1WMJA

Solution structure of thioredoxin type h from oryza sativa
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
122
structure length
122
Chain Sequence
MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASASA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin H-type
publication title Solution structure of Thioredoxin type h from Oryza sativa
rcsb
source organism Oryza sativa
total genus 18
structure length 122
sequence length 122
ec nomenclature ec 1.8.4.8: Phosphoadenylyl-sulfate reductase (thioredoxin).
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1wmjA01
1TOFA 1ST9A 2H0HA 5IOWA 2IIYA 3GSSA 2GLRA 1G6YA 4KGIA 2L6CA 3ZFLA 3HVSA 2PVQA 5DVBA 1IYHA 14GSA 3G9BA 5H5SA 5JCUA 4WF5A 2LNTA 4IKHA 3U5RE 3P2AA 4IP1A 1I5GA 3QAWA 3QAVA 1BQ7A 2EC4A 3BOAA 5IO0A 1K0BA 2H1AA 2C0FA 2H74A 2JSYA 2V1MA 2ZNMA 2YP6A 4BPYA 2GZZA 3BCIA 4HI7A 3PR8A 1DBYA 3GX8A 4RUVA 4TR3A 3D6IA 1GULA 1JLVA 2XC2A 1HNAA 2F3MA 3UBLA 2LKUA 4KDUA 2DJJA 5LD0A 4FYCA 2PMTA 1GNWA 2CX4A 1HD2A 2FWGA 5CRHA 4V2NA 3FYGA 2YWNA 2P31A 3TRPA 1GUMA 2LQQA 1TRUA 1O85A 1X5DA 2LUSA 1T8EB 4N10A 4K2DA 1GRXA 5G5FA 5B8BA 2GQMA 4NHWA 1DSBA 3TOUA 1ERUA 2E2MA 2YWOA 2V41A 1K0MA 1N8JA 1K0OA 3DXBA 13GSA 1JFUA 2IPAA 3ISOA 4TKYA 3DIEA 2WJUA 1TI1A 1PSQA 2LEGA 1ML6A 2GSRA 1OE7A 2C0GA 5D9TA 1GSUA 1FOVA 2GQKA 5ID2B 2VCVA 1TRWA 2PBJA 2C80A 4IQ1A 2FNOA 5E59A 3EMXA 2AV4A 4J56E 4OMVA 5B6MA 5IMDA 1PQNA 5HFGA 3TKRA 2PPTA 3WGDA 1E2YA 4HU9A 1XCCA 4WR4A 1UVZA 2IJYA 2V32A 3MAKA 3GNJA 1GLPA 5G2ZA 3UOMA 1U3IA 3E3EA 1XPVA 4XS4B 4LMVA 1B4QA 4MPFA 1R5PA 3CSJA 2YWIA 3FR6A 1TU8A 2XBQA 5ECOB 1TP9A 1WMJA 3CSIA 3LGCA 1ZOFA 3H8QA 4HQSA 3UJ1A 3ERWA 5H5RA 2BJXA 1VF2A 1F3BA 4CDOA 2FHEA 4F9ZA 4ZB9A 3P8WA 3IRAA 2VM1A 4KX4A 3RDWA 3WD6A 4RI7A 2NBSA 3TRXA 5FWGA 1GLQA 4CW9A 2ZCTA 4EL1A 2N5FA 3HKRA 4PX1A 4TXOA 1XZOA 4MABA 4N0VA 3LWAA 4KNDA 2O8VB 3APOA 1OYJA 1RQMA 1LJRA 5LNKe 2GQLA 1M9BA 2HSHA 2HRFA 3A2VA 1J0FA 1FO5A 5GSTA 1FVKA 2H76A 1ZGNA 3KTLA 4BL7A 5IMVA 2CT6A 1O8WA 2C0DA 4PQHA 5ECNB 5DJMA 2K8VA 1XWCA 4GCIA 4KA0A 1R5AA 5A4WA 5B8AA 1MD4A 1G0TA 1A0FA 3TGZA 1EEJA 2HI7A 4EE0A 2BMXA 3KMNA 10GSA 2RUFA 3NOFA 4IP6A 3UAPA 2KP2A 4HS1A 2HZFA 2VD1A 2VL9A 3Q19A 1I9DA 5L71A 3D22A 1Y6EA 2RLIA 1U87A 3ERGA 4NXIA 4DSSA 3LXTA 3DGQA 3F4SA 1R7HA 3FZ9A 1FG4A 2M72A 2C4JA 4MJEA 3KD0A 2YCDA 1F3AA 2GT5A 4BWSA 2ZUPA 4ZXGA 3LSZA 4MA9A 3ZIVA 1SU9A 1B48A 3HZ8A 2FA8A 2O7KA 3EWLA 1SKWB 5ECMB 2A4VA 3FZAA 1AXDA 4FIWA 1PX6A 3HYPA 4JBBA 1GSEA 1O81A 1X0RA 4WETA 4MF7A 2ES7A 1GSSA 1GSYA 20GSA 3H4KA 2H70A 4F82A 1BX9A 1TDIA 5JCWA 4AJ6A 1FAAA 1GL8A 3KXOA 1GSFA 3H79A 5E4WA 2AUVA 2HSYA 3O6TA 1F2EA 3FZ5A 4D73B 2FA4A 1DUGA 2AHEA 1A2LA 3L9VA 5DAKB 2PUKC 4LLRA 3BJ5A 1XW6A 1C72A 4MZWA 3Q6OA 2L59A 1PD21 1SKRB 6GSUA 3GTUA 5CAXA 2LSTA 1WE0A 3QFBC 3KP8A 1MD3A 3HVXA 4IELA 4H86A 2MBTA 5IOXA 4LA1A 1X9WB 12GSA 5DCHA 4IBPA 1YKAA 5JWQB 1OKDA 4POBA 2VO4A 2H01A 2YZHA 4LL4B 1EOGA 5ECPB 1X5CA 1KTEA 4IGJA 1YJ6A 3I43A 3UMAA 5AGYA 5DCGA 3W8SA 2VLUA 3WGEA 1BJXA 2WGRA 1EZKA 4CHSA 2DJ1A 4TXVA 3F6DA 3LFLA 5EVOA 2MMOA 3KH9A 5HR2A 2X8GA 5HQPA 1VF1A 6GSXA 4DSQA 3EURA 4MDCA 3HJPA 4L0UA 1K0AA 4BWQA 4PNFA 3EINA 2X8HA 2F8FA 1OKTA 2YWMA 1QMVA 5CRWA 4MJAA 3P90A 2K6VA 1HNBA 2JADA 1G6WA 4KCAA 5CRDA 2R3XA 4KW6A 1YKCA 2B7JA 3LYPA 3PH9A 2YN1A 3FZ4A 4KSOA 2LRTA 1SYRA 1X5EA 4NHZA 1XBSA 4JR4A 2VM2A 2IL3A 1XW5A 3K8NA 5G1LA 1EGRA 5F07A 5EL8A 4EC0A 1V9WA 4ZL8A 4YAVA 4EKZA 5IPHA 1E6BA 2HLSA 5HFKA 4MK3A 2RIIA 3L9UA 3ZVJA 5D96A 1ERWA 3C7MA 4QL7A 2FWFA 1Z6MA 4V2LA 4MLYA 3QR6A 1QFNA 5ELAA 2XBIA 3GX0A 2MZCA 3DWVA 5KN3A 4NWYA 3SWLA 4MZBA 5FT3A 3FK8A 3D21A 3GUSA 2R37A 3UL3A 5A4VA 1TW9A 2VLTA 2RM6A 5ID2A 1H75A 2L4CA 4EVMA 4ILFA 2AYTA 3ZMLA 2O89A 5DALB 2QSIA 3C1SA 2GZPA 4KE3A 4ULXA 2OACA 3F6FA 2DJ2A 3ERFA 3G7JA 4TR4A 3CBUA 2CAQA 3VURA 2JZRA 2DLXA 2KHPA 5D93A 4OD7A 4XIHA 1ILOA 3KTBA 4XS1A 2PN8A 5G1KA 4KSMA 4IJIA 1A2JA 1A2MA 1PL2A 1GUKA 1R26A 1M2AA 3JCML 4XS4A 2LQOA 5IIZA 2GSTA 6GSVA 2I81A 4GSTA 4WXTA 3VI5A 3KCMA 3TJKA 1XWAA 4K8MA 5J4UA 4ZL7A 1T4ZA 4IJ3A 3US3A 1SENA 2VLVA 3GMFA 2KOKA 4F03A 5HR0A 4ACSA 4ID0A 5ECLB 1F9MA 1GSDA 3F3RA 2WZ9A 2H1GA 2DMLA 2Z9SA 2A2RA 4GLTA 1ZL9A 3NZNA 4YAPA 3Q18A 1FB0A 2MYGA 3M0FA 1G7OA 1A0RP 1SK1A 1QQ2A 1KEBA 4XTSA 1Z3EA 1SK2A 1PA3A 1FB6A 2VD0A 3TKQA 1OAZA 2YV7A 5KN1A 1T1VA 3ZIJA 1LU4A 4HZ2A 5B6NA 2C1YA 2WB9A 5DBQA 4MMMA 1HNCA 2H75A 5COHA 3WT2A 1O73A 4IQAA 5EY6A 2IN3A 4OFNA 4LMWA 5F8BA 1ZCPA 2P5QA 2H6YA 3DMLA 3IXRA 1TRVA 2JZTA 1CQHA 1VF3A 2ON5A 2J9HA 3RPNA 3ME7A 3GURA 2I3YA 2R2JA 1ERVA 2CAIA 1G7EA 4IHUA 3D4TA 4E8EA 2K9FA 3TKSC 4IVFA 1K0NA 4ZB8A 2WULA 1XOBA 4KDYA 3EMPA 3L78A 3DRNA 1YEXA 2L57A 2M80A 2H72A 2OJLA 2REMA 1A23A 3C71A 1SYXA 4Z7XA 6GSWA 3TKSA 3M9JA 4MJCA 3A2XA 1PKWA 2D2ZA 5IMFA 3MSZA 1NM3A 1SL1B 3D5JA 1H4OA 1Z9HA 1YEPA 1ZYEA 4ML6A 2B1LA 2MMAA 1TK8B 3TUEA 1GTBA 2G0FA 1GUHA 2HE3A 2OA7A 4PUAA 1Q98A 2DIZA 5ABRA 4ECIA 4MZCA 2OE3A 2OBIA 1NHOA 2VUPA 1BEDA 2V6KA 3W6GA 1XVQA 4O92A 1U88A 3FY7A 4G9HA 1TKDB 4KAEA 3F4TA 1BG5A 1PMTA 3VWXA 4XS6A 3ZYWA 4TR1B 2QKEA 4MJBA 2KP1A 1WIKA 1TK5B 4ECCA 4FYBA 2NDOA 1GTIA 2VCZA 1AW9A 3ME8A 3IPZA 2RM5A 4MCUA 4NPBA 3KP9A 4K7IA 2ALBA 3PGTA 1WOUA 1ON4A 3CTGA 3DD3A 1TRSA 3M1GA 5IMZA 1XWGA 4NV2A 1J9BA 2FUG2 3EYTA 3UIWA 1URMA 1V58A 1M9AA 1ERTA 2VOCA 4L5LA 2E7PA 4PQ1A 3TKSE 1AC1A 1A8LA 3RHBA 4Q5NA 3MDKA 5B7CA 1S3CA 4WBRD 4KDXA 1B9YC 2CQ9A 3QPMA 2PWJA 3A3TA 1GNEA 3APQA 3CSHA 1TJDA 5CRGA 5J9BA 1X9SB 1JZOA 3IBHA 2GSQA 2H8LA 1DE2A 1DE1A 2XPEA 4OFMA 3IC4A 5D9XA 3IR4A 1AAZA 2KUCA 3EC3A 3DVXA 1GTUA 1PX7A 4DEJA 3KMOA 4GSNA 1QXHA 1U3AA 5F0GA 1GP1A 1HYUA 2C0EA 2VCTA 2JU5A 5D8IA 2VL3A 1PL1A 1M99A 3PINA 1A24A 3F9UA 5C04A 4HDEA 5ECQB 2KLXA 1BAYA 2H30A 3U6VA 4Q5FA 4G10A 4I8BA 1JHBA 6GSSA 3Q74A 2H1DA 2N5AA 2EIRA 3N9JA 1QUWA 3ZZXA 2X64A 3TDGA 3CRUA 3HVVA 4HU7A 3ED3A 4ZBAA 2YV9A 4HJ2A 2H0GA 3TRQA 4J57E 3QMXA 2GGTA 3TB2A 3IK7A 3V1WA 1F6MC 1M2DA 2WRTA 2JACA 4FH8A 2HNLA 3IE3A 4N30A 1K3YA 3LEFA 2L4QA 5GSSA 2LJRA 5ECSA 3HD5A 4QQ7A 1MDKA 1O6JA 2H71A 3GKNA 1YY7A 4KCEA 3MNGA 2ON7A 1B4PA 3C8EA 4RQRA 2TRCP 1OC9A 2LRCA 1KBNA 2H0IA 1PKZA 4HZ4A 4GF0A 1AQWA 2LS5A 4F2IA 2DJ3A 2G2QA 1TTZA 4EF0A 1OC3A 1GSQA 2O87A 4V2MA 1S3DA 4TVEA 3R2QA 4JR6A 1ZMAA 5IMAA 4YQMA 4JEDA 5HR1A 4EXJA 1MTCA 4WBJA 1XW9A 4DSRA 2CVKA 3GKKA 4ZBDA 2LNSA 6GSYA 4JE1A 3HZ4A 2OKAA 3D4MA 5CO3A 2MBSA 3QD9A 3FW2A 3ZL5A 1NW2A 2VCXA 3TCOA 4NMUA 2HFDA 5G5EA 