTKA 4ECIA 3G7YA 1A2MA 1EZKA 2QGVA 4EIPA 2XC2A 2QA1A 5DALA 4E8EA 3J7Yb 3E3EA 1A23A 1WPIA 4GSNA 1K0DA 3GSTA 2H1DA 3HVVA 1OE7A 2A2PA 2C80A 3EU3A 4I2TA 4I97A 4WXTA 1R7HA 5ECSA 2H6XA 1XW5A 4YAVA 1O85A 5ECLB 3WGXA 1PN0A 4EE0A 1GWCA 1A2JA 5GSTA 4GLTA 3FKFA 5HQPA 5B8AA 2R37A 1RQMA 1I5GA 2HE3A 2H0HA 1YJ6A 3HA9A 1GLPA 1O8WA 1BAYA 5HR2A 1TU7A 1ZYPA 3PR8A 1ZZYA 5JWRB 4NWYA 4MMMA 3HYPA 2VL3A 4ZB8A 5GAPD 2XPDA 2C4JA 3EMXA 2UZ8A 3A2VA 1A0FA 2V2GA 1ACVA 2TIRA 5BMUA 1ERTA 3US3A 2GS3A 2MZCA 4WBRD 2L6CA 3TB2A 1Q98A 5IIZA 3M0FA 1EV9A 4EC0A 3ZITA 3IDVA 5EL8A 4D73A 4BA7A 5B6NA 2MBTA 2WFCA 4F2IA 1XCCA 1SL2B 7GSSA 5IM9A 2H0GA 2GZYA 5DVBA 1Y25A 3VWUA 1MTCA 3AY8A 1XG8A 1WIKA 2YP6A 2R4VA 2VLTA 2C0EA 2H6YA 1F9MA 4ACSA 2MMZA 3DIEA 4ZBBA 1K0MA 3GH9A 2GZZA 3TDGA 4HU9A 2HLSA 3D22A 2J23A 4IJIA 3GL5A 1AAZA 1ML6A 3QDNA 2JL4A 4XRDA 16GSA 3ERGA 3HVSA 3GV1A 1QUWA 3PGTA 1IYIA 4IELA 1YEPA 3KP8A 3S9FA 3L9VA 2B5EA 4AJ6A 1XVQA 5D93A 2AAWA 1TW9A 3LEFA 1SL0B 3ME8A 5LNKe 3VWVA 2JZTA 3IOSA 2C3NA 3M9KA 2MMAA 4ZL9A 2R2JA 1RK4A 3HZ8A 1LU4A 1BG5A 2LRTA 5H5RA 4PNGA 1GTBA 1O73A 2CAQA 1M2AA 1QK8A 4MZCA 2X4AA 5LD0A 3GKXA 1SYXA 2B6MA 2V6KA 4CY8A 2VL2C 1OYJA 4X4JA 1MDKA 2FHEA 3G9BA 1GSDA 8GSSA 3KTBA 4KH7A 3L9UA 5IMAA 4TR0A 1XWGA 3UBKA 1GUMA 2H8LA 4OO5A 2IJYA 4NMUA 3LSZA 2RLIA 5HR3A 4MF7A 4EDZA 3IK7A 5IOXA 5G31A 4K7IA 3Q6OA 3ZMLA 5JWOB 1X5DA 4BPYA 5F8BA 2B3SA 3M1GA 12GSA 1ON4A 3TKSA 3C1SA 3I6AA 5C00A 2OACA 4JRRA 1T4YA 4EL1A 3VI5A 2PVQA 2YWNA 5AN1A 2R6KA 1ERUA 3RHCA 4LA1A 3OR5A 4MH3A 1TRSA 1GNWA 3GKMA 5H5SA 3ZZXA 1M9BA 4MZWA 1ERVA 4OFNA 3F9UA 3RBTA 5F06A 2E2MA 5IMCA 1NSWA 1M3IA 4XS4A 3FHKA 4L5OA 2HNLA 2GSTA 3N9JA 2VCWA 1WMJA 1YKAA 1A2LA 4OD7A 2WJUA 4IQ1A 3E0UA 4MF5A 2XHFA 3TKSE 2O7KA 1ZYQB 5HFKA 5IMZA 3EMPA 3FR9A 2OE3A 3GYKA 3DYRA 4MF6A 4X0XA 4FIWA 3D5JA 2V41A 2MBSA 2HYXA 4IW9A 4G19A 2VCXA 4X43A 1YKCA 22GSA 1CQGA 3ZVJA 2CVBA 1GSSA 3KGKA 1FW1A 4MJCA 5INYA 1TOFA 2K18A 3H93A 3CRUA 4NV2A 3N5OA 3KJYA 3BCIA 1O81A 2BJXA 3IHQA 1FHEA 3A2WA 1USBA 3HHVA 5ENUA 3KEBA 2ZNMA 4BL7B 4GSTA 3F3QA 1SK2A 2PMTA 3J7Yk 2H72A 2GQMA 1M2DA 1V9WA 4IBPA 1GSEA 4O5RA 1BX9A 3EC3A 4OCFA 2DC5A 5ABRA 2IIYA 2IMEA 3TKRA 1TRWA 3H79A 2R5GA 2PERA 1TP9A 4IQAA 2VUPA 3FZ5A 1S3RA 1SKRB 3QCPA 4L0UA 3I9V2 2GT6A 14GSA 4BIKA 3CSIA 3TRPA 1SK0A 4Q5QA 2NBSA 5DCHA 5ID2B 2M72A 2I3YA 3C8EA 2OA7A 3L4NA 5EPFA 2YN1A 5F07A 4MZBA 4ZXGA 6GSUA 2R0CA 4K5SA 3F63A 1GL8A 3ZYWA 5J9BA 1A8LA 3F6DA 1F6MC 4BVYB 2H74A 4TXOB 3ZMKA 3GKNA 1KNGA 1X5EA 5ECRB 2VO4A 4GTUA 1HD2A 3WD6A 2LSTA 4N11A 4GF0A 5CP1A 1A0RP 3A5WA 5AISA 1N2AA 3A2XA 3W8JA 2H76A 3R3EA 3FW2A 3QR6A 2NVLA 2JZRA 1E2YA 4RI7A 1B9XC 1H4OA 4G0IA 4ML1A 1DSBA 2MYGA 1R26A 4WKWA 4FYCA 5DQSA 2L6DA 1TU8A 1EWXA 4MJAA 1LBKA 2LQOA 2X64A 1H75A 2H01A 2I9HA 1F3BA 1B8XA 1XW6A 4IJ3A 5CRDA 3P2AA 3G7JA 3IXRA 1VRSD 4V1Ag 4CHSA 1GSQA 3ERFA 2B7JA 3D6IA 4ID0A 3DVWA 3EPTA 1T3BA 5ECPB 1VGLA 3RPPA 1GNEA 4H86A 4V2MA 2KOKA 4MPGA 2HT9A 3Q18A 3FY7A 5J4UA 4G10A 3VWWA 2KP1A 1SL1B 4ILFA 3RAZA 2LEGA 2XPEA 5D96A 3DVXA 17GSA 3PINA 3GFKA 1PQNA 3HJOA 18GSA 4I8BA 4MH2A 5JCWA 1K0AA 3GURA 4HDEA 4F9ZA 3WYWA 5D9WA 2WULA 2FY6A 4PURA 3P90A 2FGXA 4Q5NA 2R0GA 1GUKA 3GX0A 1MEKA 3UBLA 4KNDA 1TJDA 4AGSA 1K3LA 2CA8A 3KXOA 4F82A 4WF5A 2RIIA 5FT3A 3F6FA 4L0WA 4OFTA 1OC9B 4G9HA 2X99A 1FB6A 4HQZA 4AJ8A 2CVKA 1WP0A 3VWXA 1TRUA 2YV7A 4Z2RA 2P5QA 4V1Ap 3LXZA 2F3MA 1JFUA 4KSOA 1WE0A 5L71A 2FWGA 4ZBAA 4HS1A 2HRAA 3RPNA 4ZL7A 4KF9A 2WZ9A 2GSSA 2C0GA 1JZRA 1Z9HA 2RUFA 4F03A 5E59A 1V40A 1U3AA 3SWLA 5ECKB 2A2SA 3QMXA 1DUGA 5D73A 2NDOA 1GUHA 1TRVA 2A2RA 2DJ1A 1TI1A 3L9SA 1ZGNA 4HZ4A 5A4UA 2VCZA 2IL3A 1GP1A 2HRKA 4EVMA 6GSWA 5CREA 1KBNA 2CT6A 2M80A 1B4PA 1B4QA 5JCUA 2R3XA 3UVTA 1X9SB 4K7NA 4EUYA 4HUAA 2OE1A 2IFQB 3HZ4A 1AQWA 3FMWA 4Q5FA 4JU5A 2C3TA 4XS1A 3TKPA 1VF2A 1AW9A 4JR4A 5E4WA 3RDWA 4EXJA 3TJJA 2RUEA 3FYGA 5ECHB 2GTUA 3EYTA 5F05A 1XZOA 3W6GA 4JBBA 5CO3A 1T1VA 3RHBA 3GTUB 3QOUA 4BVXA 3WT2A 4I2UA 1YZXA 3MSZA 1U3IA 2R0PA 4K2DA 4GWRA 4NHWA 1TDIA 5AGYA 4HJMA 2OJLA 1FVJA 1Z3EA 1K0OA 3LFLA 1XBSA 2HRNA 5F0GA 1MD4A 2LV3A 3DMLA 2VCQA 4PX1A 1DE2A 3EVIA 1AXDA 1OC3A 1R4WA 4K6XA 1ST9A 1Z7RA 6GSVA 3FR3A 1Y6EA 2F9SA 3DWVA 4POKA 3ZL5A 3HJPA 3QPMA 3P8WA 3ZLPA 1OVNA 2DMLA 3CQFA 3PPUA 3PH9A 2YWOA 4EIQA 1PX6A 5DBQA 4HQSA 6GSSA 1RW1A 1EP8A 1S3AA 4K2XA 4TR1A 2E7PA 1ERWA 1BYEA 4I5QA 3HDCA 3C71A 5KEJA 3Q19A 1PD21 3IHGA 3WGEA 4IS0A 1TK8B 1YEXA 5ECOB 3KP9A 2B7KA 3EINA 2ALBA 4GQFA 4L8EA 4O5UA 1JZDA 2ZCTA 2Z9SA 1SENA 1QQ2A 3IE3A 3UMAA 3KD0A 4LL4B 4FH8A 2H6ZA 5DALB 3VPQA 5DDLA 2X8HA 4ZL8A 1GSYA 1W4VA 19GSA 4MJBA 1F2EA 2CV4A 3GMFA 1HYUA 2ZUPA 5HFGA 1S3DA 5GZZB 1PFOA 2FWHA 4MPFA 2GQKA 1EP7A 4IVFA 4CY6A 2LJRA 3V1WA 2FA4A 4Z7XA 3VFIA 5J41A 1T4ZA 1YDKA 2F8AA 2YV9A 2O87A 2JACA 3LGCA 4MA9A 1DE1A 2CX4A 2IPAA 3CMIA 1BEDA 1G7OA 3CSHA 1ZYEA 1WWJA 1NHYA 5D9XA 3BOAA 4ULXA 3HY2A 5JWQB 2LKUA 2PVOC 4I6XA 4IP1A 1QGVA 4YKGA 2CZ3A 2GZPA 4BWSA 9GSSA 2RM5A 4YQMA 4KDXA 4D73B 2PN8A 3A3TA 2P5RA 3FR6A 2EIOA 4NAXA 4K0NA 1OC8A 4NHZA 3TKSC 2H0IA 4KDUA 5A4VA 1FB0A 4MCUA 3KZQA 1JHBA 4ZIJA 5B7CA 2DLXA 5J5NA 2JADA 1SU9A 1YQ1A 3CYNA 4POLA 4PGTA 5CNWA 3LW9A 2C8UA 4G0LA 1EGOA 3TKQA 1CQHA 5J9CA 2TRXA 2B5XA 2C0DA 1HNBA 4DSSA 4O32A 4J57E 4FO5A 1M2BA 2JSYA 1GH2A 5HFIA 1G7EA 2QA2A 4J56E 1NHOA 2DSAA 4IP6A 3IA1A 3CSJA 3MAKA 2DMMA 2FD3A 2GVPA 3TOUA 4WBJA 4OCEA 5DAKA 1KEBA 2B1KA 5GSSA 1QMVA 4O7HA 2H75A 2HZEA 3HKRA 2OBKA 2H1GA 2LRNA 1FOHA 1M99A 3MDKA 2C0FA 2WDUA 3Q74A 1PL2A 2KP2A 4ML6A 5AIVA 3CXGA 2H19A 1EOGA 2GQLA 1JLVA 1GTIA 1URMA 4XCSA 4ISDA 1O7UA 3CBUA 1ZYNA 2WB9A 4YQVA 1AQXA 4EO3A 1V57A 2IMDA 3TRXA 2AHEA 3BCKA 1THOA 20GSA 1FVKA 2TRCP 2K9FA 2OKAA 2FLSA 3TGZA 3KM6A 1SJ6A 1TK5B 2DKHA 3DD3A 2OADA 3KH9A 1ZL9A 3BD2A 5D9VA 1WJKA 3W8SA 3CTGA 1SKWB 2A4HA 4MDCA 5ECMB 1IYHA 1MD3A 2ON7A 2AUVA 3TJFA 2PGTA 4HU7A 1M0UA 3CTFA 3GHAA 2P0GA 3ZTLA 5G1LA 2IMIA 3GA4A 3UEMA 3VURA 1HNCA 1U88A 5IO0A 2K8SA 1SJIA 4ZILA 3F4SA 3ZIVA 2N5BA 1PX7A 4OWYA 2DJ3A 2N5FA 1M3JA 3H1NA 5A5KA 1TK0B 4KSMA 2PBJA 1Z7PA 2RM6A 4XTSA 4IGJA 2HSHA 4WR4A 2I4AA 2L4CA 1GSUA 4MNNA 4PTSA 2O89A 2VL9A 5KOWA 4ZB9A 4ECBA 1M7TA 1Z6MA 1G0TA 5G2ZA 3HJMA 3C1RA 3IK9A 4K9ZA 4PQIA 1K3OA 4ECJA
chains in the Genus database with same CATH topology
4K1FA 1HQOA 2HSMA 4PNFA 2KUCA 5D8IA 2WRTA 2F51A 1XWCA 4YH2A 2C1YA 2GSQA 3NOFA 3UL3A 1DBYA 3CRTA 3O76A 5DJMA 1YY7A 1G6WA 1NM3A 2WGRA 4EDYA 4HZ2A 3FK8A 3MWHA 1AIUA 3M3MA 1X0RA 2JSZA 1VF3A 4NPBA 3DRNA 4E8HA 3GNJA 1VF1A 2LJKA 2PPTA 3KTLA 4N0VA 2VOCA 3IV4A 1JLWA 4DVCA 1GRXA 4LL1B 1JZWA 5HR0A 4G2EA 4FYBA 6GSTA 3F0IA 4QQ7A 4K7OA 2B5YA 2V32A 4POMA 3APOA 2K8VA 4PUFC 2DJJA 4MK3A 1GTAA 1PN9A 4TVEA 1F37A 2WCIA 4V2NA 3L78A 1ZCPA 1F3AA 3VLNA 2CZ2A 4TOPA 3FEUA 2AB6A 13GSA 2A4VA 3LYKA 5H5QA 4RUVA 1XWAA 3EE2A 5G1KA 3IPZA 3MYDA 2H70A 5ECQB 2X8GA 2YZUA 3KH7A 4V2LA 3VI7A 1U6TA 2HFDA 4HI7A 3IAM2 4HJ2A 3GX8A 1PL1A 1THXA 4KGIA 5D9TA 5LCZA 3D4MA 4KAEA 1TXXA 2QC7A 3ERWA 3QFAC 3D0ZA 1AQVA 3EU4A 1UA5A 1ZMAA 1E6BA 2X49A 1UN2A 4JEDA 4QL7A 2YCDA 4N30A 1V58A 2K6VA 4TR4A 3P7XA 3TCOA 4KB3A 1Q4JA 1LJRA 2H66A 4DSRA 4OMVA 4AF2A 4GSSA 2VAFA 1K0NA 4A5PA 1A8YA 1T7PB 2O85A 1EEJA 1G6YA 5ELGA 4J2FA 2LNTA 3R2QA 4PQHA 3EWLA 2YJ7A 3LYPA 3HVXA 4LMWA 1XPVA 2QKEA 4TR3A 2YPMA 2V1MA 4L5LA 2HSYA 1GTUA 4Z2TA 1X5CA 3WT1A 2VM2A 1FG4A 2J9HA 1OAZA 2VD0A 3UARA 3VPTA 1GSFA 2ES7A 4POBA 2DIZA 1J9BA 4RQXA 4YKFA 4KA0A 1OKTA 2E0QA 3DGQA 5KN1A 2GT5A 3F4RA 2AJQB 1MDIA 2AYTA 2VL2A 4JE1A 6GSXA 4WF4A 2VCTA 1A24A 3LJRA 4P3YB 1PRXA 2YJHA 2IN3A 3F8UA 4ICYA 1WRYA 5IOWA 2NPBA 1XXUA 2VCVA 1V2AA 2LQQA 5KN0A 1PKWA 5KN2A 4PQ1A 2LNSA 2L5LA 