1WMJA

Solution structure of thioredoxin type h from oryza sativa
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
122
structure length
122
Chain Sequence
MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin H-type
publication title Solution structure of Thioredoxin type h from Oryza sativa
rcsb
source organism Oryza sativa
molecule tags Oxidoreductase
total genus 18
structure length 122
sequence length 122
ec nomenclature ec 1.8.4.8: Phosphoadenylyl-sulfate reductase (thioredoxin).
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1wmjA01
1DE1A 4GCIA 4K2DA 3LYKA 3HKRA 4FIWA 1QMVA 5EL8A 3CSHA 4YQMA 2NPBA 4NHZA 1XXUA 4G19A 1R4WA 1THXA 2P0GA 5IO0A 2WS2A 2H75A 2RLIA 1JFUA 2YJ7A 4ECJA 5CRWA 4BWSA 1K0NA 1QUWA 1XFLA 4EUYA 1GTUA 1J0FA 4JZQA 1A2LA 2ES7A 3BOAA 4TW5A 4LL1B 2AAWA 2XBIA 1T3BA 2DSAA 1UN2A 2DJ3A 4G10A 3EE2A 4L5OA 2R6KA 2WCIA 3QMXA 2EIOA 4IP1A 5F0GA 4EDZA 1BEDA 1ZGNA 3D4MA 4TRXA 2I9HA 5JCUA 1JLVA 1U87A 1A8YA 2H66A 4DSSB 4O32A 2JADA 3RDWA 1V9WA 2B5XA 1JZDA 4KW6A 2KP1A 2ZUPA 3KP8A 4FYUA 2AYTA 3DRNA 2QGVA 3FZ4A 5FT3A 2LV3A 1OC9A 3K8NA 3F0IA 1NW2A 2RUFA 2ZCTA 2C4JA 2FWEA 6GSWA 2YWMA 1R26A 4NHWA 5D93A 1Z9HA 5F06A 1M2BA 4KE3A 3HZ4A 3LFLA 4HQZA 2H73A 2GT5A 4NWYA 1SU9A 1YF1A 4EF0A 3ZVJD 4KH7A 2C0FA 5G5FA 2ON7A 2OA7A 2DMLA 5DQSA 1QFNA 3GX0A 3LQ7A 1PGTA 5ABRA 1OC8A 5D96A 3QFBC 3MNGA 3EWLA 4N10A 3LORA 3TOUA 2LRNA 3O3TA 3KMNA 2YWIA 4OFNA 4BVXA 5JWOB 5F8BA 3TKRA 1SK0A 1Q4JA 1SENA 3F63A 4ZBDA 3ZL5A 1ST9A 3EVIA 3UL3A 1TK8B 5ENUA 5ELGA 3Q19A 2C8UA 4DVCA 1ILOA 5DDLA 1EWXA 4MK3A 4NMUA 3APQA 2MMZA 4MPFA 4ZBAA 3HYPA 3ERFA 4ML6A 3BCIA 1TI1A 1T8EB 1F2EA 4N30A 2L5OA 3FY7A 3D5JA 1AQWA 6GSVA 4IBPA 1EOHA 4TXOB 1SL1B 2C80A 3IDVA 3LJRA 2VM1A 2NTOA 1QQ2A 4ACSA 1Z7PA 3GKNA 2PN8A 5HFIA 5JWQB 3E9JB 14GSA 3CSIA 2RIIA 3HY2A 3CXGA 3UIWA 5J5NA 3DMLA 4TVEA 2IMDA 3HXSA 3EYTA 1KNGA 7GSSA 2P5QA 1Z6NA 4NXIA 3L9SA 3A5WA 4XS1A 3TDGA 3GYKA 3RPPA 4HS1A 2REMA 3H4KA 3BBYA 2PGTA 4WF4A 4YQVA 1SKWB 1B4QA 3F4RA 3TJKA 1GL8A 4IN0A 2B1LA 3FZAA 2H8LA 4MJEA 4JRRA 4EXJA 3KGKA 5CREA 5IPHA 2CVDA 3RBTA 2VCWA 1ZYEA 1EGRA 4AJ7A 1DSBA 1K0DA 2H74A 1J9BA 4BPYA 1K3OA 3VWWA 4D73A 4KDXA 5KN0A 1CQGA 1ABAA 1TKDB 1YKCA 5IMZA 2N5AA 4TR3A 2AHEA 3KH9A 2EIQA 3Q6OA 3EURA 4HEA2 4TXVA 4L0WA 1X5CA 2JZRA 3HVSA 5DVBA 3UOMA 1EV4A 2CX4A 2GS3A 5A5KA 1K0AA 4HUAA 1AQXA 3GKMA 2LSTA 4JU5A 1TK5B 3UBLA 2VL2C 4G2EA 3TJFA 2BTOT 2PU9C 4GF0A 2OBKA 4Q5NA 4IJ3A 3EMPA 3RAZA 5IPGA 3J7Yb 2V32A 4ML1A 1MD4A 1ACVA 3GL3A 4POBA 5DJMA 4V2NA 5GSSA 2JSYA 2YZHA 2H19A 3GNJA 3TKSA 3GA4A 5J3RA 2K8SA 3QR6A 4O92A 1XZOA 2KUCA 1XCCA 2FA4A 2YJHA 5ECKB 2F9SA 3UJ1A 3RPNA 5B7CA 3GKKA 4KCEA 3KCMA 2I4AA 6GSSA 2C1YA 3HVXA 3GSSA 3P2AA 2XBQA 3I6AA 4N0VA 3W6GA 4JR4A 1SKSB 4WBRD 4XS4B 1XWKA 1TI3A 3D0ZA 4K8MA 4KNDA 3UEMA 1TXXA 5GZZB 1I5GA 5AN1A 1PL1A 3ZRDA 3TJBA 1MD3A 3IR4A 4OFMA 1O81A 4HI7A 3CSJA 1GTBA 1ZYQB 2R3XA 5D73A 2FUG2 4MZBA 5CRHA 5D8IA 1VGLA 2CVKA 2VCZA 2IWTA 3HDCA 1B4PA 1QGVA 4MP4A 2NDOA 4GTUA 4CW9A 5ECQB 3FRCA 1A0FA 2A2SA 2CV4A 4KSOA 1YY7A 3FZ9A 3IAS2 1PN9A 1NSWA 1Z3EA 4ZB6A 3I9V2 3W8JA 4KX4A 3CTGA 4F0CA 3IV4A 1TRVA 2FY6A 2VL3A 4NV5A 4WF5A 3MDKA 3KM6A 3TGZA 1U3IA 1OYJA 3G7IA 2FWGA 1HNCA 3Q74A 18GSA 4PNGA 2DJ1A 5DAKB 1KBNA 4HJMA 4LLRA 4O5RA 1JZOA 2CZ3A 3HJMA 1BAYA 2H6XA 3HVVA 4RUVA 3I69A 3GKXA 1GSUA 4MH3A 2FLSA 3IC4A 2BMXA 1GULA 2I81A 4I2TA 2VIMA 5JCWA 1XW6A 2IJYA 1HD2A 1G7OA 3M1GA 4KA0A 1SKRB 3SWLA 4IS0A 1C72A 1SJIA 3GTUB 1N8JA 2Z9SA 4ZL7A 2OKAA 2AJQB 3GHAA 3GUSA 3QD9A 4TR0A 1I9DA 2DJKA 1MEKA 1N2AA 3GSTA 2IL3A 2HRFA 5ID2B 2KOKA 4RQXA 3GX8A 5C04A 2N5FA 2GGTA 3VK9A 1S3DA 3D6IA 4ISDA 4WXTA 6GSUA 1ML6A 2JZTA 1THOA 2ALBA 2AV4A 4ZL8A 4MPGA 2VLUA 2OBIA 5HQPA 4HZ2A 2FNOA 4GSNA 4X0XA 1V98A 2CVBA 4PUFC 1G6YA 3C7MA 4IQ1A 4TR1A 8GSSA 2CAIA 4POMA 1TK0B 1V2AA 12GSA 1AAZA 1GTAA 3FZ5A 2C0GA 2M72A 2PWJA 2B5YA 2L4QA 3BJ5A 4G9HA 3ERWA 1XW5A 2VO4A 2YOIA 4L0UA 3EU4A 5H5RA 1E2YA 5IMCA 1HYUA 4N11A 1EV9A 4IJIA 3TKPA 1EOGA 2H30A 2H0GA 4DSQA 2B6MA 1WMJA 1MDIA 4F9ZA 2HT9A 3TJGA 3PH9A 3IAM2 2B5EA 2WULA 2LJRA 1O85A 2V1MA 1V57A 2VM2A 2OE3A 4ID0A 10GSA 1GLQA 3S9FA 4IKHA 3FYGA 4XHMA 5J41A 1SD8A 1Y6EA 5CNWA 4MF7A 3IA1A 3F4TA 4LMVA 1PA3A 1OVNA 1K3LA 1AQVA 3BD2A 3MSZA 2K8VA 1O7UA 3L9VA 1PSQA 1Z6MA 3VWXA 2FWHA 1B9XC 1XOBA 3DEXA 4FYBA 2WFCA 2R5GA 4IVFA 5IMAA 1YZXA 1WIKA 4MMMA 2FGXA 4FYCA 2IPAA 6GSXA 4K1FA 3DD3A 2RUEA 2WZ9A 4EDYA 2NBSA 1ZZYA 1JZWA 4OCFA 5IIZA 5HR1A 3IBHA 2BJXA 4WBJA 3C71A 1YQ1A 1T1VA 3GV1A 1HNAA 3GH6A 2HZEB 5B6NA 4KGIA 1O8XA 3F6DA 2DIZA 1WE0A 3WD6A 2H1DA 4MF5A 1WOUA 3FHKA 3VLNA 2DJ0A 2A4VA 1G6WA 4WR4A 1K0CA 1WWJA 3QFAC 3G7YA 1A2JA 5D9XA 1TRUA 4QQ7A 3M0FA 2IMEA 1TRSA 1FOVA 1EEMA 5IM9A 2YP6A 3ZREA 1NHOA 2VOCA 4EKZA 4EC0A 1F37A 5B8AA 4K9ZA 4KUNA 4GXZA 2X8HA 4DEJA 2B1KA 2HFDA 4IW9A 5A4VA 1USBA 2G0FA 1W4VA 1AXDA 3FR9A 3HZ8A 2R4VA 2PBJA 4ZXGA 2YV9A 3TKQA 2QSIA 3P7XA 2JU5A 1GP1A 1JLWA 2H70A 3FW2A 2KP2A 3NZNA 1TJDA 13GSA 2VCQA 19GSA 1XOAA 2B7KA 4RI6A 2HSYA 1XW9A 2LJAA 3TRQA 11GSA 1TP9A 3G7JA 3EINA 2E0QA 4EO3A 1X9SB 4NAXA 3MWHA 1MDKA 5GAND 1O73A 4JBBA 2CX3A 1NHYA 1T4YA 3P8WA 2OE1A 3PR8A 2LS5A 3G9BA 3TRXA 1SL2B 5CAXA 5GSTA 2VUPA 1XPVA 9GSSA 5DCGA 3QAVA 3TJJA 4TOPA 3ERGA 3DVXA 2YZUA 1GSSA 4MJAA 2CQ9A 1OC9B 2I1UA 6GSYA 2VCTA 2IMIA 4KSMA 1PX7A 5DJLA 3JCML 3O6TA 3UAPA 5IQYA 1FVJA 2GQKA 1H75A 3US3A 1XIYA 2LQOA 3NIVA 1R7HA 4PXOA 2LEGA 4JE1A 2M46A 1A23A 4WEYA 1PL2A 5CRGA 3QOUA 2FCHA 5EY6A 1H4OA 2JSZA 2IFQA 2QC7A 4AJ8A 3ZTLA 2ZNMA 5HR2A 4YH2A 5A4WA 3F8UA 1QXHA 3HHVA 4E8HA 1EP8A 5D9WA 1JZRA 4HU7A 2DBCA 4BWQA 3E0UA 1X0RA 1A8LA 2VLTA 2V41A 2XC2A 4NV2A 3TUEA 3CBUA 3TCOA 3HCZA 2XPEA 1K0BA 3Q18A 3HD5A 2H6ZA 1X5DA 1RW1A 1W89A 1VF4A 4PURA 5DQYA 1GRXA 2MMOA 1QK8A 4XS6A 1FG4A 3VPQA 1A2MA 3J7Yk 1SL0B 3F9UA 4OMVA 2H1BA 1FHEA 3UVHA 3SBCA 2PERA 4OCEA 3CTFA 1IYHA 2WRTA 1M2DA 5G31A 3A3TA 5F05A 1SJZA 5D9VA 1EZKA 5ECOB 2CT6A 2IIYA 2GZPA 3TB2A 1X9WB 2H01A 4WKWA 1F3AA 5G30A 4GSTA 1B8XA 5ECRB 2DLXA 2H1AA 1XWAA 3L9UA 4I8BA 2O8VB 3KMOA 4MJBA 4F2IA 2C3NA 1FW1A 4MH2A 4ILFA 3H93A 4KDYA 3GL5A 4BVYA 2TRCP 1KEBA 4ZB8A 1PX6A 4IP6A 3P90A 3FK8A 5E4WA 5KN2A 4QL9A 3ZFBA 5ECPB 4GQCA 1BQ7A 2GZZA 2OACA 1GSEA 2FD3A 2RM5A 4OFTA 1AUCA 1ERVA 3ZLPA 1SYRA 4HJ2A 2C0DA 1U88A 2D2ZA 3A2WA 3QAGA 2WB9A 3IK7A 3WT1A 1OE8A 4ZIJA 3ISOA 1GNWA 3KD0A 3VI7A 2P5RA 3GIXA 4TR4A 3KEBA 1X5EA 1UA5A 1DBYA 1OE7A 1G0TA 2VD1A 3EMXA 3DGQA 1ZL9A 4D73B 1NM3A 5IOXA 3HJOA 2MZCA 1GLPA 1VF3A 5G5EA 4Q5RA 2P31A 5KN1A 4MABA 4PQ1A 4ZB9A 4PQIA 3KH7A 2K6VA 3E3EA 1Z5YE 1KTEA 3A2XA 5EVOA 4DSSA 2VAFA 2H71A 4F03A 4CHSA 2VD0A 1F3BA 2PVQA 3GRXA 3VWVA 1AW9A 5KEJA 2I3YA 1GWCA 2LTKA 1SJ6A 5G1KA 1GH2A 3APSA 2X64A 2E2MA 2WGRA 5ECHB 2K18A 4PX1A 4I5QA 1ZMAA 2MBSA 3IK9A 1PKWA 2LRTA 1YJ6A 5IMVA 2B3SA 3UMAA 2HLSA 1E6BA 5L71A 1TW9A 2JL4A 3VURA 2IMFA 2IN3A 5AGYA 4MDCA 5B6MA 4F0BA 3D4TA 5G1LA 3C1RA 4E8EA 2HNLA 3CMIA 2N5BA 1R5AA 3TKSE 2V6KA 2GSQA 5KN3A 3IPZA 4AF2A 1VRSD 1WP0A 3LEFA 2MMNA 3WT2A 4H86A 1WJKA 1GSYA 4J57E 4LA1A 4HDEA 2GDRA 2DMMA 2E7PA 3A2VA 5CYYA 1ZOFA 1ZCPA 4KDUA 1TU7A 2YV7A 1SYXA 4HU9A 2GZYA 2R37A 3VPTA 3H1NA 4GQFA 2J23A 2TRXA 4V1Ag 3HJPA 1PD21 1MDJA 5J9BA 2QKEA 2LNTA 1EGOA 2HRNA 5GAPD 3O76A 4DSRA 1HQOA 5D9TA 2A2RA 3ZITA 4K0GA 1OC3A 4IGJA 1UVZA 3QAWA 2H72A 5CO3A 4HQSA 1TTZA 5F07A 4K7IA 4FH8A 20GSA 4K7OA 1X9MB 5ECIB 3ZMKA 1U6TA 1LU4A 1UC7A 3ME7A 4HZ4A 1O6JA 1T00A 2GSRA 4XIHA 3U6VA 1T7PB 4EL1A 2PVOC 1FVKA 1TRWA 3IXRA 4JR6A 2IMKA 3OR5A 2L6DA 5ECLB 3TOTA 2VCVA 1T4ZA 4V2MA 3R2QA 4PNFA 5ELAA 2K9FA 3KTLA 1BG5A 4BA7A 3IRAA 4TXOA 3PGTA 17GSA 3D22A 4POLA 2VL2A 1RQMA 1XVQA 2O89A 4ZBBA 1YDKA 3M9JA 2HYXA 4N0ZA 4HOJA 3TKSC 5LNKe 2XHFA 4POKA 5DCHA 3IE3A 3L4NA 5DALB 4MJCA 1Z7RA 5INYA 4V1Ap 2JACA 2DIYA 2C0EA 1BYEA 1ERWA 2LJKA 5J4UA 3W8SA 2XPDA 3QPMA 4XCSA 3EC3A 2OJLA 5ECNB 4K0NA 4EE0A 2GT6A 3VI5A 3KIJA 4L8EA 1ERTA 1JHBA 2L5LA 2OADA 4FO5A 3F6FA 4OO5A 2V2GA 4GRFA 4ULXA 5FHIA 2DJJA 4AGSA 1TDIA 4IELA 3ZZXA 2AB6A 4RQRA 1S3CA 3KP9A 3F4SA 3D21A 5ECMB 1GNEA 4GWRA 5CP1A 5HFGA 2MMAA 1CQHA 3V1WA 3FEUA 3LGCA 4QL7A 3ZFLA 1WPIA 2H1GA 1AC1A 2KHPA 2O87A 2LRCA 4XRDA 4TR1B 5H5SA 3CRTA 2MYGA 4F82A 4LMWA 3DIEA 1VF1A 3CRUA 2YWNA 4WR5A 1SK2A 1Q98A 1DUGA 3ZMLA 4GLTA 2GTUA 3GN3A 2CA8A 2HI7A 5ECSA 5FWGA 1DE2A 2WDUA 1M2AA 1OAZA 1VF2A 4PQHA 1V40A 3LSZA 5COHA 3ZVJA 2JZSA 1M9BA 1AIUA 2HXKA 3WGXA 1LJRA 3APOA 2G2QA 3CYNA 2L59A 1YKAA 1V58A 2F8FA 4OD7A 4RI7A 3VWUA 1TU8A 4YAVA 4JEDA 2FA8A 4XTSA 1BX9A 3HA9A 2C3QA 1XVWA 5G2ZA 4MCUA 4XS4A 1RK4A 3L0HA 4Q5QA 2LQQA 3L78A 2L4CA 4PUAA 2LNSA 3DXBA 4MF6A 4IQAA 3LWAA 2GVPA 2L57A 2H76A 2EC4A 3AY8A 3GFKA 3N5OA 2F3MA 1K0OA 4I6XA 4ECCA 3M9KA 1MTCA 4K6XA 1B9YC 5AIXA 1J08A 4XRAA 2PPTA 1U3AA 3RHBA 3FR3A 4TN8A 3PINA 4AJ6A 4ECBA 1IYIA 5IO2A 2R2JA 2LKUA 2DC5A 1YEXA 2J9HA 3F3RA 1FO5A 4NPBA 16GSA 1HNBA 1LBKA 2AUVA 4MZWA 4IHUA 3H8QA 5JCGA 3C8EA 1F9MA 2VCXA 4LL4B 3N9JA 2VLVA 2YWOA 1GUHA 2YPMA 4J56E 5DAKA 1S3AA 2LUSA 2OE0A 2PUKC 1WRYA 3IOSA 4K7NA 2GQLA 2WJUA 3DKSA 3M8NA 1YEPA 4PGTA 2KLXA 2HZFA 2F51A 1M0UA 3FKFA 3ED3A 5CRDA 2H0IA 3UARA 3IHQA 4GSSA 4L5LA 5B8BA 5IMFA 4P3YB 1M7TA 3GTUA 1ERUA 3U5RE 4X43A 1EP7A 3M3MA 1G7EA 2GLRA 1SD9A 4ECIA 6GSTA 1PRXA 5ID2A 5C00A 1GSQA 1TOFA 2B7JA 2GQMA 3C73A 4CDOA 2E2GA 4EVMA 3ME8A 2O7KA 2RM6A 1K0MA 1R5PA 4I97A 1M9AA 2TIRA 3EU3A 2X8GA 2HE3A 4Q5FA 2M80A 3NOFA 2CAQA 1FB0A 1K3YA 4WETA 4MZCA 4KB3A 2PMTA 5E59A 2DJ2A 3QDNA 2O85A 4I2UA 3UVTA 5LD0A 5EPFA 3GH9A 2HSHA 3FR6A 3ZIJA 2H6YA 1GSDA 2YANA 3ZIVA 3DYRA 2YNXA 3KZQA 2L6CA 4MLYA 5JWRB 1GSFA 1PQNA 1M99A 1GTIA 1SK1A 2IFQB 5HFKA 1BJXA 2H0HA 3LG6A 2V6OA 3BCKA 22GSA 2CZ2A 2FWFA 3WGEA 1EEJA 2X99A 2EIRA 1B48A 1FAAA 5J9CA 3UBKA 4V2LA 1OKTA 5AIVA 4YQUA 1GUMA 5DBQA 3DVWA 2X8CA 4MA9A 4O7HA 2NVLA 5IOWA 4ZILA 3WYWA 1ON4A 3C1SA 1FB6A 2YCDA 1OKDA 3GURA 5HR3A 4ZL9A 3KJYA 3VFIA 2YN1A 1PMTA 1YF0A 5DALA 4KAEA 2F8AA 3I43A 5HR0A 1XWCA 3LXTA 4OWYA 4YAPA 3LXZA 2ON5A 3LYPA 1XBSA 3H79A 1O8WA 3DWVA 1Y25A 1GUKA 2FHEA 4TKYA 4BL7A 2GSTA 1URMA 1A0RP 3GMFA 3QCPA 1A24A 2HZEA 2MBTA 1PKZA 2VL9A 3KTBA 1XWGA 1XWBA 3F3QA 3MAKA 1F6MC 4J2FA 5LCZA 5AISA 4X1UA 3TRPA 4OO4A 3RHCA 3KXOA 3ZYWA 5H5QA 2C3TA 4KCAA 5IMDA 4Z7XA 5A4UA 3WGDA 2GSSA