2EIQA 5ELGA 4K0NA 3LQ7A 4HEA2 2E2GA 3HJOA 4ZBBA 1VGLA 1XWKA 4WEYA 2TIRA 3OR5A 3G7YA 4N11A 1FHEA 4GSSA 4GQCA 3VLNA 5ECHB 2QGVA 4HJMA 1TXXA 2H6XA 3M3MA 9GSSA 3ZREA 1UC7A 1XOAA 3C73A 4L8EA 2P5RA 4AJ8A 4OO4A 1YQ1A 2M46A 3F63A 3IV4A 3WYWA 4K7OA 2HT9A 4K6XA 3HJMA 1Z7RA 2JSZA 2GT6A 4ZB6A 1O8XA 1RW1A 1V2AA 5FHIA 3FHKA 1GWCA 2FCHA 3A2WA 4AGSA 2MMZA 5INYA 2FY6A 2I4AA 4L0WA 3RBTA 3UEMA 3ZRDA 5ENUA 1AIUA 2CZ2A 2LV3A 5JWOB 1VRSD 2LJKA 3CXGA 3GKMA 2HRNA 4AJ7A 1OE8A 1NHYA 2GTUA 2YZUA 1SD8A 3KEBA 3LORA 3VWWA 4PUFC 3IA1A 1YDKA 2VAFA 4FYUA 1EWXA 4BVYA 2DMMA 2C8UA 4JZQA 2HZEB 3O3TA 3J7Yb 4PQIA 3L9SA 5AIXA 1SK0A 3HCZA 4KB3A 2E0QA 2R6KA 2C3NA 4X1UA 2HXKA 4I2UA 4EO3A 3G7IA 3TJBA 4MH3A 2DIYA 5LCZA 5CREA 1T3BA 2DJ0A 3QFAC 2IFQB 3GL3A 3RAZA 1EP7A 1K0DA 1VF4A 1T00A 1EP8A 5G31A 5F05A 3A5WA 2F8AA 2CA8A 2WFCA 5GAPD 2XHFA 5DJLA 3I6AA 1MEKA 4L5OA 1EV9A 5CNWA 3IHQA 2J23A 3VI7A 1N2AA 4PXOA 1K0CA 2B7KA 1XIYA 3M9KA 3ZITA 1Q4JA 5H5QA 2C3TA 4I5QA 1W89A 4GWRA 3TKPA 2PERA 4Q5QA 1JZRA 2XPDA 1OC8A 4I2TA 1TU7A 4E8HA 3KGKA 1GH2A 4ZIJA 2PU9C 3GV1A 2LRNA 5KN0A 5G30A 2OE0A 3VWVA 2GDRA 2LTKA 4XRAA 4O7HA 2OBKA 2DC5A 5D9VA 5EPFA 2QC7A 3QOUA 4YH2A 2VCQA 3RPPA 1OVNA 3NIVA 3UVHA 3KZQA 1TI3A 5F06A 2B5XA 1WPIA 1JZWA 1GTAA 5IMCA 3VWUA 5HR3A 4WR5A 3IDVA 3KM6A 1Z5YE 1SJIA 4OCFA 2GVPA 2VCWA 1FVJA 2RUEA 4TR1A 2AJQB 2X99A 1ABAA 4OO5A 1B9XC 4NAXA 1K3LA 3KJYA 3WT1A 1FW1A 3W8JA 3FEUA 3ZTLA 3ZVJD 3VFIA 2H6ZA 1R4WA 1PGTA 2VIMA 5A5KA 2FLSA 4ML1A 3GHAA 5KEJA 3LXZA 4RI6A 1YF0A 3CRTA 4GQFA 1WWJA 2MMNA 5ECKB 1UN2A 5JCGA 4N0ZA 3FRCA 2VL2C 1PRXA 1EOHA 2HYXA 2I1UA 2EIOA 3F0IA 2IMDA 4XRDA 1TK0B 4MF6A 3KH7A 4YQVA 3MWHA 4HUAA 2I9HA 2FD3A 4TR0A 2VL2A 5J3RA 3BBYA 4TN8A 4IS0A 3IAM2 1K3OA 3ZLPA 3CYNA 1SD9A 4KH7A 3HXSA 3APSA 1PN9A 2WCIA 4GXZA 3QAGA 4ECJA 3BCKA 2WDUA 1M7TA 1HQOA 2DBCA 3D0ZA 3UVTA 1SJZA 3FKFA 3TOTA 4EDYA 4X0XA 4TW5A 4MPGA 2IMKA 1J08A 5D73A 4POLA 5J9CA 1KNGA 3UARA 3HA9A 1JZDA 1ZZYA 5C00A 4ECBA 1THOA 3DVWA 2CVBA 4D73A 4XCSA 22GSA 1B8XA 19GSA 2YJ7A 5DAKA 2H1BA 3AY8A 3C1RA 16GSA 2H66A 4O5RA 3L4NA 4POMA 4XHMA 3GYKA 2YJHA 3IOSA 4O32A 2YPMA 4NV5A 4EUYA 3LYKA 2B5EA 5HFIA 3LG6A 2YOIA 4OFTA 7GSSA 1RK4A 1V57A 5AIVA 5GZZB 2CZ3A 4X43A 3DEXA 1A8YA 1AQXA 3HDCA 3QCPA 4IW9A 1X9MB 4MH2A 4K9ZA 1O7UA 2NTOA 3GA4A 4JU5A 4JRRA 2GZYA 4PGTA 2L6DA 2K18A 4QL9A 4YQUA 5DDLA 1SL0B 1CQGA 2GS3A 2L5LA 1T7PB 2PGTA 5D9WA 1BYEA 3BD2A 2AB6A 4G19A 1USBA 3L0HA 4HOJA 4TRXA 2AAWA 5J5NA 4K7NA 3GH9A 3LJRA 2P0GA 3F4RA 5ECRB 4F0BA 1SKSB 3EU3A 4PNGA 4J2FA 4OWYA 3O76A 4OCEA 1MDJA 1ACVA 3HY2A 4ZL9A 3F8UA 2CVDA 2CV4A 3H93A 2L5OA 1T4YA 2V6OA 1WRYA 3H1NA 1EGOA 2B5YA 4TXOB 3GFKA 1U6TA 2FWEA 5IM9A 5DQYA 1THXA 1Z6NA 1XFLA 1LBKA 2O85A 1QGVA 3CTFA 3FR3A 3S9FA 3SBCA 4MF5A 2F51A 3IAS2 4BVXA 11GSA 2NVLA 4K1FA 4BA7A 2H73A 3EE2A 5KN2A 5IO2A 3EVIA 4WKWA 3HHVA 1MDIA 4KUNA 3I69A 4LL1B 4AF2A 2B3SA 4FO5A 1F37A 5AN1A 1SJ6A 4G2EA 1S3AA 2LJAA 3IK9A 3ZFBA 3GH6A 3I9V2 5AISA 2DSAA 4ZILA 2R4VA 4Q5RA 4GRFA 4K0GA 2FGXA 4DSSB 3GL5A 2N5BA 5DQSA 1XVWA 2CX3A 1YF1A 3GIXA 4P3YB 3TJFA 3GN3A 2JL4A 4ISDA 3P7XA 8GSSA 2YNXA 3ZMKA 1W4VA 4V1Ap 1NSWA 1SL2B 2WS2A 2PVOC 1WJKA 2HZEA 5IPGA 1EEMA 1V40A 2IMEA 2IMIA 3DKSA 5CP1A 1Y25A 4I6XA 3F3QA 3UBKA 2V2GA 3QDNA 3E9JB 1XWBA 1AUCA 2IMFA 2YANA 4RQXA 1ZYQB 2IFQA 1EV4A 5DALA 1M0UA 1QK8A 3J7Yk 4IN0A 3GRXA 5CYYA 1XXUA 2R5GA 4POKA 1JLWA 1V98A 4V1Ag 4F0CA 18GSA 3GSTA 4WF4A 2FWHA 4TOPA 1WP0A 2C3QA 5JWRB 2X8CA 5GAND 6GSTA 17GSA 2H19A 3GTUB 3VPTA 5ECIB 3FR9A 3CMIA 3M8NA 2K8SA 4MP4A 2BTOT 2OE1A 4GTUA 3KIJA 2GSSA 3VK9A 3TJJA 2TRXA 3DYRA 5IQYA 3N5OA 4PURA 3WGXA 2B1KA 5J41A 1IYIA 1OC9B 1Z7PA 3EU4A 2OADA 1UA5A 2F9SA 2IWTA 3TJGA 2JZSA 2DJKA 2A2SA 2B6MA 4DVCA 3RHCA 1YZXA 2NPBA 1AQVA 3E0UA 5A4UA 3VPQA 3GKXA 4HQZA 4EDZA 1M2BA 4I97A
chains in the Genus database with same CATH superfamily
1TOFA 1ST9A 2H0HA 5IOWA 2IIYA 3GSSA 2GLRA 1G6YA 4KGIA 1PN0A 2L6CA 3ZFLA 4FQUA 3HVSA 2PVQA 5DVBA 1IYHA 14GSA 3G9BA 5H5SA 5JCUA 4WF5A 2LNTA 4IKHA 3U5RE 3P2AA 4IP1A 1I5GA 3QAWA 3QAVA 1BQ7A 2EC4A 3BOAA 5IO0A 1K0BA 2H1AA 1PFOA 2C0FA 2H74A 2JSYA 2V1MA 2ZNMA 2YP6A 4BPYA 2GZZA 3BCIA 4HI7A 3PR8A 1DBYA 3GX8A 1ZYNA 4RUVA 4TR3A 3D6IA 1GULA 1JLVA 2XC2A 1HNAA 2F3MA 3UBLA 2LKUA 4KDUA 2DJJA 5LD0A 4FYCA 2PMTA 1GNWA 2CX4A 1HD2A 2FWGA 5CRHA 4V2NA 3FYGA 2YWNA 2P31A 3TRPA 1GUMA 2LQQA 1TRUA 1O85A 1X5DA 2LUSA 1T8EB 4N10A 4K2DA 1GRXA 5G5FA 5B8BA 2GQMA 4ICYA 4NHWA 1DSBA 3TOUA 4BVYB 1ERUA 2E2MA 2YWOA 2V41A 1K0MA 1N8JA 1K0OA 3DXBA 13GSA 1JFUA 2IPAA 3ISOA 4TKYA 3DIEA 1FOHA 2WJUA 1TI1A 1PSQA 2LEGA 1ML6A 2GSRA 1OE7A 2C0GA 5D9TA 1GSUA 4BIKA 1FOVA 2GQKA 5ID2B 2VCVA 1TRWA 2PBJA 2C80A 4IQ1A 2FNOA 5E59A 3EMXA 2AV4A 4J56E 4OMVA 5B6MA 5IMDA 1PQNA 5HFGA 3TKRA 2PPTA 3WGDA 1E2YA 4HU9A 1XCCA 4WR4A 1UVZA 2IJYA 2V32A 3MAKA 3GNJA 1GLPA 5G2ZA 3UOMA 1U3IA 3E3EA 1XPVA 4XS4B 4LMVA 1B4QA 4MPFA 1R5PA 3CSJA 2YWIA 3FR6A 1TU8A 2XBQA 5ECOB 1TP9A 1WMJA 3CSIA 3LGCA 1ZOFA 3H8QA 4HQSA 3UJ1A 3ERWA 5H5RA 2BJXA 1VF2A 1F3BA 4CDOA 2FHEA 4F9ZA 4ZB9A 1S3RA 3P8WA 4CY6A 3IRAA 2VM1A 4KX4A 3RDWA 3WD6A 4RI7A 2NBSA 3TRXA 5FWGA 1GLQA 4CW9A 2ZCTA 4EL1A 2N5FA 3HKRA 4PX1A 4TXOA 1XZOA 4MABA 4N0VA 3LWAA 4KNDA 2O8VB 3APOA 1OYJA 1RQMA 1LJRA 5LNKe 2GQLA 1M9BA 2HSHA 2HRFA 3A2VA 1J0FA 1FO5A 5GSTA 1FVKA 2H76A 3IC8A 1ZGNA 3KTLA 4X4JA 4BL7A 5IMVA 2CT6A 1O8WA 2C0DA 4PQHA 5ECNB 5DJMA 2K8VA 1XWCA 4GCIA 4KA0A 1R5AA 5A4WA 5B8AA 3MIXA 1MD4A 1G0TA 1A0FA 3TGZA 1EEJA 2HI7A 4EE0A 2BMXA 3KMNA 4O5UA 10GSA 2RUFA 3NOFA 4IP6A 3UAPA 2KP2A 4HS1A 2HZFA 2VD1A 2VL9A 3Q19A 1I9DA 5L71A 3D22A 1Y6EA 2RLIA 1U87A 3ERGA 4NXIA 4DSSA 3LXTA 3DGQA 3F4SA 1R7HA 3FZ9A 1FG4A 2M72A 4MNNA 2C4JA 4MJEA 3KD0A 2YCDA 1F3AA 2GT5A 4BWSA 2ZUPA 4ZXGA 3LSZA 4MA9A 3ZIVA 1SU9A 1B48A 3HZ8A 2FA8A 2O7KA 4Z2UA 3EWLA 1SKWB 5ECMB 2A4VA 3FZAA 1AXDA 4FIWA 1PX6A 3HYPA 4JBBA 1GSEA 1O81A 1X0RA 4WETA 4MF7A 5KOWA 2ES7A 1GSSA 1GSYA 20GSA 2DKIA 3H4KA 2H70A 4F82A 1BX9A 1TDIA 5JCWA 4AJ6A 1FAAA 1GL8A 3KXOA 1GSFA 3H79A 5E4WA 2AUVA 2HSYA 4YKFA 3O6TA 1F2EA 3FZ5A 4D73B 2FA4A 1DUGA 2AHEA 1A2LA 3L9VA 2UZ8A 5DAKB 2PUKC 4LLRA 3BJ5A 1XW6A 1C72A 4MZWA 3Q6OA 2L59A 1PD21 1SKRB 6GSUA 3GTUA 5CAXA 2LSTA 1WE0A 3QFBC 3KP8A 1MD3A 3HVXA 4IELA 4H86A 2MBTA 5IOXA 4LA1A 1X9WB 12GSA 5DCHA 4IBPA 1YKAA 5JWQB 1OKDA 4POBA 2VO4A 2H01A 2YZHA 4LL4B 1EOGA 5ECPB 1X5CA 1KTEA 4IGJA 1YJ6A 3I43A 3UMAA 5AGYA 5DCGA 3W8SA 2VLUA 3WGEA 1BJXA 2WGRA 1EZKA 4CHSA 2DJ1A 4TXVA 3F6DA 3LFLA 