3D4TA 4BL7A 4MP4A 1HNAA 3TUEA 2DJ0A 5IMFA 2YWMA 5ECNB 2FWFA 4GCIA 4ECCA 4K5RA 5G5FA 1C72A 11GSA 4KCAA 2GGTA 2LUSA 3GKKA 4DSQA 3APQA 3H4KA 2YANA 1XIYA 3H8QA 5EVOA 3ED3A 5ELAA 3WGDA 2PUKC 2FNOA 4GRFA 3FZAA 2FWEA 1QFNA 1S3CA 2QSIA 4RQRA 3O6TA 2P31A 2DIYA 2FCHA 1K0CA 3K8NA 4WETA 1T8EB 1ZOFA 2YOIA 5CRHA 1UC7A 4KDYA 1QXHA 3BBYA 4OO4A 3HCZA 2XBQA 5IMDA 1Z5YE 1EGRA 2H1AA 5ID2A 4QL9A 5IMVA 5BRTA 2H30A 5JCGA 3LXTA 2X8CA 3M8NA 1GLQA 3TJBA 1J0FA 4BVYA 4OFMA 1J08A 4TXOA 3UVHA 5G30A 4KW6A 3C73A 3IRAA 5CAXA 3MIXA 2OBIA 2REMA 3ZRDA 2LS5A 3LORA 1VF4A 1O6JA 6GSYA 2JU5A 1K3YA 2ON5A 4TXVA 2DJKA 2KHPA 5C04A 4TW5A 4HOJA 4NV5A 3E9JB 3DEXA 4BVXB 4XS6A 4IKHA 1SKSB 1V98A 1BJXA 1MDJA 1GULA 2MMOA 4BWQA 2B1LA 2GDRA 3GUSA 2AV4A 2PWJA 2VLVA 5HR1A 4TKYA 4F0BA 1PGTA 1PMTA 2CX3A 4GQCA 1PA3A 1BQ7A 2G2QA 1EEMA 5B6MA 1SK1A 3TOTA 2N5AA 3ISOA 2BTOT 3LQ7A 3D21A 1JZOA 3U5RE 2H1BA 2HZFA 1SD9A 5CRGA 4TR1B 2VM1A 4TN8A 3TRQA 5IO2A 2XBIA 5CYYA 1ABAA 1TTZA 5EY6A 3ZIJA 3L0HA 3NZNA 4KX4A 3FRCA 5B8BA 3KMOA 2GSRA 2YWIA 1OE8A 3KIJA 5AIXA 1XWBA 1EV4A 2F8FA 4CDOA 1X9WB 2H71A 4JZQA 4TRXA 1NW2A 1XW9A 5ECIB 4KUNA 3BJ5A 4G0KA 3VK9A 3LWAA 5FHIA 2I81A 2LRCA 3KCMA 1AC1A 1FO5A 1OC9A 3KMNA 5IQYA 4X1UA 4USSA 4MABA 3IAS2 1EOHA 4CW9A 1KTEA 3A5IA 1SJZA 4LLRA 5IPHA 1ILOA 2L5OA 3UJ1A 1I9DA 2E2GA 4YQUA 3IC4A 3QD9A 3MNGA 3G7IA 1WOUA 2KLXA 2L57A 2NTOA 2H73A 2D2ZA 2FUG2 3ME7A 2JZSA 1UVZA 3TJKA 2GLRA 3NIVA 3SBCA 3ZVJD 3TJGA 4EKZA 1O8XA 1YF0A 5A4WA 2IMKA 4MJEA 5DQYA 5KN3A 2FA8A 3C7MA 3O3TA 2HXKA 3ZFLA 4K0GA 4GXZA 2G0FA 4IN0A 4XS4B 5FWGA 4IHUA 4AJ7A 2YZHA 2BMXA 3LG6A 1T00A 1U87A 1N8JA 2V6OA 4N0ZA 1XWKA 1W89A 5COHA 2HI7A 1B48A 2IWTA 3UAPA 4RI6A 1R5AA 1PSQA 2EIRA 3IC8A 2IFQA 3GL3A 3GIXA 4ZBDA 2MMNA 3GSSA 4XHMA 3GN3A 4DEJA 1XOAA 3ZREA 3HD5A 4MLYA 1SYRA 4PUAA 2YNXA 4FQUA 3GTUA 4PXOA 4ZB6A 2C3QA 5KOXA 3ZFBA 3HXSA 4LMVA 3FZ4A 3IBHA 5CRWA 2IMFA 4YAPA 4DSSB 2CVDA 3I69A 4KCEA 1XVWA 2HRFA 3I43A 3QAVA 3GH6A 2OE0A 2L4QA 3APSA 4XIHA 3QFBC 2I1UA 3F4TA 2CQ9A 5DJLA 4HEA2 5J3RA 1R5PA 4N10A 5DAKB 1Z6NA 4JR6A 4FYUA 4WR5A 1B9YC 2HZEB 2DJ2A 2O8VB 1K0BA 1TKDB 1FAAA 2WS2A 1X9MB 1M9AA 5DCGA 1FOVA 3JCML 4WEYA 2CAIA 3UOMA 10GSA 3EURA 2DKIA 2VLUA 3F3RA 4NXIA 5IPGA 1OKDA 4EF0A 4Z2UA 2M46A 4F0CA 3UIWA 2DBCA 1TI3A 4Q5RA 2VD1A 3FZ9A 4K8MA 3U6VA 4KE3A 4O5QA 3QAWA 2PU9C 1PKZA 3DKSA 1XOBA 5G5EA 2EC4A 3IR4A 5GAND 2EIQA 4XRAA 4O92A 1AUCA 2L59A 3M9JA 1YF1A 1XFLA 3DXBA 3GRXA 2VIMA 2LJAA 1SD8A 3QAGA 2LTKA 4ECIA 3G7YA 1A2MA 1EZKA 2QGVA 4EIPA 2XC2A 2QA1A 5DALA 4E8EA 3J7Yb 3E3EA 1A23A 1WPIA 4GSNA 1K0DA 3GSTA 2H1DA 3HVVA 1OE7A 2A2PA 2C80A 3EU3A 4I2TA 4I97A 4WXTA 1R7HA 5ECSA 2H6XA 1XW5A 4YAVA 1O85A 5ECLB 3WGXA 1PN0A 4EE0A 1GWCA 1A2JA 5GSTA 4GLTA 3FKFA 5HQPA 5B8AA 2R37A 1RQMA 1I5GA 2HE3A 2H0HA 1YJ6A 3HA9A 1GLPA 1O8WA 1BAYA 5HR2A 1TU7A 1ZYPA 3PR8A 1ZZYA 5JWRB 4NWYA 4MMMA 3HYPA 2VL3A 4ZB8A 5GAPD 2XPDA 2C4JA 3EMXA 2UZ8A 3A2VA 1A0FA 2V2GA 1ACVA 2TIRA 5BMUA 1ERTA 3US3A 2GS3A 2MZCA 4WBRD 2L6CA 3TB2A 1Q98A 5IIZA 3M0FA 1EV9A 4EC0A 3ZITA 3IDVA 5EL8A 4D73A 4BA7A 5B6NA 2MBTA 2WFCA 4F2IA 1XCCA 1SL2B 7GSSA 5IM9A 2H0GA 2GZYA 5DVBA 1Y25A 3VWUA 1MTCA 3AY8A 1WIKA 2YP6A 2R4VA 2VLTA 2C0EA 2H6YA 1F9MA 4ACSA 2MMZA 3DIEA 4ZBBA 1K0MA 3GH9A 2GZZA 3TDGA 4HU9A 2HLSA 3D22A 2J23A 4IJIA 3GL5A 1AAZA 1ML6A 3QDNA 2JL4A 4XRDA 16GSA 3ERGA 3HVSA 3GV1A 1QUWA 3PGTA 1IYIA 4IELA 1YEPA 3KP8A 3S9FA 3L9VA 2B5EA 4AJ6A 1XVQA 5D93A 2AAWA 1TW9A 3LEFA 1SL0B 3ME8A 5LNKe 3VWVA 2JZTA 3IOSA 2C3NA 3M9KA 2MMAA 4ZL9A 2R2JA 1RK4A 3HZ8A 1LU4A 1BG5A 2LRTA 5H5RA 4PNGA 1GTBA 1O73A 2CAQA 1M2AA 1QK8A 4MZCA 2X4AA 5LD0A 3GKXA 1SYXA 2B6MA 2V6KA 4CY8A 2VL2C 1OYJA 4X4JA 1MDKA 2FHEA 3G9BA 1GSDA 8GSSA 3KTBA 4KH7A 3L9UA 5IMAA 4TR0A 1XWGA 3UBKA 1GUMA 2H8LA 4OO5A 2IJYA 4NMUA 3LSZA 2RLIA 5HR3A 4MF7A 4EDZA 3IK7A 5IOXA 5G31A 4K7IA 3Q6OA 3ZMLA 5JWOB 1X5DA 4BPYA 5F8BA 2B3SA 3M1GA 12GSA 1ON4A 3TKSA 3C1SA 3I6AA 5C00A 2OACA 4JRRA 1T4YA 4EL1A 3VI5A 2PVQA 2YWNA 5AN1A 2R6KA 1ERUA 3RHCA 4LA1A 3OR5A 4MH3A 1TRSA 1GNWA 3GKMA 5H5SA 3ZZXA 1M9BA 4MZWA 1ERVA 4OFNA 3F9UA 3RBTA 5F06A 2E2MA 5IMCA 1NSWA 4XS4A 3FHKA 4L5OA 2HNLA 2GSTA 3N9JA 2VCWA 1WMJA 1YKAA 1A2LA 4OD7A 2WJUA 4IQ1A 3E0UA 4MF5A 2XHFA 3TKSE 2O7KA 1ZYQB 5HFKA 5IMZA 3EMPA 3FR9A 2OE3A 3GYKA 3DYRA 4MF6A 4X0XA 4FIWA 3D5JA 2V41A 2MBSA 2HYXA 4IW9A 4G19A 2VCXA 4X43A 1YKCA 22GSA 1CQGA 3ZVJA 2CVBA 1GSSA 3KGKA 1FW1A 4MJCA 5INYA 1TOFA 2K18A 3H93A 3CRUA 4NV2A 3N5OA 3KJYA 3BCIA 1O81A 2BJXA 3IHQA 1FHEA 3A2WA 1USBA 3HHVA 5ENUA 3KEBA 2ZNMA 4BL7B 4GSTA 3F3QA 1SK2A 2PMTA 3J7Yk 2H72A 2GQMA 1M2DA 1V9WA 4IBPA 1GSEA 4O5RA 1BX9A 3EC3A 4OCFA 2DC5A 5ABRA 2IIYA 2IMEA 3TKRA 1TRWA 3H79A 2R5GA 2PERA 1TP9A 4IQAA 2VUPA 3FZ5A 1SKRB 3QCPA 4L0UA 3I9V2 2GT6A 14GSA 3CSIA 3TRPA 1SK0A 4Q5QA 2NBSA 5DCHA 5ID2B 2M72A 2I3YA 3C8EA 2OA7A 3L4NA 5EPFA 2YN1A 5F07A 4MZBA 4ZXGA 6GSUA 2R0CA 4K5SA 3F63A 1GL8A 3ZYWA 5J9BA 1A8LA 3F6DA 1F6MC 4BVYB 2H74A 4TXOB 3ZMKA 3GKNA 1KNGA 1X5EA 5ECRB 2VO4A 4GTUA 1HD2A 3WD6A 2LSTA 4N11A 4GF0A 5CP1A 1A0RP 3A5WA 5AISA 1N2AA 3A2XA 3W8JA 2H76A 3R3EA 3FW2A 3QR6A 2NVLA 2JZRA 1E2YA 4RI7A 1B9XC 1H4OA 4G0IA 4ML1A 1DSBA 2MYGA 1R26A 4WKWA 4FYCA 5DQSA 2L6DA 1TU8A 1EWXA 4MJAA 1LBKA 2LQOA 2X64A 1H75A 2H01A 2I9HA 1F3BA 1B8XA 1XW6A 4IJ3A 5CRDA 3P2AA 3G7JA 3IXRA 1VRSD 4V1Ag 4CHSA 1GSQA 3ERFA 2B7JA 3D6IA 4ID0A 3DVWA 3EPTA 1T3BA 5ECPB 1VGLA 3RPPA 1GNEA 4H86A 4V2MA 2KOKA 4MPGA 2HT9A 3Q18A 3FY7A 5J4UA 4G10A 3VWWA 2KP1A 1SL1B 4ILFA 3RAZA 2LEGA 2XPEA 5D96A 3DVXA 17GSA 3PINA 3GFKA 1PQNA 3HJOA 18GSA 4I8BA 4MH2A 5JCWA 1K0AA 3GURA 4HDEA 4F9ZA 3WYWA 5D9WA 2WULA 2FY6A 4PURA 3P90A 2FGXA 4Q5NA 2R0GA 1GUKA 3GX0A 1MEKA 3UBLA 4KNDA 1TJDA 4AGSA 1K3LA 2CA8A 3KXOA 4F82A 4WF5A 2RIIA 5FT3A 3F6FA 4L0WA 4OFTA 1OC9B 4G9HA 2X99A 1FB6A 4HQZA 4AJ8A 2CVKA 1WP0A 3VWXA 1TRUA 2YV7A 4Z2RA 2P5QA 4V1Ap 3LXZA 2F3MA 1JFUA 4KSOA 1WE0A 5L71A 2FWGA 4ZBAA 4HS1A 2HRAA 3RPNA 4ZL7A 4KF9A 2WZ9A 2GSSA 2C0GA 1JZRA 1Z9HA 2RUFA 4F03A 5E59A 1V40A 1U3AA 3SWLA 5ECKB 2A2SA 3QMXA 1DUGA 5D73A 2NDOA 1GUHA 1TRVA 2A2RA 2DJ1A 1TI1A 3L9SA 1ZGNA 4HZ4A 5A4UA 2VCZA 2IL3A 1GP1A 2HRKA 4EVMA 6GSWA 5CREA 1KBNA 2CT6A 2M80A 1B4PA 1B4QA 5JCUA 2R3XA 3UVTA 1X9SB 4K7NA 4EUYA 4HUAA 2OE1A 2IFQB 3HZ4A 1AQWA 3FMWA 4Q5FA 4JU5A 2C3TA 4XS1A 3TKPA 1VF2A 1AW9A 4JR4A 5E4WA 3RDWA 4EXJA 3TJJA 2RUEA 3FYGA 5ECHB 2GTUA 3EYTA 5F05A 1XZOA 3W6GA 4JBBA 5CO3A 1T1VA 3RHBA 3GTUB 3QOUA 4BVXA 3WT2A 4I2UA 1YZXA 3MSZA 1U3IA 2R0PA 4K2DA 4GWRA 4NHWA 1TDIA 5AGYA 4HJMA 2OJLA 1FVJA 1Z3EA 1K0OA 3LFLA 1XBSA 2HRNA 5F0GA 1MD4A 2LV3A 3DMLA 2VCQA 4PX1A 1DE2A 3EVIA 1AXDA 1OC3A 1R4WA 4K6XA 1ST9A 1Z7RA 6GSVA 3FR3A 1Y6EA 2F9SA 3DWVA 4POKA 3ZL5A 3HJPA 3QPMA 3P8WA 3ZLPA 1OVNA 2DMLA 3PPUA 3PH9A 2YWOA 4EIQA 1PX6A 5DBQA 4HQSA 6GSSA 1RW1A 1EP8A 1S3AA 4K2XA 4TR1A 2E7PA 1ERWA 1BYEA 4I5QA 3HDCA 3C71A 5KEJA 3Q19A 1PD21 3IHGA 3WGEA 4IS0A 1TK8B 1YEXA 5ECOB 3KP9A 2B7KA 3EINA 2ALBA 4GQFA 4L8EA 4O5UA 1JZDA 2ZCTA 2Z9SA 1SENA 1QQ2A 3IE3A 3UMAA 3KD0A 4LL4B 4FH8A 2H6ZA 5DALB 3VPQA 5DDLA 2X8HA 4ZL8A 1GSYA 1W4VA 19GSA 4MJBA 1F2EA 2CV4A 3GMFA 1HYUA 2ZUPA 5HFGA 1S3DA 5GZZB 2FWHA 4MPFA 2GQKA 1EP7A 4IVFA 4CY6A 2LJRA 3V1WA 2FA4A 4Z7XA 3VFIA 5J41A 1T4ZA 1YDKA 2F8AA 2YV9A 2O87A 2JACA 3LGCA 4MA9A 1DE1A 2CX4A 2IPAA 3CMIA 1BEDA 1G7OA 3CSHA 1ZYEA 1WWJA 1NHYA 5D9XA 3BOAA 4ULXA 3HY2A 5JWQB 2LKUA 2PVOC 4I6XA 4IP1A 1QGVA 4YKGA 2CZ3A 2GZPA 4BWSA 9GSSA 2RM5A 4YQMA 4KDXA 4D73B 2PN8A 3A3TA 2P5RA 3FR6A 2EIOA 4NAXA 4K0NA 1OC8A 4NHZA 3TKSC 2H0IA 4KDUA 5A4VA 1FB0A 4MCUA 3KZQA 1JHBA 4ZIJA 5B7CA 2DLXA 5J5NA 2JADA 1SU9A 1YQ1A 3CYNA 4POLA 4PGTA 5CNWA 3LW9A 2C8UA 4G0LA 1EGOA 3TKQA 