chains in the Genus database with same CATH superfamily
1DE1A 4GCIA 4K2DA 3LYKA 3HKRA 4FIWA 1QMVA 5EL8A 3CSHA 4YQMA 2NPBA 4NHZA 1XXUA 4G19A 1R4WA 1THXA 2P0GA 5IO0A 2WS2A 2H75A 2RLIA 1JFUA 2YJ7A 4ECJA 5CRWA 4BWSA 1K0NA 1QUWA 1XFLA 4EUYA 1GTUA 1J0FA 4JZQA 1A2LA 2ES7A 3BOAA 4TW5A 4LL1B 2AAWA 2XBIA 1T3BA 2DSAA 1UN2A 2DJ3A 4G10A 3EE2A 4L5OA 2R6KA 2WCIA 3QMXA 2EIOA 4IP1A 5F0GA 4EDZA 1BEDA 1ZGNA 3D4MA 4TRXA 2I9HA 5JCUA 1JLVA 1U87A 1A8YA 2H66A 4DSSB 4Z2RA 4O32A 2JADA 3RDWA 1V9WA 2B5XA 1JZDA 4KW6A 4BIKA 2KP1A 2ZUPA 3KP8A 4FYUA 2AYTA 3DRNA 2QGVA 3FZ4A 5FT3A 2LV3A 1OC9A 3K8NA 3F0IA 1NW2A 2RUFA 2ZCTA 2C4JA 2FWEA 6GSWA 4K5SA 2YWMA 1R26A 4NHWA 5D93A 1Z9HA 5F06A 1M2BA 4KE3A 3HZ4A 3LFLA 4HQZA 2H73A 2GT5A 4NWYA 1SU9A 1YF1A 2QA1A 4EF0A 3ZVJD 4KH7A 2R0GA 2C0FA 5G5FA 2ON7A 2OA7A 2DMLA 5DQSA 1QFNA 3GX0A 3LQ7A 1PGTA 5ABRA 1OC8A 5D96A 3QFBC 3MNGA 3EWLA 4N10A 3LORA 3TOUA 2LRNA 3O3TA 3KMNA 2YWIA 4OFNA 4BVXA 5JWOB 5F8BA 3TKRA 1SK0A 1Q4JA 1SENA 3F63A 4ZBDA 3ZL5A 1ST9A 3EVIA 3UL3A 1TK8B 5ENUA 5ELGA 3Q19A 2C8UA 4DVCA 1ILOA 5DDLA 1EWXA 4MK3A 4NMUA 3APQA 2MMZA 4MPFA 4ZBAA 3HYPA 3ERFA 4ML6A 3BCIA 1TI1A 1T8EB 1F2EA 4N30A 2L5OA 3FY7A 3D5JA 1AQWA 6GSVA 4IBPA 1EOHA 4TXOB 1SL1B 3PPUA 2C80A 3IDVA 3LJRA 2VM1A 2NTOA 1QQ2A 4ACSA 1Z7PA 3GKNA 2PN8A 4EIQA 5HFIA 5JWQB 3E9JB 14GSA 3CSIA 2RIIA 3HY2A 3CXGA 3UIWA 5J5NA 3DMLA 4TVEA 2IMDA 3HXSA 3EYTA 1KNGA 7GSSA 2P5QA 1Z6NA 4NXIA 3L9SA 3A5WA 4XS1A 3TDGA 3GYKA 3RPPA 4YKGA 4HS1A 2REMA 3H4KA 3BBYA 2PGTA 4WF4A 4YQVA 1SKWB 1B4QA 3F4RA 3TJKA 1GL8A 4IN0A 2B1LA 3FZAA 2H8LA 4MJEA 4JRRA 3A5IA 4EXJA 3KGKA 5CREA 5IPHA 2CVDA 3RBTA 2VCWA 1ZYEA 1EGRA 4AJ7A 1DSBA 1K0DA 2H74A 1J9BA 4BPYA 1K3OA 3VWWA 4D73A 4KDXA 5KN0A 1CQGA 1ABAA 1TKDB 1YKCA 5IMZA 2N5AA 4TR3A 2AHEA 3KH9A 2EIQA 3Q6OA 3EURA 4HEA2 4TXVA 4L0WA 1X5CA 2JZRA 3HVSA 5DVBA 2X4AA 3UOMA 1EV4A 2CX4A 2GS3A 5A5KA 1K0AA 4HUAA 1AQXA 3GKMA 2LSTA 4G0LA 4JU5A 1TK5B 3UBLA 2VL2C 4G2EA 3TJFA 2BTOT 2PU9C 4GF0A 2OBKA 4Q5NA 4IJ3A 3EMPA 3RAZA 5IPGA 3J7Yb 2V32A 4ML1A 1MD4A 1ACVA 3GL3A 4POBA 5DJMA 4V2NA 5GSSA 2JSYA 2YZHA 2H19A 3GNJA 3TKSA 3GA4A 3FMWA 5J3RA 2K8SA 3QR6A 4O92A 1XZOA 2KUCA 1XCCA 2FA4A 2YJHA 5ECKB 2F9SA 3UJ1A 3HVNA 5B7CA 3RPNA 3GKKA 1PFOA 4KCEA 3KCMA 2I4AA 6GSSA 2C1YA 3HVXA 3GSSA 3P2AA 2XBQA 3I6AA 4N0VA 3W6GA 4JR4A 1SKSB 4WBRD 4XS4B 1XWKA 1TI3A 3D0ZA 4K8MA 4KNDA 3UEMA 1TXXA 5GZZB 1I5GA 4EIPA 5AN1A 1PL1A 3ZRDA 3TJBA 4K5RA 1MD3A 3IR4A 4OFMA 1O81A 4HI7A 3CSJA 1GTBA 1ZYQB 2R3XA 5D73A 2FUG2 4MZBA 5CRHA 5D8IA 1VGLA 2CVKA 2VCZA 2IWTA 3HDCA 1B4PA 4CY8A 1QGVA 4MP4A 2NDOA 1S3RA 4GTUA 4CW9A 5ECQB 3FRCA 1A0FA 2A2SA 2CV4A 4KSOA 1YY7A 3FZ9A 3IAS2 2HSMA 1PN9A 1NSWA 1Z3EA 4ZB6A 3I9V2 3W8JA 4KX4A 3CTGA 4F0CA 3IV4A 1TRVA 2FY6A 2VL3A 4NV5A 4WF5A 3MDKA 3KM6A 1PN0A 3TGZA 1U3IA 1OYJA 3G7IA 2FWGA 1HNCA 3Q74A 18GSA 3R3EA 4PNGA 2DJ1A 5DAKB 1KBNA 4HJMA 4LLRA 4O5RA 1JZOA 2CZ3A 3HJMA 1BAYA 2H6XA 3HVVA 4RUVA 3I69A 3GKXA 1GSUA 4MH3A 2FLSA 3IC4A 2BMXA 1GULA 2I81A 4I2TA 2VIMA 5JCWA 1XW6A 2IJYA 1HD2A 1G7OA 3M1GA 4KA0A 1SKRB 3SWLA 4IS0A 1C72A 1SJIA 3GTUB 1N8JA 2Z9SA 4ZL7A 2OKAA 4CY6A 2AJQB 3GHAA 3GUSA 3QD9A 4TR0A 1I9DA 2DJKA 1MEKA 1N2AA 3GSTA 2IL3A 2HRFA 5ID2B 2KOKA 4MNNA 4RQXA 3GX8A 5C04A 2N5FA 2GGTA 3VK9A 1S3DA 3D6IA 4ISDA 4WXTA 6GSUA 1ML6A 2JZTA 1THOA 2ALBA 2AV4A 4ZL8A 4MPGA 2VLUA 2OBIA 5HQPA 4HZ2A 2FNOA 4GSNA 4X0XA 1V98A 2CVBA 4PUFC 1G6YA 3C7MA 4IQ1A 4TR1A 8GSSA 2CAIA 4POMA 1TK0B 1V2AA 2DKIA 12GSA 1AAZA 1GTAA 3FZ5A 2C0GA 1M3IA 2M72A 2PWJA 2B5YA 2L4QA 3BJ5A 4G9HA 3ERWA 1XW5A 2VO4A 2YOIA 4L0UA 3EU4A 5H5RA 5KOXA 1E2YA 5IMCA 1HYUA 4N11A 1EV9A 4O5UA 4IJIA 3EPTA 3TKPA 1EOGA 2H30A 2H0GA 4DSQA 2B6MA 1WMJA 1ZYNA 1MDIA 4F9ZA 2HT9A 3TJGA 3PH9A 3IAM2 2B5EA 2WULA 2LJRA 5BMUA 1O85A 2V1MA 1V57A 2VM2A 2OE3A 4ID0A 10GSA 3MIXA 1GLQA 3S9FA 4IKHA 3FYGA 4XHMA 5J41A 1SD8A 1Y6EA 5CNWA 4MF7A 3IA1A 3F4TA 4LMVA 1PA3A 1OVNA 1K3LA 1AQVA 3BD2A 3MSZA 2K8VA 1O7UA 3L9VA 4KF9A 4FQUA 1PSQA 1Z6MA 3VWXA 2FWHA 1B9XC 1XOBA 3DEXA 4FYBA 2WFCA 2R5GA 4IVFA 5IMAA 1YZXA 1WIKA 4MMMA 2FGXA 4K2XA 4FYCA 2IPAA 6GSXA 4K1FA 3DD3A 2RUEA 2WZ9A 4EDYA 2NBSA 1ZZYA 4BL7B 1JZWA 4OCFA 5IIZA 5HR1A 3IBHA 2BJXA 4WBJA 3C71A 1YQ1A 1T1VA 3GV1A 1HNAA 3GH6A 2HZEB 5B6NA 4KGIA 1O8XA 3MYDA 3F6DA 2DIZA 1WE0A 3WD6A 2H1DA 4MF5A 1WOUA 3FHKA 3VLNA 2DJ0A 2A4VA 1G6WA 4WR4A 1K0CA 1WWJA 3QFAC 3G7YA 1A2JA 5D9XA 1TRUA 4QQ7A 3M0FA 2IMEA 1TRSA 1FOVA 1EEMA 2A4HA 5IM9A 2YP6A 3ZREA 1NHOA 2VOCA 4EKZA 4EC0A 1F37A 5B8AA 4K9ZA 4KUNA 4GXZA 2X8HA 4DEJA 2B1KA 2HFDA 4IW9A 5A4VA 1USBA 2G0FA 1W4VA 1AXDA 3FR9A 3HZ8A 2R4VA 2PBJA 4ZXGA 2YV9A 3TKQA 2QSIA 3P7XA 2JU5A 1GP1A 1JLWA 2H70A 3FW2A 2KP2A 3NZNA 1TJDA 13GSA 2VCQA 19GSA 1XOAA 2B7KA 4RI6A 2HSYA 1XW9A 2LJAA 3TRQA 11GSA 1TP9A 3G7JA 3EINA 2E0QA 4EO3A 1X9SB 4NAXA 3MWHA 1MDKA 5GAND 1O73A 4JBBA 2CX3A 1NHYA 1T4YA 3P8WA 2OE1A 3PR8A 2LS5A 3G9BA 3TRXA 1SL2B 5CAXA 5GSTA 2VUPA 1XPVA 9GSSA 5DCGA 3QAVA 2R0PA 3TJJA 4TOPA 3ERGA 3DVXA 2YZUA 1GSSA 4MJAA 2CQ9A 1OC9B 2I1UA 6GSYA 2VCTA 2IMIA 4KSMA 1PX7A 2UZ8A 5DJLA 3JCML 3O6TA 3UAPA 5IQYA 1FVJA 2GQKA 1H75A 3US3A 1XIYA 2LQOA 3NIVA 1R7HA 4PXOA 2LEGA 4JE1A 2M46A 1A23A 4WEYA 1PL2A 4Z2TA 5CRGA 3QOUA 2FCHA 1H4OA 5EY6A 2JSZA 2IFQA 2QC7A 4AJ8A 3ZTLA 2ZNMA 5HR2A 4YH2A 5A4WA 3F8UA 1QXHA 3HHVA 4E8HA 1EP8A 5D9WA 1JZRA 4HU7A 2DBCA 4BWQA 3E0UA 1X0RA 1A8LA 2VLTA 2V41A 2XC2A 4NV2A 3TUEA 3CBUA 3TCOA 3HCZA 2XPEA 1K0BA 3Q18A 3HD5A 2H6ZA 1X5DA 1RW1A 1W89A 1VF4A 4PURA 5DQYA 1GRXA 4BVXB 2A2PA 2MMOA 1QK8A 4XS6A 1FG4A 3VPQA 1A2MA 3J7Yk 1SL0B 3CQFA 3F9UA 4OMVA 2H1BA 1FHEA 3UVHA 3SBCA 2PERA 4OCEA 3CTFA 1IYHA 2WRTA 1M2DA 5G31A 3A3TA 5F05A 1SJZA 5D9VA 1EZKA 5ECOB 1M3JA 2CT6A 2IIYA 2GZPA 3TB2A 1X9WB 1ZYPA 2H01A 4WKWA 1F3AA 5G30A 4GSTA 1B8XA 5ECRB 2DLXA 2H1AA 1XWAA 3L9UA 4I8BA 2O8VB 3KMOA 4MJBA 4PTSA 4F2IA 2C3NA 1FW1A 2X49A 4MH2A 4ILFA 3H93A 4KDYA 3GL5A 4BVYA 2TRCP 1KEBA 4ZB8A 1PX6A 4G0KA 4IP6A 3P90A 3FK8A 5E4WA 5KN2A 4QL9A 3ZFBA 5ECPB 4GQCA 1BQ7A 2GZZA 2OACA 1GSEA 2FD3A 2RM5A 4OFTA 1AUCA 1ERVA 3ZLPA 1SYRA 3IC8A 4HJ2A 2C0DA 1U88A 4G0IA 2D2ZA 3A2WA 3QAGA 2WB9A 3IK7A 3WT1A 1OE8A 4ZIJA 3ISOA 1GNWA 3KD0A 3VI7A 2P5RA 3GIXA 4TR4A 3KEBA 4USSA 1X5EA 1UA5A 1DBYA 1OE7A 1G0TA 2VD1A 3EMXA 3DGQA 1ZL9A 4D73B 1NM3A 5IOXA 3HJOA 2MZCA 1GLPA 1VF3A 5G5EA 4Q5RA 2P31A 5KN1A 4MABA 4PQ1A 4ZB9A 4PQIA 3KH7A 4HSCX 2K6VA 3E3EA 1Z5YE 1KTEA 3A2XA 5EVOA 4DSSA 2VAFA 2H71A 4F03A 4CHSA 2VD0A 1F3BA 2PVQA 3GRXA 3VWVA 1AW9A 5KEJA 2I3YA 1GWCA 2LTKA 1SJ6A 5G1KA 1GH2A 3APSA 2X64A 2E2MA 2WGRA 5ECHB 2K18A 4PX1A 4I5QA 1ZMAA 2MBSA 3IK9A 1PKWA 2LRTA 1YJ6A 5IMVA 2B3SA 3UMAA 2HLSA 1E6BA 5L71A 1TW9A 2JL4A 3VURA 2IMFA 2IN3A 5AGYA 4MDCA 5B6MA 4F0BA 3D4TA 5G1LA 3C1RA 4E8EA 2HNLA 3CMIA 2N5BA 1R5AA 3TKSE 2V6KA 2GSQA 5KN3A 3IPZA 4AF2A 1VRSD 1WP0A 3LEFA 2MMNA 3WT2A 4H86A 1WJKA 1GSYA 4J57E 4LA1A 4HDEA 2GDRA 2DMMA 2E7PA 3A2VA 5CYYA 1ZOFA 1ZCPA 4KDUA 1TU7A 2YV7A 1SYXA 4HU9A 2GZYA 2R37A 3VPTA 3H1NA 4GQFA 2J23A 2TRXA 4V1Ag 3HJPA 1PD21 1MDJA 5J9BA 2QKEA 2LNTA 1EGOA 2HRNA 5GAPD 3O76A 4DSRA 1HQOA 5D9TA 2A2RA 3ZITA 4K0GA 1OC3A 4IGJA 1UVZA 3QAWA 2H72A 5CO3A 4HQSA 1TTZA 5F07A 4K7IA 1XG8A 4FH8A 20GSA 4K7OA 1X9MB 5ECIB 3ZMKA 1U6TA 1LU4A 1UC7A 3ME7A 4HZ4A 1O6JA 1T00A 2GSRA 4XIHA 3U6VA 4A5PA 1T7PB 4EL1A 2PVOC 1FVKA 1TRWA 3IXRA 4JR6A 2IMKA 5KOWA 3OR5A 2L6DA 5ECLB 3TOTA 2VCVA 1T4ZA 3LW9A 4V2MA 3R2QA 4PNFA 5ELAA 2K9FA 3KTLA 1BG5A 4BA7A 3IHGA 3IRAA 4TXOA 3PGTA 17GSA 3D22A 4POLA 2VL2A 1RQMA 1XVQA 2O89A 4ZBBA 1YDKA 3M9JA 2HYXA 4N0ZA 4HOJA 3TKSC 5LNKe 2XHFA 4POKA 5DCHA 3IE3A 3L4NA 5DALB 4MJCA 1Z7RA 5INYA 4V1Ap 2JACA 2DIYA 2C0EA 2DKHA 1BYEA 1ERWA 2LJKA 5J4UA 3W8SA 2XPDA 3QPMA 4XCSA 3EC3A 2OJLA 5ECNB 4K0NA 4EE0A 2GT6A 3VI5A 3KIJA 4L8EA 1ERTA 1JHBA 2L5LA 2OADA 4FO5A 3F6FA 4OO5A 2V2GA 4GRFA 4ULXA 5FHIA 2DJJA 4AGSA 1TDIA 4IELA 3ZZXA 2AB6A 4RQRA 1S3CA 3KP9A 3F4SA 3D21A 5ECMB 1GNEA 4GWRA 5CP1A 5HFGA 2MMAA 1CQHA 2R0CA 3V1WA 3FEUA 3LGCA 4QL7A 3ZFLA 1WPIA 2H1GA 1AC1A 2KHPA 2O87A 2LRCA 4XRDA 4TR1B 5H5SA 3CRTA 2MYGA 4F82A 4LMWA 3DIEA 1VF1A 3CRUA 2YWNA 4WR5A 1SK2A 1Q98A 1DUGA 3ZMLA 4GLTA 2GTUA 3GN3A 2CA8A 2HI7A 5ECSA 5FWGA 1DE2A 2WDUA 1M2AA 1OAZA 1VF2A 4PQHA 1V40A 3LSZA 5COHA 3ZVJA 2JZSA 1M9BA 1AIUA 2HXKA 4X4JA 3WGXA 1LJRA 3APOA 2G2QA 3CYNA 2L59A 1YKAA 1V58A 2F8FA 4OD7A 4RI7A 3VWUA 1TU8A 4YAVA 4JEDA 2FA8A 2HRKA 4O5QA 4XTSA 1BX9A 3HA9A 2C3QA 1XVWA 5G2ZA 4MCUA 4XS4A 1RK4A 3L0HA 4Q5QA 2LQQA 3L78A 2L4CA 4PUAA 2LNSA 3DXBA 4MF6A 4IQAA 3LWAA 2GVPA 2L57A 2H76A 2EC4A 3AY8A 3GFKA 3N5OA 2F3MA 1K0OA 4I6XA 2QA2A 4ECCA 3M9KA 1MTCA 4K6XA 1B9YC 5AIXA 1J08A 