5EVOA 2MMOA 3KH9A 5HR2A 2X8GA 5HQPA 1VF1A 6GSXA 4DSQA 3EURA 4MDCA 3HJPA 4L0UA 1K0AA 4BWQA 4PNFA 3EINA 2X8HA 2F8FA 1OKTA 2YWMA 1QMVA 5CRWA 4Z2RA 4MJAA 3P90A 2K6VA 1HNBA 2JADA 1G6WA 4KCAA 5CRDA 2R3XA 4KW6A 1YKCA 2B7JA 3LYPA 3PH9A 2YN1A 3FZ4A 4KSOA 2LRTA 1SYRA 1X5EA 4NHZA 1XBSA 4JR4A 3R3EA 2VM2A 2IL3A 1XW5A 3K8NA 5G1LA 1EGRA 5F07A 5EL8A 4EC0A 1V9WA 4ZL8A 4YAVA 4EKZA 5IPHA 1E6BA 2HLSA 5HFKA 4MK3A 2RIIA 3L9UA 3ZVJA 5D96A 1ERWA 3C7MA 4QL7A 2FWFA 1Z6MA 4V2LA 2R0GA 4MLYA 3QR6A 1QFNA 5ELAA 2XBIA 3GX0A 2MZCA 3DWVA 5KN3A 4NWYA 3SWLA 3HVNA 4MZBA 5FT3A 3FK8A 3D21A 3GUSA 2R37A 3UL3A 5A4VA 1TW9A 2VLTA 2RM6A 5ID2A 1H75A 2L4CA 4EVMA 4ILFA 2AYTA 3ZMLA 2O89A 5DALB 2QSIA 3C1SA 2GZPA 4KE3A 4ULXA 2OACA 3F6FA 2DJ2A 3ERFA 3G7JA 4TR4A 3CBUA 2CAQA 3VURA 2JZRA 2DLXA 2KHPA 5D93A 4OD7A 4XIHA 1ILOA 3KTBA 4XS1A 2PN8A 5G1KA 4KSMA 4IJIA 1A2JA 1A2MA 1PL2A 1GUKA 1R26A 1M2AA 3JCML 4XS4A 2LQOA 5IIZA 2GSTA 6GSVA 2I81A 4GSTA 4WXTA 3VI5A 3KCMA 3TJKA 1XWAA 4K8MA 5J4UA 4ZL7A 1T4ZA 4IJ3A 3US3A 1SENA 2VLVA 3GMFA 2KOKA 4F03A 5HR0A 4ACSA 4ID0A 5ECLB 1F9MA 1GSDA 3F3RA 2WZ9A 2H1GA 2DMLA 2Z9SA 2A2RA 4GLTA 1ZL9A 3NZNA 4YAPA 3Q18A 1FB0A 2MYGA 3M0FA 1G7OA 1A0RP 1SK1A 1QQ2A 1KEBA 2DKHA 1Z3EA 4XTSA 1SK2A 1PA3A 1FB6A 2VD0A 3TKQA 1OAZA 2YV7A 5KN1A 1T1VA 3ZIJA 1LU4A 4HZ2A 5B6NA 2C1YA 2WB9A 5DBQA 4MMMA 1HNCA 2H75A 5COHA 3WT2A 1O73A 4IQAA 5EY6A 2IN3A 4OFNA 4LMWA 5F8BA 1ZCPA 2P5QA 2H6YA 3DMLA 2A2PA 3IXRA 1TRVA 2JZTA 1CQHA 3IHGA 1VF3A 2ON5A 2J9HA 3RPNA 3ME7A 3GURA 2I3YA 2R2JA 1ERVA 1M3JA 2CAIA 1G7EA 4IHUA 3D4TA 4E8EA 2K9FA 3TKSC 4IVFA 1K0NA 4ZB8A 2WULA 1XOBA 4KDYA 3EMPA 3L78A 3DRNA 1YEXA 2L57A 2M80A 2H72A 2OJLA 2REMA 3MYDA 1A23A 3C71A 1SYXA 4Z7XA 6GSWA 3TKSA 3M9JA 4MJCA 3A2XA 1PKWA 2D2ZA 5IMFA 3MSZA 1NM3A 1SL1B 3D5JA 1H4OA 1Z9HA 1YEPA 1ZYEA 4ML6A 2B1LA 2MMAA 1TK8B 3TUEA 1GTBA 2G0FA 1GUHA 2HE3A 2OA7A 4PUAA 1Q98A 2DIZA 5ABRA 4ECIA 4MZCA 2OE3A 2OBIA 1NHOA 2VUPA 1BEDA 2V6KA 3W6GA 1XVQA 4O92A 1U88A 3FY7A 4G9HA 1TKDB 4KAEA 3F4TA 1BG5A 1PMTA 3VWXA 4XS6A 3ZYWA 4TR1B 2QKEA 4MJBA 2KP1A 1WIKA 1TK5B 4ECCA 4FYBA 2NDOA 1GTIA 2VCZA 1AW9A 3ME8A 3IPZA 2RM5A 4MCUA 4NPBA 3KP9A 4K7IA 2ALBA 3PGTA 5BMUA 1WOUA 1ON4A 3CTGA 3DD3A 1TRSA 3M1GA 5IMZA 1XWGA 4NV2A 1J9BA 2FUG2 3EYTA 3UIWA 2R0CA 1URMA 1V58A 1M9AA 1ERTA 2VOCA 4L5LA 2E7PA 4PQ1A 3TKSE 1AC1A 1A8LA 3RHBA 4Q5NA 3MDKA 5B7CA 1S3CA 4WBRD 4KDXA 1B9YC 2CQ9A 3QPMA 2PWJA 3A3TA 1GNEA 3APQA 3CSHA 1TJDA 5KOXA 5CRGA 5J9BA 1X9SB 1JZOA 3IBHA 2GSQA 2H8LA 1DE2A 1DE1A 2XPEA 4OFMA 3IC4A 5D9XA 3IR4A 1AAZA 2KUCA 3EC3A 3DVXA 4EIPA 1GTUA 1PX7A 4DEJA 3KMOA 4GSNA 1QXHA 1U3AA 5F0GA 1GP1A 1HYUA 2C0EA 2VCTA 2JU5A 5D8IA 2VL3A 1PL1A 1M99A 3PINA 1A24A 3F9UA 5C04A 4HDEA 3CQFA 5ECQB 2KLXA 1BAYA 2H30A 3U6VA 4Q5FA 4G10A 4I8BA 1JHBA 6GSSA 3Q74A 2H1DA 2N5AA 2EIRA 3N9JA 1QUWA 4BL7B 3ZZXA 2X64A 3TDGA 3CRUA 3HVVA 4HU7A 3ED3A 4ZBAA 2YV9A 4HJ2A 2H0GA 3TRQA 4J57E 3QMXA 2GGTA 3TB2A 3IK7A 3V1WA 1F6MC 1M2DA 2WRTA 2JACA 4FH8A 2HNLA 3IE3A 4N30A 1K3YA 3LEFA 2L4QA 5GSSA 2LJRA 5ECSA 3HD5A 4QQ7A 1MDKA 1O6JA 2H71A 3GKNA 1YY7A 4KCEA 3MNGA 2ON7A 1B4PA 3C8EA 4RQRA 2TRCP 1OC9A 2LRCA 1KBNA 2H0IA 1PKZA 4HZ4A 4GF0A 1AQWA 2LS5A 4F2IA 2DJ3A 2G2QA 1TTZA 4EF0A 1OC3A 2R0PA 1GSQA 2O87A 2HRKA 4V2MA 1S3DA 4TVEA 3R2QA 4JR6A 1ZMAA 5IMAA 4YQMA 4JEDA 5HR1A 4EXJA 1MTCA 4WBJA 1XW9A 4DSRA 2CVKA 3GKKA 4ZBDA 2LNSA 6GSYA 4JE1A 3HZ4A 2OKAA 3D4MA 3A5IA 4EIQA 5CO3A 2MBSA 3QD9A 3FW2A 3ZL5A 1NW2A 2VCXA 3TCOA 4NMUA 2HFDA 5G5EA 2EIQA 5ELGA 4K0NA 3LQ7A 4HEA2 2E2GA 3HJOA 4ZBBA 1VGLA 1XWKA 4WEYA 2TIRA 3OR5A 3G7YA 4N11A 1FHEA 4GSSA 4GQCA 3VLNA 5ECHB 2QGVA 4HJMA 1TXXA 2H6XA 3M3MA 4G0IA 4BVXB 9GSSA 3ZREA 1UC7A 1XOAA 3C73A 4L8EA 2P5RA 4AJ8A 4OO4A 1YQ1A 2M46A 3F63A 3IV4A 3WYWA 4K7OA 2HT9A 4K6XA 3HJMA 1Z7RA 2JSZA 2GT6A 4ZB6A 1O8XA 1RW1A 1V2AA 5FHIA 3FHKA 1GWCA 2FCHA 3A2WA 4AGSA 2MMZA 5INYA 2FY6A 2I4AA 4L0WA 3RBTA 3UEMA 3ZRDA 5ENUA 1AIUA 2CZ2A 2LV3A 5JWOB 1VRSD 2LJKA 3CXGA 3GKMA 2HRNA 4AJ7A 1OE8A 1NHYA 2GTUA 2YZUA 1SD8A 3KEBA 3LORA 3VWWA 4PUFC 3IA1A 1YDKA 2VAFA 4FYUA 1EWXA 4BVYA 2DMMA 2C8UA 4JZQA 2HZEB 3O3TA 3J7Yb 4PQIA 3L9SA 5AIXA 1SK0A 3HCZA 4KB3A 2E0QA 2R6KA 2C3NA 4X1UA 2HXKA 4A5PA 4I2UA 4EO3A 3G7IA 3TJBA 4MH3A 2DIYA 5LCZA 5CREA 1T3BA 2DJ0A 3QFAC 2IFQB 4G0LA 3GL3A 3RAZA 1EP7A 1K0DA 1VF4A 1T00A 1EP8A 5G31A 5F05A 3A5WA 2F8AA 2CA8A 2WFCA 5GAPD 2XHFA 5DJLA 3I6AA 1MEKA 4L5OA 1EV9A 5CNWA 3IHQA 4PTSA 2J23A 3VI7A 1N2AA 4PXOA 1K0CA 2B7KA 1XIYA 3M9KA 3ZITA 1Q4JA 5H5QA 2C3TA 4I5QA 1W89A 4GWRA 3TKPA 2PERA 4Q5QA 1JZRA 2XPDA 1OC8A 4I2TA 1TU7A 4E8HA 3KGKA 1GH2A 4ZIJA 2PU9C 3GV1A 2LRNA 5KN0A 5G30A 2OE0A 3VWVA 2GDRA 2LTKA 4XRAA 4O7HA 2OBKA 2DC5A 5D9VA 5EPFA 2QC7A 3QOUA 4YH2A 2VCQA 3RPPA 1OVNA 3NIVA 3LW9A 3UVHA 3KZQA 1TI3A 5F06A 2B5XA 1WPIA 1JZWA 1GTAA 5IMCA 3VWUA 5HR3A 4WR5A 3IDVA 3KM6A 1Z5YE 1SJIA 4USSA 4OCFA 2GVPA 2VCWA 1FVJA 2RUEA 4TR1A 2AJQB 2X99A 1ABAA 4OO5A 1B9XC 4NAXA 1K3LA 3KJYA 3WT1A 1FW1A 3W8JA 3FEUA 3ZTLA 3ZVJD 3VFIA 2H6ZA 1R4WA 1PGTA 2VIMA 4HSCX 5A5KA 4YKGA 4K5RA 2FLSA 4ML1A 3GHAA 5KEJA 3LXZA 4RI6A 1YF0A 3CRTA 4GQFA 1WWJA 2MMNA 5ECKB 1UN2A 4O5QA 5JCGA 4N0ZA 3FRCA 2VL2C 1PRXA 1EOHA 2HYXA 2I1UA 2EIOA 3F0IA 2IMDA 4XRDA 1TK0B 4MF6A 2HRAA 3KH7A 4YQVA 3MWHA 4HUAA 2I9HA 2FD3A 4TR0A 2VL2A 5J3RA 3BBYA 4TN8A 4IS0A 3IAM2 1K3OA 3ZLPA 3CYNA 1SD9A 4KH7A 3HXSA 3APSA 1PN9A 2WCIA 4GXZA 3QAGA 4ECJA 3BCKA 2WDUA 1M7TA 1HQOA 2DBCA 3D0ZA 3PPUA 3UVTA 1SJZA 3FKFA 3TOTA 4EDYA 4X0XA 4TW5A 4MPGA 2IMKA 1J08A 5D73A 4POLA 5J9CA 1KNGA 3UARA 4CY8A 3HA9A 1JZDA 1ZZYA 5C00A 4ECBA 1THOA 3DVWA 2CVBA 4D73A 4XCSA 22GSA 1B8XA 19GSA 2YJ7A 5DAKA 2H1BA 3AY8A 3C1RA 16GSA 2H66A 2X4AA 4O5RA 3L4NA 4POMA 4XHMA 3GYKA 2YJHA 3IOSA 4O32A 2YPMA 4NV5A 4EUYA 3LYKA 2B5EA 5HFIA 2QA2A 3LG6A 2YOIA 4OFTA 7GSSA 1RK4A 1V57A 5AIVA 5GZZB 2CZ3A 4X43A 3DEXA 1A8YA 1AQXA 3HDCA 3QCPA 4IW9A 1X9MB 4MH2A 4K9ZA 1O7UA 2NTOA 3GA4A 4JU5A 4JRRA 2GZYA 4PGTA 2L6DA 2K18A 4QL9A 4YQUA 5DDLA 2X49A 1SL0B 1CQGA 2GS3A 2L5LA 1T7PB 2PGTA 5D9WA 1BYEA 3BD2A 2AB6A 4G19A 1USBA 3L0HA 4HOJA 4TRXA 2AAWA 5J5NA 4K7NA 3GH9A 3LJRA 2P0GA 3F4RA 5ECRB 4F0BA 1SKSB 4K5SA 3EU3A 4PNGA 4J2FA 4OWYA 3O76A 4OCEA 1MDJA 1ACVA 3HY2A 4ZL9A 3F8UA 2CVDA 2CV4A 3H93A 2L5OA 1T4YA 2V6OA 1WRYA 3H1NA 1EGOA 2B5YA 4TXOB 3GFKA 1U6TA 2FWEA 5IM9A 5DQYA 1THXA 1Z6NA 1XFLA 1XG8A 1LBKA 2O85A 1QGVA 3CTFA 3FR3A 4Z2TA 3S9FA 3SBCA 4MF5A 2F51A 3FMWA 3IAS2 4BVXA 11GSA 2NVLA 4K1FA 4BA7A 2H73A 3EE2A 5KN2A 