1CQHA 5J9CA 2TRXA 2B5XA 2C0DA 1HNBA 4DSSA 4O32A 4J57E 4FO5A 1M2BA 2JSYA 1GH2A 5HFIA 1G7EA 2QA2A 4J56E 1NHOA 2DSAA 4IP6A 3IA1A 3CSJA 3MAKA 2DMMA 2FD3A 2GVPA 3TOUA 4WBJA 4OCEA 5DAKA 1KEBA 2B1KA 5GSSA 1QMVA 4O7HA 2H75A 2HZEA 3HKRA 2OBKA 2H1GA 2LRNA 1FOHA 1M99A 3MDKA 2C0FA 2WDUA 3Q74A 1PL2A 2KP2A 4ML6A 5AIVA 3CXGA 2H19A 1EOGA 2GQLA 1JLVA 1GTIA 1URMA 4XCSA 4ISDA 1O7UA 3CBUA 1ZYNA 2WB9A 4YQVA 1AQXA 4EO3A 1V57A 2IMDA 3TRXA 2AHEA 3BCKA 1THOA 20GSA 1FVKA 2TRCP 2K9FA 2OKAA 2FLSA 3TGZA 3KM6A 1SJ6A 1TK5B 2DKHA 3DD3A 2OADA 3KH9A 1ZL9A 3BD2A 5D9VA 1WJKA 3W8SA 3CTGA 1SKWB 2A4HA 4MDCA 5ECMB 1IYHA 1MD3A 2ON7A 2AUVA 3TJFA 2PGTA 4HU7A 1M0UA 3CTFA 3GHAA 2P0GA 3ZTLA 5G1LA 2IMIA 3GA4A 3UEMA 3VURA 1HNCA 1U88A 5IO0A 2K8SA 1SJIA 4ZILA 3F4SA 3ZIVA 2N5BA 1PX7A 4OWYA 2DJ3A 2N5FA 3H1NA 5A5KA 1TK0B 4KSMA 2PBJA 1Z7PA 2RM6A 4XTSA 4IGJA 2HSHA 4WR4A 2I4AA 2L4CA 1GSUA 4MNNA 4PTSA 2O89A 2VL9A 5KOWA 4ZB9A 4ECBA 1M7TA 1Z6MA 1G0TA 5G2ZA 3HJMA 3C1RA 3IK9A 4K9ZA 4PQIA 1K3OA 4ECJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1F A;  1HQO A;  4PNF A;  2KUC A;  5D8I A;  2WRT A;  2F51 A;  1XWC A;  4YH2 A;  2C1Y A;  2GSQ A;  3NOF A;  3UL3 A;  1DBY A;  3CRT A;  3O76 A;  5DJM A;  1YY7 A;  1G6W A;  1NM3 A;  2WGR A;  4EDY A;  4HZ2 A;  3FK8 A;  3MWH A;  1AIU A;  3M3M A;  1X0R A;  2JSZ A;  1VF3 A;  4NPB A;  3DRN A;  4E8H A;  3GNJ A;  1VF1 A;  2LJK A;  2PPT A;  3KTL A;  4N0V A;  2VOC A;  3IV4 A;  1JLW A;  4DVC A;  1GRX A;  4LL1 B;  1JZW A;  5HR0 A;  4G2E A;  4FYB A;  6GST A;  3F0I A;  4QQ7 A;  4K7O A;  2B5Y A;  2V32 A;  4POM A;  3APO A;  2K8V A;  4PUF C;  2DJJ A;  4MK3 A;  1GTA A;  1PN9 A;  4TVE A;  1F37 A;  2WCI A;  4V2N A;  3L78 A;  1ZCP A;  1F3A A;  3VLN A;  2CZ2 A;  4TOP A;  3FEU A;  2AB6 A;  13GS A;  2A4V A;  3LYK A;  5H5Q A;  4RUV A;  1XWA A;  3EE2 A;  5G1K A;  3IPZ A;  2H70 A;  5ECQ B;  2X8G A;  2YZU A;  3KH7 A;  4V2L A;  3VI7 A;  1U6T A;  2HFD A;  4HI7 A;  3IAM 2;  4HJ2 A;  3GX8 A;  1PL1 A;  1THX A;  4KGI A;  5D9T A;  5LCZ A;  3D4M A;  4KAE A;  1TXX A;  2QC7 A;  3ERW A;  3QFA C;  3D0Z A;  1AQV A;  3EU4 A;  1UA5 A;  1ZMA A;  1E6B A;  1UN2 A;  4JED A;  4QL7 A;  2YCD A;  4N30 A;  1V58 A;  2K6V A;  4TR4 A;  3P7X A;  3TCO A;  4KB3 A;  1Q4J A;  1LJR A;  2H66 A;  4DSR A;  4OMV A;  4AF2 A;  4GSS A;  2VAF A;  1K0N A;  1A8Y A;  1T7P B;  2O85 A;  1EEJ A;  1G6Y A;  5ELG A;  4J2F A;  2LNT A;  3R2Q A;  4PQH A;  3EWL A;  2YJ7 A;  3LYP A;  3HVX A;  4LMW A;  1XPV A;  2QKE A;  4TR3 A;  2YPM A;  2V1M A;  4L5L A;  2HSY A;  1GTU A;  1X5C A;  3WT1 A;  2VM2 A;  1FG4 A;  2J9H A;  1OAZ A;  2VD0 A;  3UAR A;  3VPT A;  1GSF A;  2ES7 A;  4POB A;  2DIZ A;  1J9B A;  4RQX A;  4KA0 A;  1OKT A;  2E0Q A;  3DGQ A;  5KN1 A;  2GT5 A;  3F4R A;  2AJQ B;  1MDI A;  2AYT A;  2VL2 A;  4JE1 A;  6GSX A;  4WF4 A;  2VCT A;  1A24 A;  3LJR A;  4P3Y B;  1PRX A;  2YJH A;  2IN3 A;  3F8U A;  1WRY A;  5IOW A;  2NPB A;  1XXU A;  2VCV A;  1V2A A;  2LQQ A;  5KN0 A;  1PKW A;  5KN2 A;  4PQ1 A;  2LNS A;  2L5L A;  3D4T A;  4BL7 A;  4MP4 A;  1HNA A;  3TUE A;  2DJ0 A;  5IMF A;  2YWM A;  5ECN B;  2FWF A;  4GCI A;  4ECC A;  5G5F A;  1C72 A;  11GS A;  4KCA A;  2GGT A;  2LUS A;  3GKK A;  4DSQ A;  3APQ A;  3H4K A;  2YAN A;  1XIY A;  3H8Q A;  5EVO A;  3ED3 A;  5ELA A;  3WGD A;  2PUK C;  2FNO A;  4GRF A;  3FZA A;  2FWE A;  1QFN A;  1S3C A;  2QSI A;  4RQR A;  3O6T A;  2P31 A;  2DIY A;  2FCH A;  1K0C A;  3K8N A;  4WET A;  1T8E B;  1ZOF A;  2YOI A;  5CRH A;  1UC7 A;  4KDY A;  1QXH A;  3BBY A;  4OO4 A;  3HCZ A;  2XBQ A;  5IMD A;  1Z5Y E;  1EGR A;  2H1A A;  5ID2 A;  4QL9 A;  5IMV A;  2H30 A;  5JCG A;  3LXT A;  2X8C A;  3M8N A;  1GLQ A;  3TJB A;  1J0F A;  4BVY A;  4OFM A;  1J08 A;  4TXO A;  3UVH A;  5G30 A;  4KW6 A;  3C73 A;  3IRA A;  5CAX A;  2OBI A;  2REM A;  3ZRD A;  2LS5 A;  3LOR A;  1VF4 A;  1O6J A;  6GSY A;  2JU5 A;  1K3Y A;  2ON5 A;  4TXV A;  2DJK A;  2KHP A;  5C04 A;  4TW5 A;  4HOJ A;  4NV5 A;  3E9J B;  3DEX A;  4XS6 A;  4IKH A;  1SKS B;  1V98 A;  1BJX A;  1MDJ A;  1GUL A;  2MMO A;  4BWQ A;  2B1L A;  2GDR A;  3GUS A;  2AV4 A;  2PWJ A;  2VLV A;  5HR1 A;  4TKY A;  4F0B A;  1PGT A;  1PMT A;  2CX3 A;  4GQC A;  1PA3 A;  1BQ7 A;  2G2Q A;  1EEM A;  5B6M A;  1SK1 A;  3TOT A;  2N5A A;  3ISO A;  2BTO T;  3LQ7 A;  3D21 A;  1JZO A;  3U5R E;  2H1B A;  2HZF A;  1SD9 A;  5CRG A;  4TR1 B;  2VM1 A;  4TN8 A;  3TRQ A;  5IO2 A;  2XBI A;  5CYY A;  1ABA A;  1TTZ A;  5EY6 A;  3ZIJ A;  3L0H A;  3NZN A;  4KX4 A;  3FRC A;  5B8B A;  3KMO A;  2GSR A;  2YWI A;  1OE8 A;  3KIJ A;  5AIX A;  1XWB A;  1EV4 A;  2F8F A;  4CDO A;  1X9W B;  2H71 A;  4JZQ A;  4TRX A;  1NW2 A;  1XW9 A;  5ECI B;  4KUN A;  3BJ5 A;  3VK9 A;  3LWA A;  5FHI A;  2I81 A;  2LRC A;  3KCM A;  1AC1 A;  1FO5 A;  1OC9 A;  3KMN A;  5IQY A;  4X1U A;  4MAB A;  3IAS 2;  1EOH A;  4CW9 A;  1KTE A;  1SJZ A;  4LLR A;  5IPH A;  1ILO A;  2L5O A;  3UJ1 A;  1I9D A;  2E2G A;  4YQU A;  3IC4 A;  3QD9 A;  3MNG A;  3G7I A;  1WOU A;  2KLX A;  2L57 A;  2NTO A;  2H73 A;  2D2Z A;  2FUG 2;  3ME7 A;  2JZS A;  1UVZ A;  3TJK A;  2GLR A;  3NIV A;  3SBC A;  3ZVJ D;  3TJG A;  4EKZ A;  1O8X A;  1YF0 A;  5A4W A;  2IMK A;  4MJE A;  5DQY A;  5KN3 A;  2FA8 A;  3C7M A;  3O3T A;  2HXK A;  3ZFL A;  4K0G A;  4GXZ A;  2G0F A;  4IN0 A;  4XS4 B;  5FWG A;  4IHU A;  4AJ7 A;  2YZH A;  2BMX A;  3LG6 A;  1T00 A;  1U87 A;  1N8J A;  2V6O A;  4N0Z A;  1XWK A;  1W89 A;  5COH A;  2HI7 A;  1B48 A;  2IWT A;  3UAP A;  4RI6 A;  1R5A A;  1PSQ A;  2EIR A;  2IFQ A;  3GL3 A;  3GIX A;  4ZBD A;  2MMN A;  3GSS A;  4XHM A;  3GN3 A;  4DEJ A;  1XOA A;  3ZRE A;  3HD5 A;  4MLY A;  1SYR A;  4PUA A;  2YNX A;  3GTU A;  4PXO A;  4ZB6 A;  2C3Q A;  3ZFB A;  3HXS A;  4LMV A;  3FZ4 A;  3IBH A;  5CRW A;  2IMF A;  4YAP A;  4DSS B;  2CVD A;  3I69 A;  4KCE A;  1XVW A;  2HRF A;  3I43 A;  3QAV A;  3GH6 A;  2OE0 A;  2L4Q A;  3APS A;  4XIH A;  3QFB C;  2I1U A;  3F4T A;  2CQ9 A;  5DJL A;  4HEA 2;  5J3R A;  1R5P A;  4N10 A;  5DAK B;  1Z6N A;  4JR6 A;  4FYU A;  4WR5 A;  1B9Y C;  2HZE B;  2DJ2 A;  2O8V B;  1K0B A;  1TKD B;  1FAA A;  2WS2 A;  1X9M B;  1M9A A;  5DCG A;  1FOV A;  3JCM L;  4WEY A;  2CAI A;  3UOM A;  10GS A;  3EUR A;  2VLU A;  3F3R A;  4NXI A;  5IPG A;  1OKD A;  4EF0 A;  2M46 A;  4F0C A;  3UIW A;  2DBC A;  1TI3 A;  4Q5R A;  2VD1 A;  3FZ9 A;  4K8M A;  3U6V A;  4KE3 A;  3QAW A;  2PU9 C;  1PKZ A;  3DKS A;  1XOB A;  5G5E A;  2EC4 A;  3IR4 A;  5GAN D;  2EIQ A;  4XRA A;  4O92 A;  1AUC A;  2L59 A;  3M9J A;  1YF1 A;  1XFL A;  3DXB A;  3GRX A;  2VIM A;  2LJA A;  1SD8 A;  3QAG A;  2LTK A;  4ECI A;  3G7Y A;  1A2M A;  1EZK A;  2QGV A;  2XC2 A;  5DAL A;  4E8E A;  3J7Y b;  3E3E A;  1A23 A;  1WPI A;  4GSN A;  1K0D A;  3GST A;  2H1D A;  3HVV A;  1OE7 A;  2C80 A;  3EU3 A;  4I2T A;  4I97 A;  4WXT A;  1R7H A;  5ECS A;  2H6X A;  1XW5 A;  4YAV A;  1O85 A;  5ECL B;  3WGX A;  4EE0 A;  1GWC A;  1A2J A;  5GST A;  4GLT A;  3FKF A;  5HQP A;  5B8A A;  2R37 A;  1RQM A;  1I5G A;  2HE3 A;  2H0H A;  1YJ6 A;  3HA9 A;  1GLP A;  1O8W A;  1BAY A;  5HR2 A;  1TU7 A;  3PR8 A;  1ZZY A;  5JWR B;  4NWY A;  4MMM A;  3HYP A;  2VL3 A;  4ZB8 A;  5GAP D;  2XPD A;  2C4J A;  3EMX A;  3A2V A;  1A0F A;  2V2G A;  1ACV A;  2TIR A;  1ERT A;  3US3 A;  2GS3 A;  2MZC A;  4WBR D;  2L6C A;  3TB2 A;  1Q98 A;  5IIZ A;  3M0F A;  1EV9 A;  4EC0 A;  3ZIT A;  3IDV A;  5EL8 A;  4D73 A;  4BA7 A;  5B6N A;  2MBT A;  2WFC A;  4F2I A;  1XCC A;  1SL2 B;  7GSS A;  5IM9 A;  2H0G A;  2GZY A;  5DVB A;  1Y25 A;  3VWU A;  1MTC A;  3AY8 A;  1WIK A;  2YP6 A;  2R4V A;  