4XRAA 2PPTA 1U3AA 3RHBA 3FR3A 4TN8A 3PINA 4AJ6A 4ECBA 1IYIA 5IO2A 2R2JA 2LKUA 2DC5A 1YEXA 2J9HA 3F3RA 1FO5A 4NPBA 16GSA 1HNBA 1LBKA 2AUVA 4MZWA 2HRAA 4IHUA 3H8QA 5JCGA 3C8EA 1F9MA 2VCXA 4LL4B 3N9JA 2VLVA 2YWOA 1GUHA 2YPMA 4J56E 5DAKA 1S3AA 2LUSA 2OE0A 2PUKC 1WRYA 3IOSA 4K7NA 2GQLA 2WJUA 3DKSA 3M8NA 1YEPA 4PGTA 2KLXA 2HZFA 2F51A 1M0UA 3FKFA 3ED3A 5CRDA 2H0IA 3UARA 3IHQA 4GSSA 4L5LA 5B8BA 5IMFA 4P3YB 1M7TA 3GTUA 5BRTA 1ERUA 3U5RE 4X43A 1EP7A 3M3MA 1G7EA 2GLRA 1SD9A 4ECIA 6GSTA 1PRXA 1FOHA 5ID2A 5C00A 1GSQA 1TOFA 2B7JA 2GQMA 3C73A 4CDOA 2E2GA 4EVMA 3ME8A 2O7KA 2RM6A 1K0MA 1R5PA 4I97A 1M9AA 2TIRA 3EU3A 2X8GA 2HE3A 4Q5FA 2M80A 3NOFA 2CAQA 1FB0A 1K3YA 4WETA 4MZCA 4KB3A 2PMTA 5E59A 2DJ2A 3QDNA 2O85A 4I2UA 3UVTA 5LD0A 5EPFA 3GH9A 2HSHA 3FR6A 3ZIJA 2H6YA 1GSDA 2YANA 3ZIVA 3DYRA 2YNXA 3KZQA 2L6CA 4MLYA 5JWRB 1GSFA 1PQNA 1M99A 1GTIA 1SK1A 2IFQB 5HFKA 1BJXA 2H0HA 3LG6A 2V6OA 3BCKA 22GSA 2CZ2A 2FWFA 3WGEA 1EEJA 2X99A 2EIRA 1B48A 1FAAA 5J9CA 3UBKA 4V2LA 1OKTA 5AIVA 4YQUA 1GUMA 5DBQA 3DVWA 2X8CA 4MA9A 4O7HA 2NVLA 5IOWA 4ZILA 3WYWA 1ON4A 3C1SA 1FB6A 2YCDA 1OKDA 3GURA 5HR3A 4ZL9A 3KJYA 3VFIA 2YN1A 1PMTA 1YF0A 4Z2UA 5DALA 4ICYA 4KAEA 2F8AA 3I43A 5HR0A 1XWCA 3LXTA 4OWYA 4YAPA 3LXZA 2ON5A 3LYPA 1XBSA 3H79A 1O8WA 3DWVA 1Y25A 1GUKA 4YKFA 2FHEA 4TKYA 4BL7A 2GSTA 1URMA 1A0RP 3GMFA 3QCPA 1A24A 2HZEA 2MBTA 1PKZA 2VL9A 3KTBA 1XWGA 1XWBA 4BVYB 3F3QA 3MAKA 1F6MC 4J2FA 5LCZA 5AISA 4X1UA 3TRPA 4OO4A 3RHCA 3KXOA 3ZYWA 5H5QA 2C3TA 4KCAA 5IMDA 4Z7XA 5A4UA 3WGDA 2GSSA
chains in the Genus database with same CATH topology
1DE1A 4GCIA 4K2DA 3LYKA 3HKRA 4FIWA 1QMVA 5EL8A 3CSHA 4YQMA 2NPBA 4NHZA 1XXUA 4G19A 1R4WA 1THXA 2P0GA 5IO0A 2WS2A 2H75A 2RLIA 1JFUA 2YJ7A 4ECJA 5CRWA 4BWSA 1K0NA 1QUWA 1XFLA 4EUYA 1GTUA 1J0FA 4JZQA 1A2LA 2ES7A 3BOAA 4TW5A 4LL1B 2AAWA 2XBIA 1T3BA 2DSAA 1UN2A 2DJ3A 4G10A 3EE2A 4L5OA 2R6KA 2WCIA 3QMXA 2EIOA 4IP1A 5F0GA 4EDZA 1BEDA 1ZGNA 3D4MA 4TRXA 2I9HA 5JCUA 1JLVA 1U87A 1A8YA 2H66A 4DSSB 4Z2RA 4O32A 2JADA 3RDWA 1V9WA 2B5XA 1JZDA 4KW6A 2KP1A 2ZUPA 3KP8A 4FYUA 2AYTA 3DRNA 2QGVA 3FZ4A 5FT3A 2LV3A 1OC9A 3K8NA 3F0IA 1NW2A 2RUFA 2ZCTA 2C4JA 2FWEA 6GSWA 4K5SA 2YWMA 1R26A 4NHWA 5D93A 1Z9HA 5F06A 1M2BA 4KE3A 3HZ4A 3LFLA 4HQZA 2H73A 2GT5A 4NWYA 1SU9A 1YF1A 2QA1A 4EF0A 3ZVJD 4KH7A 2R0GA 2C0FA 5G5FA 2ON7A 2OA7A 2DMLA 5DQSA 1QFNA 3GX0A 3LQ7A 1PGTA 5ABRA 1OC8A 5D96A 3QFBC 3MNGA 3EWLA 4N10A 3LORA 3TOUA 2LRNA 3O3TA 3KMNA 2YWIA 4OFNA 4BVXA 5JWOB 5F8BA 3TKRA 1SK0A 1Q4JA 1SENA 3F63A 4ZBDA 3ZL5A 1ST9A 3EVIA 3UL3A 1TK8B 5ENUA 5ELGA 3Q19A 2C8UA 4DVCA 1ILOA 5DDLA 1EWXA 4MK3A 4NMUA 3APQA 2MMZA 4MPFA 4ZBAA 3HYPA 3ERFA 4ML6A 3BCIA 1TI1A 1T8EB 1F2EA 4N30A 2L5OA 3FY7A 3D5JA 1AQWA 6GSVA 4IBPA 1EOHA 4TXOB 1SL1B 3PPUA 2C80A 3IDVA 3LJRA 2VM1A 2NTOA 1QQ2A 4ACSA 1Z7PA 3GKNA 2PN8A 4EIQA 5HFIA 5JWQB 3E9JB 14GSA 3CSIA 2RIIA 3HY2A 3CXGA 3UIWA 5J5NA 3DMLA 4TVEA 2IMDA 3HXSA 3EYTA 1KNGA 7GSSA 2P5QA 1Z6NA 4NXIA 3L9SA 3A5WA 4XS1A 3TDGA 3GYKA 3RPPA 4YKGA 4HS1A 2REMA 3H4KA 3BBYA 2PGTA 4WF4A 4YQVA 1SKWB 1B4QA 3F4RA 3TJKA 1GL8A 4IN0A 2B1LA 3FZAA 2H8LA 4MJEA 4JRRA 3A5IA 4EXJA 3KGKA 5CREA 5IPHA 2CVDA 3RBTA 2VCWA 1ZYEA 1EGRA 4AJ7A 1DSBA 1K0DA 2H74A 1J9BA 4BPYA 1K3OA 3VWWA 4D73A 4KDXA 5KN0A 1CQGA 1ABAA 1TKDB 1YKCA 5IMZA 2N5AA 4TR3A 2AHEA 3KH9A 2EIQA 3Q6OA 3EURA 4HEA2 4TXVA 4L0WA 1X5CA 2JZRA 3HVSA 5DVBA 2X4AA 3UOMA 1EV4A 2CX4A 2GS3A 5A5KA 1K0AA 4HUAA 1AQXA 3GKMA 2LSTA 4G0LA 4JU5A 1TK5B 3UBLA 2VL2C 4G2EA 3TJFA 2BTOT 2PU9C 4GF0A 2OBKA 4Q5NA 4IJ3A 3EMPA 3RAZA 5IPGA 3J7Yb 2V32A 4ML1A 1MD4A 1ACVA 3GL3A 4POBA 5DJMA 4V2NA 5GSSA 2JSYA 2YZHA 2H19A 3GNJA 3TKSA 3GA4A 3FMWA 5J3RA 2K8SA 3QR6A 4O92A 1XZOA 2KUCA 1XCCA 2FA4A 2YJHA 5ECKB 2F9SA 3UJ1A 3RPNA 5B7CA 3GKKA 4KCEA 3KCMA 2I4AA 6GSSA 2C1YA 3HVXA 3GSSA 3P2AA 2XBQA 3I6AA 4N0VA 3W6GA 4JR4A 1SKSB 4WBRD 4XS4B 1XWKA 1TI3A 3D0ZA 4K8MA 4KNDA 3UEMA 1TXXA 5GZZB 1I5GA 4EIPA 5AN1A 1PL1A 3ZRDA 3TJBA 4K5RA 1MD3A 3IR4A 4OFMA 1O81A 4HI7A 3CSJA 1GTBA 1ZYQB 2R3XA 5D73A 2FUG2 4MZBA 5CRHA 5D8IA 1VGLA 2CVKA 2VCZA 2IWTA 3HDCA 1B4PA 4CY8A 1QGVA 4MP4A 2NDOA 4GTUA 4CW9A 5ECQB 3FRCA 1A0FA 2A2SA 2CV4A 4KSOA 1YY7A 3FZ9A 3IAS2 2HSMA 1PN9A 1NSWA 1Z3EA 4ZB6A 3I9V2 3W8JA 4KX4A 3CTGA 4F0CA 3IV4A 1TRVA 2FY6A 2VL3A 4NV5A 4WF5A 3MDKA 3KM6A 1PN0A 3TGZA 1U3IA 1OYJA 3G7IA 2FWGA 1HNCA 3Q74A 18GSA 3R3EA 4PNGA 2DJ1A 5DAKB 1KBNA 4HJMA 4LLRA 4O5RA 1JZOA 2CZ3A 3HJMA 1BAYA 2H6XA 3HVVA 4RUVA 3I69A 3GKXA 1GSUA 4MH3A 2FLSA 3IC4A 2BMXA 1GULA 2I81A 4I2TA 2VIMA 5JCWA 1XW6A 2IJYA 1HD2A 1G7OA 3M1GA 4KA0A 1SKRB 3SWLA 4IS0A 1C72A 1SJIA 3GTUB 1N8JA 2Z9SA 4ZL7A 2OKAA 4CY6A 2AJQB 3GHAA 3GUSA 3QD9A 4TR0A 1I9DA 2DJKA 1MEKA 1N2AA 3GSTA 2IL3A 2HRFA 5ID2B 2KOKA 4MNNA 4RQXA 3GX8A 5C04A 2N5FA 2GGTA 3VK9A 1S3DA 3D6IA 4ISDA 4WXTA 6GSUA 1ML6A 2JZTA 1THOA 2ALBA 2AV4A 4ZL8A 4MPGA 2VLUA 2OBIA 5HQPA 4HZ2A 2FNOA 4GSNA 4X0XA 1V98A 2CVBA 4PUFC 1G6YA 3C7MA 4IQ1A 4TR1A 8GSSA 2CAIA 4POMA 1TK0B 1V2AA 2DKIA 12GSA 1AAZA 1GTAA 3FZ5A 2C0GA 2M72A 2PWJA 2B5YA 2L4QA 3BJ5A 4G9HA 3ERWA 1XW5A 2VO4A 2YOIA 4L0UA 3EU4A 5H5RA 5KOXA 1E2YA 5IMCA 1HYUA 4N11A 1EV9A 4O5UA 4IJIA 3EPTA 3TKPA 1EOGA 2H30A 2H0GA 4DSQA 2B6MA 1WMJA 1ZYNA 1MDIA 4F9ZA 2HT9A 3TJGA 3PH9A 3IAM2 2B5EA 2WULA 2LJRA 5BMUA 1O85A 2V1MA 1V57A 2VM2A 2OE3A 4ID0A 10GSA 3MIXA 1GLQA 3S9FA 4IKHA 3FYGA 4XHMA 5J41A 1SD8A 1Y6EA 5CNWA 4MF7A 3IA1A 3F4TA 4LMVA 1PA3A 1OVNA 1K3LA 1AQVA 3BD2A 3MSZA 2K8VA 1O7UA 3L9VA 4KF9A 4FQUA 1PSQA 1Z6MA 3VWXA 2FWHA 1B9XC 1XOBA 3DEXA 4FYBA 2WFCA 2R5GA 4IVFA 5IMAA 1YZXA 1WIKA 4MMMA 2FGXA 4K2XA 4FYCA 2IPAA 6GSXA 4K1FA 3DD3A 2RUEA 2WZ9A 4EDYA 2NBSA 1ZZYA 4BL7B 1JZWA 4OCFA 5IIZA 5HR1A 3IBHA 2BJXA 4WBJA 3C71A 1YQ1A 1T1VA 3GV1A 1HNAA 3GH6A 2HZEB 5B6NA 4KGIA 1O8XA 3MYDA 3F6DA 2DIZA 1WE0A 3WD6A 2H1DA 4MF5A 1WOUA 3FHKA 3VLNA 2DJ0A 2A4VA 1G6WA 4WR4A 1K0CA 1WWJA 3QFAC 3G7YA 1A2JA 5D9XA 1TRUA 4QQ7A 3M0FA 2IMEA 1TRSA 1FOVA 1EEMA 2A4HA 5IM9A 2YP6A 3ZREA 1NHOA 2VOCA 4EKZA 4EC0A 1F37A 5B8AA 4K9ZA 4KUNA 4GXZA 2X8HA 4DEJA 2B1KA 2HFDA 4IW9A 5A4VA 1USBA 2G0FA 1W4VA 1AXDA 3FR9A 3HZ8A 2R4VA 2PBJA 4ZXGA 2YV9A 3TKQA 2QSIA 3P7XA 2JU5A 1GP1A 1JLWA 2H70A 3FW2A 2KP2A 3NZNA 1TJDA 13GSA 2VCQA 19GSA 1XOAA 2B7KA 4RI6A 2HSYA 1XW9A 2LJAA 3TRQA 11GSA 1TP9A 3G7JA 3EINA 2E0QA 4EO3A 1X9SB 4NAXA 3MWHA 1MDKA 5GAND 1O73A 4JBBA 2CX3A 1NHYA 1T4YA 3P8WA 2OE1A 3PR8A 2LS5A 3G9BA 3TRXA 1SL2B 5CAXA 5GSTA 2VUPA 1XPVA 9GSSA 5DCGA 3QAVA 2R0PA 3TJJA 4TOPA 3ERGA 3DVXA 2YZUA 1GSSA 4MJAA 2CQ9A 1OC9B 2I1UA 6GSYA 2VCTA 2IMIA 4KSMA 1PX7A 2UZ8A 5DJLA 3JCML 3O6TA 3UAPA 5IQYA 1FVJA 2GQKA 1H75A 3US3A 1XIYA 2LQOA 3NIVA 1R7HA 4PXOA 2LEGA 4JE1A 2M46A 1A23A 4WEYA 1PL2A 4Z2TA 5CRGA 3QOUA 2FCHA 1H4OA 5EY6A 2JSZA 2IFQA 2QC7A 4AJ8A 3ZTLA 2ZNMA 5HR2A 4YH2A 5A4WA 3F8UA 1QXHA 3HHVA 4E8HA 1EP8A 5D9WA 1JZRA 4HU7A 2DBCA 4BWQA 3E0UA 1X0RA 1A8LA 2VLTA 2V41A 2XC2A 4NV2A 3TUEA 3CBUA 3TCOA 3HCZA 2XPEA 1K0BA 3Q18A 3HD5A 2H6ZA 1X5DA 1RW1A 1W89A 1VF4A 4PURA 5DQYA 1GRXA 4BVXB 2A2PA 2MMOA 1QK8A 4XS6A 1FG4A 3VPQA 1A2MA 3J7Yk 1SL0B 3F9UA 4OMVA 2H1BA 1FHEA 3UVHA 3SBCA 2PERA 4OCEA 3CTFA 1IYHA 2WRTA 1M2DA 5G31A 3A3TA 5F05A 1SJZA 5D9VA 1EZKA 5ECOB 2CT6A 2IIYA 2GZPA 3TB2A 1X9WB 1ZYPA 2H01A 4WKWA 1F3AA 5G30A 4GSTA 1B8XA 5ECRB 2DLXA 2H1AA 1XWAA 3L9UA 4I8BA 2O8VB 3KMOA 4MJBA 4PTSA 4F2IA 2C3NA 1FW1A 2X49A 4MH2A 4ILFA 3H93A 4KDYA 3GL5A 4BVYA 2TRCP 1KEBA 4ZB8A 1PX6A 4G0KA 4IP6A 3P90A 3FK8A 5E4WA 5KN2A 4QL9A 3ZFBA 5ECPB 4GQCA 1BQ7A 2GZZA 2OACA 1GSEA 2FD3A 2RM5A 4OFTA 1AUCA 1ERVA 3ZLPA 1SYRA 3IC8A 4HJ2A 2C0DA 1U88A 4G0IA 2D2ZA 3A2WA 3QAGA 2WB9A 3IK7A 3WT1A 1OE8A 4ZIJA 3ISOA 1GNWA 3KD0A 3VI7A 2P5RA 3GIXA 4TR4A 3KEBA 4USSA 1X5EA 1UA5A 1DBYA 1OE7A 1G0TA 2VD1A 3EMXA 3DGQA 1ZL9A 4D73B 1NM3A 5IOXA 3HJOA 2MZCA 1GLPA 1VF3A 5G5EA 4Q5RA 2P31A 5KN1A 4MABA 4PQ1A 4ZB9A 4PQIA 3KH7A 2K6VA 3E3EA 1Z5YE 1KTEA 3A2XA 5EVOA 4DSSA 2VAFA 2H71A 4F03A 4CHSA 2VD0A 1F3BA 2PVQA 3GRXA 3VWVA 1AW9A 5KEJA 2I3YA 1GWCA 2LTKA 1SJ6A 5G1KA 1GH2A 3APSA 2X64A 2E2MA 2WGRA 5ECHB 2K18A 4PX1A 4I5QA 1ZMAA 2MBSA 3IK9A 1PKWA 2LRTA 1YJ6A 5IMVA 2B3SA 3UMAA 2HLSA 1E6BA 5L71A 1TW9A 2JL4A 3VURA 2IMFA 2IN3A 5AGYA 4MDCA 5B6MA 4F0BA 3D4TA 5G1LA 3C1RA 4E8EA 2HNLA 3CMIA 2N5BA 1R5AA 3TKSE 2V6KA 2GSQA 5KN3A 3IPZA 4AF2A 1VRSD 1WP0A 3LEFA 2MMNA 3WT2A 4H86A 1WJKA 1GSYA 4J57E 4LA1A 4HDEA 2GDRA 2DMMA 2E7PA 3A2VA 5CYYA 1ZOFA 1ZCPA 4KDUA 1TU7A 2YV7A 1SYXA 4HU9A 2GZYA 2R37A 3VPTA 3H1NA 4GQFA 2J23A 2TRXA 4V1Ag 3HJPA 1PD21 1MDJA 5J9BA 2QKEA 2LNTA 1EGOA 2HRNA 5GAPD 3O76A 4DSRA 1HQOA 5D9TA 2A2RA 3ZITA 4K0GA 1OC3A 4IGJA 1UVZA 3QAWA 2H72A 5CO3A 4HQSA 1TTZA 5F07A 4K7IA 4FH8A 20GSA 4K7OA 1X9MB 5ECIB 3ZMKA 1U6TA 1LU4A 1UC7A 3ME7A 4HZ4A 1O6JA 1T00A 2GSRA 4XIHA 3U6VA 4A5PA 1T7PB 4EL1A 2PVOC 1FVKA 1TRWA 3IXRA 4JR6A 2IMKA 5KOWA 3OR5A 2L6DA 5ECLB 3TOTA 2VCVA 1T4ZA 3LW9A 4V2MA 3R2QA 4PNFA 5ELAA 2K9FA 3KTLA 1BG5A 4BA7A 3IHGA 3IRAA 4TXOA 3PGTA 17GSA 3D22A 4POLA 2VL2A 1RQMA 1XVQA 2O89A 4ZBBA 1YDKA 3M9JA 2HYXA 4N0ZA 4HOJA 3TKSC 5LNKe 2XHFA 4POKA 5DCHA 3IE3A 3L4NA 5DALB 4MJCA 1Z7RA 5INYA 4V1Ap 2JACA 2DIYA 2C0EA 2DKHA 1BYEA 1ERWA 2LJKA 5J4UA 3W8SA 2XPDA 3QPMA 4XCSA 3EC3A 2OJLA 5ECNB 4K0NA 4EE0A 2GT6A 3VI5A 3KIJA 4L8EA 1ERTA 1JHBA 2L5LA 2OADA 4FO5A 3F6FA 4OO5A 2V2GA 4GRFA 4ULXA 5FHIA 2DJJA 4AGSA 1TDIA 4IELA 3ZZXA 2AB6A 4RQRA 1S3CA 3KP9A 3F4SA 3D21A 5ECMB 1GNEA 4GWRA 5CP1A 5HFGA 2MMAA 1CQHA 2R0CA 