5IO2A 3EVIA 2HSMA 4WKWA 3HHVA 1MDIA 4KUNA 3I69A 4LL1B 4AF2A 2B3SA 4FO5A 1F37A 5AN1A 1SJ6A 4G2EA 1S3AA 2LJAA 3IK9A 3ZFBA 3GH6A 3I9V2 5AISA 2DSAA 4ZILA 2R4VA 4Q5RA 4GRFA 4K0GA 2FGXA 4DSSB 3GL5A 2N5BA 5DQSA 1XVWA 2CX3A 1YF1A 3GIXA 4P3YB 3TJFA 3GN3A 2JL4A 4ISDA 3P7XA 8GSSA 2YNXA 3ZMKA 1W4VA 4V1Ap 1NSWA 1SL2B 2WS2A 2PVOC 1WJKA 2HZEA 5IPGA 1EEMA 1V40A 2IMEA 2IMIA 3DKSA 5CP1A 1Y25A 4I6XA 3F3QA 3UBKA 2A4HA 2V2GA 3QDNA 3E9JB 1XWBA 1AUCA 2IMFA 2YANA 4RQXA 1ZYQB 2IFQA 1EV4A 5DALA 1M0UA 1QK8A 3J7Yk 4IN0A 3GRXA 5CYYA 1XXUA 2R5GA 4POKA 1JLWA 1V98A 4V1Ag 5BRTA 4F0CA 18GSA 3GSTA 4WF4A 4KF9A 2FWHA 4TOPA 1M3IA 1WP0A 2C3QA 5JWRB 2X8CA 5GAND 6GSTA 17GSA 2H19A 3GTUB 3VPTA 5ECIB 3EPTA 3FR9A 3CMIA 3M8NA 2QA1A 2K8SA 4MP4A 2BTOT 2OE1A 4GTUA 3KIJA 2GSSA 4G0KA 3VK9A 3TJJA 2TRXA 3DYRA 5IQYA 3N5OA 4PURA 3WGXA 2B1KA 5J41A 1IYIA 1OC9B 1Z7PA 3EU4A 2OADA 1UA5A 2F9SA 2IWTA 3TJGA 2JZSA 2DJKA 2A2SA 4K2XA 2B6MA 4DVCA 3RHCA 1YZXA 2NPBA 1AQVA 3E0UA 5A4UA 3VPQA 3GKXA 4HQZA 4EDZA 1M2BA 4I97A 1ZYPA
chains in the Genus database with same CATH topology
1TOFA 1ST9A 2H0HA 5IOWA 2IIYA 3GSSA 2GLRA 1G6YA 4KGIA 1PN0A 2L6CA 3ZFLA 4FQUA 3HVSA 2PVQA 5DVBA 1IYHA 14GSA 3G9BA 5H5SA 5JCUA 4WF5A 2LNTA 4IKHA 3U5RE 3P2AA 4IP1A 1I5GA 3QAWA 3QAVA 1BQ7A 2EC4A 3BOAA 5IO0A 1K0BA 2H1AA 2C0FA 2H74A 2JSYA 2V1MA 2ZNMA 2YP6A 4BPYA 2GZZA 3BCIA 4HI7A 3PR8A 1DBYA 3GX8A 1ZYNA 4RUVA 4TR3A 3D6IA 1GULA 1JLVA 2XC2A 1HNAA 2F3MA 3UBLA 2LKUA 4KDUA 2DJJA 5LD0A 4FYCA 2PMTA 1GNWA 2CX4A 1HD2A 2FWGA 5CRHA 4V2NA 3FYGA 2YWNA 2P31A 3TRPA 1GUMA 2LQQA 1TRUA 1O85A 1X5DA 2LUSA 1T8EB 4N10A 4K2DA 1GRXA 5G5FA 5B8BA 2GQMA 4ICYA 4NHWA 1DSBA 3TOUA 4BVYB 1ERUA 2E2MA 2YWOA 2V41A 1K0MA 1N8JA 1K0OA 3DXBA 13GSA 1JFUA 2IPAA 3ISOA 4TKYA 3DIEA 1FOHA 2WJUA 1TI1A 1PSQA 2LEGA 1ML6A 2GSRA 1OE7A 2C0GA 5D9TA 1GSUA 1FOVA 2GQKA 5ID2B 2VCVA 1TRWA 2PBJA 2C80A 4IQ1A 2FNOA 5E59A 3EMXA 2AV4A 4J56E 4OMVA 5B6MA 5IMDA 1PQNA 5HFGA 3TKRA 2PPTA 3WGDA 1E2YA 4HU9A 1XCCA 4WR4A 1UVZA 2IJYA 2V32A 3MAKA 3GNJA 1GLPA 5G2ZA 3UOMA 1U3IA 3E3EA 1XPVA 4XS4B 4LMVA 1B4QA 4MPFA 1R5PA 3CSJA 2YWIA 3FR6A 1TU8A 2XBQA 5ECOB 1TP9A 1WMJA 3CSIA 3LGCA 1ZOFA 3H8QA 4HQSA 3UJ1A 3ERWA 5H5RA 2BJXA 1VF2A 1F3BA 4CDOA 2FHEA 4F9ZA 4ZB9A 3P8WA 4CY6A 3IRAA 2VM1A 4KX4A 3RDWA 3WD6A 4RI7A 2NBSA 3TRXA 5FWGA 1GLQA 4CW9A 2ZCTA 4EL1A 2N5FA 3HKRA 4PX1A 4TXOA 1XZOA 4MABA 4N0VA 3LWAA 4KNDA 2O8VB 3APOA 1OYJA 1RQMA 1LJRA 5LNKe 2GQLA 1M9BA 2HSHA 2HRFA 3A2VA 1J0FA 1FO5A 5GSTA 1FVKA 2H76A 3IC8A 1ZGNA 3KTLA 4X4JA 4BL7A 5IMVA 2CT6A 1O8WA 2C0DA 4PQHA 5ECNB 5DJMA 2K8VA 1XWCA 4GCIA 4KA0A 1R5AA 5A4WA 5B8AA 3MIXA 1MD4A 1G0TA 1A0FA 3TGZA 1EEJA 2HI7A 4EE0A 2BMXA 3KMNA 4O5UA 10GSA 2RUFA 3NOFA 4IP6A 3UAPA 2KP2A 4HS1A 2HZFA 2VD1A 2VL9A 3Q19A 1I9DA 5L71A 3D22A 1Y6EA 2RLIA 1U87A 3ERGA 4NXIA 4DSSA 3LXTA 3DGQA 3F4SA 1R7HA 3FZ9A 1FG4A 2M72A 4MNNA 2C4JA 4MJEA 3KD0A 2YCDA 1F3AA 2GT5A 4BWSA 2ZUPA 4ZXGA 3LSZA 4MA9A 3ZIVA 1SU9A 1B48A 3HZ8A 2FA8A 2O7KA 4Z2UA 3EWLA 1SKWB 5ECMB 2A4VA 3FZAA 1AXDA 4FIWA 1PX6A 3HYPA 4JBBA 1GSEA 1O81A 1X0RA 4WETA 4MF7A 5KOWA 2ES7A 1GSSA 1GSYA 20GSA 2DKIA 3H4KA 2H70A 4F82A 1BX9A 1TDIA 5JCWA 4AJ6A 1FAAA 1GL8A 3KXOA 1GSFA 3H79A 5E4WA 2AUVA 2HSYA 4YKFA 3O6TA 1F2EA 3FZ5A 4D73B 2FA4A 1DUGA 2AHEA 1A2LA 3L9VA 2UZ8A 5DAKB 2PUKC 4LLRA 3BJ5A 1XW6A 1C72A 4MZWA 3Q6OA 2L59A 1PD21 1SKRB 6GSUA 3GTUA 5CAXA 2LSTA 1WE0A 3QFBC 3KP8A 1MD3A 3HVXA 4IELA 4H86A 2MBTA 5IOXA 4LA1A 1X9WB 12GSA 5DCHA 4IBPA 1YKAA 5JWQB 1OKDA 4POBA 2VO4A 2H01A 2YZHA 4LL4B 1EOGA 5ECPB 1X5CA 1KTEA 4IGJA 1YJ6A 3I43A 3UMAA 5AGYA 5DCGA 3W8SA 2VLUA 3WGEA 1BJXA 2WGRA 1EZKA 4CHSA 2DJ1A 4TXVA 3F6DA 3LFLA 5EVOA 2MMOA 3KH9A 5HR2A 2X8GA 5HQPA 1VF1A 6GSXA 4DSQA 3EURA 4MDCA 3HJPA 4L0UA 1K0AA 4BWQA 4PNFA 3EINA 2X8HA 2F8FA 1OKTA 2YWMA 1QMVA 5CRWA 4Z2RA 4MJAA 3P90A 2K6VA 1HNBA 2JADA 1G6WA 4KCAA 5CRDA 2R3XA 4KW6A 1YKCA 2B7JA 3LYPA 3PH9A 2YN1A 3FZ4A 4KSOA 2LRTA 1SYRA 1X5EA 4NHZA 1XBSA 4JR4A 3R3EA 2VM2A 2IL3A 1XW5A 3K8NA 5G1LA 1EGRA 5F07A 5EL8A 4EC0A 1V9WA 4ZL8A 4YAVA 4EKZA 5IPHA 1E6BA 2HLSA 5HFKA 4MK3A 2RIIA 3L9UA 3ZVJA 5D96A 1ERWA 3C7MA 4QL7A 2FWFA 1Z6MA 4V2LA 2R0GA 4MLYA 3QR6A 1QFNA 5ELAA 2XBIA 3GX0A 2MZCA 3DWVA 5KN3A 4NWYA 3SWLA 4MZBA 5FT3A 3FK8A 3D21A 3GUSA 2R37A 3UL3A 5A4VA 1TW9A 2VLTA 2RM6A 5ID2A 1H75A 2L4CA 4EVMA 4ILFA 2AYTA 3ZMLA 2O89A 5DALB 2QSIA 3C1SA 2GZPA 4KE3A 4ULXA 2OACA 3F6FA 2DJ2A 3ERFA 3G7JA 4TR4A 3CBUA 2CAQA 3VURA 2JZRA 2DLXA 2KHPA 5D93A 4OD7A 4XIHA 1ILOA 3KTBA 4XS1A 2PN8A 5G1KA 4KSMA 4IJIA 1A2JA 1A2MA 1PL2A 1GUKA 1R26A 1M2AA 3JCML 4XS4A 2LQOA 5IIZA 2GSTA 6GSVA 2I81A 4GSTA 4WXTA 3VI5A 3KCMA 3TJKA 1XWAA 4K8MA 5J4UA 4ZL7A 1T4ZA 4IJ3A 3US3A 1SENA 2VLVA 3GMFA 2KOKA 4F03A 5HR0A 4ACSA 4ID0A 5ECLB 1F9MA 1GSDA 3F3RA 2WZ9A 2H1GA 2DMLA 2Z9SA 2A2RA 4GLTA 1ZL9A 3NZNA 4YAPA 3Q18A 1FB0A 2MYGA 3M0FA 1G7OA 1A0RP 1SK1A 1QQ2A 1KEBA 2DKHA 1Z3EA 4XTSA 1SK2A 1PA3A 1FB6A 2VD0A 3TKQA 1OAZA 2YV7A 5KN1A 1T1VA 3ZIJA 1LU4A 4HZ2A 5B6NA 2C1YA 2WB9A 5DBQA 4MMMA 1HNCA 2H75A 5COHA 3WT2A 1O73A 4IQAA 5EY6A 2IN3A 4OFNA 4LMWA 5F8BA 1ZCPA 2P5QA 2H6YA 3DMLA 2A2PA 3IXRA 1TRVA 2JZTA 1CQHA 3IHGA 1VF3A 2ON5A 2J9HA 3RPNA 3ME7A 3GURA 2I3YA 2R2JA 1ERVA 2CAIA 1G7EA 4IHUA 3D4TA 4E8EA 2K9FA 3TKSC 4IVFA 1K0NA 4ZB8A 2WULA 1XOBA 4KDYA 3EMPA 3L78A 3DRNA 1YEXA 2L57A 2M80A 2H72A 2OJLA 2REMA 3MYDA 1A23A 3C71A 1SYXA 4Z7XA 6GSWA 3TKSA 3M9JA 4MJCA 3A2XA 1PKWA 2D2ZA 5IMFA 3MSZA 1NM3A 1SL1B 3D5JA 1H4OA 1Z9HA 1YEPA 1ZYEA 4ML6A 2B1LA 2MMAA 1TK8B 3TUEA 1GTBA 2G0FA 1GUHA 2HE3A 2OA7A 4PUAA 1Q98A 2DIZA 5ABRA 4ECIA 4MZCA 2OE3A 2OBIA 1NHOA 2VUPA 1BEDA 2V6KA 3W6GA 1XVQA 4O92A 1U88A 3FY7A 4G9HA 1TKDB 4KAEA 3F4TA 1BG5A 1PMTA 3VWXA 4XS6A 3ZYWA 4TR1B 2QKEA 4MJBA 2KP1A 1WIKA 1TK5B 4ECCA 4FYBA 2NDOA 1GTIA 2VCZA 1AW9A 3ME8A 3IPZA 2RM5A 4MCUA 4NPBA 3KP9A 4K7IA 2ALBA 3PGTA 5BMUA 1WOUA 1ON4A 3CTGA 3DD3A 1TRSA 3M1GA 5IMZA 1XWGA 4NV2A 1J9BA 2FUG2 3EYTA 3UIWA 2R0CA 1URMA 1V58A 1M9AA 1ERTA 2VOCA 4L5LA 2E7PA 4PQ1A 3TKSE 1AC1A 1A8LA 3RHBA 4Q5NA 3MDKA 5B7CA 1S3CA 4WBRD 4KDXA 1B9YC 2CQ9A 3QPMA 2PWJA 3A3TA 1GNEA 3APQA 3CSHA 1TJDA 5KOXA 5CRGA 5J9BA 1X9SB 1JZOA 3IBHA 2GSQA 2H8LA 1DE2A 1DE1A 2XPEA 4OFMA 3IC4A 5D9XA 3IR4A 1AAZA 2KUCA 3EC3A 3DVXA 4EIPA 1GTUA 1PX7A 4DEJA 3KMOA 4GSNA 1QXHA 1U3AA 5F0GA 1GP1A 1HYUA 2C0EA 2VCTA 2JU5A 5D8IA 2VL3A 1PL1A 1M99A 3PINA 1A24A 3F9UA 5C04A 4HDEA 5ECQB 2KLXA 1BAYA 2H30A 3U6VA 4Q5FA 4G10A 4I8BA 1JHBA 6GSSA 3Q74A 2H1DA 2N5AA 