2VLT A;  2C0E A;  2H6Y A;  1F9M A;  4ACS A;  2MMZ A;  3DIE A;  4ZBB A;  1K0M A;  3GH9 A;  2GZZ A;  3TDG A;  4HU9 A;  2HLS A;  3D22 A;  2J23 A;  4IJI A;  3GL5 A;  1AAZ A;  1ML6 A;  3QDN A;  2JL4 A;  4XRD A;  16GS A;  3ERG A;  3HVS A;  3GV1 A;  1QUW A;  3PGT A;  1IYI A;  4IEL A;  1YEP A;  3KP8 A;  3S9F A;  3L9V A;  2B5E A;  4AJ6 A;  1XVQ A;  5D93 A;  2AAW A;  1TW9 A;  3LEF A;  1SL0 B;  3ME8 A;  5LNK e;  3VWV A;  2JZT A;  3IOS A;  2C3N A;  3M9K A;  2MMA A;  4ZL9 A;  2R2J A;  1RK4 A;  3HZ8 A;  1LU4 A;  1BG5 A;  2LRT A;  5H5R A;  4PNG A;  1GTB A;  1O73 A;  2CAQ A;  1M2A A;  1QK8 A;  4MZC A;  5LD0 A;  3GKX A;  1SYX A;  2B6M A;  2V6K A;  2VL2 C;  1OYJ A;  1MDK A;  2FHE A;  3G9B A;  1GSD A;  8GSS A;  3KTB A;  4KH7 A;  3L9U A;  5IMA A;  4TR0 A;  1XWG A;  3UBK A;  1GUM A;  2H8L A;  4OO5 A;  2IJY A;  4NMU A;  3LSZ A;  2RLI A;  5HR3 A;  4MF7 A;  4EDZ A;  3IK7 A;  5IOX A;  5G31 A;  4K7I A;  3Q6O A;  3ZML A;  5JWO B;  1X5D A;  4BPY A;  5F8B A;  2B3S A;  3M1G A;  12GS A;  1ON4 A;  3TKS A;  3C1S A;  3I6A A;  5C00 A;  2OAC A;  4JRR A;  1T4Y A;  4EL1 A;  3VI5 A;  2PVQ A;  2YWN A;  5AN1 A;  2R6K A;  1ERU A;  3RHC A;  4LA1 A;  3OR5 A;  4MH3 A;  1TRS A;  1GNW A;  3GKM A;  5H5S A;  3ZZX A;  1M9B A;  4MZW A;  1ERV A;  4OFN A;  3F9U A;  3RBT A;  5F06 A;  2E2M A;  5IMC A;  1NSW A;  4XS4 A;  3FHK A;  4L5O A;  2HNL A;  2GST A;  3N9J A;  2VCW A;  1WMJ A;  1YKA A;  1A2L A;  4OD7 A;  2WJU A;  4IQ1 A;  3E0U A;  4MF5 A;  2XHF A;  3TKS E;  2O7K A;  1ZYQ B;  5HFK A;  5IMZ A;  3EMP A;  3FR9 A;  2OE3 A;  3GYK A;  3DYR A;  4MF6 A;  4X0X A;  4FIW A;  3D5J A;  2V41 A;  2MBS A;  2HYX A;  4IW9 A;  4G19 A;  2VCX A;  4X43 A;  1YKC A;  22GS A;  1CQG A;  3ZVJ A;  2CVB A;  1GSS A;  3KGK A;  1FW1 A;  4MJC A;  5INY A;  1TOF A;  2K18 A;  3H93 A;  3CRU A;  4NV2 A;  3N5O A;  3KJY A;  3BCI A;  1O81 A;  2BJX A;  3IHQ A;  1FHE A;  3A2W A;  1USB A;  3HHV A;  5ENU A;  3KEB A;  2ZNM A;  4GST A;  3F3Q A;  1SK2 A;  2PMT A;  3J7Y k;  2H72 A;  2GQM A;  1M2D A;  1V9W A;  4IBP A;  1GSE A;  4O5R A;  1BX9 A;  3EC3 A;  4OCF A;  2DC5 A;  5ABR A;  2IIY A;  2IME A;  3TKR A;  1TRW A;  3H79 A;  2R5G A;  2PER A;  1TP9 A;  4IQA A;  2VUP A;  3FZ5 A;  1SKR B;  3QCP A;  4L0U A;  3I9V 2;  2GT6 A;  14GS A;  3CSI A;  3TRP A;  1SK0 A;  4Q5Q A;  2NBS A;  5DCH A;  5ID2 B;  2M72 A;  2I3Y A;  3C8E A;  2OA7 A;  3L4N A;  5EPF A;  2YN1 A;  5F07 A;  4MZB A;  4ZXG A;  6GSU A;  3F63 A;  1GL8 A;  3ZYW A;  5J9B A;  1A8L A;  3F6D A;  1F6M C;  2H74 A;  4TXO B;  3ZMK A;  3GKN A;  1KNG A;  1X5E A;  5ECR B;  2VO4 A;  4GTU A;  1HD2 A;  3WD6 A;  2LST A;  4N11 A;  4GF0 A;  5CP1 A;  1A0R P;  3A5W A;  5AIS A;  1N2A A;  3A2X A;  3W8J A;  2H76 A;  3FW2 A;  3QR6 A;  2NVL A;  2JZR A;  1E2Y A;  4RI7 A;  1B9X C;  1H4O A;  4ML1 A;  1DSB A;  2MYG A;  1R26 A;  4WKW A;  4FYC A;  5DQS A;  2L6D A;  1TU8 A;  1EWX A;  4MJA A;  1LBK A;  2LQO A;  2X64 A;  1H75 A;  2H01 A;  2I9H A;  1F3B A;  1B8X A;  1XW6 A;  4IJ3 A;  5CRD A;  3P2A A;  3G7J A;  3IXR A;  1VRS D;  4V1A g;  4CHS A;  1GSQ A;  3ERF A;  2B7J A;  3D6I A;  4ID0 A;  3DVW A;  1T3B A;  5ECP B;  1VGL A;  3RPP A;  1GNE A;  4H86 A;  4V2M A;  2KOK A;  4MPG A;  2HT9 A;  3Q18 A;  3FY7 A;  5J4U A;  4G10 A;  3VWW A;  2KP1 A;  1SL1 B;  4ILF A;  3RAZ A;  2LEG A;  2XPE A;  5D96 A;  3DVX A;  17GS A;  3PIN A;  3GFK A;  1PQN A;  3HJO A;  18GS A;  4I8B A;  4MH2 A;  5JCW A;  1K0A A;  3GUR A;  4HDE A;  4F9Z A;  3WYW A;  5D9W A;  2WUL A;  2FY6 A;  4PUR A;  3P90 A;  2FGX A;  4Q5N A;  3GX0 A;  1GUK A;  1MEK A;  3UBL A;  4KND A;  1TJD A;  4AGS A;  1K3L A;  2CA8 A;  3KXO A;  4F82 A;  4WF5 A;  2RII A;  5FT3 A;  3F6F A;  4L0W A;  4OFT A;  1OC9 B;  4G9H A;  2X99 A;  1FB6 A;  4HQZ A;  4AJ8 A;  2CVK A;  1WP0 A;  3VWX A;  1TRU A;  2YV7 A;  2P5Q A;  4V1A p;  3LXZ A;  2F3M A;  1JFU A;  4KSO A;  1WE0 A;  5L71 A;  2FWG A;  4ZBA A;  4HS1 A;  3RPN A;  4ZL7 A;  2WZ9 A;  2GSS A;  2C0G A;  1JZR A;  1Z9H A;  2RUF A;  4F03 A;  5E59 A;  1V40 A;  1U3A A;  3SWL A;  5ECK B;  2A2S A;  3QMX A;  1DUG A;  5D73 A;  2NDO A;  1GUH A;  1TRV A;  2A2R A;  2DJ1 A;  1TI1 A;  3L9S A;  1ZGN A;  4HZ4 A;  5A4U A;  2VCZ A;  2IL3 A;  1GP1 A;  4EVM A;  6GSW A;  5CRE A;  1KBN A;  2CT6 A;  2M80 A;  1B4P A;  1B4Q A;  5JCU A;  2R3X A;  3UVT A;  1X9S B;  4K7N A;  4EUY A;  4HUA A;  2OE1 A;  2IFQ B;  3HZ4 A;  1AQW A;  4Q5F A;  4JU5 A;  2C3T A;  4XS1 A;  3TKP A;  1VF2 A;  1AW9 A;  4JR4 A;  5E4W A;  3RDW A;  4EXJ A;  3TJJ A;  2RUE A;  3FYG A;  5ECH B;  2GTU A;  3EYT A;  5F05 A;  1XZO A;  3W6G A;  4JBB A;  5CO3 A;  1T1V A;  3RHB A;  3GTU B;  3QOU A;  4BVX A;  3WT2 A;  4I2U A;  1YZX A;  3MSZ A;  1U3I A;  4K2D A;  4GWR A;  4NHW A;  1TDI A;  5AGY A;  4HJM A;  2OJL A;  1FVJ A;  1Z3E A;  1K0O A;  3LFL A;  1XBS A;  2HRN A;  5F0G A;  1MD4 A;  2LV3 A;  3DML A;  2VCQ A;  4PX1 A;  1DE2 A;  3EVI A;  1AXD A;  1OC3 A;  1R4W A;  4K6X A;  1ST9 A;  1Z7R A;  6GSV A;  3FR3 A;  1Y6E A;  2F9S A;  3DWV A;  4POK A;  3ZL5 A;  3HJP A;  3QPM A;  3P8W A;  3ZLP A;  1OVN A;  2DML A;  3PH9 A;  2YWO A;  1PX6 A;  5DBQ A;  4HQS A;  6GSS A;  1RW1 A;  1EP8 A;  1S3A A;  4TR1 A;  2E7P A;  1ERW A;  1BYE A;  4I5Q A;  3HDC A;  3C71 A;  5KEJ A;  3Q19 A;  1PD2 1;  3WGE A;  4IS0 A;  1TK8 B;  1YEX A;  5ECO B;  3KP9 A;  2B7K A;  3EIN A;  2ALB A;  4GQF A;  4L8E A;  1JZD A;  2ZCT A;  2Z9S A;  1SEN A;  1QQ2 A;  3IE3 A;  3UMA A;  3KD0 A;  4LL4 B;  4FH8 A;  2H6Z A;  5DAL B;  3VPQ A;  5DDL A;  2X8H A;  4ZL8 A;  1GSY A;  1W4V A;  19GS A;  4MJB A;  1F2E A;  2CV4 A;  3GMF A;  1HYU A;  2ZUP A;  5HFG A;  1S3D A;  5GZZ B;  2FWH A;  4MPF A;  2GQK A;  1EP7 A;  4IVF A;  2LJR A;  3V1W A;  2FA4 A;  4Z7X A;  3VFI A;  5J41 A;  1T4Z A;  1YDK A;  2F8A A;  2YV9 A;  2O87 A;  2JAC A;  3LGC A;  4MA9 A;  1DE1 A;  2CX4 A;  2IPA A;  3CMI A;  1BED A;  1G7O A;  3CSH A;  1ZYE A;  1WWJ A;  1NHY A;  5D9X A;  3BOA A;  4ULX A;  3HY2 A;  5JWQ B;  2LKU A;  2PVO C;  4I6X A;  4IP1 A;  1QGV A;  2CZ3 A;  2GZP A;  4BWS A;  9GSS A;  2RM5 A;  4YQM A;  4KDX A;  4D73 B;  2PN8 A;  3A3T A;  2P5R A;  3FR6 A;  2EIO A;  4NAX A;  4K0N A;  1OC8 A;  4NHZ A;  3TKS C;  2H0I A;  4KDU A;  5A4V A;  1FB0 A;  4MCU A;  3KZQ A;  1JHB A;  4ZIJ A;  5B7C A;  2DLX A;  5J5N A;  2JAD A;  1SU9 A;  1YQ1 A;  3CYN A;  4POL A;  4PGT A;  5CNW A;  2C8U A;  1EGO A;  3TKQ A;  1CQH A;  5J9C A;  2TRX A;  2B5X A;  2C0D A;  1HNB A;  4DSS A;  4O32 A;  4J57 E;  4FO5 A;  1M2B A;  2JSY A;  1GH2 A;  5HFI A;  1G7E A;  4J56 E;  1NHO A;  2DSA A;  4IP6 A;  3IA1 A;  3CSJ A;  3MAK A;  2DMM A;  2FD3 A;  2GVP A;  3TOU A;  4WBJ A;  4OCE A;  5DAK A;  1KEB A;  2B1K A;  5GSS A;  1QMV A;  4O7H A;  2H75 A;  2HZE A;  3HKR A;  2OBK A;  2H1G A;  2LRN A;  1M99 A;  3MDK A;  2C0F A;  2WDU A;  3Q74 A;  1PL2 A;  2KP2 A;  4ML6 A;  5AIV A;  3CXG A;  2H19 A;  1EOG A;  2GQL A;  1JLV A;  1GTI A;  1URM A;  4XCS A;  4ISD A;  1O7U A;  3CBU A;  2WB9 A;  4YQV A;  1AQX A;  4EO3 A;  1V57 A;  2IMD A;  3TRX A;  2AHE A;  3BCK A;  1THO A;  20GS A;  1FVK A;  2TRC P;  2K9F A;  2OKA A;  2FLS A;  3TGZ A;  3KM6 A;  1SJ6 A;  1TK5 B;  3DD3 A;  2OAD A;  3KH9 A;  1ZL9 A;  3BD2 A;  5D9V A;  1WJK A;  3W8S A;  3CTG A;  1SKW B;  4MDC A;  5ECM B;  1IYH A;  1MD3 A;  2ON7 A;  2AUV A;  3TJF A;  2PGT A;  4HU7 A;  1M0U A;  3CTF A;  3GHA A;  2P0G A;  3ZTL A;  5G1L A;  2IMI A;  3GA4 A;  3UEM A;  3VUR A;  1HNC A;  1U88 A;  5IO0 A;  2K8S A;  1SJI A;  4ZIL A;  3F4S A;  3ZIV A;  2N5B A;  1PX7 A;  4OWY A;  2DJ3 A;  2N5F A;  3H1N A;  5A5K A;  1TK0 B;  4KSM A;  2PBJ A;  1Z7P A;  2RM6 A;  4XTS A;  4IGJ A;  2HSH A;  4WR4 A;  2I4A A;  2L4C A;  1GSU A;  2O89 A;  2VL9 A;  4ZB9 A;  4ECB A;  1M7T A;  1Z6M A;  1G0T A;  5G2Z A;  3HJM A;  3C1R A;  3IK9 A;  4K9Z A;  4PQI A;  1K3O A;  4ECJ A; 