3V1WA 3FEUA 3LGCA 4QL7A 3ZFLA 1WPIA 2H1GA 1AC1A 2KHPA 2O87A 2LRCA 4XRDA 4TR1B 5H5SA 3CRTA 2MYGA 4F82A 4LMWA 3DIEA 1VF1A 3CRUA 2YWNA 4WR5A 1SK2A 1Q98A 1DUGA 3ZMLA 4GLTA 2GTUA 3GN3A 2CA8A 2HI7A 5ECSA 5FWGA 1DE2A 2WDUA 1M2AA 1OAZA 1VF2A 4PQHA 1V40A 3LSZA 5COHA 3ZVJA 2JZSA 1M9BA 1AIUA 2HXKA 4X4JA 3WGXA 1LJRA 3APOA 2G2QA 3CYNA 2L59A 1YKAA 1V58A 2F8FA 4OD7A 4RI7A 3VWUA 1TU8A 4YAVA 4JEDA 2FA8A 2HRKA 4O5QA 4XTSA 1BX9A 3HA9A 2C3QA 1XVWA 5G2ZA 4MCUA 4XS4A 1RK4A 3L0HA 4Q5QA 2LQQA 3L78A 2L4CA 4PUAA 2LNSA 3DXBA 4MF6A 4IQAA 3LWAA 2GVPA 2L57A 2H76A 2EC4A 3AY8A 3GFKA 3N5OA 2F3MA 1K0OA 4I6XA 2QA2A 4ECCA 3M9KA 1MTCA 4K6XA 1B9YC 5AIXA 1J08A 4XRAA 2PPTA 1U3AA 3RHBA 3FR3A 4TN8A 3PINA 4AJ6A 4ECBA 1IYIA 5IO2A 2R2JA 2LKUA 2DC5A 1YEXA 2J9HA 3F3RA 1FO5A 4NPBA 16GSA 1HNBA 1LBKA 2AUVA 4MZWA 2HRAA 4IHUA 3H8QA 5JCGA 3C8EA 1F9MA 2VCXA 4LL4B 3N9JA 2VLVA 2YWOA 1GUHA 2YPMA 4J56E 5DAKA 1S3AA 2LUSA 2OE0A 2PUKC 1WRYA 3IOSA 4K7NA 2GQLA 2WJUA 3DKSA 3M8NA 1YEPA 4PGTA 2KLXA 2HZFA 2F51A 1M0UA 3FKFA 3ED3A 5CRDA 2H0IA 3UARA 3IHQA 4GSSA 4L5LA 5B8BA 5IMFA 4P3YB 1M7TA 3GTUA 5BRTA 1ERUA 3U5RE 4X43A 1EP7A 3M3MA 1G7EA 2GLRA 1SD9A 4ECIA 6GSTA 1PRXA 1FOHA 5ID2A 5C00A 1GSQA 1TOFA 2B7JA 2GQMA 3C73A 4CDOA 2E2GA 4EVMA 3ME8A 2O7KA 2RM6A 1K0MA 1R5PA 4I97A 1M9AA 2TIRA 3EU3A 2X8GA 2HE3A 4Q5FA 2M80A 3NOFA 2CAQA 1FB0A 1K3YA 4WETA 4MZCA 4KB3A 2PMTA 5E59A 2DJ2A 3QDNA 2O85A 4I2UA 3UVTA 5LD0A 5EPFA 3GH9A 2HSHA 3FR6A 3ZIJA 2H6YA 1GSDA 2YANA 3ZIVA 3DYRA 2YNXA 3KZQA 2L6CA 4MLYA 5JWRB 1GSFA 1PQNA 1M99A 1GTIA 1SK1A 2IFQB 5HFKA 1BJXA 2H0HA 3LG6A 2V6OA 3BCKA 22GSA 2CZ2A 2FWFA 3WGEA 1EEJA 2X99A 2EIRA 1B48A 1FAAA 5J9CA 3UBKA 4V2LA 1OKTA 5AIVA 4YQUA 1GUMA 5DBQA 3DVWA 2X8CA 4MA9A 4O7HA 2NVLA 5IOWA 4ZILA 3WYWA 1ON4A 3C1SA 1FB6A 2YCDA 1OKDA 3GURA 5HR3A 4ZL9A 3KJYA 3VFIA 2YN1A 1PMTA 1YF0A 4Z2UA 5DALA 4ICYA 4KAEA 2F8AA 3I43A 5HR0A 1XWCA 3LXTA 4OWYA 4YAPA 3LXZA 2ON5A 3LYPA 1XBSA 3H79A 1O8WA 3DWVA 1Y25A 1GUKA 4YKFA 2FHEA 4TKYA 4BL7A 2GSTA 1URMA 1A0RP 3GMFA 3QCPA 1A24A 2HZEA 2MBTA 1PKZA 2VL9A 3KTBA 1XWGA 1XWBA 4BVYB 3F3QA 3MAKA 1F6MC 4J2FA 5LCZA 5AISA 4X1UA 3TRPA 4OO4A 3RHCA 3KXOA 3ZYWA 5H5QA 2C3TA 4KCAA 5IMDA 4Z7XA 5A4UA 3WGDA 2GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE1 A;  4GCI A;  4K2D A;  3LYK A;  3HKR A;  4FIW A;  1QMV A;  5EL8 A;  3CSH A;  4YQM A;  2NPB A;  4NHZ A;  1XXU A;  4G19 A;  1R4W A;  1THX A;  2P0G A;  5IO0 A;  2WS2 A;  2H75 A;  2RLI A;  1JFU A;  2YJ7 A;  4ECJ A;  5CRW A;  4BWS A;  1K0N A;  1QUW A;  1XFL A;  4EUY A;  1GTU A;  1J0F A;  4JZQ A;  1A2L A;  2ES7 A;  3BOA A;  4TW5 A;  4LL1 B;  2AAW A;  2XBI A;  1T3B A;  2DSA A;  1UN2 A;  2DJ3 A;  4G10 A;  3EE2 A;  4L5O A;  2R6K A;  2WCI A;  3QMX A;  2EIO A;  4IP1 A;  5F0G A;  4EDZ A;  1BED A;  1ZGN A;  3D4M A;  4TRX A;  2I9H A;  5JCU A;  1JLV A;  1U87 A;  1A8Y A;  2H66 A;  4DSS B;  4O32 A;  2JAD A;  3RDW A;  1V9W A;  2B5X A;  1JZD A;  4KW6 A;  2KP1 A;  2ZUP A;  3KP8 A;  4FYU A;  2AYT A;  3DRN A;  2QGV A;  3FZ4 A;  5FT3 A;  2LV3 A;  1OC9 A;  3K8N A;  3F0I A;  1NW2 A;  2RUF A;  2ZCT A;  2C4J A;  2FWE A;  6GSW A;  2YWM A;  1R26 A;  4NHW A;  5D93 A;  1Z9H A;  5F06 A;  1M2B A;  4KE3 A;  3HZ4 A;  3LFL A;  4HQZ A;  2H73 A;  2GT5 A;  4NWY A;  1SU9 A;  1YF1 A;  4EF0 A;  3ZVJ D;  4KH7 A;  2C0F A;  5G5F A;  2ON7 A;  2OA7 A;  2DML A;  5DQS A;  1QFN A;  3GX0 A;  3LQ7 A;  1PGT A;  5ABR A;  1OC8 A;  5D96 A;  3QFB C;  3MNG A;  3EWL A;  4N10 A;  3LOR A;  3TOU A;  2LRN A;  3O3T A;  3KMN A;  2YWI A;  4OFN A;  4BVX A;  5JWO B;  5F8B A;  3TKR A;  1SK0 A;  1Q4J A;  1SEN A;  3F63 A;  4ZBD A;  3ZL5 A;  1ST9 A;  3EVI A;  3UL3 A;  1TK8 B;  5ENU A;  5ELG A;  3Q19 A;  2C8U A;  4DVC A;  1ILO A;  5DDL A;  1EWX A;  4MK3 A;  4NMU A;  3APQ A;  2MMZ A;  4MPF A;  4ZBA A;  3HYP A;  3ERF A;  4ML6 A;  3BCI A;  1TI1 A;  1T8E B;  1F2E A;  4N30 A;  2L5O A;  3FY7 A;  3D5J A;  1AQW A;  6GSV A;  4IBP A;  1EOH A;  4TXO B;  1SL1 B;  2C80 A;  3IDV A;  3LJR A;  2VM1 A;  2NTO A;  1QQ2 A;  4ACS A;  1Z7P A;  3GKN A;  2PN8 A;  5HFI A;  5JWQ B;  3E9J B;  14GS A;  3CSI A;  2RII A;  3HY2 A;  3CXG A;  3UIW A;  5J5N A;  3DML A;  4TVE A;  2IMD A;  3HXS A;  3EYT A;  1KNG A;  7GSS A;  2P5Q A;  1Z6N A;  4NXI A;  3L9S A;  3A5W A;  4XS1 A;  3TDG A;  3GYK A;  3RPP A;  4HS1 A;  2REM A;  3H4K A;  3BBY A;  2PGT A;  4WF4 A;  4YQV A;  1SKW B;  1B4Q A;  3F4R A;  3TJK A;  1GL8 A;  4IN0 A;  2B1L A;  3FZA A;  2H8L A;  4MJE A;  4JRR A;  4EXJ A;  3KGK A;  5CRE A;  5IPH A;  2CVD A;  3RBT A;  2VCW A;  1ZYE A;  1EGR A;  4AJ7 A;  1DSB A;  1K0D A;  2H74 A;  1J9B A;  4BPY A;  1K3O A;  3VWW A;  4D73 A;  4KDX A;  5KN0 A;  1CQG A;  1ABA A;  1TKD B;  1YKC A;  5IMZ A;  2N5A A;  4TR3 A;  2AHE A;  3KH9 A;  2EIQ A;  3Q6O A;  3EUR A;  4HEA 2;  4TXV A;  4L0W A;  1X5C A;  2JZR A;  3HVS A;  5DVB A;  3UOM A;  1EV4 A;  2CX4 A;  2GS3 A;  5A5K A;  1K0A A;  4HUA A;  1AQX A;  3GKM A;  2LST A;  4JU5 A;  1TK5 B;  3UBL A;  2VL2 C;  4G2E A;  3TJF A;  2BTO T;  2PU9 C;  4GF0 A;  2OBK A;  4Q5N A;  4IJ3 A;  3EMP A;  3RAZ A;  5IPG A;  3J7Y b;  2V32 A;  4ML1 A;  1MD4 A;  1ACV A;  3GL3 A;  4POB A;  5DJM A;  4V2N A;  5GSS A;  2JSY A;  2YZH A;  2H19 A;  3GNJ A;  3TKS A;  3GA4 A;  5J3R A;  2K8S A;  3QR6 A;  4O92 A;  1XZO A;  2KUC A;  1XCC A;  2FA4 A;  2YJH A;  5ECK B;  2F9S A;  3UJ1 A;  3RPN A;  5B7C A;  3GKK A;  4KCE A;  3KCM A;  2I4A A;  6GSS A;  2C1Y A;  3HVX A;  3GSS A;  3P2A A;  2XBQ A;  3I6A A;  4N0V A;  3W6G A;  4JR4 A;  1SKS B;  4WBR D;  4XS4 B;  1XWK A;  1TI3 A;  3D0Z A;  4K8M A;  4KND A;  3UEM A;  1TXX A;  5GZZ B;  1I5G A;  5AN1 A;  1PL1 A;  3ZRD A;  3TJB A;  1MD3 A;  3IR4 A;  4OFM A;  1O81 A;  4HI7 A;  3CSJ A;  1GTB A;  1ZYQ B;  2R3X A;  5D73 A;  2FUG 2;  4MZB A;  5CRH A;  5D8I A;  1VGL A;  2CVK A;  2VCZ A;  2IWT A;  3HDC A;  1B4P A;  1QGV A;  4MP4 A;  2NDO A;  4GTU A;  4CW9 A;  5ECQ B;  3FRC A;  1A0F A;  2A2S A;  2CV4 A;  4KSO A;  1YY7 A;  3FZ9 A;  3IAS 2;  1PN9 A;  1NSW A;  1Z3E A;  4ZB6 A;  3I9V 2;  3W8J A;  4KX4 A;  3CTG A;  4F0C A;  3IV4 A;  1TRV A;  2FY6 A;  2VL3 A;  4NV5 A;  4WF5 A;  3MDK A;  3KM6 A;  3TGZ A;  1U3I A;  1OYJ A;  3G7I A;  2FWG A;  1HNC A;  3Q74 A;  18GS A;  4PNG A;  2DJ1 A;  5DAK B;  1KBN A;  4HJM A;  4LLR A;  4O5R A;  1JZO A;  2CZ3 A;  3HJM A;  1BAY A;  2H6X A;  3HVV A;  4RUV A;  3I69 A;  3GKX A;  1GSU A;  4MH3 A;  2FLS A;  3IC4 A;  2BMX A;  1GUL A;  2I81 A;  4I2T A;  2VIM A;  5JCW A;  1XW6 A;  2IJY A;  1HD2 A;  1G7O A;  3M1G A;  4KA0 A;  1SKR B;  3SWL A;  4IS0 A;  1C72 A;  1SJI A;  3GTU B;  1N8J A;  2Z9S A;  4ZL7 A;  2OKA A;  2AJQ B;  3GHA A;  3GUS A;  3QD9 A;  4TR0 A;  1I9D A;  2DJK A;  1MEK A;  1N2A A;  3GST A;  2IL3 A;  2HRF A;  5ID2 B;  2KOK A;  4RQX A;  3GX8 A;  5C04 A;  2N5F A;  2GGT A;  3VK9 A;  1S3D A;  3D6I A;  4ISD A;  4WXT A;  6GSU A;  1ML6 A;  2JZT A;  1THO A;  2ALB A;  2AV4 A;  4ZL8 A;  4MPG A;  2VLU A;  2OBI A;  5HQP A;  4HZ2 A;  2FNO A;  4GSN A;  4X0X A;  1V98 A;  2CVB A;  4PUF C;  1G6Y A;  3C7M A;  4IQ1 A;  4TR1 A;  8GSS A;  2CAI A;  4POM A;  1TK0 B;  1V2A A;  12GS A;  1AAZ A;  1GTA A;  3FZ5 A;  2C0G A;  2M72 A;  2PWJ A;  2B5Y A;  2L4Q A;  3BJ5 A;  4G9H A;  3ERW A;  1XW5 A;  2VO4 A;  2YOI A;  4L0U A;  3EU4 A;  5H5R A;  1E2Y A;  5IMC A;  1HYU A;  4N11 A;  1EV9 A;  4IJI A;  3TKP A;  1EOG A;  2H30 A;  2H0G A;  4DSQ A;  2B6M A;  1WMJ A;  1MDI A;  4F9Z A;  2HT9 A;  3TJG A;  3PH9 A;  3IAM 2;  2B5E A;  2WUL A;  2LJR A;  1O85 A;  2V1M A;  1V57 A;  2VM2 A;  2OE3 A;  4ID0 A;  10GS A;  1GLQ A;  3S9F A;  4IKH A;  3FYG A;  4XHM A;  5J41 A;  1SD8 A;  1Y6E A;  5CNW A;  4MF7 A;  3IA1 A;  3F4T A;  4LMV A;  1PA3 A;  1OVN A;  1K3L A;  1AQV A;  3BD2 A;  3MSZ A;  2K8V A;  1O7U A;  3L9V A;  1PSQ A;  1Z6M A;  3VWX A;  2FWH A;  1B9X C;  1XOB A;  3DEX A;  4FYB A;  2WFC A;  2R5G A;  4IVF A;  5IMA A;  1YZX A;  1WIK A;  4MMM A;  2FGX A;  4FYC A;  2IPA A;  6GSX A;  4K1F A;  3DD3 A;  2RUE A;  2WZ9 A;  4EDY A;  2NBS A;  1ZZY A;  1JZW A;  4OCF A;  5IIZ A;  5HR1 A;  3IBH A;  2BJX A;  4WBJ A;  3C71 A;  1YQ1 A;  1T1V A;  3GV1 A;  1HNA A;  3GH6 A;  2HZE B;  5B6N A;  4KGI A;  1O8X A;  3F6D A;  2DIZ A;  1WE0 A;  3WD6 A;  2H1D A;  4MF5 A;  1WOU A;  3FHK A;  3VLN A;  2DJ0 A;  2A4V A;  1G6W A;  4WR4 A;  1K0C A;  1WWJ A;  3QFA C;  3G7Y A;  1A2J A;  5D9X A;  1TRU A;  4QQ7 A;  3M0F A;  2IME A;  1TRS A;  1FOV A;  1EEM A;  5IM9 A;  2YP6 A;  3ZRE A;  1NHO A;  2VOC A;  4EKZ A;  4EC0 A;  1F37 A;  5B8A A;  4K9Z A;  4KUN A;  4GXZ A;  2X8H A;  4DEJ A;  2B1K A;  2HFD A;  4IW9 A;  5A4V A;  1USB A;  2G0F A;  1W4V A;  1AXD A;  3FR9 A;  3HZ8 A;  2R4V A;  2PBJ A;  4ZXG A;  2YV9 A;  3TKQ A;  2QSI A;  3P7X A;  2JU5 A;  1GP1 A;  1JLW A;  2H70 A;  3FW2 A;  2KP2 A;  3NZN A;  1TJD A;  13GS A;  2VCQ A;  19GS A;  1XOA A;  2B7K A;  4RI6 A;  2HSY A;  1XW9 A;  2LJA A;  3TRQ A;  11GS A;  1TP9 A;  3G7J A;  3EIN A;  2E0Q A;  4EO3 A;  1X9S B;  4NAX A;  3MWH A;  1MDK A;  5GAN D;  1O73 A;  4JBB A;  2CX3 A;  1NHY A;  1T4Y A;  3P8W A;  2OE1 A;  3PR8 A;  2LS5 A;  3G9B A;  3TRX A;  1SL2 B;  5CAX A;  5GST A;  2VUP A;  1XPV A;  9GSS A;  5DCG A;  3QAV A;  3TJJ A;  4TOP A;  3ERG A;  3DVX A;  2YZU A;  1GSS A;  4MJA A;  2CQ9 A;  1OC9 B;  2I1U A;  6GSY A;  2VCT A;  2IMI A;  4KSM A;  1PX7 A;  5DJL A;  3JCM L;  3O6T A;  3UAP A;  