2EIRA 3N9JA 1QUWA 4BL7B 3ZZXA 2X64A 3TDGA 3CRUA 3HVVA 4HU7A 3ED3A 4ZBAA 2YV9A 4HJ2A 2H0GA 3TRQA 4J57E 3QMXA 2GGTA 3TB2A 3IK7A 3V1WA 1F6MC 1M2DA 2WRTA 2JACA 4FH8A 2HNLA 3IE3A 4N30A 1K3YA 3LEFA 2L4QA 5GSSA 2LJRA 5ECSA 3HD5A 4QQ7A 1MDKA 1O6JA 2H71A 3GKNA 1YY7A 4KCEA 3MNGA 2ON7A 1B4PA 3C8EA 4RQRA 2TRCP 1OC9A 2LRCA 1KBNA 2H0IA 1PKZA 4HZ4A 4GF0A 1AQWA 2LS5A 4F2IA 2DJ3A 2G2QA 1TTZA 4EF0A 1OC3A 2R0PA 1GSQA 2O87A 2HRKA 4V2MA 1S3DA 4TVEA 3R2QA 4JR6A 1ZMAA 5IMAA 4YQMA 4JEDA 5HR1A 4EXJA 1MTCA 4WBJA 1XW9A 4DSRA 2CVKA 3GKKA 4ZBDA 2LNSA 6GSYA 4JE1A 3HZ4A 2OKAA 3D4MA 3A5IA 4EIQA 5CO3A 2MBSA 3QD9A 3FW2A 3ZL5A 1NW2A 2VCXA 3TCOA 4NMUA 2HFDA 5G5EA 2EIQA 5ELGA 4K0NA 3LQ7A 4HEA2 2E2GA 3HJOA 4ZBBA 1VGLA 1XWKA 4WEYA 2TIRA 3OR5A 3G7YA 4N11A 1FHEA 4GSSA 4GQCA 3VLNA 5ECHB 2QGVA 4HJMA 1TXXA 2H6XA 3M3MA 4G0IA 4BVXB 9GSSA 3ZREA 1UC7A 1XOAA 3C73A 4L8EA 2P5RA 4AJ8A 4OO4A 1YQ1A 2M46A 3F63A 3IV4A 3WYWA 4K7OA 2HT9A 4K6XA 3HJMA 1Z7RA 2JSZA 2GT6A 4ZB6A 1O8XA 1RW1A 1V2AA 5FHIA 3FHKA 1GWCA 2FCHA 3A2WA 4AGSA 2MMZA 5INYA 2FY6A 2I4AA 4L0WA 3RBTA 3UEMA 3ZRDA 5ENUA 1AIUA 2CZ2A 2LV3A 5JWOB 1VRSD 2LJKA 3CXGA 3GKMA 2HRNA 4AJ7A 1OE8A 1NHYA 2GTUA 2YZUA 1SD8A 3KEBA 3LORA 3VWWA 4PUFC 3IA1A 1YDKA 2VAFA 4FYUA 1EWXA 4BVYA 2DMMA 2C8UA 4JZQA 2HZEB 3O3TA 3J7Yb 4PQIA 3L9SA 5AIXA 1SK0A 3HCZA 4KB3A 2E0QA 2R6KA 2C3NA 4X1UA 2HXKA 4A5PA 4I2UA 4EO3A 3G7IA 3TJBA 4MH3A 2DIYA 5LCZA 5CREA 1T3BA 2DJ0A 3QFAC 2IFQB 4G0LA 3GL3A 3RAZA 1EP7A 1K0DA 1VF4A 1T00A 1EP8A 5G31A 5F05A 3A5WA 2F8AA 2CA8A 2WFCA 5GAPD 2XHFA 5DJLA 3I6AA 1MEKA 4L5OA 1EV9A 5CNWA 3IHQA 4PTSA 2J23A 3VI7A 1N2AA 4PXOA 1K0CA 2B7KA 1XIYA 3M9KA 3ZITA 1Q4JA 5H5QA 2C3TA 4I5QA 1W89A 4GWRA 3TKPA 2PERA 4Q5QA 1JZRA 2XPDA 1OC8A 4I2TA 1TU7A 4E8HA 3KGKA 1GH2A 4ZIJA 2PU9C 3GV1A 2LRNA 5KN0A 5G30A 2OE0A 3VWVA 2GDRA 2LTKA 4XRAA 4O7HA 2OBKA 2DC5A 5D9VA 5EPFA 2QC7A 3QOUA 4YH2A 2VCQA 3RPPA 1OVNA 3NIVA 3LW9A 3UVHA 3KZQA 1TI3A 5F06A 2B5XA 1WPIA 1JZWA 1GTAA 5IMCA 3VWUA 5HR3A 4WR5A 3IDVA 3KM6A 1Z5YE 1SJIA 4USSA 4OCFA 2GVPA 2VCWA 1FVJA 2RUEA 4TR1A 2AJQB 2X99A 1ABAA 4OO5A 1B9XC 4NAXA 1K3LA 3KJYA 3WT1A 1FW1A 3W8JA 3FEUA 3ZTLA 3ZVJD 3VFIA 2H6ZA 1R4WA 1PGTA 2VIMA 5A5KA 4YKGA 4K5RA 2FLSA 4ML1A 3GHAA 5KEJA 3LXZA 4RI6A 1YF0A 3CRTA 4GQFA 1WWJA 2MMNA 5ECKB 1UN2A 4O5QA 5JCGA 4N0ZA 3FRCA 2VL2C 1PRXA 1EOHA 2HYXA 2I1UA 2EIOA 3F0IA 2IMDA 4XRDA 1TK0B 4MF6A 2HRAA 3KH7A 4YQVA 3MWHA 4HUAA 2I9HA 2FD3A 4TR0A 2VL2A 5J3RA 3BBYA 4TN8A 4IS0A 3IAM2 1K3OA 3ZLPA 3CYNA 1SD9A 4KH7A 3HXSA 3APSA 1PN9A 2WCIA 4GXZA 3QAGA 4ECJA 3BCKA 2WDUA 1M7TA 1HQOA 2DBCA 3D0ZA 3PPUA 3UVTA 1SJZA 3FKFA 3TOTA 4EDYA 4X0XA 4TW5A 4MPGA 2IMKA 1J08A 5D73A 4POLA 5J9CA 1KNGA 3UARA 4CY8A 3HA9A 1JZDA 1ZZYA 5C00A 4ECBA 1THOA 3DVWA 2CVBA 4D73A 4XCSA 22GSA 1B8XA 19GSA 2YJ7A 5DAKA 2H1BA 3AY8A 3C1RA 16GSA 2H66A 2X4AA 4O5RA 3L4NA 4POMA 4XHMA 3GYKA 2YJHA 3IOSA 4O32A 2YPMA 4NV5A 4EUYA 3LYKA 2B5EA 5HFIA 2QA2A 3LG6A 2YOIA 4OFTA 7GSSA 1RK4A 1V57A 5AIVA 5GZZB 2CZ3A 4X43A 3DEXA 1A8YA 1AQXA 3HDCA 3QCPA 4IW9A 1X9MB 4MH2A 4K9ZA 1O7UA 2NTOA 3GA4A 4JU5A 4JRRA 2GZYA 4PGTA 2L6DA 2K18A 4QL9A 4YQUA 5DDLA 2X49A 1SL0B 1CQGA 2GS3A 2L5LA 1T7PB 2PGTA 5D9WA 1BYEA 3BD2A 2AB6A 4G19A 1USBA 3L0HA 4HOJA 4TRXA 2AAWA 5J5NA 4K7NA 3GH9A 3LJRA 2P0GA 3F4RA 5ECRB 4F0BA 1SKSB 4K5SA 3EU3A 4PNGA 4J2FA 4OWYA 3O76A 4OCEA 1MDJA 1ACVA 3HY2A 4ZL9A 3F8UA 2CVDA 2CV4A 3H93A 2L5OA 1T4YA 2V6OA 1WRYA 3H1NA 1EGOA 2B5YA 4TXOB 3GFKA 1U6TA 2FWEA 5IM9A 5DQYA 1THXA 1Z6NA 1XFLA 1LBKA 2O85A 1QGVA 3CTFA 3FR3A 4Z2TA 3S9FA 3SBCA 4MF5A 2F51A 3FMWA 3IAS2 4BVXA 11GSA 2NVLA 4K1FA 4BA7A 2H73A 3EE2A 5KN2A 5IO2A 3EVIA 2HSMA 4WKWA 3HHVA 1MDIA 4KUNA 3I69A 4LL1B 4AF2A 2B3SA 4FO5A 1F37A 5AN1A 1SJ6A 4G2EA 1S3AA 2LJAA 3IK9A 3ZFBA 3GH6A 3I9V2 5AISA 2DSAA 4ZILA 2R4VA 4Q5RA 4GRFA 4K0GA 2FGXA 4DSSB 3GL5A 2N5BA 5DQSA 1XVWA 2CX3A 1YF1A 3GIXA 4P3YB 3TJFA 3GN3A 2JL4A 4ISDA 3P7XA 8GSSA 2YNXA 3ZMKA 1W4VA 4V1Ap 1NSWA 1SL2B 2WS2A 2PVOC 1WJKA 2HZEA 5IPGA 1EEMA 1V40A 2IMEA 2IMIA 3DKSA 5CP1A 1Y25A 4I6XA 3F3QA 3UBKA 2A4HA 2V2GA 3QDNA 3E9JB 1XWBA 1AUCA 2IMFA 2YANA 4RQXA 1ZYQB 2IFQA 1EV4A 5DALA 1M0UA 1QK8A 3J7Yk 4IN0A 3GRXA 5CYYA 1XXUA 2R5GA 4POKA 1JLWA 1V98A 4V1Ag 5BRTA 4F0CA 18GSA 3GSTA 4WF4A 4KF9A 2FWHA 4TOPA 1WP0A 2C3QA 5JWRB 2X8CA 5GAND 6GSTA 17GSA 2H19A 3GTUB 3VPTA 5ECIB 3EPTA 3FR9A 3CMIA 3M8NA 2QA1A 2K8SA 4MP4A 2BTOT 2OE1A 4GTUA 3KIJA 2GSSA 4G0KA 3VK9A 3TJJA 2TRXA 3DYRA 5IQYA 3N5OA 4PURA 3WGXA 2B1KA 5J41A 1IYIA 1OC9B 1Z7PA 3EU4A 2OADA 1UA5A 2F9SA 2IWTA 3TJGA 2JZSA 2DJKA 2A2SA 4K2XA 2B6MA 4DVCA 3RHCA 1YZXA 2NPBA 1AQVA 3E0UA 5A4UA 3VPQA 3GKXA 4HQZA 4EDZA 1M2BA 4I97A 1ZYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOF A;  1ST9 A;  2H0H A;  5IOW A;  2IIY A;  3GSS A;  2GLR A;  1G6Y A;  4KGI A;  2L6C A;  3ZFL A;  3HVS A;  2PVQ A;  5DVB A;  1IYH A;  14GS A;  3G9B A;  5H5S A;  5JCU A;  4WF5 A;  2LNT A;  4IKH A;  3U5R E;  3P2A A;  4IP1 A;  1I5G A;  3QAW A;  3QAV A;  1BQ7 A;  2EC4 A;  3BOA A;  5IO0 A;  1K0B A;  2H1A A;  2C0F A;  2H74 A;  2JSY A;  2V1M A;  2ZNM A;  2YP6 A;  4BPY A;  2GZZ A;  3BCI A;  4HI7 A;  3PR8 A;  1DBY A;  3GX8 A;  4RUV A;  4TR3 A;  3D6I A;  1GUL A;  1JLV A;  2XC2 A;  1HNA A;  2F3M A;  3UBL A;  2LKU A;  4KDU A;  2DJJ A;  5LD0 A;  4FYC A;  2PMT A;  1GNW A;  2CX4 A;  1HD2 A;  2FWG A;  5CRH A;  4V2N A;  3FYG A;  2YWN A;  2P31 A;  3TRP A;  1GUM A;  2LQQ A;  1TRU A;  1O85 A;  1X5D A;  2LUS A;  1T8E B;  4N10 A;  4K2D A;  1GRX A;  5G5F A;  5B8B A;  2GQM A;  4NHW A;  1DSB A;  3TOU A;  1ERU A;  2E2M A;  2YWO A;  2V41 A;  1K0M A;  1N8J A;  1K0O A;  3DXB A;  13GS A;  1JFU A;  2IPA A;  3ISO A;  4TKY A;  3DIE A;  2WJU A;  1TI1 A;  1PSQ A;  2LEG A;  1ML6 A;  2GSR A;  1OE7 A;  2C0G A;  5D9T A;  1GSU A;  1FOV A;  2GQK A;  5ID2 B;  2VCV A;  1TRW A;  2PBJ A;  2C80 A;  4IQ1 A;  2FNO A;  5E59 A;  3EMX A;  2AV4 A;  4J56 E;  4OMV A;  5B6M A;  5IMD A;  1PQN A;  5HFG A;  3TKR A;  2PPT A;  3WGD A;  1E2Y A;  4HU9 A;  1XCC A;  4WR4 A;  1UVZ A;  2IJY A;  2V32 A;  3MAK A;  3GNJ A;  1GLP A;  5G2Z A;  3UOM A;  1U3I A;  3E3E A;  1XPV A;  4XS4 B;  4LMV A;  1B4Q A;  4MPF A;  1R5P A;  3CSJ A;  2YWI A;  3FR6 A;  1TU8 A;  2XBQ A;  5ECO B;  1TP9 A;  1WMJ A;  3CSI A;  3LGC A;  1ZOF A;  3H8Q A;  4HQS A;  3UJ1 A;  3ERW A;  5H5R A;  2BJX A;  1VF2 A;  1F3B A;  4CDO A;  2FHE A;  4F9Z A;  4ZB9 A;  3P8W A;  3IRA A;  2VM1 A;  4KX4 A;  3RDW A;  3WD6 A;  4RI7 