#chains in the Genus database with same CATH topology
 4K1F A;  1HQO A;  2HSM A;  4PNF A;  2KUC A;  5D8I A;  2WRT A;  2F51 A;  1XWC A;  4YH2 A;  2C1Y A;  2GSQ A;  3NOF A;  3UL3 A;  1DBY A;  3CRT A;  3O76 A;  5DJM A;  1YY7 A;  1G6W A;  1NM3 A;  2WGR A;  4EDY A;  4HZ2 A;  3FK8 A;  3MWH A;  1AIU A;  3M3M A;  1X0R A;  2JSZ A;  1VF3 A;  4NPB A;  3DRN A;  4E8H A;  3GNJ A;  1VF1 A;  2LJK A;  2PPT A;  3KTL A;  4HSC X;  4N0V A;  2VOC A;  3IV4 A;  1JLW A;  4DVC A;  1GRX A;  4LL1 B;  1JZW A;  5HR0 A;  4G2E A;  4FYB A;  6GST A;  3F0I A;  4QQ7 A;  4K7O A;  2B5Y A;  2V32 A;  4POM A;  3APO A;  2K8V A;  4PUF C;  2DJJ A;  4MK3 A;  1GTA A;  1PN9 A;  4TVE A;  1F37 A;  2WCI A;  4V2N A;  3L78 A;  1ZCP A;  1F3A A;  3VLN A;  2CZ2 A;  4TOP A;  3FEU A;  2AB6 A;  13GS A;  2A4V A;  3LYK A;  5H5Q A;  4RUV A;  1XWA A;  3EE2 A;  5G1K A;  3IPZ A;  3MYD A;  2H70 A;  5ECQ B;  2X8G A;  2YZU A;  3KH7 A;  4V2L A;  3VI7 A;  1U6T A;  2HFD A;  4HI7 A;  3IAM 2;  4HJ2 A;  3GX8 A;  1PL1 A;  1THX A;  4KGI A;  5D9T A;  5LCZ A;  3D4M A;  4KAE A;  1TXX A;  2QC7 A;  3ERW A;  3QFA C;  3D0Z A;  1AQV A;  3EU4 A;  1UA5 A;  1ZMA A;  1E6B A;  2X49 A;  1UN2 A;  4JED A;  4QL7 A;  2YCD A;  4N30 A;  1V58 A;  2K6V A;  4TR4 A;  3P7X A;  3TCO A;  4KB3 A;  1Q4J A;  1LJR A;  2H66 A;  4DSR A;  4OMV A;  4AF2 A;  4GSS A;  2VAF A;  1K0N A;  4A5P A;  1A8Y A;  1T7P B;  2O85 A;  1EEJ A;  1G6Y A;  5ELG A;  4J2F A;  2LNT A;  3R2Q A;  4PQH A;  3EWL A;  2YJ7 A;  3LYP A;  3HVX A;  4LMW A;  1XPV A;  2QKE A;  4TR3 A;  2YPM A;  2V1M A;  4L5L A;  2HSY A;  1GTU A;  4Z2T A;  1X5C A;  3WT1 A;  2VM2 A;  1FG4 A;  2J9H A;  1OAZ A;  2VD0 A;  3UAR A;  3VPT A;  1GSF A;  2ES7 A;  4POB A;  2DIZ A;  1J9B A;  4RQX A;  4YKF A;  4KA0 A;  1OKT A;  2E0Q A;  3DGQ A;  5KN1 A;  2GT5 A;  3F4R A;  2AJQ B;  1MDI A;  2AYT A;  2VL2 A;  4JE1 A;  6GSX A;  4WF4 A;  2VCT A;  1A24 A;  3LJR A;  4P3Y B;  1PRX A;  2YJH A;  2IN3 A;  3F8U A;  4ICY A;  1WRY A;  5IOW A;  2NPB A;  1XXU A;  2VCV A;  1V2A A;  2LQQ A;  5KN0 A;  1PKW A;  5KN2 A;  4PQ1 A;  2LNS A;  2L5L A;  3D4T A;  4BL7 A;  4MP4 A;  1HNA A;  3TUE A;  2DJ0 A;  5IMF A;  2YWM A;  5ECN B;  2FWF A;  4GCI A;  4ECC A;  4K5R A;  5G5F A;  1C72 A;  11GS A;  4KCA A;  2GGT A;  2LUS A;  3GKK A;  4DSQ A;  3APQ A;  3H4K A;  2YAN A;  1XIY A;  3H8Q A;  5EVO A;  3ED3 A;  5ELA A;  3WGD A;  2PUK C;  2FNO A;  4GRF A;  3FZA A;  2FWE A;  1QFN A;  1S3C A;  2QSI A;  4RQR A;  3O6T A;  2P31 A;  2DIY A;  2FCH A;  1K0C A;  3K8N A;  4WET A;  1T8E B;  1ZOF A;  2YOI A;  5CRH A;  1UC7 A;  4KDY A;  1QXH A;  3BBY A;  4OO4 A;  3HCZ A;  2XBQ A;  5IMD A;  1Z5Y E;  1EGR A;  2H1A A;  5ID2 A;  4QL9 A;  5IMV A;  5BRT A;  2H30 A;  5JCG A;  3LXT A;  2X8C A;  3M8N A;  1GLQ A;  3TJB A;  1J0F A;  4BVY A;  4OFM A;  1J08 A;  4TXO A;  3UVH A;  5G30 A;  4KW6 A;  3C73 A;  3IRA A;  5CAX A;  3MIX A;  2OBI A;  2REM A;  3ZRD A;  2LS5 A;  3LOR A;  1VF4 A;  1O6J A;  6GSY A;  2JU5 A;  1K3Y A;  2ON5 A;  4TXV A;  2DJK A;  2KHP A;  5C04 A;  4TW5 A;  4HOJ A;  4NV5 A;  3E9J B;  3DEX A;  4BVX B;  4XS6 A;  4IKH A;  1SKS B;  1V98 A;  1BJX A;  1MDJ A;  1GUL A;  2MMO A;  4BWQ A;  2B1L A;  2GDR A;  3GUS A;  2AV4 A;  2PWJ A;  2VLV A;  5HR1 A;  4TKY A;  4F0B A;  1PGT A;  1PMT A;  2CX3 A;  4GQC A;  1PA3 A;  1BQ7 A;  2G2Q A;  1EEM A;  5B6M A;  1SK1 A;  3TOT A;  2N5A A;  3ISO A;  2BTO T;  3LQ7 A;  3D21 A;  1JZO A;  3U5R E;  2H1B A;  2HZF A;  1SD9 A;  5CRG A;  4TR1 B;  2VM1 A;  4TN8 A;  3TRQ A;  5IO2 A;  2XBI A;  5CYY A;  1ABA A;  1TTZ A;  5EY6 A;  3ZIJ A;  3L0H A;  3NZN A;  4KX4 A;  3FRC A;  5B8B A;  3KMO A;  2GSR A;  2YWI A;  1OE8 A;  3KIJ A;  5AIX A;  1XWB A;  1EV4 A;  2F8F A;  4CDO A;  1X9W B;  2H71 A;  4JZQ A;  4TRX A;  1NW2 A;  1XW9 A;  5ECI B;  4KUN A;  3BJ5 A;  4G0K A;  3VK9 A;  3LWA A;  5FHI A;  2I81 A;  2LRC A;  3KCM A;  1AC1 A;  1FO5 A;  1OC9 A;  3KMN A;  5IQY A;  4X1U A;  4USS A;  4MAB A;  3IAS 2;  1EOH A;  4CW9 A;  1KTE A;  3A5I A;  1SJZ A;  4LLR A;  5IPH A;  1ILO A;  2L5O A;  3UJ1 A;  1I9D A;  2E2G A;  4YQU A;  3IC4 A;  3QD9 A;  3MNG A;  3G7I A;  1WOU A;  2KLX A;  2L57 A;  2NTO A;  2H73 A;  2D2Z A;  2FUG 2;  3ME7 A;  2JZS A;  1UVZ A;  3TJK A;  2GLR A;  3NIV A;  3SBC A;  3ZVJ D;  3TJG A;  4EKZ A;  1O8X A;  1YF0 A;  5A4W A;  2IMK A;  4MJE A;  5DQY A;  5KN3 A;  2FA8 A;  3C7M A;  3O3T A;  2HXK A;  3ZFL A;  4K0G A;  4GXZ A;  2G0F A;  4IN0 A;  4XS4 B;  5FWG A;  4IHU A;  4AJ7 A;  2YZH A;  2BMX A;  3LG6 A;  1T00 A;  1U87 A;  1N8J A;  2V6O A;  4N0Z A;  1XWK A;  1W89 A;  5COH A;  2HI7 A;  1B48 A;  2IWT A;  3UAP A;  4RI6 A;  1R5A A;  1PSQ A;  2EIR A;  3IC8 A;  2IFQ A;  3GL3 A;  3GIX A;  4ZBD A;  2MMN A;  3GSS A;  4XHM A;  3GN3 A;  4DEJ A;  1XOA A;  3ZRE A;  3HD5 A;  4MLY A;  1SYR A;  4PUA A;  2YNX A;  4FQU A;  3GTU A;  4PXO A;  4ZB6 A;  2C3Q A;  5KOX A;  3ZFB A;  3HXS A;  4LMV A;  3FZ4 A;  3IBH A;  5CRW A;  2IMF A;  4YAP A;  4DSS B;  2CVD A;  3I69 A;  4KCE A;  1XVW A;  2HRF A;  3I43 A;  3QAV A;  3GH6 A;  2OE0 A;  2L4Q A;  3APS A;  4XIH A;  3QFB C;  2I1U A;  3F4T A;  2CQ9 A;  5DJL A;  4HEA 2;  5J3R A;  1R5P A;  4N10 A;  5DAK B;  1Z6N A;  4JR6 A;  4FYU A;  4WR5 A;  1B9Y C;  2HZE B;  3HVN A;  2DJ2 A;  2O8V B;  1K0B A;  1TKD B;  1FAA A;  2WS2 A;  1X9M B;  1M9A A;  5DCG A;  1FOV A;  3JCM L;  4WEY A;  2CAI A;  3UOM A;  10GS A;  3EUR A;  2DKI A;  2VLU A;  3F3R A;  4NXI A;  5IPG A;  1OKD A;  4EF0 A;  4Z2U A;  2M46 A;  4F0C A;  3UIW A;  2DBC A;  1TI3 A;  4Q5R A;  2VD1 A;  3FZ9 A;  4K8M A;  3U6V A;  4KE3 A;  4O5Q A;  3QAW A;  2PU9 C;  1PKZ A;  3DKS A;  1XOB A;  5G5E A;  2EC4 A;  3IR4 A;  5GAN D;  2EIQ A;  4XRA A;  4O92 A;  1AUC A;  2L59 A;  3M9J A;  1YF1 A;  1XFL A;  3DXB A;  3GRX A;  2VIM A;  2LJA A;  1SD8 A;  3QAG A;  2LTK A;  4ECI A;  3G7Y A;  1A2M A;  1EZK A;  2QGV A;  4EIP A;  2XC2 A;  2QA1 A;  5DAL A;  4E8E A;  3J7Y b;  3E3E A;  1A23 A;  1WPI A;  4GSN A;  1K0D A;  3GST A;  2H1D A;  3HVV A;  1OE7 A;  2A2P A;  2C80 A;  3EU3 A;  4I2T A;  4I97 A;  4WXT A;  1R7H A;  5ECS A;  2H6X A;  1XW5 A;  4YAV A;  1O85 A;  5ECL B;  3WGX A;  1PN0 A;  4EE0 A;  1GWC A;  1A2J A;  5GST A;  4GLT A;  3FKF A;  5HQP A;  5B8A A;  2R37 A;  1RQM A;  1I5G A;  2HE3 A;  2H0H A;  1YJ6 A;  3HA9 A;  1GLP A;  1O8W A;  1BAY A;  5HR2 A;  1TU7 A;  1ZYP A;  3PR8 A;  1ZZY A;  5JWR B;  4NWY A;  4MMM A;  3HYP A;  2VL3 A;  4ZB8 A;  5GAP D;  2XPD A;  2C4J A;  3EMX A;  2UZ8 A;  3A2V A;  1A0F A;  2V2G A;  1ACV A;  2TIR A;  5BMU A;  1ERT A;  3US3 A;  2GS3 A;  2MZC A;  4WBR D;  2L6C A;  3TB2 A;  1Q98 A;  5IIZ A;  3M0F A;  1EV9 A;  4EC0 A;  3ZIT A;  3IDV A;  5EL8 A;  4D73 A;  4BA7 A;  5B6N A;  2MBT A;  2WFC A;  4F2I A;  1XCC A;  1SL2 B;  7GSS A;  5IM9 A;  2H0G A;  2GZY A;  5DVB A;  1Y25 A;  3VWU A;  1MTC A;  3AY8 A;  1XG8 A;  1WIK A;  2YP6 A;  2R4V A;  2VLT A;  2C0E A;  2H6Y A;  1F9M A;  4ACS A;  2MMZ A;  3DIE A;  4ZBB A;  1K0M A;  3GH9 A;  2GZZ A;  3TDG A;  4HU9 A;  2HLS A;  3D22 A;  2J23 A;  4IJI A;  3GL5 A;  1AAZ A;  1ML6 A;  3QDN A;  2JL4 A;  4XRD A;  16GS A;  3ERG A;  3HVS A;  3GV1 A;  1QUW A;  3PGT A;  1IYI A;  4IEL A;  1YEP A;  3KP8 A;  3S9F A;  3L9V A;  2B5E A;  4AJ6 A;  1XVQ A;  5D93 A;  2AAW A;  1TW9 A;  3LEF A;  1SL0 B;  3ME8 A;  5LNK e;  3VWV A;  2JZT A;  3IOS A;  2C3N A;  3M9K A;  2MMA