5IQY A;  1FVJ A;  2GQK A;  1H75 A;  3US3 A;  1XIY A;  2LQO A;  3NIV A;  1R7H A;  4PXO A;  2LEG A;  4JE1 A;  2M46 A;  1A23 A;  4WEY A;  1PL2 A;  5CRG A;  3QOU A;  2FCH A;  5EY6 A;  1H4O A;  2JSZ A;  2IFQ A;  2QC7 A;  4AJ8 A;  3ZTL A;  2ZNM A;  5HR2 A;  4YH2 A;  5A4W A;  3F8U A;  1QXH A;  3HHV A;  4E8H A;  1EP8 A;  5D9W A;  1JZR A;  4HU7 A;  2DBC A;  4BWQ A;  3E0U A;  1X0R A;  1A8L A;  2VLT A;  2V41 A;  2XC2 A;  4NV2 A;  3TUE A;  3CBU A;  3TCO A;  3HCZ A;  2XPE A;  1K0B A;  3Q18 A;  3HD5 A;  2H6Z A;  1X5D A;  1RW1 A;  1W89 A;  1VF4 A;  4PUR A;  5DQY A;  1GRX A;  2MMO A;  1QK8 A;  4XS6 A;  1FG4 A;  3VPQ A;  1A2M A;  3J7Y k;  1SL0 B;  3F9U A;  4OMV A;  2H1B A;  1FHE A;  3UVH A;  3SBC A;  2PER A;  4OCE A;  3CTF A;  1IYH A;  2WRT A;  1M2D A;  5G31 A;  3A3T A;  5F05 A;  1SJZ A;  5D9V A;  1EZK A;  5ECO B;  2CT6 A;  2IIY A;  2GZP A;  3TB2 A;  1X9W B;  2H01 A;  4WKW A;  1F3A A;  5G30 A;  4GST A;  1B8X A;  5ECR B;  2DLX A;  2H1A A;  1XWA A;  3L9U A;  4I8B A;  2O8V B;  3KMO A;  4MJB A;  4F2I A;  2C3N A;  1FW1 A;  4MH2 A;  4ILF A;  3H93 A;  4KDY A;  3GL5 A;  4BVY A;  2TRC P;  1KEB A;  4ZB8 A;  1PX6 A;  4IP6 A;  3P90 A;  3FK8 A;  5E4W A;  5KN2 A;  4QL9 A;  3ZFB A;  5ECP B;  4GQC A;  1BQ7 A;  2GZZ A;  2OAC A;  1GSE A;  2FD3 A;  2RM5 A;  4OFT A;  1AUC A;  1ERV A;  3ZLP A;  1SYR A;  4HJ2 A;  2C0D A;  1U88 A;  2D2Z A;  3A2W A;  3QAG A;  2WB9 A;  3IK7 A;  3WT1 A;  1OE8 A;  4ZIJ A;  3ISO A;  1GNW A;  3KD0 A;  3VI7 A;  2P5R A;  3GIX A;  4TR4 A;  3KEB A;  1X5E A;  1UA5 A;  1DBY A;  1OE7 A;  1G0T A;  2VD1 A;  3EMX A;  3DGQ A;  1ZL9 A;  4D73 B;  1NM3 A;  5IOX A;  3HJO A;  2MZC A;  1GLP A;  1VF3 A;  5G5E A;  4Q5R A;  2P31 A;  5KN1 A;  4MAB A;  4PQ1 A;  4ZB9 A;  4PQI A;  3KH7 A;  2K6V A;  3E3E A;  1Z5Y E;  1KTE A;  3A2X A;  5EVO A;  4DSS A;  2VAF A;  2H71 A;  4F03 A;  4CHS A;  2VD0 A;  1F3B A;  2PVQ A;  3GRX A;  3VWV A;  1AW9 A;  5KEJ A;  2I3Y A;  1GWC A;  2LTK A;  1SJ6 A;  5G1K A;  1GH2 A;  3APS A;  2X64 A;  2E2M A;  2WGR A;  5ECH B;  2K18 A;  4PX1 A;  4I5Q A;  1ZMA A;  2MBS A;  3IK9 A;  1PKW A;  2LRT A;  1YJ6 A;  5IMV A;  2B3S A;  3UMA A;  2HLS A;  1E6B A;  5L71 A;  1TW9 A;  2JL4 A;  3VUR A;  2IMF A;  2IN3 A;  5AGY A;  4MDC A;  5B6M A;  4F0B A;  3D4T A;  5G1L A;  3C1R A;  4E8E A;  2HNL A;  3CMI A;  2N5B A;  1R5A A;  3TKS E;  2V6K A;  2GSQ A;  5KN3 A;  3IPZ A;  4AF2 A;  1VRS D;  1WP0 A;  3LEF A;  2MMN A;  3WT2 A;  4H86 A;  1WJK A;  1GSY A;  4J57 E;  4LA1 A;  4HDE A;  2GDR A;  2DMM A;  2E7P A;  3A2V A;  5CYY A;  1ZOF A;  1ZCP A;  4KDU A;  1TU7 A;  2YV7 A;  1SYX A;  4HU9 A;  2GZY A;  2R37 A;  3VPT A;  3H1N A;  4GQF A;  2J23 A;  2TRX A;  4V1A g;  3HJP A;  1PD2 1;  1MDJ A;  5J9B A;  2QKE A;  2LNT A;  1EGO A;  2HRN A;  5GAP D;  3O76 A;  4DSR A;  1HQO A;  5D9T A;  2A2R A;  3ZIT A;  4K0G A;  1OC3 A;  4IGJ A;  1UVZ A;  3QAW A;  2H72 A;  5CO3 A;  4HQS A;  1TTZ A;  5F07 A;  4K7I A;  4FH8 A;  20GS A;  4K7O A;  1X9M B;  5ECI B;  3ZMK A;  1U6T A;  1LU4 A;  1UC7 A;  3ME7 A;  4HZ4 A;  1O6J A;  1T00 A;  2GSR A;  4XIH A;  3U6V A;  1T7P B;  4EL1 A;  2PVO C;  1FVK A;  1TRW A;  3IXR A;  4JR6 A;  2IMK A;  3OR5 A;  2L6D A;  5ECL B;  3TOT A;  2VCV A;  1T4Z A;  4V2M A;  3R2Q A;  4PNF A;  5ELA A;  2K9F A;  3KTL A;  1BG5 A;  4BA7 A;  3IRA A;  4TXO A;  3PGT A;  17GS A;  3D22 A;  4POL A;  2VL2 A;  1RQM A;  1XVQ A;  2O89 A;  4ZBB A;  1YDK A;  3M9J A;  2HYX A;  4N0Z A;  4HOJ A;  3TKS C;  5LNK e;  2XHF A;  4POK A;  5DCH A;  3IE3 A;  3L4N A;  5DAL B;  4MJC A;  1Z7R A;  5INY A;  4V1A p;  2JAC A;  2DIY A;  2C0E A;  1BYE A;  1ERW A;  2LJK A;  5J4U A;  3W8S A;  2XPD A;  3QPM A;  4XCS A;  3EC3 A;  2OJL A;  5ECN B;  4K0N A;  4EE0 A;  2GT6 A;  3VI5 A;  3KIJ A;  4L8E A;  1ERT A;  1JHB A;  2L5L A;  2OAD A;  4FO5 A;  3F6F A;  4OO5 A;  2V2G A;  4GRF A;  4ULX A;  5FHI A;  2DJJ A;  4AGS A;  1TDI A;  4IEL A;  3ZZX A;  2AB6 A;  4RQR A;  1S3C A;  3KP9 A;  3F4S A;  3D21 A;  5ECM B;  1GNE A;  4GWR A;  5CP1 A;  5HFG A;  2MMA A;  1CQH A;  3V1W A;  3FEU A;  3LGC A;  4QL7 A;  3ZFL A;  1WPI A;  2H1G A;  1AC1 A;  2KHP A;  2O87 A;  2LRC A;  4XRD A;  4TR1 B;  5H5S A;  3CRT A;  2MYG A;  4F82 A;  4LMW A;  3DIE A;  1VF1 A;  3CRU A;  2YWN A;  4WR5 A;  1SK2 A;  1Q98 A;  1DUG A;  3ZML A;  4GLT A;  2GTU A;  3GN3 A;  2CA8 A;  2HI7 A;  5ECS A;  5FWG A;  1DE2 A;  2WDU A;  1M2A A;  1OAZ A;  1VF2 A;  4PQH A;  1V40 A;  3LSZ A;  5COH A;  3ZVJ A;  2JZS A;  1M9B A;  1AIU A;  2HXK A;  3WGX A;  1LJR A;  3APO A;  2G2Q A;  3CYN A;  2L59 A;  1YKA A;  1V58 A;  2F8F A;  4OD7 A;  4RI7 A;  3VWU A;  1TU8 A;  4YAV A;  4JED A;  2FA8 A;  4XTS A;  1BX9 A;  3HA9 A;  2C3Q A;  1XVW A;  5G2Z A;  4MCU A;  4XS4 A;  1RK4 A;  3L0H A;  4Q5Q A;  2LQQ A;  3L78 A;  2L4C A;  4PUA A;  2LNS A;  3DXB A;  4MF6 A;  4IQA A;  3LWA A;  2GVP A;  2L57 A;  2H76 A;  2EC4 A;  3AY8 A;  3GFK A;  3N5O A;  2F3M A;  1K0O A;  4I6X A;  4ECC A;  3M9K A;  1MTC A;  4K6X A;  1B9Y C;  5AIX A;  1J08 A;  4XRA A;  2PPT A;  1U3A A;  3RHB A;  3FR3 A;  4TN8 A;  3PIN A;  4AJ6 A;  4ECB A;  1IYI A;  5IO2 A;  2R2J A;  2LKU A;  2DC5 A;  1YEX A;  2J9H A;  3F3R A;  1FO5 A;  4NPB A;  16GS A;  1HNB A;  1LBK A;  2AUV A;  4MZW A;  4IHU A;  3H8Q A;  5JCG A;  3C8E A;  1F9M A;  2VCX A;  4LL4 B;  3N9J A;  2VLV A;  2YWO A;  1GUH A;  2YPM A;  4J56 E;  5DAK A;  1S3A A;  2LUS A;  2OE0 A;  2PUK C;  1WRY A;  3IOS A;  4K7N A;  2GQL A;  2WJU A;  3DKS A;  3M8N A;  1YEP A;  4PGT A;  2KLX A;  2HZF A;  2F51 A;  1M0U A;  3FKF A;  3ED3 A;  5CRD A;  2H0I A;  3UAR A;  3IHQ A;  4GSS A;  4L5L A;  5B8B A;  5IMF A;  4P3Y B;  1M7T A;  3GTU A;  1ERU A;  3U5R E;  4X43 A;  1EP7 A;  3M3M A;  1G7E A;  2GLR A;  1SD9 A;  4ECI A;  6GST A;  1PRX A;  5ID2 A;  5C00 A;  1GSQ A;  1TOF A;  2B7J A;  2GQM A;  3C73 A;  4CDO A;  2E2G A;  4EVM A;  3ME8 A;  2O7K A;  2RM6 A;  1K0M A;  1R5P A;  4I97 A;  1M9A A;  2TIR A;  3EU3 A;  2X8G A;  2HE3 A;  4Q5F A;  2M80 A;  3NOF A;  2CAQ A;  1FB0 A;  1K3Y A;  4WET A;  4MZC A;  4KB3 A;  2PMT A;  5E59 A;  2DJ2 A;  3QDN A;  2O85 A;  4I2U A;  3UVT A;  5LD0 A;  5EPF A;  3GH9 A;  2HSH A;  3FR6 A;  3ZIJ A;  2H6Y A;  1GSD A;  2YAN A;  3ZIV A;  3DYR A;  2YNX A;  3KZQ A;  2L6C A;  4MLY A;  5JWR B;  1GSF A;  1PQN A;  1M99 A;  1GTI A;  1SK1 A;  2IFQ B;  5HFK A;  1BJX A;  2H0H A;  3LG6 A;  2V6O A;  3BCK A;  22GS A;  2CZ2 A;  2FWF A;  3WGE A;  1EEJ A;  2X99 A;  2EIR A;  1B48 A;  1FAA A;  5J9C A;  3UBK A;  4V2L A;  1OKT A;  5AIV A;  4YQU A;  1GUM A;  5DBQ A;  3DVW A;  2X8C A;  4MA9 A;  4O7H A;  2NVL A;  5IOW A;  4ZIL A;  3WYW A;  1ON4 A;  3C1S A;  1FB6 A;  2YCD A;  1OKD A;  3GUR A;  5HR3 A;  4ZL9 A;  3KJY A;  3VFI A;  2YN1 A;  1PMT A;  1YF0 A;  5DAL A;  4KAE A;  2F8A A;  3I43 A;  5HR0 A;  1XWC A;  3LXT A;  4OWY A;  4YAP A;  3LXZ A;  2ON5 A;  3LYP A;  1XBS A;  3H79 A;  1O8W A;  3DWV A;  1Y25 A;  1GUK A;  2FHE A;  4TKY A;  4BL7 A;  2GST A;  1URM A;  1A0R P;  3GMF A;  3QCP A;  1A24 A;  2HZE A;  2MBT A;  1PKZ A;  2VL9 A;  3KTB A;  1XWG A;  1XWB A;  3F3Q A;  3MAK A;  1F6M C;  4J2F A;  5LCZ A;  5AIS A;  4X1U A;  3TRP A;  4OO4 A;  3RHC A;  3KXO A;  3ZYW A;  5H5Q A;  2C3T A;  4KCA A;  5IMD A;  4Z7X A;  5A4U A;  3WGD A;  2GSS A; 
#chains in the Genus database with same CATH topology
 1DE1 A;  4GCI A;  4K2D A;  3LYK A;  3HKR A;  4FIW A;  1QMV A;  5EL8 A;  3CSH A;  4YQM A;  2NPB A;  4NHZ A;  1XXU A;  4G19 A;  1R4W A;  1THX A;  2P0G A;  5IO0 A;  2WS2 A;  2H75 A;  2RLI A;  1JFU A;  2YJ7 A;  4ECJ A;  5CRW A;  4BWS A;  1K0N A;  1QUW A;  1XFL A;  4EUY A;  1GTU A;  1J0F A;  4JZQ A;  1A2L A;  2ES7 A;  3BOA A;  4TW5 A;  4LL1 B;  2AAW A;  2XBI A;  1T3B A;  2DSA A;  1UN2 A;  2DJ3 A;  4G10 A;  3EE2 A;  4L5O A;  2R6K A;  2WCI A;  3QMX A;  2EIO A;  4IP1 A;  5F0G A;  4EDZ A;  1BED A;  1ZGN A;  3D4M A;  4TRX A;  2I9H A;  5JCU A;  1JLV A;  1U87 A;  1A8Y A;  2H66 A;  4DSS B;  4Z2R A;  4O32 A;  2JAD A;  3RDW A;  1V9W A;  2B5X A;  1JZD A;  4KW6 A;  4BIK A;  2KP1 A;  2ZUP A;  3KP8 A;  4FYU A;  2AYT A;  3DRN A;  2QGV A;  3FZ4 A;  5FT3 A;  2LV3 A;  1OC9 A;  3K8N A;  3F0I A;  1NW2 A;  2RUF A;  2ZCT A;  2C4J A;  2FWE A;  6GSW A;  4K5S A;  2YWM A;  1R26 A;  4NHW A;  5D93 A;  1Z9H A;  5F06 A;  1M2B A;  4KE3 A;  3HZ4 A;  3LFL A;  4HQZ A;  2H73 A;  2GT5 A;  4NWY A;  1SU9 A;  1YF1 A;  2QA1 A;  4EF0 A;  3ZVJ D;  4KH7 A;  2R0G A;  2C0F A;  5G5F A;  2ON7 A;  2OA7 A;  2DML A;  5DQS A;  1QFN A;  3GX0 A;  3LQ7 A;  1PGT A;  5ABR A;  1OC8 A;  5D96 A;  3QFB C;  3MNG A;  3EWL A;  4N10 A;  3LOR A;  3TOU A;  2LRN A;  3O3T A;  3KMN A;  2YWI A;  4OFN A;  4BVX A;  5JWO B;  5F8B A;  3TKR A;  1SK0 A;  1Q4J A;  1SEN A;  3F63 A;  4ZBD A;  3ZL5 A;  1ST9 A;  3EVI A;  3UL3 A;  1TK8 B;  5ENU A;  5ELG A;  3Q19 A;  2C8U A;  4DVC A;  1ILO A;  5DDL A;  1EWX A;  4MK3 A;  4NMU A;  3APQ A;  2MMZ A;  4MPF A;  4ZBA A;  3HYP A;  3ERF A;  4ML6 A;  3BCI A;  1TI1 A;  1T8E B;  1F2E A;  4N30 A;  2L5O A;  3FY7 A;  3D5J A;  1AQW A;  6GSV A;  4IBP A;  1EOH A;  4TXO B;  1SL1 B;  3PPU A;  2C80 A;  3IDV A;  3LJR A;  2VM1 A;  2NTO A;  1QQ2 A;  4ACS A;  1Z7P A;  3GKN A;  2PN8 A;  4EIQ A;  5HFI A;  5JWQ B;  3E9J B;  14GS A;  3CSI A;  2RII A;  3HY2 A;  3CXG A;  3UIW A;  5J5N A;  3DML A;  4TVE A;  2IMD A;  3HXS A;  3EYT A;  1KNG A;  7GSS A;  