A;  2NBS A;  3TRX A;  5FWG A;  1GLQ A;  4CW9 A;  2ZCT A;  4EL1 A;  2N5F A;  3HKR A;  4PX1 A;  4TXO A;  1XZO A;  4MAB A;  4N0V A;  3LWA A;  4KND A;  2O8V B;  3APO A;  1OYJ A;  1RQM A;  1LJR A;  5LNK e;  2GQL A;  1M9B A;  2HSH A;  2HRF A;  3A2V A;  1J0F A;  1FO5 A;  5GST A;  1FVK A;  2H76 A;  1ZGN A;  3KTL A;  4BL7 A;  5IMV A;  2CT6 A;  1O8W A;  2C0D A;  4PQH A;  5ECN B;  5DJM A;  2K8V A;  1XWC A;  4GCI A;  4KA0 A;  1R5A A;  5A4W A;  5B8A A;  1MD4 A;  1G0T A;  1A0F A;  3TGZ A;  1EEJ A;  2HI7 A;  4EE0 A;  2BMX A;  3KMN A;  10GS A;  2RUF A;  3NOF A;  4IP6 A;  3UAP A;  2KP2 A;  4HS1 A;  2HZF A;  2VD1 A;  2VL9 A;  3Q19 A;  1I9D A;  5L71 A;  3D22 A;  1Y6E A;  2RLI A;  1U87 A;  3ERG A;  4NXI A;  4DSS A;  3LXT A;  3DGQ A;  3F4S A;  1R7H A;  3FZ9 A;  1FG4 A;  2M72 A;  2C4J A;  4MJE A;  3KD0 A;  2YCD A;  1F3A A;  2GT5 A;  4BWS A;  2ZUP A;  4ZXG A;  3LSZ A;  4MA9 A;  3ZIV A;  1SU9 A;  1B48 A;  3HZ8 A;  2FA8 A;  2O7K A;  3EWL A;  1SKW B;  5ECM B;  2A4V A;  3FZA A;  1AXD A;  4FIW A;  1PX6 A;  3HYP A;  4JBB A;  1GSE A;  1O81 A;  1X0R A;  4WET A;  4MF7 A;  2ES7 A;  1GSS A;  1GSY A;  20GS A;  3H4K A;  2H70 A;  4F82 A;  1BX9 A;  1TDI A;  5JCW A;  4AJ6 A;  1FAA A;  1GL8 A;  3KXO A;  1GSF A;  3H79 A;  5E4W A;  2AUV A;  2HSY A;  3O6T A;  1F2E A;  3FZ5 A;  4D73 B;  2FA4 A;  1DUG A;  2AHE A;  1A2L A;  3L9V A;  5DAK B;  2PUK C;  4LLR A;  3BJ5 A;  1XW6 A;  1C72 A;  4MZW A;  3Q6O A;  2L59 A;  1PD2 1;  1SKR B;  6GSU A;  3GTU A;  5CAX A;  2LST A;  1WE0 A;  3QFB C;  3KP8 A;  1MD3 A;  3HVX A;  4IEL A;  4H86 A;  2MBT A;  5IOX A;  4LA1 A;  1X9W B;  12GS A;  5DCH A;  4IBP A;  1YKA A;  5JWQ B;  1OKD A;  4POB A;  2VO4 A;  2H01 A;  2YZH A;  4LL4 B;  1EOG A;  5ECP B;  1X5C A;  1KTE A;  4IGJ A;  1YJ6 A;  3I43 A;  3UMA A;  5AGY A;  5DCG A;  3W8S A;  2VLU A;  3WGE A;  1BJX A;  2WGR A;  1EZK A;  4CHS A;  2DJ1 A;  4TXV A;  3F6D A;  3LFL A;  5EVO A;  2MMO A;  3KH9 A;  5HR2 A;  2X8G A;  5HQP A;  1VF1 A;  6GSX A;  4DSQ A;  3EUR A;  4MDC A;  3HJP A;  4L0U A;  1K0A A;  4BWQ A;  4PNF A;  3EIN A;  2X8H A;  2F8F A;  1OKT A;  2YWM A;  1QMV A;  5CRW A;  4MJA A;  3P90 A;  2K6V A;  1HNB A;  2JAD A;  1G6W A;  4KCA A;  5CRD A;  2R3X A;  4KW6 A;  1YKC A;  2B7J A;  3LYP A;  3PH9 A;  2YN1 A;  3FZ4 A;  4KSO A;  2LRT A;  1SYR A;  1X5E A;  4NHZ A;  1XBS A;  4JR4 A;  2VM2 A;  2IL3 A;  1XW5 A;  3K8N A;  5G1L A;  1EGR A;  5F07 A;  5EL8 A;  4EC0 A;  1V9W A;  4ZL8 A;  4YAV A;  4EKZ A;  5IPH A;  1E6B A;  2HLS A;  5HFK A;  4MK3 A;  2RII A;  3L9U A;  3ZVJ A;  5D96 A;  1ERW A;  3C7M A;  4QL7 A;  2FWF A;  1Z6M A;  4V2L A;  4MLY A;  3QR6 A;  1QFN A;  5ELA A;  2XBI A;  3GX0 A;  2MZC A;  3DWV A;  5KN3 A;  4NWY A;  3SWL A;  4MZB A;  5FT3 A;  3FK8 A;  3D21 A;  3GUS A;  2R37 A;  3UL3 A;  5A4V A;  1TW9 A;  2VLT A;  2RM6 A;  5ID2 A;  1H75 A;  2L4C A;  4EVM A;  4ILF A;  2AYT A;  3ZML A;  2O89 A;  5DAL B;  2QSI A;  3C1S A;  2GZP A;  4KE3 A;  4ULX A;  2OAC A;  3F6F A;  2DJ2 A;  3ERF A;  3G7J A;  4TR4 A;  3CBU A;  2CAQ A;  3VUR A;  2JZR A;  2DLX A;  2KHP A;  5D93 A;  4OD7 A;  4XIH A;  1ILO A;  3KTB A;  4XS1 A;  2PN8 A;  5G1K A;  4KSM A;  4IJI A;  1A2J A;  1A2M A;  1PL2 A;  1GUK A;  1R26 A;  1M2A A;  3JCM L;  4XS4 A;  2LQO A;  5IIZ A;  2GST A;  6GSV A;  2I81 A;  4GST A;  4WXT A;  3VI5 A;  3KCM A;  3TJK A;  1XWA A;  4K8M A;  5J4U A;  4ZL7 A;  1T4Z A;  4IJ3 A;  3US3 A;  1SEN A;  2VLV A;  3GMF A;  2KOK A;  4F03 A;  5HR0 A;  4ACS A;  4ID0 A;  5ECL B;  1F9M A;  1GSD A;  3F3R A;  2WZ9 A;  2H1G A;  2DML A;  2Z9S A;  2A2R A;  4GLT A;  1ZL9 A;  3NZN A;  4YAP A;  3Q18 A;  1FB0 A;  2MYG A;  3M0F A;  1G7O A;  1A0R P;  1SK1 A;  1QQ2 A;  1KEB A;  4XTS A;  1Z3E A;  1SK2 A;  1PA3 A;  1FB6 A;  2VD0 A;  3TKQ A;  1OAZ A;  2YV7 A;  5KN1 A;  1T1V A;  3ZIJ A;  1LU4 A;  4HZ2 A;  5B6N A;  2C1Y A;  2WB9 A;  5DBQ A;  4MMM A;  1HNC A;  2H75 A;  5COH A;  3WT2 A;  1O73 A;  4IQA A;  5EY6 A;  2IN3 A;  4OFN A;  4LMW A;  5F8B A;  1ZCP A;  2P5Q A;  2H6Y A;  3DML A;  3IXR A;  1TRV A;  2JZT A;  1CQH A;  1VF3 A;  2ON5 A;  2J9H A;  3RPN A;  3ME7 A;  3GUR A;  2I3Y A;  2R2J A;  1ERV A;  2CAI A;  1G7E A;  4IHU A;  3D4T A;  4E8E A;  2K9F A;  3TKS C;  4IVF A;  1K0N A;  4ZB8 A;  2WUL A;  1XOB A;  4KDY A;  3EMP A;  3L78 A;  3DRN A;  1YEX A;  2L57 A;  2M80 A;  2H72 A;  2OJL A;  2REM A;  1A23 A;  3C71 A;  1SYX A;  4Z7X A;  6GSW A;  3TKS A;  3M9J A;  4MJC A;  3A2X A;  1PKW A;  2D2Z A;  5IMF A;  3MSZ A;  1NM3 A;  1SL1 B;  3D5J A;  1H4O A;  1Z9H A;  1YEP A;  1ZYE A;  4ML6 A;  2B1L A;  2MMA A;  1TK8 B;  3TUE A;  1GTB A;  2G0F A;  1GUH A;  2HE3 A;  2OA7 A;  4PUA A;  1Q98 A;  2DIZ A;  5ABR A;  4ECI A;  4MZC A;  2OE3 A;  2OBI A;  1NHO A;  2VUP A;  1BED A;  2V6K A;  3W6G A;  1XVQ A;  4O92 A;  1U88 A;  3FY7 A;  4G9H A;  1TKD B;  4KAE A;  3F4T A;  1BG5 A;  1PMT A;  3VWX A;  4XS6 A;  3ZYW A;  4TR1 B;  2QKE A;  4MJB A;  2KP1 A;  1WIK A;  1TK5 B;  4ECC A;  4FYB A;  2NDO A;  1GTI A;  2VCZ A;  1AW9 A;  3ME8 A;  3IPZ A;  2RM5 A;  4MCU A;  4NPB A;  3KP9 A;  4K7I A;  2ALB A;  3PGT A;  1WOU A;  1ON4 A;  3CTG A;  3DD3 A;  1TRS A;  3M1G A;  5IMZ A;  1XWG A;  4NV2 A;  1J9B A;  2FUG 2;  3EYT A;  3UIW A;  1URM A;  1V58 A;  1M9A A;  1ERT A;  2VOC A;  4L5L A;  2E7P A;  4PQ1 A;  3TKS E;  1AC1 A;  1A8L A;  3RHB A;  4Q5N A;  3MDK A;  5B7C A;  1S3C A;  4WBR D;  4KDX A;  1B9Y C;  2CQ9 A;  3QPM A;  2PWJ A;  3A3T A;  1GNE A;  3APQ A;  3CSH A;  1TJD A;  5CRG A;  5J9B A;  1X9S B;  1JZO A;  3IBH A;  2GSQ A;  2H8L A;  1DE2 A;  1DE1 A;  2XPE A;  4OFM A;  3IC4 A;  5D9X A;  3IR4 A;  1AAZ A;  2KUC A;  3EC3 A;  3DVX A;  1GTU A;  1PX7 A;  4DEJ A;  3KMO A;  4GSN A;  1QXH A;  1U3A A;  5F0G A;  1GP1 A;  1HYU A;  2C0E A;  2VCT A;  2JU5 A;  5D8I A;  2VL3 A;  1PL1 A;  1M99 A;  3PIN A;  1A24 A;  3F9U A;  5C04 A;  4HDE A;  5ECQ B;  2KLX A;  1BAY A;  2H30 A;  3U6V A;  4Q5F A;  4G10 A;  4I8B A;  1JHB A;  6GSS A;  3Q74 A;  2H1D A;  2N5A A;  2EIR A;  3N9J A;  1QUW A;  3ZZX A;  2X64 A;  3TDG A;  3CRU A;  3HVV A;  4HU7 A;  3ED3 A;  4ZBA A;  2YV9 A;  4HJ2 A;  2H0G A;  3TRQ A;  4J57 E;  3QMX A;  2GGT A;  3TB2 A;  3IK7 A;  3V1W A;  1F6M C;  1M2D A;  2WRT A;  2JAC A;  4FH8 A;  2HNL A;  3IE3 A;  4N30 A;  1K3Y A;  3LEF A;  2L4Q A;  5GSS A;  2LJR A;  5ECS A;  3HD5 A;  4QQ7 A;  1MDK A;  1O6J A;  2H71 A;  3GKN A;  1YY7 A;  4KCE A;  3MNG A;  