A;  4ZL9 A;  2R2J A;  1RK4 A;  3HZ8 A;  1LU4 A;  1BG5 A;  2LRT A;  5H5R A;  4PNG A;  1GTB A;  1O73 A;  2CAQ A;  1M2A A;  1QK8 A;  4MZC A;  2X4A A;  5LD0 A;  3GKX A;  1SYX A;  2B6M A;  2V6K A;  4CY8 A;  2VL2 C;  1OYJ A;  4X4J A;  1MDK A;  2FHE A;  3G9B A;  1GSD A;  8GSS A;  3KTB A;  4KH7 A;  3L9U A;  5IMA A;  4TR0 A;  1XWG A;  3UBK A;  1GUM A;  2H8L A;  4OO5 A;  2IJY A;  4NMU A;  3LSZ A;  2RLI A;  5HR3 A;  4MF7 A;  4EDZ A;  3IK7 A;  5IOX A;  5G31 A;  4K7I A;  3Q6O A;  3ZML A;  5JWO B;  1X5D A;  4BPY A;  5F8B A;  2B3S A;  3M1G A;  12GS A;  1ON4 A;  3TKS A;  3C1S A;  3I6A A;  5C00 A;  2OAC A;  4JRR A;  1T4Y A;  4EL1 A;  3VI5 A;  2PVQ A;  2YWN A;  5AN1 A;  2R6K A;  1ERU A;  3RHC A;  4LA1 A;  3OR5 A;  4MH3 A;  1TRS A;  1GNW A;  3GKM A;  5H5S A;  3ZZX A;  1M9B A;  4MZW A;  1ERV A;  4OFN A;  3F9U A;  3RBT A;  5F06 A;  2E2M A;  5IMC A;  1NSW A;  1M3I A;  4XS4 A;  3FHK A;  4L5O A;  2HNL A;  2GST A;  3N9J A;  2VCW A;  1WMJ A;  1YKA A;  1A2L A;  4OD7 A;  2WJU A;  4IQ1 A;  3E0U A;  4MF5 A;  2XHF A;  3TKS E;  2O7K A;  1ZYQ B;  5HFK A;  5IMZ A;  3EMP A;  3FR9 A;  2OE3 A;  3GYK A;  3DYR A;  4MF6 A;  4X0X A;  4FIW A;  3D5J A;  2V41 A;  2MBS A;  2HYX A;  4IW9 A;  4G19 A;  2VCX A;  4X43 A;  1YKC A;  22GS A;  1CQG A;  3ZVJ A;  2CVB A;  1GSS A;  3KGK A;  1FW1 A;  4MJC A;  5INY A;  1TOF A;  2K18 A;  3H93 A;  3CRU A;  4NV2 A;  3N5O A;  3KJY A;  3BCI A;  1O81 A;  2BJX A;  3IHQ A;  1FHE A;  3A2W A;  1USB A;  3HHV A;  5ENU A;  3KEB A;  2ZNM A;  4BL7 B;  4GST A;  3F3Q A;  1SK2 A;  2PMT A;  3J7Y k;  2H72 A;  2GQM A;  1M2D A;  1V9W A;  4IBP A;  1GSE A;  4O5R A;  1BX9 A;  3EC3 A;  4OCF A;  2DC5 A;  5ABR A;  2IIY A;  2IME A;  3TKR A;  1TRW A;  3H79 A;  2R5G A;  2PER A;  1TP9 A;  4IQA A;  2VUP A;  3FZ5 A;  1S3R A;  1SKR B;  3QCP A;  4L0U A;  3I9V 2;  2GT6 A;  14GS A;  4BIK A;  3CSI A;  3TRP A;  1SK0 A;  4Q5Q A;  2NBS A;  5DCH A;  5ID2 B;  2M72 A;  2I3Y A;  3C8E A;  2OA7 A;  3L4N A;  5EPF A;  2YN1 A;  5F07 A;  4MZB A;  4ZXG A;  6GSU A;  2R0C A;  4K5S A;  3F63 A;  1GL8 A;  3ZYW A;  5J9B A;  1A8L A;  3F6D A;  1F6M C;  4BVY B;  2H74 A;  4TXO B;  3ZMK A;  3GKN A;  1KNG A;  1X5E A;  5ECR B;  2VO4 A;  4GTU A;  1HD2 A;  3WD6 A;  2LST A;  4N11 A;  4GF0 A;  5CP1 A;  1A0R P;  3A5W A;  5AIS A;  1N2A A;  3A2X A;  3W8J A;  2H76 A;  3R3E A;  3FW2 A;  3QR6 A;  2NVL A;  2JZR A;  1E2Y A;  4RI7 A;  1B9X C;  1H4O A;  4G0I A;  4ML1 A;  1DSB A;  2MYG A;  1R26 A;  4WKW A;  4FYC A;  5DQS A;  2L6D A;  1TU8 A;  1EWX A;  4MJA A;  1LBK A;  2LQO A;  2X64 A;  1H75 A;  2H01 A;  2I9H A;  1F3B A;  1B8X A;  1XW6 A;  4IJ3 A;  5CRD A;  3P2A A;  3G7J A;  3IXR A;  1VRS D;  4V1A g;  4CHS A;  1GSQ A;  3ERF A;  2B7J A;  3D6I A;  4ID0 A;  3DVW A;  3EPT A;  1T3B A;  5ECP B;  1VGL A;  3RPP A;  1GNE A;  4H86 A;  4V2M A;  2KOK A;  4MPG A;  2HT9 A;  3Q18 A;  3FY7 A;  5J4U A;  4G10 A;  3VWW A;  2KP1 A;  1SL1 B;  4ILF A;  3RAZ A;  2LEG A;  2XPE A;  5D96 A;  3DVX A;  17GS A;  3PIN A;  3GFK A;  1PQN A;  3HJO A;  18GS A;  4I8B A;  4MH2 A;  5JCW A;  1K0A A;  3GUR A;  4HDE A;  4F9Z A;  3WYW A;  5D9W A;  2WUL A;  2FY6 A;  4PUR A;  3P90 A;  2FGX A;  4Q5N A;  2R0G A;  1GUK A;  3GX0 A;  1MEK A;  3UBL A;  4KND A;  1TJD A;  4AGS A;  1K3L A;  2CA8 A;  3KXO A;  4F82 A;  4WF5 A;  2RII A;  5FT3 A;  3F6F A;  4L0W A;  4OFT A;  1OC9 B;  4G9H A;  2X99 A;  1FB6 A;  4HQZ A;  4AJ8 A;  2CVK A;  1WP0 A;  3VWX A;  1TRU A;  2YV7 A;  4Z2R A;  2P5Q A;  4V1A p;  3LXZ A;  2F3M A;  1JFU A;  4KSO A;  1WE0 A;  5L71 A;  2FWG A;  4ZBA A;  4HS1 A;  2HRA A;  3RPN A;  4ZL7 A;  4KF9 A;  2WZ9 A;  2GSS A;  2C0G A;  1JZR A;  1Z9H A;  2RUF A;  4F03 A;  5E59 A;  1V40 A;  1U3A A;  3SWL A;  5ECK B;  2A2S A;  3QMX A;  1DUG A;  5D73 A;  2NDO A;  1GUH A;  1TRV A;  2A2R A;  2DJ1 A;  1TI1 A;  3L9S A;  1ZGN A;  4HZ4 A;  5A4U A;  2VCZ A;  2IL3 A;  1GP1 A;  2HRK A;  4EVM A;  6GSW A;  5CRE A;  1KBN A;  2CT6 A;  2M80 A;  1B4P A;  1B4Q A;  5JCU A;  2R3X A;  3UVT A;  1X9S B;  4K7N A;  4EUY A;  4HUA A;  2OE1 A;  2IFQ B;  3HZ4 A;  1AQW A;  3FMW A;  4Q5F A;  4JU5 A;  2C3T A;  4XS1 A;  3TKP A;  1VF2 A;  1AW9 A;  4JR4 A;  5E4W A;  3RDW A;  4EXJ A;  3TJJ A;  2RUE A;  3FYG A;  5ECH B;  2GTU A;  3EYT A;  5F05 A;  1XZO A;  3W6G A;  4JBB A;  5CO3 A;  1T1V A;  3RHB A;  3GTU B;  3QOU A;  4BVX A;  3WT2 A;  4I2U A;  1YZX A;  3MSZ A;  1U3I A;  2R0P A;  4K2D A;  4GWR A;  4NHW A;  1TDI A;  5AGY A;  4HJM A;  2OJL A;  1FVJ A;  1Z3E A;  1K0O A;  3LFL A;  1XBS A;  2HRN A;  5F0G A;  1MD4 A;  2LV3 A;  3DML A;  2VCQ A;  4PX1 A;  1DE2 A;  3EVI A;  1AXD A;  1OC3 A;  1R4W A;  4K6X A;  1ST9 A;  1Z7R A;  6GSV A;  3FR3 A;  1Y6E A;  2F9S A;  3DWV A;  4POK A;  3ZL5 A;  3HJP A;  3QPM A;  3P8W A;  3ZLP A;  1OVN A;  2DML A;  3CQF A;  3PPU A;  3PH9 A;  2YWO A;  4EIQ A;  1PX6 A;  5DBQ A;  4HQS A;  6GSS A;  1RW1 A;  1EP8 A;  1S3A A;  4K2X A;  4TR1 A;  2E7P A;  1ERW A;  1BYE A;  4I5Q A;  3HDC A;  3C71 A;  5KEJ A;  3Q19 A;  1PD2 1;  3IHG A;  3WGE A;  4IS0 A;  1TK8 B;  1YEX A;  5ECO B;  3KP9 A;  2B7K A;  3EIN A;  2ALB A;  4GQF A;  4L8E A;  4O5U A;  1JZD A;  2ZCT A;  2Z9S A;  1SEN A;  1QQ2 A;  3IE3 A;  3UMA A;  3KD0 A;  4LL4 B;  4FH8 A;  2H6Z A;  5DAL B;  3VPQ A;  5DDL A;  2X8H A;  4ZL8 A;  1GSY A;  1W4V A;  19GS A;  4MJB A;  1F2E A;  2CV4 A;  3GMF A;  1HYU A;  2ZUP A;  5HFG A;  1S3D A;  5GZZ B;  1PFO A;  2FWH A;  4MPF A;  2GQK A;  1EP7 A;  4IVF A;  4CY6 A;  2LJR A;  3V1W A;  2FA4 A;  4Z7X A;  3VFI A;  5J41 A;  1T4Z A;  1YDK A;  2F8A A;  2YV9 A;  2O87 A;  2JAC A;  3LGC A;  4MA9 A;  1DE1 A;  2CX4 A;  2IPA A;  3CMI A;  1BED A;  1G7O A;  3CSH A;  1ZYE A;  1WWJ A;  1NHY A;  5D9X A;  3BOA A;  4ULX A;  3HY2 A;  5JWQ B;  2LKU A;  2PVO C;  4I6X A;  4IP1 A;  1QGV A;  4YKG A;  2CZ3 A;  2GZP A;  4BWS A;  9GSS A;  2RM5 A;  4YQM A;  4KDX A;  4D73 B;  2PN8 A;  3A3T A;  2P5R A;  3FR6 A;  2EIO A;  4NAX A;  4K0N A;  1OC8 A;  4NHZ A;  3TKS C;  2H0I A;  4KDU A;  5A4V A;  1FB0 A;  4MCU A;  3KZQ A;  1JHB A;  4ZIJ A;  5B7C A;  2DLX A;  5J5N A;  2JAD A;  1SU9 A;  1YQ1 A;  3CYN A;  4POL A;  4PGT A;  5CNW A;  3LW9 A;  2C8U A;  4G0L A;  1EGO A;  3TKQ A;  1CQH A;  5J9C A;  2TRX A;  2B5X A;  2C0D A;  1HNB A;  4DSS A;  4O32 A;  4J57 E;  4FO5 A;  1M2B A;  2JSY A;  1GH2 A;  5HFI A;  1G7E A;  2QA2 A;  4J56 E;  1NHO A;  2DSA A;  4IP6 A;  3IA1 A;  3CSJ A;  3MAK A;  2DMM A;  2FD3 A;  2GVP A;  3TOU A;  4WBJ A;  4OCE A;  5DAK A;  1KEB A;  2B1K A;  5GSS A;  1QMV A;  4O7H A;  2H75 A;  2HZE A;  3HKR A;  2OBK A;  2H1G A;  2LRN A;  1FOH A;  1M99 A;  3MDK A;  2C0F A;  2WDU A;  3Q74 A;  1PL2 A;  2KP2 A;  4ML6 A;  5AIV A;  3CXG A;  2H19 A;  1EOG A;  2GQL A;  1JLV A;  1GTI A;  1URM A;  4XCS A;  4ISD A;  1O7U A;  3CBU A;  1ZYN A;  2WB9 A;  4YQV A;  1AQX A;  4EO3 A;  1V57 A;  2IMD A;  3TRX A;  2AHE A;  3BCK A;  1THO A;  20GS A;  1FVK A;  2TRC P;  2K9F A;  2OKA A;  2FLS A;  3TGZ A;  3KM6 A;  1SJ6 A;  1TK5 B;  2DKH A;  3DD3 A;  2OAD A;  3KH9 A;  1ZL9 A;  3BD2 A;  5D9V A;  1WJK A;  3W8S A;  3CTG A;  1SKW B;  2A4H A;  4MDC A;  5ECM B;  1IYH A;  1MD3 A;  2ON7 A;  2AUV A;  3TJF A;  2PGT A;  4HU7 A;  1M0U A;  3CTF A;  3GHA A;  2P0G A;  3ZTL A;  5G1L A;  2IMI A;  3GA4 A;  3UEM A;  3VUR A;  1HNC A;  1U88 A;  5IO0 A;  2K8S A;  1SJI A;  4ZIL A;  3F4S A;  3ZIV A;  2N5B A;  1PX7 A;  4OWY A;  2DJ3 A;  2N5F A;  1M3J A;  3H1N A;  5A5K A;  1TK0 B;  4KSM A;  2PBJ A;  1Z7P A;  2RM6 A;  4XTS A;  4IGJ A;  2HSH A;  4WR4 A;  2I4A A;  2L4C A;  1GSU A;  4MNN A;  4PTS A;  2O89 A;  2VL9 A;  5KOW A;  4ZB9 A;  4ECB A;  1M7T A;  1Z6M A;  1G0T A;  5G2Z A;  3HJM A;  3C1R A;  3IK9 A;  4K9Z A;  4PQI A;  1K3O A;  4ECJ A; 