2P5Q A;  1Z6N A;  4NXI A;  3L9S A;  3A5W A;  4XS1 A;  3TDG A;  3GYK A;  3RPP A;  4YKG A;  4HS1 A;  2REM A;  3H4K A;  3BBY A;  2PGT A;  4WF4 A;  4YQV A;  1SKW B;  1B4Q A;  3F4R A;  3TJK A;  1GL8 A;  4IN0 A;  2B1L A;  3FZA A;  2H8L A;  4MJE A;  4JRR A;  3A5I A;  4EXJ A;  3KGK A;  5CRE A;  5IPH A;  2CVD A;  3RBT A;  2VCW A;  1ZYE A;  1EGR A;  4AJ7 A;  1DSB A;  1K0D A;  2H74 A;  1J9B A;  4BPY A;  1K3O A;  3VWW A;  4D73 A;  4KDX A;  5KN0 A;  1CQG A;  1ABA A;  1TKD B;  1YKC A;  5IMZ A;  2N5A A;  4TR3 A;  2AHE A;  3KH9 A;  2EIQ A;  3Q6O A;  3EUR A;  4HEA 2;  4TXV A;  4L0W A;  1X5C A;  2JZR A;  3HVS A;  5DVB A;  2X4A A;  3UOM A;  1EV4 A;  2CX4 A;  2GS3 A;  5A5K A;  1K0A A;  4HUA A;  1AQX A;  3GKM A;  2LST A;  4G0L A;  4JU5 A;  1TK5 B;  3UBL A;  2VL2 C;  4G2E A;  3TJF A;  2BTO T;  2PU9 C;  4GF0 A;  2OBK A;  4Q5N A;  4IJ3 A;  3EMP A;  3RAZ A;  5IPG A;  3J7Y b;  2V32 A;  4ML1 A;  1MD4 A;  1ACV A;  3GL3 A;  4POB A;  5DJM A;  4V2N A;  5GSS A;  2JSY A;  2YZH A;  2H19 A;  3GNJ A;  3TKS A;  3GA4 A;  3FMW A;  5J3R A;  2K8S A;  3QR6 A;  4O92 A;  1XZO A;  2KUC A;  1XCC A;  2FA4 A;  2YJH A;  5ECK B;  2F9S A;  3UJ1 A;  3HVN A;  5B7C A;  3RPN A;  3GKK A;  1PFO A;  4KCE A;  3KCM A;  2I4A A;  6GSS A;  2C1Y A;  3HVX A;  3GSS A;  3P2A A;  2XBQ A;  3I6A A;  4N0V A;  3W6G A;  4JR4 A;  1SKS B;  4WBR D;  4XS4 B;  1XWK A;  1TI3 A;  3D0Z A;  4K8M A;  4KND A;  3UEM A;  1TXX A;  5GZZ B;  1I5G A;  4EIP A;  5AN1 A;  1PL1 A;  3ZRD A;  3TJB A;  4K5R A;  1MD3 A;  3IR4 A;  4OFM A;  1O81 A;  4HI7 A;  3CSJ A;  1GTB A;  1ZYQ B;  2R3X A;  5D73 A;  2FUG 2;  4MZB A;  5CRH A;  5D8I A;  1VGL A;  2CVK A;  2VCZ A;  2IWT A;  3HDC A;  1B4P A;  4CY8 A;  1QGV A;  4MP4 A;  2NDO A;  1S3R A;  4GTU A;  4CW9 A;  5ECQ B;  3FRC A;  1A0F A;  2A2S A;  2CV4 A;  4KSO A;  1YY7 A;  3FZ9 A;  3IAS 2;  2HSM A;  1PN9 A;  1NSW A;  1Z3E A;  4ZB6 A;  3I9V 2;  3W8J A;  4KX4 A;  3CTG A;  4F0C A;  3IV4 A;  1TRV A;  2FY6 A;  2VL3 A;  4NV5 A;  4WF5 A;  3MDK A;  3KM6 A;  1PN0 A;  3TGZ A;  1U3I A;  1OYJ A;  3G7I A;  2FWG A;  1HNC A;  3Q74 A;  18GS A;  3R3E A;  4PNG A;  2DJ1 A;  5DAK B;  1KBN A;  4HJM A;  4LLR A;  4O5R A;  1JZO A;  2CZ3 A;  3HJM A;  1BAY A;  2H6X A;  3HVV A;  4RUV A;  3I69 A;  3GKX A;  1GSU A;  4MH3 A;  2FLS A;  3IC4 A;  2BMX A;  1GUL A;  2I81 A;  4I2T A;  2VIM A;  5JCW A;  1XW6 A;  2IJY A;  1HD2 A;  1G7O A;  3M1G A;  4KA0 A;  1SKR B;  3SWL A;  4IS0 A;  1C72 A;  1SJI A;  3GTU B;  1N8J A;  2Z9S A;  4ZL7 A;  2OKA A;  4CY6 A;  2AJQ B;  3GHA A;  3GUS A;  3QD9 A;  4TR0 A;  1I9D A;  2DJK A;  1MEK A;  1N2A A;  3GST A;  2IL3 A;  2HRF A;  5ID2 B;  2KOK A;  4MNN A;  4RQX A;  3GX8 A;  5C04 A;  2N5F A;  2GGT A;  3VK9 A;  1S3D A;  3D6I A;  4ISD A;  4WXT A;  6GSU A;  1ML6 A;  2JZT A;  1THO A;  2ALB A;  2AV4 A;  4ZL8 A;  4MPG A;  2VLU A;  2OBI A;  5HQP A;  4HZ2 A;  2FNO A;  4GSN A;  4X0X A;  1V98 A;  2CVB A;  4PUF C;  1G6Y A;  3C7M A;  4IQ1 A;  4TR1 A;  8GSS A;  2CAI A;  4POM A;  1TK0 B;  1V2A A;  2DKI A;  12GS A;  1AAZ A;  1GTA A;  3FZ5 A;  2C0G A;  1M3I A;  2M72 A;  2PWJ A;  2B5Y A;  2L4Q A;  3BJ5 A;  4G9H A;  3ERW A;  1XW5 A;  2VO4 A;  2YOI A;  4L0U A;  3EU4 A;  5H5R A;  5KOX A;  1E2Y A;  5IMC A;  1HYU A;  4N11 A;  1EV9 A;  4O5U A;  4IJI A;  3EPT A;  3TKP A;  1EOG A;  2H30 A;  2H0G A;  4DSQ A;  2B6M A;  1WMJ A;  1ZYN A;  1MDI A;  4F9Z A;  2HT9 A;  3TJG A;  3PH9 A;  3IAM 2;  2B5E A;  2WUL A;  2LJR A;  5BMU A;  1O85 A;  2V1M A;  1V57 A;  2VM2 A;  2OE3 A;  4ID0 A;  10GS A;  3MIX A;  1GLQ A;  3S9F A;  4IKH A;  3FYG A;  4XHM A;  5J41 A;  1SD8 A;  1Y6E A;  5CNW A;  4MF7 A;  3IA1 A;  3F4T A;  4LMV A;  1PA3 A;  1OVN A;  1K3L A;  1AQV A;  3BD2 A;  3MSZ A;  2K8V A;  1O7U A;  3L9V A;  4KF9 A;  4FQU A;  1PSQ A;  1Z6M A;  3VWX A;  2FWH A;  1B9X C;  1XOB A;  3DEX A;  4FYB A;  2WFC A;  2R5G A;  4IVF A;  5IMA A;  1YZX A;  1WIK A;  4MMM A;  2FGX A;  4K2X A;  4FYC A;  2IPA A;  6GSX A;  4K1F A;  3DD3 A;  2RUE A;  2WZ9 A;  4EDY A;  2NBS A;  1ZZY A;  4BL7 B;  1JZW A;  4OCF A;  5IIZ A;  5HR1 A;  3IBH A;  2BJX A;  4WBJ A;  3C71 A;  1YQ1 A;  1T1V A;  3GV1 A;  1HNA A;  3GH6 A;  2HZE B;  5B6N A;  4KGI A;  1O8X A;  3MYD A;  3F6D A;  2DIZ A;  1WE0 A;  3WD6 A;  2H1D A;  4MF5 A;  1WOU A;  3FHK A;  3VLN A;  2DJ0 A;  2A4V A;  1G6W A;  4WR4 A;  1K0C A;  1WWJ A;  3QFA C;  3G7Y A;  1A2J A;  5D9X A;  1TRU A;  4QQ7 A;  3M0F A;  2IME A;  1TRS A;  1FOV A;  1EEM A;  2A4H A;  5IM9 A;  2YP6 A;  3ZRE A;  1NHO A;  2VOC A;  4EKZ A;  4EC0 A;  1F37 A;  5B8A A;  4K9Z A;  4KUN A;  4GXZ A;  2X8H A;  4DEJ A;  2B1K A;  2HFD A;  4IW9 A;  5A4V A;  1USB A;  2G0F A;  1W4V A;  1AXD A;  3FR9 A;  3HZ8 A;  2R4V A;  2PBJ A;  4ZXG A;  2YV9 A;  3TKQ A;  2QSI A;  3P7X A;  2JU5 A;  1GP1 A;  1JLW A;  2H70 A;  3FW2 A;  2KP2 A;  3NZN A;  1TJD A;  13GS A;  2VCQ A;  19GS A;  1XOA A;  2B7K A;  4RI6 A;  2HSY A;  1XW9 A;  2LJA A;  3TRQ A;  11GS A;  1TP9 A;  3G7J A;  3EIN A;  2E0Q A;  4EO3 A;  1X9S B;  4NAX A;  3MWH A;  1MDK A;  5GAN D;  1O73 A;  4JBB A;  2CX3 A;  1NHY A;  1T4Y A;  3P8W A;  2OE1 A;  3PR8 A;  2LS5 A;  3G9B A;  3TRX A;  1SL2 B;  5CAX A;  5GST A;  2VUP A;  1XPV A;  9GSS A;  5DCG A;  3QAV A;  2R0P A;  3TJJ A;  4TOP A;  3ERG A;  3DVX A;  2YZU A;  1GSS A;  4MJA A;  2CQ9 A;  1OC9 B;  2I1U A;  6GSY A;  2VCT A;  2IMI A;  4KSM A;  1PX7 A;  2UZ8 A;  5DJL A;  3JCM L;  3O6T A;  3UAP A;  5IQY A;  1FVJ A;  2GQK A;  1H75 A;  3US3 A;  1XIY A;  2LQO A;  3NIV A;  1R7H A;  4PXO A;  2LEG A;  4JE1 A;  2M46 A;  1A23 A;  4WEY A;  1PL2 A;  4Z2T A;  5CRG A;  3QOU A;  2FCH A;  1H4O A;  5EY6 A;  2JSZ A;  2IFQ A;  2QC7 A;  4AJ8 A;  3ZTL A;  2ZNM A;  5HR2 A;  4YH2 A;  5A4W A;  3F8U A;  1QXH A;  3HHV A;  4E8H A;  1EP8 A;  5D9W A;  1JZR A;  4HU7 A;  2DBC A;  4BWQ A;  3E0U A;  1X0R A;  1A8L A;  2VLT A;  2V41 A;  2XC2 A;  4NV2 A;  3TUE A;  3CBU A;  3TCO A;  3HCZ A;  2XPE A;  1K0B A;  3Q18 A;  3HD5 A;  2H6Z A;  1X5D A;  1RW1 A;  1W89 A;  1VF4 A;  4PUR A;  5DQY A;  1GRX A;  4BVX B;  2A2P A;  2MMO A;  1QK8 A;  4XS6 A;  1FG4 A;  3VPQ A;  1A2M A;  3J7Y k;  1SL0 B;  3CQF A;  3F9U A;  4OMV A;  2H1B A;  1FHE A;  3UVH A;  3SBC A;  2PER A;  4OCE A;  3CTF A;  1IYH A;  2WRT A;  1M2D A;  5G31 A;  3A3T A;  5F05 A;  1SJZ A;  5D9V A;  1EZK A;  5ECO B;  1M3J A;  2CT6 A;  2IIY A;  2GZP A;  3TB2 A;  1X9W B;  1ZYP A;  2H01 A;  4WKW A;  1F3A A;  5G30 A;  4GST A;  1B8X A;  5ECR B;  2DLX A;  2H1A A;  1XWA A;  3L9U A;  4I8B A;  2O8V B;  3KMO A;  4MJB A;  4PTS A;  4F2I A;  2C3N A;  1FW1 A;  2X49 A;  4MH2 A;  4ILF A;  3H93 A;  4KDY A;  3GL5 A;  4BVY A;  2TRC P;  1KEB A;  4ZB8 A;  1PX6 A;  4G0K A;  4IP6 A;  3P90 A;  3FK8 A;  5E4W A;  5KN2 A;  4QL9 A;  3ZFB A;  5ECP B;  4GQC A;  1BQ7 A;  2GZZ A;  2OAC A;  1GSE A;  2FD3 A;  2RM5 A;  4OFT A;  1AUC A;  1ERV A;  3ZLP A;  1SYR A;  3IC8 A;  4HJ2 A;  2C0D A;  1U88 A;  4G0I A;  2D2Z A;  3A2W A;  3QAG A;  2WB9 A;  3IK7 A;  3WT1 A;  1OE8 A;  4ZIJ A;  3ISO A;  1GNW A;  3KD0 A;  3VI7 A;  2P5R A;  3GIX A;  4TR4 A;  3KEB A;  4USS A;  1X5E A;  1UA5 A;  1DBY A;  1OE7 A;  1G0T A;  2VD1 A;  3EMX A;  3DGQ A;  1ZL9 A;  4D73 B;  1NM3 A;  5IOX A;  3HJO A;  2MZC A;  1GLP A;  1VF3 A;  5G5E A;  4Q5R A;  2P31 A;  5KN1 A;  4MAB A;  4PQ1 A;  4ZB9 A;  4PQI A;  3KH7 A;  4HSC X;  2K6V A;  3E3E A;  1Z5Y E;  1KTE A;  3A2X A;  5EVO A;  4DSS A;  2VAF A;  2H71 A;  4F03 A;  4CHS A;  2VD0 A;  1F3B A;  2PVQ A;  3GRX A;  3VWV A;  1AW9 A;  5KEJ A;  2I3Y A;  1GWC A;  2LTK A;  1SJ6 A;  5G1K A;  1GH2 A;  3APS A;  2X64 A;  2E2M A;  2WGR A;  5ECH B;  2K18 A;  4PX1 A;  4I5Q A;  1ZMA A;  2MBS A;  3IK9 A;  1PKW A;  2LRT A;  1YJ6 A;  5IMV A;  2B3S A;  3UMA A;  2HLS A;  1E6B A;  5L71 A;  1TW9 A;  2JL4 A;  3VUR A;  2IMF A;  2IN3 A;  5AGY A;  4MDC A;  5B6M A;  4F0B A;  3D4T A;  5G1L A;  3C1R A;  4E8E A;  2HNL A;  3CMI A;  2N5B A;  1R5A A;  3TKS E;  2V6K A;  2GSQ A;  5KN3 A;  3IPZ A;  4AF2 A;  1VRS D;  1WP0 A;  3LEF A;  2MMN A;  3WT2 A;  4H86 A;  1WJK A;  1GSY A;  4J57 E;  4LA1 A;  4HDE A;  2GDR A;  2DMM A;  2E7P A;  3A2V A;  5CYY A;  1ZOF A;  1ZCP A;  4KDU A;  1TU7 A;  2YV7 A;  1SYX A;  4HU9 A;  2GZY A;  2R37 A;  3VPT A;  3H1N A;  4GQF A;  2J23 A;  2TRX A;  4V1A g;  3HJP A;  1PD2 1;  1MDJ A;  5J9B A;  2QKE A;  2LNT A;  1EGO A;  2HRN A;  5GAP D;  3O76 A;  4DSR A;  1HQO A;  5D9T A;  2A2R A;  3ZIT A;  4K0G A;  1OC3 A;  4IGJ A;  1UVZ A;  3QAW A;  2H72 A;  5CO3 A;  4HQS A;  1TTZ A;  5F07 A;  4K7I A;  1XG8 A;  4FH8 A;  20GS A;  4K7O A;  1X9M B;  5ECI B;  3ZMK A;  1U6T A;  1LU4 A;  1UC7 A;  3ME7 A;  4HZ4 A;  1O6J A;  1T00 A;  2GSR A;  4XIH A;  3U6V A;  4A5P A;  1T7P B;  4EL1 A;  2PVO C;  1FVK A;  1TRW A;  3IXR A;  4JR6 A;  2IMK A;  5KOW A;  3OR5 A;  2L6D A;  5ECL B;  3TOT A;  2VCV A;  1T4Z A;  3LW9 A;  4V2M A;  3R2Q A;  4PNF A;  5ELA A;  2K9F A;  3KTL A;  1BG5 A;  4BA7 A;  3IHG A;  3IRA A;  4TXO A;  3PGT A;  17GS A;  3D22 A;  4POL A;  2VL2 A;  1RQM A;  1XVQ A;  2O89 A;  4ZBB A;  1YDK A;  3M9J A;  2HYX A;  4N0Z A;  4HOJ A;  3TKS C;  5LNK e;  2XHF A;  4POK A;  5DCH A;  3IE3 A;  3L4N A;  5DAL B;  4MJC A;  1Z7R A;  5INY A;  4V1A p;  2JAC A;  2DIY A;  2C0E A;  2DKH A;  1BYE A;  1ERW A;  2LJK A;  5J4U A;  3W8S A;  2XPD A;  3QPM A;  4XCS A;  3EC3 A;  2OJL A;  5ECN B;  4K0N