2ON7 A;  1B4P A;  3C8E A;  4RQR A;  2TRC P;  1OC9 A;  2LRC A;  1KBN A;  2H0I A;  1PKZ A;  4HZ4 A;  4GF0 A;  1AQW A;  2LS5 A;  4F2I A;  2DJ3 A;  2G2Q A;  1TTZ A;  4EF0 A;  1OC3 A;  1GSQ A;  2O87 A;  4V2M A;  1S3D A;  4TVE A;  3R2Q A;  4JR6 A;  1ZMA A;  5IMA A;  4YQM A;  4JED A;  5HR1 A;  4EXJ A;  1MTC A;  4WBJ A;  1XW9 A;  4DSR A;  2CVK A;  3GKK A;  4ZBD A;  2LNS A;  6GSY A;  4JE1 A;  3HZ4 A;  2OKA A;  3D4M A;  5CO3 A;  2MBS A;  3QD9 A;  3FW2 A;  3ZL5 A;  1NW2 A;  2VCX A;  3TCO A;  4NMU A;  2HFD A;  5G5E A;  2EIQ A;  5ELG A;  4K0N A;  3LQ7 A;  4HEA 2;  2E2G A;  3HJO A;  4ZBB A;  1VGL A;  1XWK A;  4WEY A;  2TIR A;  3OR5 A;  3G7Y A;  4N11 A;  1FHE A;  4GSS A;  4GQC A;  3VLN A;  5ECH B;  2QGV A;  4HJM A;  1TXX A;  2H6X A;  3M3M A;  9GSS A;  3ZRE A;  1UC7 A;  1XOA A;  3C73 A;  4L8E A;  2P5R A;  4AJ8 A;  4OO4 A;  1YQ1 A;  2M46 A;  3F63 A;  3IV4 A;  3WYW A;  4K7O A;  2HT9 A;  4K6X A;  3HJM A;  1Z7R A;  2JSZ A;  2GT6 A;  4ZB6 A;  1O8X A;  1RW1 A;  1V2A A;  5FHI A;  3FHK A;  1GWC A;  2FCH A;  3A2W A;  4AGS A;  2MMZ A;  5INY A;  2FY6 A;  2I4A A;  4L0W A;  3RBT A;  3UEM A;  3ZRD A;  5ENU A;  1AIU A;  2CZ2 A;  2LV3 A;  5JWO B;  1VRS D;  2LJK A;  3CXG A;  3GKM A;  2HRN A;  4AJ7 A;  1OE8 A;  1NHY A;  2GTU A;  2YZU A;  1SD8 A;  3KEB A;  3LOR A;  3VWW A;  4PUF C;  3IA1 A;  1YDK A;  2VAF A;  4FYU A;  1EWX A;  4BVY A;  2DMM A;  2C8U A;  4JZQ A;  2HZE B;  3O3T A;  3J7Y b;  4PQI A;  3L9S A;  5AIX A;  1SK0 A;  3HCZ A;  4KB3 A;  2E0Q A;  2R6K A;  2C3N A;  4X1U A;  2HXK A;  4I2U A;  4EO3 A;  3G7I A;  3TJB A;  4MH3 A;  2DIY A;  5LCZ A;  5CRE A;  1T3B A;  2DJ0 A;  3QFA C;  2IFQ B;  3GL3 A;  3RAZ A;  1EP7 A;  1K0D A;  1VF4 A;  1T00 A;  1EP8 A;  5G31 A;  5F05 A;  3A5W A;  2F8A A;  2CA8 A;  2WFC A;  5GAP D;  2XHF A;  5DJL A;  3I6A A;  1MEK A;  4L5O A;  1EV9 A;  5CNW A;  3IHQ A;  2J23 A;  3VI7 A;  1N2A A;  4PXO A;  1K0C A;  2B7K A;  1XIY A;  3M9K A;  3ZIT A;  1Q4J A;  5H5Q A;  2C3T A;  4I5Q A;  1W89 A;  4GWR A;  3TKP A;  2PER A;  4Q5Q A;  1JZR A;  2XPD A;  1OC8 A;  4I2T A;  1TU7 A;  4E8H A;  3KGK A;  1GH2 A;  4ZIJ A;  2PU9 C;  3GV1 A;  2LRN A;  5KN0 A;  5G30 A;  2OE0 A;  3VWV A;  2GDR A;  2LTK A;  4XRA A;  4O7H A;  2OBK A;  2DC5 A;  5D9V A;  5EPF A;  2QC7 A;  3QOU A;  4YH2 A;  2VCQ A;  3RPP A;  1OVN A;  3NIV A;  3UVH A;  3KZQ A;  1TI3 A;  5F06 A;  2B5X A;  1WPI A;  1JZW A;  1GTA A;  5IMC A;  3VWU A;  5HR3 A;  4WR5 A;  3IDV A;  3KM6 A;  1Z5Y E;  1SJI A;  4OCF A;  2GVP A;  2VCW A;  1FVJ A;  2RUE A;  4TR1 A;  2AJQ B;  2X99 A;  1ABA A;  4OO5 A;  1B9X C;  4NAX A;  1K3L A;  3KJY A;  3WT1 A;  1FW1 A;  3W8J A;  3FEU A;  3ZTL A;  3ZVJ D;  3VFI A;  2H6Z A;  1R4W A;  1PGT A;  2VIM A;  5A5K A;  2FLS A;  4ML1 A;  3GHA A;  5KEJ A;  3LXZ A;  4RI6 A;  1YF0 A;  3CRT A;  4GQF A;  1WWJ A;  2MMN A;  5ECK B;  1UN2 A;  5JCG A;  4N0Z A;  3FRC A;  2VL2 C;  1PRX A;  1EOH A;  2HYX A;  2I1U A;  2EIO A;  3F0I A;  2IMD A;  4XRD A;  1TK0 B;  4MF6 A;  3KH7 A;  4YQV A;  3MWH A;  4HUA A;  2I9H A;  2FD3 A;  4TR0 A;  2VL2 A;  5J3R A;  3BBY A;  4TN8 A;  4IS0 A;  3IAM 2;  1K3O A;  3ZLP A;  3CYN A;  1SD9 A;  4KH7 A;  3HXS A;  3APS A;  1PN9 A;  2WCI A;  4GXZ A;  3QAG A;  4ECJ A;  3BCK A;  2WDU A;  1M7T A;  1HQO A;  2DBC A;  3D0Z A;  3UVT A;  1SJZ A;  3FKF A;  3TOT A;  4EDY A;  4X0X A;  4TW5 A;  4MPG A;  2IMK A;  1J08 A;  5D73 A;  4POL A;  5J9C A;  1KNG A;  3UAR A;  3HA9 A;  1JZD A;  1ZZY A;  5C00 A;  4ECB A;  1THO A;  3DVW A;  2CVB A;  4D73 A;  4XCS A;  22GS A;  1B8X A;  19GS A;  2YJ7 A;  5DAK A;  2H1B A;  3AY8 A;  3C1R A;  16GS A;  2H66 A;  4O5R A;  3L4N A;  4POM A;  4XHM A;  3GYK A;  2YJH A;  3IOS A;  4O32 A;  2YPM A;  4NV5 A;  4EUY A;  3LYK A;  2B5E A;  5HFI A;  3LG6 A;  2YOI A;  4OFT A;  7GSS A;  1RK4 A;  1V57 A;  5AIV A;  5GZZ B;  2CZ3 A;  4X43 A;  3DEX A;  1A8Y A;  1AQX A;  3HDC A;  3QCP A;  4IW9 A;  1X9M B;  4MH2 A;  4K9Z A;  1O7U A;  2NTO A;  3GA4 A;  4JU5 A;  4JRR A;  2GZY A;  4PGT A;  2L6D A;  2K18 A;  4QL9 A;  4YQU A;  5DDL A;  1SL0 B;  1CQG A;  2GS3 A;  2L5L A;  1T7P B;  2PGT A;  5D9W A;  1BYE A;  3BD2 A;  2AB6 A;  4G19 A;  1USB A;  3L0H A;  4HOJ A;  4TRX A;  2AAW A;  5J5N A;  4K7N A;  3GH9 A;  3LJR A;  2P0G A;  3F4R A;  5ECR B;  4F0B A;  1SKS B;  3EU3 A;  4PNG A;  4J2F A;  4OWY A;  3O76 A;  4OCE A;  1MDJ A;  1ACV A;  3HY2 A;  4ZL9 A;  3F8U A;  2CVD A;  2CV4 A;  3H93 A;  2L5O A;  1T4Y A;  2V6O A;  1WRY A;  3H1N A;  1EGO A;  2B5Y A;  4TXO B;  3GFK A;  1U6T A;  2FWE A;  5IM9 A;  5DQY A;  1THX A;  1Z6N A;  1XFL A;  1LBK A;  2O85 A;  1QGV A;  3CTF A;  3FR3 A;  3S9F A;  3SBC A;  4MF5 A;  2F51 A;  3IAS 2;  4BVX A;  11GS A;  2NVL A;  4K1F A;  4BA7 A;  2H73 A;  3EE2 A;  5KN2 A;  5IO2 A;  3EVI A;  4WKW A;  3HHV A;  1MDI A;  4KUN A;  3I69 A;  4LL1 B;  4AF2 A;  2B3S A;  4FO5 A;  1F37 A;  5AN1 A;  1SJ6 A;  4G2E A;  1S3A A;  2LJA A;  3IK9 A;  3ZFB A;  3GH6 A;  3I9V 2;  5AIS A;  2DSA A;  4ZIL A;  2R4V A;  4Q5R A;  4GRF A;  4K0G A;  2FGX A;  4DSS B;  3GL5 A;  2N5B A;  5DQS A;  1XVW A;  2CX3 A;  1YF1 A;  3GIX A;  4P3Y B;  3TJF A;  3GN3 A;  2JL4 A;  4ISD A;  3P7X A;  8GSS A;  2YNX A;  3ZMK A;  1W4V A;  4V1A p;  1NSW A;  1SL2 B;  2WS2 A;  2PVO C;  1WJK A;  2HZE A;  5IPG A;  1EEM A;  1V40 A;  2IME A;  2IMI A;  3DKS A;  5CP1 A;  1Y25 A;  4I6X A;  3F3Q A;  3UBK A;  2V2G A;  3QDN A;  3E9J B;  1XWB A;  1AUC A;  2IMF A;  2YAN A;  4RQX A;  1ZYQ B;  2IFQ A;  1EV4 A;  5DAL A;  1M0U A;  1QK8 A;  3J7Y k;  4IN0 A;  3GRX A;  5CYY A;  1XXU A;  2R5G A;  4POK A;  1JLW A;  1V98 A;  4V1A g;  4F0C A;  18GS A;  3GST A;  4WF4 A;  2FWH A;  4TOP A;  1WP0 A;  2C3Q A;  5JWR B;  2X8C A;  5GAN D;  6GST A;  17GS A;  2H19 A;  3GTU B;  3VPT A;  5ECI B;  3FR9 A;  3CMI A;  3M8N A;  2K8S A;  4MP4 A;  2BTO T;  2OE1 A;  4GTU A;  3KIJ A;  2GSS A;  3VK9 A;  3TJJ A;  2TRX A;  3DYR A;  5IQY A;  3N5O A;  4PUR A;  3WGX A;  2B1K A;  5J41 A;  1IYI A;  1OC9 B;  1Z7P A;  3EU4 A;  2OAD A;  1UA5 A;  2F9S A;  2IWT A;  3TJG A;  2JZS A;  2DJK A;  2A2S A;  2B6M A;  4DVC A;  3RHC A;  1YZX A;  2NPB A;  1AQV A;  3E0U A;  5A4U A;  3VPQ A;  3GKX A;  4HQZ A;  4EDZ A;  1M2B A;  4I97 A; 
#chains in the Genus database with same CATH topology