#chains in the Genus database with same CATH homology
 4K1F A;  1HQO A;  2HSM A;  4PNF A;  2KUC A;  5D8I A;  2WRT A;  2F51 A;  1XWC A;  4YH2 A;  2C1Y A;  2GSQ A;  3NOF A;  3UL3 A;  1DBY A;  3CRT A;  3O76 A;  5DJM A;  1YY7 A;  1G6W A;  1NM3 A;  2WGR A;  4EDY A;  4HZ2 A;  3FK8 A;  3MWH A;  1AIU A;  3M3M A;  1X0R A;  2JSZ A;  1VF3 A;  4NPB A;  3DRN A;  4E8H A;  3GNJ A;  1VF1 A;  2LJK A;  2PPT A;  3KTL A;  4N0V A;  2VOC A;  3IV4 A;  1JLW A;  4DVC A;  1GRX A;  4LL1 B;  1JZW A;  5HR0 A;  4G2E A;  4FYB A;  6GST A;  3F0I A;  4QQ7 A;  4K7O A;  2B5Y A;  2V32 A;  4POM A;  3APO A;  2K8V A;  4PUF C;  2DJJ A;  4MK3 A;  1GTA A;  1PN9 A;  4TVE A;  1F37 A;  2WCI A;  4V2N A;  3L78 A;  1ZCP A;  1F3A A;  3VLN A;  2CZ2 A;  4TOP A;  3FEU A;  2AB6 A;  13GS A;  2A4V A;  3LYK A;  5H5Q A;  4RUV A;  1XWA A;  3EE2 A;  5G1K A;  3IPZ A;  3MYD A;  2H70 A;  5ECQ B;  2X8G A;  2YZU A;  3KH7 A;  4V2L A;  3VI7 A;  1U6T A;  2HFD A;  4HI7 A;  3IAM 2;  4HJ2 A;  3GX8 A;  1PL1 A;  1THX A;  4KGI A;  5D9T A;  5LCZ A;  3D4M A;  4KAE A;  1TXX A;  2QC7 A;  3ERW A;  3QFA C;  3D0Z A;  1AQV A;  3EU4 A;  1UA5 A;  1ZMA A;  1E6B A;  2X49 A;  1UN2 A;  4JED A;  4QL7 A;  2YCD A;  4N30 A;  1V58 A;  2K6V A;  4TR4 A;  3P7X A;  3TCO A;  4KB3 A;  1Q4J A;  1LJR A;  2H66 A;  4DSR A;  4OMV A;  4AF2 A;  4GSS A;  2VAF A;  1K0N A;  4A5P A;  1A8Y A;  1T7P B;  2O85 A;  1EEJ A;  1G6Y A;  5ELG A;  4J2F A;  2LNT A;  3R2Q A;  4PQH A;  3EWL A;  2YJ7 A;  3LYP A;  3HVX A;  4LMW A;  1XPV A;  2QKE A;  4TR3 A;  2YPM A;  2V1M A;  4L5L A;  2HSY A;  1GTU A;  4Z2T A;  1X5C A;  3WT1 A;  2VM2 A;  1FG4 A;  2J9H A;  1OAZ A;  2VD0 A;  3UAR A;  3VPT A;  1GSF A;  2ES7 A;  4POB A;  2DIZ A;  1J9B A;  4RQX A;  4YKF A;  4KA0 A;  1OKT A;  2E0Q A;  3DGQ A;  5KN1 A;  2GT5 A;  3F4R A;  2AJQ B;  1MDI A;  2AYT A;  2VL2 A;  4JE1 A;  6GSX A;  4WF4 A;  2VCT A;  1A24 A;  3LJR A;  4P3Y B;  1PRX A;  2YJH A;  2IN3 A;  3F8U A;  4ICY A;  1WRY A;  5IOW A;  2NPB A;  1XXU A;  2VCV A;  1V2A A;  2LQQ A;  5KN0 A;  1PKW A;  5KN2 A;  4PQ1 A;  2LNS A;  2L5L A;  3D4T A;  4BL7 A;  4MP4 A;  1HNA A;  3TUE A;  2DJ0 A;  5IMF A;  2YWM A;  5ECN B;  2FWF A;  4GCI A;  4ECC A;  4K5R A;  5G5F A;  1C72 A;  11GS A;  4KCA A;  2GGT A;  2LUS A;  3GKK A;  4DSQ A;  3APQ A;  3H4K A;  2YAN A;  1XIY A;  3H8Q A;  5EVO A;  3ED3 A;  5ELA A;  3WGD A;  2PUK C;  2FNO A;  4GRF A;  3FZA A;  2FWE A;  1QFN A;  1S3C A;  2QSI A;  4RQR A;  3O6T A;  2P31 A;  2DIY A;  2FCH A;  1K0C A;  3K8N A;  4WET A;  1T8E B;  1ZOF A;  2YOI A;  5CRH A;  1UC7 A;  4KDY A;  1QXH A;  3BBY A;  4OO4 A;  3HCZ A;  2XBQ A;  5IMD A;  1Z5Y E;  1EGR A;  2H1A A;  5ID2 A;  4QL9 A;  5IMV A;  5BRT A;  2H30 A;  5JCG A;  3LXT A;  2X8C A;  3M8N A;  1GLQ A;  3TJB A;  1J0F A;  4BVY A;  4OFM A;  1J08 A;  4TXO A;  3UVH A;  5G30 A;  4KW6 A;  3C73 A;  3IRA A;  5CAX A;  3MIX A;  2OBI A;  2REM A;  3ZRD A;  2LS5 A;  3LOR A;  1VF4 A;  1O6J A;  6GSY A;  2JU5 A;  1K3Y A;  2ON5 A;  4TXV A;  2DJK A;  2KHP A;  5C04 A;  4TW5 A;  4HOJ A;  4NV5 A;  3E9J B;  3DEX A;  4BVX B;  4XS6 A;  4IKH A;  1SKS B;  1V98 A;  1BJX A;  1MDJ A;  1GUL A;  2MMO A;  4BWQ A;  2B1L A;  2GDR A;  3GUS A;  2AV4 A;  2PWJ A;  2VLV A;  5HR1 A;  4TKY A;  4F0B A;  1PGT A;  1PMT A;  2CX3 A;  4GQC A;  1PA3 A;  1BQ7 A;  2G2Q A;  1EEM A;  5B6M A;  1SK1 A;  3TOT A;  2N5A A;  3ISO A;  2BTO T;  3LQ7 A;  3D21 A;  1JZO A;  3U5R E;  2H1B A;  2HZF A;  1SD9 A;  5CRG A;  4TR1 B;  2VM1 A;  4TN8 A;  3TRQ A;  5IO2 A;  2XBI A;  5CYY A;  1ABA A;  1TTZ A;  5EY6 A;  3ZIJ A;  3L0H A;  3NZN A;  4KX4 A;  3FRC A;  5B8B A;  3KMO A;  2GSR A;  2YWI A;  1OE8 A;  3KIJ A;  5AIX A;  1XWB A;  1EV4 A;  2F8F A;  4CDO A;  1X9W B;  2H71 A;  4JZQ A;  4TRX A;  1NW2 A;  1XW9 A;  5ECI B;  4KUN A;  3BJ5 A;  4G0K A;  3VK9 A;  3LWA A;  5FHI A;  2I81 A;  2LRC A;  3KCM A;  1AC1 A;  1FO5 A;  1OC9 A;  3KMN A;  5IQY A;  4X1U A;  4USS A;  4MAB A;  3IAS 2;  1EOH A;  4CW9 A;  1KTE A;  3A5I A;  1SJZ A;  4LLR A;  5IPH A;  1ILO A;  2L5O A;  3UJ1 A;  1I9D A;  2E2G A;  4YQU A;  3IC4 A;  3QD9 A;  3MNG A;  3G7I A;  1WOU A;  2KLX A;  2L57 A;  2NTO A;  2H73 A;  2D2Z A;  2FUG 2;  3ME7 A;  2JZS A;  1UVZ A;  3TJK A;  2GLR A;  3NIV A;  3SBC A;  3ZVJ D;  3TJG A;  4EKZ A;  1O8X A;  1YF0 A;  5A4W A;  2IMK A;  4MJE A;  5DQY A;  5KN3 A;  2FA8 A;  3C7M A;  3O3T A;  2HXK A;  3ZFL A;  4K0G A;  4GXZ A;  2G0F A;  4IN0 A;  4XS4 B;  5FWG A;  4IHU A;  4AJ7 A;  2YZH A;  2BMX A;  3LG6 A;  1T00 A;  1U87 A;  1N8J A;  2V6O A;  4N0Z A;  1XWK A;  1W89 A;  5COH A;  2HI7 A;  1B48 A;  2IWT A;  3UAP A;  4RI6 A;  1R5A A;  1PSQ A;  2EIR A;  3IC8 A;  2IFQ A;  3GL3 A;  3GIX A;  4ZBD A;  2MMN A;  3GSS A;  4XHM A;  3GN3 A;  4DEJ A;  1XOA A;  3ZRE A;  3HD5 A;  4MLY A;  1SYR A;  4PUA A;  2YNX A;  4FQU A;  3GTU A;  4PXO A;  4ZB6 A;  2C3Q A;  5KOX A;  3ZFB A;  3HXS A;  4LMV A;  3FZ4 A;  3IBH A;  5CRW A;  2IMF A;  4YAP A;  4DSS B;  2CVD A;  3I69 A;  4KCE A;  1XVW A;  2HRF A;  3I43 A;  3QAV A;  3GH6 A;  2OE0 A;  2L4Q A;  3APS A;  4XIH A;  3QFB C;  2I1U A;  3F4T A;  2CQ9 A;  5DJL A;  4HEA 2;  5J3R A;  1R5P A;  4N10 A;  5DAK B;  1Z6N A;  4JR6 A;  4FYU A;  4WR5 A;  1B9Y C;  2HZE B;  2DJ2 A;  2O8V B;  1K0B A;  1TKD B;  1FAA A;  2WS2 A;  1X9M B;  1M9A A;  5DCG A;  1FOV A;  3JCM L;  4WEY A;  2CAI A;  3UOM A;  10GS A;  3EUR A;  2DKI A;  2VLU A;  3F3R A;  4NXI A;  5IPG A;  1OKD A;  4EF0 A;  4Z2U A;  2M46 A;  4F0C A;  3UIW A;  2DBC A;  1TI3 A;  4Q5R A;  2VD1 A;  3FZ9 A;  4K8M A;  3U6V A;  4KE3 A;  4O5Q A;  3QAW A;  2PU9 C;  1PKZ A;  3DKS A;  1XOB A;  5G5E A;  2EC4 A;  3IR4 A;  5GAN D;  2EIQ A;  4XRA A;  4O92 A;  1AUC A;  2L59 A;  3M9J A;  1YF1 A;  1XFL A;  3DXB A;  3GRX A;  2VIM A;  2LJA A;  1SD8 A;  3QAG A;  2LTK A;  4ECI A;  3G7Y A;  1A2M A;  1EZK A;  2QGV A;  4EIP A;  2XC2 A;  2QA1 A;  5DAL A;  4E8E A;  3J7Y b;  3E3E A;  1A23 A;  1WPI A;  4GSN A;  1K0D A;  3GST A;  2H1D A;  3HVV A;  1OE7 A;  2A2P A;  2C80 A;  3EU3 A;  4I2T A;  4I97 A;  4WXT A;  1R7H A;  5ECS A;  2H6X A;  1XW5 A;  4YAV A;  1O85 A;  5ECL B;  3WGX A;  1PN0 A;  4EE0 A;  1GWC A;  1A2J A;  5GST A;  4GLT A;  3FKF A;  5HQP A;  5B8A A;  2R37 A;  1RQM A;  1I5G A;  2HE3 A;  2H0H A;  1YJ6 A;  3HA9 A;  1GLP A;  1O8W A;  1BAY A;  5HR2 A;  1TU7 A;  1ZYP A;  3PR8 A;  1ZZY A;  5JWR B;  4NWY A;  4MMM A;  3HYP A;  2VL3 A;  4ZB8 A;  5GAP D;  2XPD A;  2C4J A;  3EMX A;  2UZ8 A;  3A2V A;  1A0F A;  2V2G A;  1ACV A;  2TIR A;  5BMU A;  1ERT A;  3US3 A;  2GS3 A;  2MZC A;  4WBR D;  2L6C A;  3TB2 A;  1Q98 A;  5IIZ A;  3M0F A;  1EV9 A;  4EC0 A;  3ZIT A;  3IDV A;  5EL8 A;  4D73 A;  4BA7 A;  5B6N A;  2MBT A;  2WFC A;  4F2I A;  1XCC A;  1SL2 B;  7GSS A;  5IM9 A;  2H0G A;  2GZY A;  5DVB A;  1Y25 A;  3VWU A;  1MTC A;  3AY8 A;  1WIK A;  2YP6 A;  2R4V A;  2VLT A;  2C0E A;  2H6Y A;  1F9M A;  4ACS A;  2MMZ A;  3DIE A;  4ZBB A;  1K0M A;  3GH9 A;  2GZZ A;  3TDG A;  4HU9 A;  2HLS A;  3D22 A;  2J23 A;  4IJI A;  3GL5 A;  1AAZ A;  1ML6 A;  3QDN A;  2JL4 A;  4XRD A;  16GS A;  3ERG A;  3HVS A;  3GV1 A;  1QUW A;  3PGT A;  1IYI A;  4IEL A;  1YEP A;  3KP8 A;  3S9F A;  3L9V A;  2B5E A;  4AJ6 A;  1XVQ A;  5D93 A;  2AAW A;  1TW9 A;  3LEF A;  1SL0 B;  3ME8 A;  5LNK e;  3VWV A;  2JZT A;  3IOS A;  2C3N A;  3M9K A;  2MMA A;  4ZL9 A;  2R2J A;  1RK4 A;  3HZ8 A;  1LU4 A;  1BG5 A;  2LRT A;  5H5R A;  4PNG A;  1GTB A;  1O73 A;  2CAQ A;  1M2A A;  