A;  4EE0 A;  2GT6 A;  3VI5 A;  3KIJ A;  4L8E A;  1ERT A;  1JHB A;  2L5L A;  2OAD A;  4FO5 A;  3F6F A;  4OO5 A;  2V2G A;  4GRF A;  4ULX A;  5FHI A;  2DJJ A;  4AGS A;  1TDI A;  4IEL A;  3ZZX A;  2AB6 A;  4RQR A;  1S3C A;  3KP9 A;  3F4S A;  3D21 A;  5ECM B;  1GNE A;  4GWR A;  5CP1 A;  5HFG A;  2MMA A;  1CQH A;  2R0C A;  3V1W A;  3FEU A;  3LGC A;  4QL7 A;  3ZFL A;  1WPI A;  2H1G A;  1AC1 A;  2KHP A;  2O87 A;  2LRC A;  4XRD A;  4TR1 B;  5H5S A;  3CRT A;  2MYG A;  4F82 A;  4LMW A;  3DIE A;  1VF1 A;  3CRU A;  2YWN A;  4WR5 A;  1SK2 A;  1Q98 A;  1DUG A;  3ZML A;  4GLT A;  2GTU A;  3GN3 A;  2CA8 A;  2HI7 A;  5ECS A;  5FWG A;  1DE2 A;  2WDU A;  1M2A A;  1OAZ A;  1VF2 A;  4PQH A;  1V40 A;  3LSZ A;  5COH A;  3ZVJ A;  2JZS A;  1M9B A;  1AIU A;  2HXK A;  4X4J A;  3WGX A;  1LJR A;  3APO A;  2G2Q A;  3CYN A;  2L59 A;  1YKA A;  1V58 A;  2F8F A;  4OD7 A;  4RI7 A;  3VWU A;  1TU8 A;  4YAV A;  4JED A;  2FA8 A;  2HRK A;  4O5Q A;  4XTS A;  1BX9 A;  3HA9 A;  2C3Q A;  1XVW A;  5G2Z A;  4MCU A;  4XS4 A;  1RK4 A;  3L0H A;  4Q5Q A;  2LQQ A;  3L78 A;  2L4C A;  4PUA A;  2LNS A;  3DXB A;  4MF6 A;  4IQA A;  3LWA A;  2GVP A;  2L57 A;  2H76 A;  2EC4 A;  3AY8 A;  3GFK A;  3N5O A;  2F3M A;  1K0O A;  4I6X A;  2QA2 A;  4ECC A;  3M9K A;  1MTC A;  4K6X A;  1B9Y C;  5AIX A;  1J08 A;  4XRA A;  2PPT A;  1U3A A;  3RHB A;  3FR3 A;  4TN8 A;  3PIN A;  4AJ6 A;  4ECB A;  1IYI A;  5IO2 A;  2R2J A;  2LKU A;  2DC5 A;  1YEX A;  2J9H A;  3F3R A;  1FO5 A;  4NPB A;  16GS A;  1HNB A;  1LBK A;  2AUV A;  4MZW A;  2HRA A;  4IHU A;  3H8Q A;  5JCG A;  3C8E A;  1F9M A;  2VCX A;  4LL4 B;  3N9J A;  2VLV A;  2YWO A;  1GUH A;  2YPM A;  4J56 E;  5DAK A;  1S3A A;  2LUS A;  2OE0 A;  2PUK C;  1WRY A;  3IOS A;  4K7N A;  2GQL A;  2WJU A;  3DKS A;  3M8N A;  1YEP A;  4PGT A;  2KLX A;  2HZF A;  2F51 A;  1M0U A;  3FKF A;  3ED3 A;  5CRD A;  2H0I A;  3UAR A;  3IHQ A;  4GSS A;  4L5L A;  5B8B A;  5IMF A;  4P3Y B;  1M7T A;  3GTU A;  5BRT A;  1ERU A;  3U5R E;  4X43 A;  1EP7 A;  3M3M A;  1G7E A;  2GLR A;  1SD9 A;  4ECI A;  6GST A;  1PRX A;  1FOH A;  5ID2 A;  5C00 A;  1GSQ A;  1TOF A;  2B7J A;  2GQM A;  3C73 A;  4CDO A;  2E2G A;  4EVM A;  3ME8 A;  2O7K A;  2RM6 A;  1K0M A;  1R5P A;  4I97 A;  1M9A A;  2TIR A;  3EU3 A;  2X8G A;  2HE3 A;  4Q5F A;  2M80 A;  3NOF A;  2CAQ A;  1FB0 A;  1K3Y A;  4WET A;  4MZC A;  4KB3 A;  2PMT A;  5E59 A;  2DJ2 A;  3QDN A;  2O85 A;  4I2U A;  3UVT A;  5LD0 A;  5EPF A;  3GH9 A;  2HSH A;  3FR6 A;  3ZIJ A;  2H6Y A;  1GSD A;  2YAN A;  3ZIV A;  3DYR A;  2YNX A;  3KZQ A;  2L6C A;  4MLY A;  5JWR B;  1GSF A;  1PQN A;  1M99 A;  1GTI A;  1SK1 A;  2IFQ B;  5HFK A;  1BJX A;  2H0H A;  3LG6 A;  2V6O A;  3BCK A;  22GS A;  2CZ2 A;  2FWF A;  3WGE A;  1EEJ A;  2X99 A;  2EIR A;  1B48 A;  1FAA A;  5J9C A;  3UBK A;  4V2L A;  1OKT A;  5AIV A;  4YQU A;  1GUM A;  5DBQ A;  3DVW A;  2X8C A;  4MA9 A;  4O7H A;  2NVL A;  5IOW A;  4ZIL A;  3WYW A;  1ON4 A;  3C1S A;  1FB6 A;  2YCD A;  1OKD A;  3GUR A;  5HR3 A;  4ZL9 A;  3KJY A;  3VFI A;  2YN1 A;  1PMT A;  1YF0 A;  4Z2U A;  5DAL A;  4ICY A;  4KAE A;  2F8A A;  3I43 A;  5HR0 A;  1XWC A;  3LXT A;  4OWY A;  4YAP A;  3LXZ A;  2ON5 A;  3LYP A;  1XBS A;  3H79 A;  1O8W A;  3DWV A;  1Y25 A;  1GUK A;  4YKF A;  2FHE A;  4TKY A;  4BL7 A;  2GST A;  1URM A;  1A0R P;  3GMF A;  3QCP A;  1A24 A;  2HZE A;  2MBT A;  1PKZ A;  2VL9 A;  3KTB A;  1XWG A;  1XWB A;  4BVY B;  3F3Q A;  3MAK A;  1F6M C;  4J2F A;  5LCZ A;  5AIS A;  4X1U A;  3TRP A;  4OO4 A;  3RHC A;  3KXO A;  3ZYW A;  5H5Q A;  2C3T A;  4KCA A;  5IMD A;  4Z7X A;  5A4U A;  3WGD A;  2GSS A; 
#chains in the Genus database with same CATH homology
 1DE1 A;  4GCI A;  4K2D A;  3LYK A;  3HKR A;  4FIW A;  1QMV A;  5EL8 A;  3CSH A;  4YQM A;  2NPB A;  4NHZ A;  1XXU A;  4G19 A;  1R4W A;  1THX A;  2P0G A;  5IO0 A;  2WS2 A;  2H75 A;  2RLI A;  1JFU A;  2YJ7 A;  4ECJ A;  5CRW A;  4BWS A;  1K0N A;  1QUW A;  1XFL A;  4EUY A;  1GTU A;  1J0F A;  4JZQ A;  1A2L A;  2ES7 A;  3BOA A;  4TW5 A;  4LL1 B;  2AAW A;  2XBI A;  1T3B A;  2DSA A;  1UN2 A;  2DJ3 A;  4G10 A;  3EE2 A;  4L5O A;  2R6K A;  2WCI A;  3QMX A;  2EIO A;  4IP1 A;  5F0G A;  4EDZ A;  1BED A;  1ZGN A;  3D4M A;  4TRX A;  2I9H A;  5JCU A;  1JLV A;  1U87 A;  1A8Y A;  2H66 A;  4DSS B;  4Z2R A;  4O32 A;  2JAD A;  3RDW A;  1V9W A;  2B5X A;  1JZD A;  4KW6 A;  2KP1 A;  2ZUP A;  3KP8 A;  4FYU A;  2AYT A;  3DRN A;  2QGV A;  3FZ4 A;  5FT3 A;  2LV3 A;  1OC9 A;  3K8N A;  3F0I A;  1NW2 A;  2RUF A;  2ZCT A;  2C4J A;  2FWE A;  6GSW A;  4K5S A;  2YWM A;  1R26 A;  4NHW A;  5D93 A;  1Z9H A;  5F06 A;  1M2B A;  4KE3 A;  3HZ4 A;  3LFL A;  4HQZ A;  2H73 A;  2GT5 A;  4NWY A;  1SU9 A;  1YF1 A;  2QA1 A;  4EF0 A;  3ZVJ D;  4KH7 A;  2R0G A;  2C0F A;  5G5F A;  2ON7 A;  2OA7 A;  2DML A;  5DQS A;  1QFN A;  3GX0 A;  3LQ7 A;  1PGT A;  5ABR A;  1OC8 A;  5D96 A;  3QFB C;  3MNG A;  3EWL A;  4N10 A;  3LOR A;  3TOU A;  2LRN A;  3O3T A;  3KMN A;  2YWI A;  4OFN A;  4BVX A;  5JWO B;  5F8B A;  3TKR A;  1SK0 A;  1Q4J A;  1SEN A;  3F63 A;  4ZBD A;  3ZL5 A;  1ST9 A;  3EVI A;  3UL3 A;  1TK8 B;  5ENU A;  5ELG A;  3Q19 A;  2C8U A;  4DVC A;  1ILO A;  5DDL A;  1EWX A;  4MK3 A;  4NMU A;  3APQ A;  2MMZ A;  4MPF A;  4ZBA A;  3HYP A;  3ERF A;  4ML6 A;  3BCI A;  1TI1 A;  1T8E B;  1F2E A;  4N30 A;  2L5O A;  3FY7 A;  3D5J A;  1AQW A;  6GSV A;  4IBP A;  1EOH A;  4TXO B;  1SL1 B;  3PPU A;  2C80 A;  3IDV A;  3LJR A;  2VM1 A;  2NTO A;  1QQ2 A;  4ACS A;  1Z7P A;  3GKN A;  2PN8 A;  4EIQ A;  5HFI A;  5JWQ B;  3E9J B;  14GS A;  3CSI A;  2RII A;  3HY2 A;  3CXG A;  3UIW A;  5J5N A;  3DML A;  4TVE A;  2IMD A;  3HXS A;  3EYT A;  1KNG A;  7GSS A;  2P5Q A;  1Z6N A;  4NXI A;  3L9S A;  3A5W A;  4XS1 A;  3TDG A;  3GYK A;  3RPP A;  4YKG A;  4HS1 A;  2REM A;  3H4K A;  3BBY A;  2PGT A;  4WF4 A;  4YQV A;  1SKW B;  1B4Q A;  3F4R A;  3TJK A;  1GL8 A;  4IN0 A;  2B1L A;  3FZA A;  2H8L A;  4MJE A;  4JRR A;  3A5I A;  4EXJ A;  3KGK A;  5CRE A;  5IPH A;  2CVD A;  3RBT A;  2VCW A;  1ZYE A;  1EGR A;  4AJ7 A;  1DSB A;  1K0D A;  2H74 A;  1J9B A;  4BPY A;  1K3O A;  3VWW A;  4D73 A;  4KDX A;  5KN0 A;  1CQG A;  1ABA A;  1TKD B;  1YKC A;  5IMZ A;  2N5A A;  4TR3 A;  2AHE A;  3KH9 A;  2EIQ A;  3Q6O A;  3EUR A;  4HEA 2;  4TXV A;  4L0W A;  1X5C A;  2JZR A;  3HVS A;  5DVB A;  2X4A A;  3UOM A;  1EV4 A;  2CX4 A;  2GS3 A;  5A5K A;  1K0A A;  4HUA A;  1AQX A;  3GKM A;  2LST A;  4G0L A;  4JU5 A;  1TK5 B;  3UBL A;  2VL2 C;  4G2E A;  3TJF A;  2BTO T;  2PU9 C;  4GF0 A;  2OBK A;  4Q5N A;  4IJ3 A;  3EMP A;  3RAZ A;  5IPG A;  3J7Y b;  2V32 A;  4ML1 A;  1MD4 A;  1ACV A;  3GL3 A;  4POB A;  5DJM A;  4V2N A;  5GSS A;  2JSY A;  2YZH A;  2H19 A;  3GNJ A;  3TKS A;  3GA4 A;  3FMW A;  5J3R A;  2K8S A;  3QR6 A;  4O92 A;  1XZO A;  2KUC A;  1XCC A;  2FA4 A;  2YJH A;  5ECK B;  2F9S A;  3UJ1 A;  3RPN A;  5B7C A;  3GKK A;  4KCE A;  3KCM A;  2I4A A;  6GSS A;  2C1Y A;  3HVX A;  3GSS A;  3P2A A;  2XBQ A;  3I6A A;  4N0V A;  3W6G A;  4JR4 A;  1SKS B;  4WBR D;  4XS4 B;  1XWK A;  1TI3 A;  3D0Z A;  4K8M A;  4KND A;  3UEM A;  1TXX A;  5GZZ B;  1I5G A;  4EIP A;  5AN1 A;  1PL1 A;  3ZRD A;  3TJB A;  4K5R A;  1MD3 A;  3IR4 A;  4OFM A;  1O81 A;  4HI7 A;  3CSJ A;  1GTB A;  1ZYQ B;  2R3X A;  5D73 A;  2FUG 2;  4MZB A;  5CRH A;  5D8I A;  1VGL A;  2CVK A;  2VCZ A;  2IWT A;  3HDC A;  1B4P A;  4CY8 A;  1QGV A;  4MP4 A;  2NDO A;  4GTU A;  4CW9 A;  5ECQ B;  3FRC A;  1A0F A;  2A2S A;  2CV4 A;  4KSO A;  1YY7 A;  3FZ9 A;  3IAS 2;  2HSM A;  1PN9 A;  1NSW A;  1Z3E A;  4ZB6 A;  3I9V 2;  3W8J A;  4KX4 A;  3CTG A;  4F0C A;  3IV4 A;  1TRV A;  2FY6 A;  2VL3 A;  4NV5 A;  4WF5 A;  3MDK A;  3KM6 A;  1PN0 A;  3TGZ A;  1U3I A;  1OYJ A;  3G7I A;  2FWG A;  1HNC A;  3Q74 A;  18GS A;  3R3E A;  4PNG A;  2DJ1 A;  5DAK B;  1KBN A;  4HJM A;  4LLR A;  4O5R A;  1JZO A;  2CZ3 A;  3HJM A;  1BAY A;  2H6X A;  3HVV A;  4RUV A;  3I69 A;  3GKX A;  1GSU A;  4MH3 A;  2FLS A;  3IC4 A;  2BMX A;  1GUL A;  2I81 A;  4I2T A;  2VIM A;  5JCW A;  1XW6 A;  2IJY A;  1HD2 A;  1G7O A;  3M1G A;  4KA0 A;  1SKR B;  3SWL A;  4IS0 A;  1C72 A;  1SJI A;  3GTU B;  1N8J A;  2Z9S A;  4ZL7 A;  2OKA A;  4CY6 A;  2AJQ B;  3GHA A;  3GUS A;  3QD9 A;  4TR0 A;  1I9D A;  2DJK A;  1MEK A;  1N2A A;  3GST A;  2IL3 A;  2HRF A;  5ID2 B;  2KOK A;  4MNN A;  4RQX A;  3GX8 A;  5C04 A;  2N5F A;  2GGT A;  3VK9 A;  1S3D A;  3D6I A;  4ISD A;  4WXT A;  6GSU A;  1ML6 A;  2JZT A;  1THO A;  2ALB A;  2AV4 A;  4ZL8 A;  4MPG A;  2VLU A;  2OBI A;  5HQP A;  4HZ2 A;  2FNO A;  4GSN A;  4X0X A;  1V98 A;  2CVB A;  4PUF C;  1G6Y A;  3C7M A;  4IQ1 A;  4TR1 A;  8GSS A;  2CAI A;  4POM A;  1TK0 B;  1V2A A;  2DKI A;  12GS A;  1AAZ A;  1GTA A;  3FZ5 A;  2C0G A;  2M72 A;  2PWJ A;  2B5Y A;  2L4Q A;  3BJ5 A;  4G9H A;  3ERW A;  1XW5 A;  2VO4 A;  2YOI A;  4L0U A;  3EU4 A;  5H5R A;  5KOX A;  1E2Y A;  5IMC A;  1HYU A;  4N11 A;  1EV9 A;  4O5U A;  4IJI A;  3EPT A;  3TKP A;  1EOG A;  2H30 A;  2H0G A;  4DSQ A;  2B6M A;  1WMJ A;  1ZYN A;  1MDI A;  4F9Z A;  2HT9 A;  3TJG A;  3PH9 A;  3IAM 2;  2B5E A;  2WUL A;  2LJR A;  5BMU A;  1O85 A;  2V1M A;  1V57 A;  2VM2 A;  2OE3 A;  4ID0 A;  10GS A;  3MIX A;  1GLQ A;  3S9F A;  4IKH A;  3FYG A;  4XHM A;  5J41 A;  1SD8 A;  1Y6E A;  5CNW A;  4MF7 A;  3IA1 A;  3F4T A;  4LMV A;  1PA3 A;  1OVN A;  1K3L A;  1AQV A;  3BD2 A;  3MSZ A;  2K8V A;  1O7U A;  3L9V A;  4KF9 A;  4FQU A;  1PSQ A;  1Z6M A;  3VWX A;  2FWH A;  1B9X C;  1XOB A;  3DEX A;  4FYB A;  2WFC A;  2R5G A;  4IVF A;  5IMA A;  1YZX A;  1WIK A;  4MMM A;  2FGX A;  4K2X A;  4FYC A;  2IPA A;  6GSX A;  4K1F A;  3DD3 A;  2RUE A;  2WZ9 A;  4EDY A;  2NBS A;  1ZZY A;  4BL7 B;  1JZW A;  4OCF A;  5IIZ A;  5HR1 A;  3IBH A;  2BJX A;  4WBJ A;  3C71 A;  1YQ1 A;  1T1V A;  3GV1 A;  1HNA A;  3GH6 A;  2HZE B;  5B6N A;  4KGI A;  1O8X A;  3MYD A;  3F6D A;  2DIZ A;  1WE0 A;  3WD6 A;  2H1D A;  4MF5 A;  1WOU A;  3FHK A;  3VLN A;  2DJ0 A;  2A4V A;  1G6W A;  4WR4 A;  1K0C A;  1WWJ A;  3QFA C;  3G7Y A;  1A2J A;  5D9X A;  1TRU A;  4QQ7 A;  3M0F A;  2IME A;  1TRS A;  1FOV A;  1EEM A;  2A4H A;  5IM9 A;  2YP6 A;  3ZRE A;  1NHO A;  2VOC A;  4EKZ A;  4EC0 A;  1F37 A;  5B8A A;  4K9Z A;  4KUN A;  4GXZ A;  2X8H A;  4DEJ A;  2B1K A;  2HFD A;  4IW9 A;  5A4V A;  1USB A;  2G0F A;  1W4V A;  1AXD A;  3FR9 A;  3HZ8 A;  2R4V A;  2PBJ A;  4ZXG A;  2YV9 A;  3TKQ A;  2QSI A;  3P7X A;  2JU5 A;  1GP1 A;  1JLW A;  2H70 A;  3FW2 A;  2KP2 A;  3NZN A;  1TJD A;  13GS A;  2VCQ A;  19GS A;  1XOA A;  2B7K A;  4RI6 A;  2HSY A;  1XW9 A;  2LJA A;  3TRQ A;  11GS A;  1TP9 A;  3G7J A;  3EIN A;  2E0Q A;  4EO3 A;  1X9S B;  4NAX A;  3MWH A;  1MDK A;  5GAN D;  1O73 A;  4JBB A;  2CX3 A;  1NHY A;  1T4Y A;  3P8W A;  2OE1 A;  3PR8 A;  2LS5 A;  3G9B A;  3TRX A;  1SL2 B;  5CAX A;  5GST A;  2VUP A;  1XPV A;  9GSS A;  5DCG A;  3QAV A;  2R0P A;  3TJJ A;  4TOP A;  3ERG A;  3DVX A;  2YZU A;  1GSS A;  4MJA A;  2CQ9 A;  1OC9 B;  2I1U A;  6GSY A;  2VCT A;  2IMI A;  4KSM A;  1PX7 A;  2UZ8 A;  5DJL A;  3JCM L;  3O6T A;  3UAP A;  5IQY A;  1FVJ A;  2GQK A;  1H75 A;  3US3 A;  1XIY A;  2LQO A;  3NIV A;  1R7H A;  4PXO A;  2LEG A;  4JE1 A;  2M46 A;  1A23 A;  4WEY A;  1PL2 A;  4Z2T A;  5CRG A;  3QOU A;  2FCH A;  1H4O A;  5EY6 A;  2JSZ A;  2IFQ A;  2QC7 A;  4AJ8 A;  3ZTL A;  2ZNM A;  5HR2 A;  4YH2 A;  5A4W A;  3F8U A;  1QXH A;  3HHV A;  4E8H A;  1EP8 A;  5D9W A;  1JZR A;  4HU7 A;  2DBC A;  4BWQ A;  3E0U A;  1X0R A;  1A8L A;  2VLT A;  2V41 A;  2XC2 A;  4NV2 A;  3TUE A;  3CBU A;  3TCO A;  3HCZ A;  2XPE A;  1K0B A;  3Q18 A;  3HD5 A;  2H6Z A;  1X5D A;  1RW1 A;  1W89 A;  1VF4 A;  4PUR A;  5DQY A;  1GRX A;  4BVX B;  2A2P A;  2MMO A;  1QK8 A;  4XS6 A;  1FG4 A;  3VPQ A;  1A2M A;  3J7Y k;  1SL0 B;  3F9U A;  4OMV A;  2H1B A;  1FHE A;  3UVH A;  3SBC A;  2PER A;  4OCE A;  3CTF A;  1IYH A;  2WRT A;  1M2D A;  5G31 A;  3A3T A;  5F05 A;  1SJZ A;  5D9V A;  1EZK A;  5ECO B;  2CT6 A;  2IIY A;  2GZP A;  3TB2 A;  1X9W B;  1ZYP A;  2H01 A;  4WKW A;  1F3A A;  5G30 A;  4GST A;  1B8X A;  5ECR B;  2DLX A;  2H1A A;  1XWA A;  3L9U A;  4I8B A;  2O8V B;  3KMO A;  4MJB A;  4PTS A;  4F2I A;  2C3N A;  1FW1 A;  2X49 A;  4MH2 A;  4ILF A;  3H93 A;  4KDY A;  3GL5 A;  4BVY A;  2TRC P;  1KEB A;  4ZB8 A;  1PX6 A;  4G0K A;  4IP6 A;  3P90 A;  3FK8 A;  5E4W A;  5KN2 A;  4QL9 A;  3ZFB A;  5ECP B;  4GQC A;  1BQ7 A;  2GZZ A;  2OAC A;  1GSE A;  2FD3 A;  2RM5 A;  4OFT A;  1AUC A;  1ERV A;  3ZLP A;  1SYR A;  3IC8 A;  4HJ2 A;  2C0D A;  1U88 A;  4G0I A;  2D2Z A;  3A2W A;  3QAG A;  2WB9 A;  3IK7 A;  3WT1 A;  1OE8 A;  4ZIJ A;  3ISO A;  1GNW A;  3KD0 A;  3VI7 A;  2P5R A;  3GIX A;  4TR4 A;  3KEB A;  4USS A;  1X5E A;  1UA5 A;  1DBY A;  1OE7 A;  1G0T A;  2VD1 A;  3EMX A;  3DGQ A;  1ZL9 A;  4D73 B;  1NM3 A;  5IOX A;  3HJO A;  2MZC A;  1GLP A;  1VF3 A;  5G5E A;  4Q5R A;  2P31 A;  5KN1 A;  4MAB A;  4PQ1 A;  4ZB9 A;  4PQI A;  3KH7 A;  2K6V A;  3E3E A;  1Z5Y E;  1KTE A;  3A2X A;  5EVO A;  4DSS A;  2VAF A;  2H71 A;  4F03 A;  4CHS A;  2VD0 A;  1F3B A;  2PVQ A;  3GRX A;  3VWV A;  1AW9 A;  5KEJ A;  2I3Y A;  1GWC A;  2LTK A;  1SJ6 A;  5G1K A;  1GH2 A;  3APS A;  2X64 A;  2E2M A;  2WGR A;  5ECH B;  2K18 A;  4PX1 A;  4I5Q A;  1ZMA A;  2MBS A;  3IK9 A;  1PKW A;  2LRT A;  1YJ6 A;  5IMV A;  2B3S A;  3UMA A;  2HLS A;  1E6B A;  5L71 A;  1TW9 A;  2JL4 A;  3VUR A;  2IMF A;  2IN3 A;  5AGY A;  4MDC A;  5B6M A;  4F0B A;  3D4T A;  5G1L A;  3C1R A;  4E8E A;  2HNL A;  3CMI A;  2N5B A;  1R5A A;  3TKS E;  2V6K A;  2GSQ A;  5KN3 A;  3IPZ A;  4AF2 A;  1VRS D;  1WP0 A;  3LEF A;  2MMN A;  3WT2 A;  4H86 A;  1WJK A;  1GSY A;  4J57 E;  4LA1 A;  4HDE A;  2GDR A;  2DMM A;  2E7P A;  3A2V A;  5CYY A;  1ZOF A;  1ZCP A;  4KDU A;  1TU7 A;  2YV7 A;  1SYX A;  4HU9 A;  2GZY A;  2R37 A;  3VPT A;  3H1N A;  4GQF A;  2J23 A;  2TRX A;  4V1A g;  3HJP A;  1PD2 1;  1MDJ A;  5J9B A;  2QKE A;  2LNT A;  1EGO A;  2HRN A;  5GAP D;  3O76 A;  4DSR A;  1HQO A;  5D9T A;  2A2R A;  3ZIT A;  4K0G A;  1OC3 A;  4IGJ A;  1UVZ A;  3QAW A;  2H72 A;  5CO3 A;  4HQS A;  1TTZ A;  5F07 A;  4K7I A;  4FH8 A;  20GS A;  4K7O A;  1X9M B;  5ECI B;  3ZMK A;  1U6T A;  1LU4 A;  1UC7 A;  3ME7 A;  4HZ4 A;  1O6J A;  1T00 A;  2GSR A;  4XIH A;  3U6V A;  4A5P A;  1T7P B;  4EL1 A;  2PVO C;  1FVK A;  1TRW A;  3IXR A;  4JR6 A;  2IMK A;  5KOW A;  3OR5 A;  2L6D A;  5ECL B;  3TOT A;  2VCV A;  1T4Z A;  3LW9 A;  4V2M A;  3R2Q A;  4PNF A;  5ELA A;  2K9F A;  3KTL A;  1BG5 A;  4BA7 A;  3IHG A;  3IRA A;  4TXO A;  3PGT A;  17GS A;  3D22 A;  4POL A;  2VL2 A;  1RQM A;  1XVQ A;  2O89 A;  4ZBB A;  1YDK A;  3M9J A;  2HYX A;  4N0Z A;  4HOJ A;  3TKS C;  5LNK e;  2XHF A;  4POK A;  5DCH A;  3IE3 A;  3L4N A;  5DAL B;  4MJC A;  1Z7R A;  5INY A;  4V1A p;  2JAC A;  2DIY A;  2C0E A;  2DKH A;  1BYE A;  1ERW A;  2LJK A;  5J4U A;  3W8S A;  2XPD A;  3QPM A;  4XCS A;  3EC3 A;  2OJL A;  5ECN B;  4K0N A;  4EE0 A;  2GT6 A;  3VI5 A;  3KIJ A;  4L8E A;  1ERT A;  1JHB A;  2L5L A;  2OAD A;  4FO5 A;  3F6F A;  4OO5 A;  2V2G A;  4GRF A;  4ULX A;  5FHI A;  2DJJ A;  4AGS A;  1TDI A;  4IEL A;  3ZZX A;  2AB6 A;  4RQR A;  1S3C A;  3KP9 A;  3F4S A;  3D21 A;  5ECM B;  1GNE A;  4GWR A;  5CP1 A;  5HFG A;  2MMA A;  1CQH A;  2R0C A;  3V1W A;  3FEU A;  3LGC A;  4QL7 A;  3ZFL A;  1WPI A;  2H1G A;  1AC1 A;  2KHP A;  2O87 A;  2LRC A;  4XRD A;  4TR1 B;  5H5S A;  3CRT A;  2MYG A;  4F82 A;  4LMW A;  3DIE A;  1VF1 A;  3CRU A;  2YWN A;  4WR5 A;  1SK2 A;  1Q98 A;  1DUG A;  3ZML A;  4GLT A;  2GTU A;  3GN3 A;  2CA8 A;  2HI7 A;  5ECS A;  5FWG A;  1DE2 A;  2WDU A;  1M2A A;  1OAZ A;  1VF2 A;  4PQH A;  1V40 A;  3LSZ A;  5COH A;  3ZVJ A;  2JZS A;  1M9B A;  1AIU A;  2HXK A;  4X4J A;  3WGX A;  1LJR A;  3APO A;  2G2Q A;  3CYN A;  2L59 A;  1YKA A;  1V58 A;  2F8F A;  4OD7 A;  4RI7 A;  3VWU A;  1TU8 A;  4YAV A;  4JED A;  2FA8 A;  2HRK A;  4O5Q A;  4XTS A;  1BX9 A;  3HA9 A;  2C3Q A;  1XVW A;  5G2Z A;  4MCU A;  4XS4 A;  1RK4 A;  3L0H A;  4Q5Q A;  2LQQ A;  3L78 A;  2L4C A;  4PUA A;  2LNS A;  3DXB A;  4MF6 A;  4IQA A;  3LWA A;  2GVP A;  2L57 A;  2H76 A;  2EC4 A;  3AY8 A;  3GFK A;  3N5O A;  2F3M A;  1K0O A;  4I6X A;  2QA2 A;  4ECC A;  3M9K A;  1MTC A;  4K6X A;  1B9Y C;  5AIX A;  1J08 A;  4XRA A;  2PPT A;  1U3A A;  3RHB A;  3FR3 A;  4TN8 A;  3PIN A;  4AJ6 A;  4ECB A;  1IYI A;  5IO2 A;  2R2J A;  2LKU A;  2DC5 A;  1YEX A;  2J9H A;  3F3R A;  1FO5 A;  4NPB A;  16GS A;  1HNB A;  1LBK A;  2AUV A;  4MZW A;  2HRA A;  4IHU A;  3H8Q A;  5JCG A;  3C8E A;  1F9M A;  2VCX A;  4LL4 B;  3N9J A;  2VLV A;  2YWO A;  1GUH A;  2YPM A;  4J56 E;  5DAK A;  1S3A A;  2LUS A;  2OE0 A;  2PUK C;  1WRY A;  3IOS A;  4K7N A;  2GQL A;  2WJU A;  3DKS A;  3M8N A;  1YEP A;  4PGT A;  2KLX A;  2HZF A;  2F51 A;  1M0U A;  3FKF A;  3ED3 A;  5CRD A;  2H0I A;  3UAR A;  3IHQ A;  4GSS A;  4L5L A;  5B8B A;  5IMF A;  4P3Y B;  1M7T A;  3GTU A;  5BRT A;  1ERU A;  3U5R E;  4X43 A;  1EP7 A;  3M3M A;  1G7E A;  2GLR A;  1SD9 A;  4ECI A;  6GST A;  1PRX A;  1FOH A;  5ID2 A;  5C00 A;  1GSQ A;  1TOF A;  2B7J A;  2GQM A;  3C73 A;  4CDO A;  2E2G A;  4EVM A;  3ME8 A;  2O7K A;  2RM6 A;  1K0M A;  1R5P A;  4I97 A;  1M9A A;  2TIR A;  3EU3 A;  2X8G A;  2HE3 A;  4Q5F A;  2M80 A;  3NOF A;  2CAQ A;  1FB0 A;  1K3Y A;  4WET A;  4MZC A;  4KB3 A;  2PMT A;  5E59 A;  2DJ2 A;  3QDN A;  2O85 A;  4I2U A;  3UVT A;  5LD0 A;  5EPF A;  3GH9 A;  2HSH A;  3FR6 A;  3ZIJ A;  2H6Y A;  1GSD A;  2YAN A;  3ZIV A;  3DYR A;  2YNX A;  3KZQ A;  2L6C A;  4MLY A;  5JWR B;  1GSF A;  1PQN A;  1M99 A;  1GTI A;  1SK1 A;  2IFQ B;  5HFK A;  1BJX A;  2H0H A;  3LG6 A;  2V6O A;  3BCK A;  22GS A;  2CZ2 A;  2FWF A;  3WGE A;  1EEJ A;  2X99 A;  2EIR A;  1B48 A;  1FAA A;  5J9C A;  3UBK A;  4V2L A;  1OKT A;  5AIV A;  4YQU A;  1GUM A;  5DBQ A;  3DVW A;  2X8C A;  4MA9 A;  4O7H A;  2NVL A;  5IOW A;  4ZIL A;  3WYW A;  1ON4 A;  3C1S A;  1FB6 A;  2YCD A;  1OKD A;  3GUR A;  5HR3 A;  4ZL9 A;  3KJY A;  3VFI A;  2YN1 A;  1PMT A;  1YF0 A;  4Z2U A;  5DAL A;  4ICY A;  4KAE A;  2F8A A;  3I43 A;  5HR0 A;  1XWC A;  3LXT A;  4OWY A;  4YAP A;  3LXZ A;  2ON5 A;  3LYP A;  1XBS A;  3H79 A;  1O8W A;  3DWV A;  1Y25 A;  1GUK A;  4YKF A;  2FHE A;  4TKY A;  4BL7 A;  2GST A;  1URM A;  1A0R P;  3GMF A;  3QCP A;  1A24 A;  2HZE A;  2MBT A;  1PKZ A;  2VL9 A;  3KTB A;  1XWG A;  1XWB A;  4BVY B;  3F3Q A;  3MAK A;  1F6M C;  4J2F A;  5LCZ A;  5AIS A;  4X1U A;  3TRP A;  4OO4 A;  3RHC A;  3KXO A;  3ZYW A;  5H5Q A;  2C3T A;  4KCA A;  5IMD A;  4Z7X A;  5A4U A;  3WGD A;  2GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...