1QK8 A;  4MZC A;  2X4A A;  5LD0 A;  3GKX A;  1SYX A;  2B6M A;  2V6K A;  4CY8 A;  2VL2 C;  1OYJ A;  4X4J A;  1MDK A;  2FHE A;  3G9B A;  1GSD A;  8GSS A;  3KTB A;  4KH7 A;  3L9U A;  5IMA A;  4TR0 A;  1XWG A;  3UBK A;  1GUM A;  2H8L A;  4OO5 A;  2IJY A;  4NMU A;  3LSZ A;  2RLI A;  5HR3 A;  4MF7 A;  4EDZ A;  3IK7 A;  5IOX A;  5G31 A;  4K7I A;  3Q6O A;  3ZML A;  5JWO B;  1X5D A;  4BPY A;  5F8B A;  2B3S A;  3M1G A;  12GS A;  1ON4 A;  3TKS A;  3C1S A;  3I6A A;  5C00 A;  2OAC A;  4JRR A;  1T4Y A;  4EL1 A;  3VI5 A;  2PVQ A;  2YWN A;  5AN1 A;  2R6K A;  1ERU A;  3RHC A;  4LA1 A;  3OR5 A;  4MH3 A;  1TRS A;  1GNW A;  3GKM A;  5H5S A;  3ZZX A;  1M9B A;  4MZW A;  1ERV A;  4OFN A;  3F9U A;  3RBT A;  5F06 A;  2E2M A;  5IMC A;  1NSW A;  4XS4 A;  3FHK A;  4L5O A;  2HNL A;  2GST A;  3N9J A;  2VCW A;  1WMJ A;  1YKA A;  1A2L A;  4OD7 A;  2WJU A;  4IQ1 A;  3E0U A;  4MF5 A;  2XHF A;  3TKS E;  2O7K A;  1ZYQ B;  5HFK A;  5IMZ A;  3EMP A;  3FR9 A;  2OE3 A;  3GYK A;  3DYR A;  4MF6 A;  4X0X A;  4FIW A;  3D5J A;  2V41 A;  2MBS A;  2HYX A;  4IW9 A;  4G19 A;  2VCX A;  4X43 A;  1YKC A;  22GS A;  1CQG A;  3ZVJ A;  2CVB A;  1GSS A;  3KGK A;  1FW1 A;  4MJC A;  5INY A;  1TOF A;  2K18 A;  3H93 A;  3CRU A;  4NV2 A;  3N5O A;  3KJY A;  3BCI A;  1O81 A;  2BJX A;  3IHQ A;  1FHE A;  3A2W A;  1USB A;  3HHV A;  5ENU A;  3KEB A;  2ZNM A;  4BL7 B;  4GST A;  3F3Q A;  1SK2 A;  2PMT A;  3J7Y k;  2H72 A;  2GQM A;  1M2D A;  1V9W A;  4IBP A;  1GSE A;  4O5R A;  1BX9 A;  3EC3 A;  4OCF A;  2DC5 A;  5ABR A;  2IIY A;  2IME A;  3TKR A;  1TRW A;  3H79 A;  2R5G A;  2PER A;  1TP9 A;  4IQA A;  2VUP A;  3FZ5 A;  1SKR B;  3QCP A;  4L0U A;  3I9V 2;  2GT6 A;  14GS A;  3CSI A;  3TRP A;  1SK0 A;  4Q5Q A;  2NBS A;  5DCH A;  5ID2 B;  2M72 A;  2I3Y A;  3C8E A;  2OA7 A;  3L4N A;  5EPF A;  2YN1 A;  5F07 A;  4MZB A;  4ZXG A;  6GSU A;  2R0C A;  4K5S A;  3F63 A;  1GL8 A;  3ZYW A;  5J9B A;  1A8L A;  3F6D A;  1F6M C;  4BVY B;  2H74 A;  4TXO B;  3ZMK A;  3GKN A;  1KNG A;  1X5E A;  5ECR B;  2VO4 A;  4GTU A;  1HD2 A;  3WD6 A;  2LST A;  4N11 A;  4GF0 A;  5CP1 A;  1A0R P;  3A5W A;  5AIS A;  1N2A A;  3A2X A;  3W8J A;  2H76 A;  3R3E A;  3FW2 A;  3QR6 A;  2NVL A;  2JZR A;  1E2Y A;  4RI7 A;  1B9X C;  1H4O A;  4G0I A;  4ML1 A;  1DSB A;  2MYG A;  1R26 A;  4WKW A;  4FYC A;  5DQS A;  2L6D A;  1TU8 A;  1EWX A;  4MJA A;  1LBK A;  2LQO A;  2X64 A;  1H75 A;  2H01 A;  2I9H A;  1F3B A;  1B8X A;  1XW6 A;  4IJ3 A;  5CRD A;  3P2A A;  3G7J A;  3IXR A;  1VRS D;  4V1A g;  4CHS A;  1GSQ A;  3ERF A;  2B7J A;  3D6I A;  4ID0 A;  3DVW A;  3EPT A;  1T3B A;  5ECP B;  1VGL A;  3RPP A;  1GNE A;  4H86 A;  4V2M A;  2KOK A;  4MPG A;  2HT9 A;  3Q18 A;  3FY7 A;  5J4U A;  4G10 A;  3VWW A;  2KP1 A;  1SL1 B;  4ILF A;  3RAZ A;  2LEG A;  2XPE A;  5D96 A;  3DVX A;  17GS A;  3PIN A;  3GFK A;  1PQN A;  3HJO A;  18GS A;  4I8B A;  4MH2 A;  5JCW A;  1K0A A;  3GUR A;  4HDE A;  4F9Z A;  3WYW A;  5D9W A;  2WUL A;  2FY6 A;  4PUR A;  3P90 A;  2FGX A;  4Q5N A;  2R0G A;  1GUK A;  3GX0 A;  1MEK A;  3UBL A;  4KND A;  1TJD A;  4AGS A;  1K3L A;  2CA8 A;  3KXO A;  4F82 A;  4WF5 A;  2RII A;  5FT3 A;  3F6F A;  4L0W A;  4OFT A;  1OC9 B;  4G9H A;  2X99 A;  1FB6 A;  4HQZ A;  4AJ8 A;  2CVK A;  1WP0 A;  3VWX A;  1TRU A;  2YV7 A;  4Z2R A;  2P5Q A;  4V1A p;  3LXZ A;  2F3M A;  1JFU A;  4KSO A;  1WE0 A;  5L71 A;  2FWG A;  4ZBA A;  4HS1 A;  2HRA A;  3RPN A;  4ZL7 A;  4KF9 A;  2WZ9 A;  2GSS A;  2C0G A;  1JZR A;  1Z9H A;  2RUF A;  4F03 A;  5E59 A;  1V40 A;  1U3A A;  3SWL A;  5ECK B;  2A2S A;  3QMX A;  1DUG A;  5D73 A;  2NDO A;  1GUH A;  1TRV A;  2A2R A;  2DJ1 A;  1TI1 A;  3L9S A;  1ZGN A;  4HZ4 A;  5A4U A;  2VCZ A;  2IL3 A;  1GP1 A;  2HRK A;  4EVM A;  6GSW A;  5CRE A;  1KBN A;  2CT6 A;  2M80 A;  1B4P A;  1B4Q A;  5JCU A;  2R3X A;  3UVT A;  1X9S B;  4K7N A;  4EUY A;  4HUA A;  2OE1 A;  2IFQ B;  3HZ4 A;  1AQW A;  3FMW A;  4Q5F A;  4JU5 A;  2C3T A;  4XS1 A;  3TKP A;  1VF2 A;  1AW9 A;  4JR4 A;  5E4W A;  3RDW A;  4EXJ A;  3TJJ A;  2RUE A;  3FYG A;  5ECH B;  2GTU A;  3EYT A;  5F05 A;  1XZO A;  3W6G A;  4JBB A;  5CO3 A;  1T1V A;  3RHB A;  3GTU B;  3QOU A;  4BVX A;  3WT2 A;  4I2U A;  1YZX A;  3MSZ A;  1U3I A;  2R0P A;  4K2D A;  4GWR A;  4NHW A;  1TDI A;  5AGY A;  4HJM A;  2OJL A;  1FVJ A;  1Z3E A;  1K0O A;  3LFL A;  1XBS A;  2HRN A;  5F0G A;  1MD4 A;  2LV3 A;  3DML A;  2VCQ A;  4PX1 A;  1DE2 A;  3EVI A;  1AXD A;  1OC3 A;  1R4W A;  4K6X A;  1ST9 A;  1Z7R A;  6GSV A;  3FR3 A;  1Y6E A;  2F9S A;  3DWV A;  4POK A;  3ZL5 A;  3HJP A;  3QPM A;  3P8W A;  3ZLP A;  1OVN A;  2DML A;  3PPU A;  3PH9 A;  2YWO A;  4EIQ A;  1PX6 A;  5DBQ A;  4HQS A;  6GSS A;  1RW1 A;  1EP8 A;  1S3A A;  4K2X A;  4TR1 A;  2E7P A;  1ERW A;  1BYE A;  4I5Q A;  3HDC A;  3C71 A;  5KEJ A;  3Q19 A;  1PD2 1;  3IHG A;  3WGE A;  4IS0 A;  1TK8 B;  1YEX A;  5ECO B;  3KP9 A;  2B7K A;  3EIN A;  2ALB A;  4GQF A;  4L8E A;  4O5U A;  1JZD A;  2ZCT A;  2Z9S A;  1SEN A;  1QQ2 A;  3IE3 A;  3UMA A;  3KD0 A;  4LL4 B;  4FH8 A;  2H6Z A;  5DAL B;  3VPQ A;  5DDL A;  2X8H A;  4ZL8 A;  1GSY A;  1W4V A;  19GS A;  4MJB A;  1F2E A;  2CV4 A;  3GMF A;  1HYU A;  2ZUP A;  5HFG A;  1S3D A;  5GZZ B;  2FWH A;  4MPF A;  2GQK A;  1EP7 A;  4IVF A;  4CY6 A;  2LJR A;  3V1W A;  2FA4 A;  4Z7X A;  3VFI A;  5J41 A;  1T4Z A;  1YDK A;  2F8A A;  2YV9 A;  2O87 A;  2JAC A;  3LGC A;  4MA9 A;  1DE1 A;  2CX4 A;  2IPA A;  3CMI A;  1BED A;  1G7O A;  3CSH A;  1ZYE A;  1WWJ A;  1NHY A;  5D9X A;  3BOA A;  4ULX A;  3HY2 A;  5JWQ B;  2LKU A;  2PVO C;  4I6X A;  4IP1 A;  1QGV A;  4YKG A;  2CZ3 A;  2GZP A;  4BWS A;  9GSS A;  2RM5 A;  4YQM A;  4KDX A;  4D73 B;  2PN8 A;  3A3T A;  2P5R A;  3FR6 A;  2EIO A;  4NAX A;  4K0N A;  1OC8 A;  4NHZ A;  3TKS C;  2H0I A;  4KDU A;  5A4V A;  1FB0 A;  4MCU A;  3KZQ A;  1JHB A;  4ZIJ A;  5B7C A;  2DLX A;  5J5N A;  2JAD A;  1SU9 A;  1YQ1 A;  3CYN A;  4POL A;  4PGT A;  5CNW A;  3LW9 A;  2C8U A;  4G0L A;  1EGO A;  3TKQ A;  1CQH A;  5J9C A;  2TRX A;  2B5X A;  2C0D A;  1HNB A;  4DSS A;  4O32 A;  4J57 E;  4FO5 A;  1M2B A;  2JSY A;  1GH2 A;  5HFI A;  1G7E A;  2QA2 A;  4J56 E;  1NHO A;  2DSA A;  4IP6 A;  3IA1 A;  3CSJ A;  3MAK A;  2DMM A;  2FD3 A;  2GVP A;  3TOU A;  4WBJ A;  4OCE A;  5DAK A;  1KEB A;  2B1K A;  5GSS A;  1QMV A;  4O7H A;  2H75 A;  2HZE A;  3HKR A;  2OBK A;  2H1G A;  2LRN A;  1FOH A;  1M99 A;  3MDK A;  2C0F A;  2WDU A;  3Q74 A;  1PL2 A;  2KP2 A;  4ML6 A;  5AIV A;  3CXG A;  2H19 A;  1EOG A;  2GQL A;  1JLV A;  1GTI A;  1URM A;  4XCS A;  4ISD A;  1O7U A;  3CBU A;  1ZYN A;  2WB9 A;  4YQV A;  1AQX A;  4EO3 A;  1V57 A;  2IMD A;  3TRX A;  2AHE A;  3BCK A;  1THO A;  20GS A;  1FVK A;  2TRC P;  2K9F A;  2OKA A;  2FLS A;  3TGZ A;  3KM6 A;  1SJ6 A;  1TK5 B;  2DKH A;  3DD3 A;  2OAD A;  3KH9 A;  1ZL9 A;  3BD2 A;  5D9V A;  1WJK A;  3W8S A;  3CTG A;  1SKW B;  2A4H A;  4MDC A;  5ECM B;  1IYH A;  1MD3 A;  2ON7 A;  2AUV A;  3TJF A;  2PGT A;  4HU7 A;  1M0U A;  3CTF A;  3GHA A;  2P0G A;  3ZTL A;  5G1L A;  2IMI A;  3GA4 A;  3UEM A;  3VUR A;  1HNC A;  1U88 A;  5IO0 A;  2K8S A;  1SJI A;  4ZIL A;  3F4S A;  3ZIV A;  2N5B A;  1PX7 A;  4OWY A;  2DJ3 A;  2N5F A;  3H1N A;  5A5K A;  1TK0 B;  4KSM A;  2PBJ A;  1Z7P A;  2RM6 A;  4XTS A;  4IGJ A;  2HSH A;  4WR4 A;  2I4A A;  2L4C A;  1GSU A;  4MNN A;  4PTS A;  2O89 A;  2VL9 A;  5KOW A;  4ZB9 A;  4ECB A;  1M7T A;  1Z6M A;  1G0T A;  5G2Z A;  3HJM A;  3C1R A;  3IK9 A;  4K9Z A;  4PQI A;  1K3O A;  4ECJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...