 1TOF A;  1ST9 A;  2H0H A;  5IOW A;  2IIY A;  3GSS A;  2GLR A;  1G6Y A;  4KGI A;  1PN0 A;  2L6C A;  3ZFL A;  4FQU A;  3HVS A;  2PVQ A;  5DVB A;  1IYH A;  14GS A;  3G9B A;  5H5S A;  5JCU A;  4WF5 A;  2LNT A;  4IKH A;  3U5R E;  3P2A A;  4IP1 A;  1I5G A;  3QAW A;  3QAV A;  1BQ7 A;  2EC4 A;  3BOA A;  5IO0 A;  1K0B A;  2H1A A;  1PFO A;  2C0F A;  2H74 A;  2JSY A;  2V1M A;  2ZNM A;  2YP6 A;  4BPY A;  2GZZ A;  3BCI A;  4HI7 A;  3PR8 A;  1DBY A;  3GX8 A;  1ZYN A;  4RUV A;  4TR3 A;  3D6I A;  1GUL A;  1JLV A;  2XC2 A;  1HNA A;  2F3M A;  3UBL A;  2LKU A;  4KDU A;  2DJJ A;  5LD0 A;  4FYC A;  2PMT A;  1GNW A;  2CX4 A;  1HD2 A;  2FWG A;  5CRH A;  4V2N A;  3FYG A;  2YWN A;  2P31 A;  3TRP A;  1GUM A;  2LQQ A;  1TRU A;  1O85 A;  1X5D A;  2LUS A;  1T8E B;  4N10 A;  4K2D A;  1GRX A;  5G5F A;  5B8B A;  2GQM A;  4ICY A;  4NHW A;  1DSB A;  3TOU A;  4BVY B;  1ERU A;  2E2M A;  2YWO A;  2V41 A;  1K0M A;  1N8J A;  1K0O A;  3DXB A;  13GS A;  1JFU A;  2IPA A;  3ISO A;  4TKY A;  3DIE A;  1FOH A;  2WJU A;  1TI1 A;  1PSQ A;  2LEG A;  1ML6 A;  2GSR A;  1OE7 A;  2C0G A;  5D9T A;  1GSU A;  4BIK A;  1FOV A;  2GQK A;  5ID2 B;  2VCV A;  1TRW A;  2PBJ A;  2C80 A;  4IQ1 A;  2FNO A;  5E59 A;  3EMX A;  2AV4 A;  4J56 E;  4OMV A;  5B6M A;  5IMD A;  1PQN A;  5HFG A;  3TKR A;  2PPT A;  3WGD A;  1E2Y A;  4HU9 A;  1XCC A;  4WR4 A;  1UVZ A;  2IJY A;  2V32 A;  3MAK A;  3GNJ A;  1GLP A;  5G2Z A;  3UOM A;  1U3I A;  3E3E A;  1XPV A;  4XS4 B;  4LMV A;  1B4Q A;  4MPF A;  1R5P A;  3CSJ A;  2YWI A;  3FR6 A;  1TU8 A;  2XBQ A;  5ECO B;  1TP9 A;  1WMJ A;  3CSI A;  3LGC A;  1ZOF A;  3H8Q A;  4HQS A;  3UJ1 A;  3ERW A;  5H5R A;  2BJX A;  1VF2 A;  1F3B A;  4CDO A;  2FHE A;  4F9Z A;  4ZB9 A;  1S3R A;  3P8W A;  4CY6 A;  3IRA A;  2VM1 A;  4KX4 A;  3RDW A;  3WD6 A;  4RI7 A;  2NBS A;  3TRX A;  5FWG A;  1GLQ A;  4CW9 A;  2ZCT A;  4EL1 A;  2N5F A;  3HKR A;  4PX1 A;  4TXO A;  1XZO A;  4MAB A;  4N0V A;  3LWA A;  4KND A;  2O8V B;  3APO A;  1OYJ A;  1RQM A;  1LJR A;  5LNK e;  2GQL A;  1M9B A;  2HSH A;  2HRF A;  3A2V A;  1J0F A;  1FO5 A;  5GST A;  1FVK A;  2H76 A;  3IC8 A;  1ZGN A;  3KTL A;  4X4J A;  4BL7 A;  5IMV A;  2CT6 A;  1O8W A;  2C0D A;  4PQH A;  5ECN B;  5DJM A;  2K8V A;  1XWC A;  4GCI A;  4KA0 A;  1R5A A;  5A4W A;  5B8A A;  3MIX A;  1MD4 A;  1G0T A;  1A0F A;  3TGZ A;  1EEJ A;  2HI7 A;  4EE0 A;  2BMX A;  3KMN A;  4O5U A;  10GS A;  2RUF A;  3NOF A;  4IP6 A;  3UAP A;  2KP2 A;  4HS1 A;  2HZF A;  2VD1 A;  2VL9 A;  3Q19 A;  1I9D A;  5L71 A;  3D22 A;  1Y6E A;  2RLI A;  1U87 A;  3ERG A;  4NXI A;  4DSS A;  3LXT A;  3DGQ A;  3F4S A;  1R7H A;  3FZ9 A;  1FG4 A;  2M72 A;  4MNN A;  2C4J A;  4MJE A;  3KD0 A;  2YCD A;  1F3A A;  2GT5 A;  4BWS A;  2ZUP A;  4ZXG A;  3LSZ A;  4MA9 A;  3ZIV A;  1SU9 A;  1B48 A;  3HZ8 A;  2FA8 A;  2O7K A;  4Z2U A;  3EWL A;  1SKW B;  5ECM B;  2A4V A;  3FZA A;  1AXD A;  4FIW A;  1PX6 A;  3HYP A;  4JBB A;  1GSE A;  1O81 A;  1X0R A;  4WET A;  4MF7 A;  5KOW A;  2ES7 A;  1GSS A;  1GSY A;  20GS A;  2DKI A;  3H4K A;  2H70 A;  4F82 A;  1BX9 A;  1TDI A;  5JCW A;  4AJ6 A;  1FAA A;  1GL8 A;  3KXO A;  1GSF A;  3H79 A;  5E4W A;  2AUV A;  2HSY A;  4YKF A;  3O6T A;  1F2E A;  3FZ5 A;  4D73 B;  2FA4 A;  1DUG A;  2AHE A;  1A2L A;  3L9V A;  2UZ8 A;  5DAK B;  2PUK C;  4LLR A;  3BJ5 A;  1XW6 A;  1C72 A;  4MZW A;  3Q6O A;  2L59 A;  1PD2 1;  1SKR B;  6GSU A;  3GTU A;  5CAX A;  2LST A;  1WE0 A;  3QFB C;  3KP8 A;  1MD3 A;  3HVX A;  4IEL A;  4H86 A;  2MBT A;  5IOX A;  4LA1 A;  1X9W B;  12GS A;  5DCH A;  4IBP A;  1YKA A;  5JWQ B;  1OKD A;  4POB A;  2VO4 A;  2H01 A;  2YZH A;  4LL4 B;  1EOG A;  5ECP B;  1X5C A;  1KTE A;  4IGJ A;  1YJ6 A;  3I43 A;  3UMA A;  5AGY A;  5DCG A;  3W8S A;  2VLU A;  3WGE A;  1BJX A;  2WGR A;  1EZK A;  4CHS A;  2DJ1 A;  4TXV A;  3F6D A;  3LFL A;  5EVO A;  2MMO A;  3KH9 A;  5HR2 A;  2X8G A;  5HQP A;  1VF1 A;  6GSX A;  4DSQ A;  3EUR A;  4MDC A;  3HJP A;  4L0U A;  1K0A A;  4BWQ A;  4PNF A;  3EIN A;  2X8H A;  2F8F A;  1OKT A;  2YWM A;  1QMV A;  5CRW A;  4Z2R A;  4MJA A;  3P90 A;  2K6V A;  1HNB A;  2JAD A;  1G6W A;  4KCA A;  5CRD A;  2R3X A;  4KW6 A;  1YKC A;  2B7J A;  3LYP A;  3PH9 A;  2YN1 A;  3FZ4 A;  4KSO A;  2LRT A;  1SYR A;  1X5E A;  4NHZ A;  1XBS A;  4JR4 A;  3R3E A;  2VM2 A;  2IL3 A;  1XW5 A;  3K8N A;  5G1L A;  1EGR A;  5F07 A;  5EL8 A;  4EC0 A;  1V9W A;  4ZL8 A;  4YAV A;  4EKZ A;  5IPH A;  1E6B A;  2HLS A;  5HFK A;  4MK3 A;  2RII A;  3L9U A;  3ZVJ A;  5D96 A;  1ERW A;  3C7M A;  4QL7 A;  2FWF A;  1Z6M A;  4V2L A;  2R0G A;  4MLY A;  3QR6 A;  1QFN A;  5ELA A;  2XBI A;  3GX0 A;  2MZC A;  3DWV A;  5KN3 A;  4NWY A;  3SWL A;  3HVN A;  4MZB A;  5FT3 A;  3FK8 A;  3D21 A;  3GUS A;  2R37 A;  3UL3 A;  5A4V A;  1TW9 A;  2VLT A;  2RM6 A;  5ID2 A;  1H75 A;  2L4C A;  4EVM A;  4ILF A;  2AYT A;  3ZML A;  2O89 A;  5DAL B;  2QSI A;  3C1S A;  2GZP A;  4KE3 A;  4ULX A;  2OAC A;  3F6F A;  2DJ2 A;  3ERF A;  3G7J A;  4TR4 A;  3CBU A;  2CAQ A;  3VUR A;  2JZR A;  2DLX A;  2KHP A;  5D93 A;  4OD7 A;  4XIH A;  1ILO A;  3KTB A;  4XS1 A;  2PN8 A;  5G1K A;  4KSM A;  4IJI A;  1A2J A;  1A2M A;  1PL2 A;  1GUK A;  1R26 A;  1M2A A;  3JCM L;  4XS4 A;  2LQO A;  5IIZ A;  2GST A;  6GSV A;  2I81 A;  4GST A;  4WXT A;  3VI5 A;  3KCM A;  3TJK A;  1XWA A;  4K8M A;  5J4U A;  4ZL7 A;  1T4Z A;  4IJ3 A;  3US3 A;  1SEN A;  2VLV A;  3GMF A;  2KOK A;  4F03 A;  5HR0 A;  4ACS A;  4ID0 A;  5ECL B;  1F9M A;  1GSD A;  3F3R A;  2WZ9 A;  2H1G A;  2DML A;  2Z9S A;  2A2R A;  4GLT A;  1ZL9 A;  3NZN A;  4YAP A;  3Q18 A;  1FB0 A;  2MYG A;  3M0F A;  1G7O A;  1A0R P;  1SK1 A;  1QQ2 A;  1KEB A;  2DKH A;  1Z3E A;  4XTS A;  1SK2 A;  1PA3 A;  1FB6 A;  2VD0 A;  3TKQ A;  1OAZ A;  2YV7 A;  5KN1 A;  1T1V A;  3ZIJ A;  1LU4 A;  4HZ2 A;  5B6N A;  2C1Y A;  2WB9 A;  5DBQ A;  4MMM A;  1HNC A;  2H75 A;  5COH A;  3WT2 A;  1O73 A;  4IQA A;  5EY6 A;  2IN3 A;  4OFN A;  4LMW A;  5F8B A;  1ZCP A;  2P5Q A;  2H6Y A;  3DML A;  2A2P A;  3IXR A;  1TRV A;  2JZT A;  1CQH A;  3IHG A;  1VF3 A;  2ON5 A;  2J9H A;  3RPN A;  3ME7 A;  3GUR A;  2I3Y A;  2R2J A;  1ERV A;  1M3J A;  2CAI A;  1G7E A;  4IHU A;  3D4T A;  4E8E A;  2K9F A;  3TKS C;  4IVF A;  1K0N A;  4ZB8 A;  2WUL A;  1XOB A;  4KDY A;  3EMP A;  3L78 A;  3DRN A;  1YEX A;  2L57 A;  2M80 A;  2H72 A;  2OJL A;  2REM A;  3MYD A;  1A23 A;  3C71 A;  1SYX A;  4Z7X A;  6GSW A;  3TKS A;  3M9J A;  4MJC A;  3A2X A;  1PKW A;  2D2Z A;  5IMF A;  3MSZ A;  1NM3 A;  1SL1 B;  3D5J A;  1H4O A;  1Z9H A;  1YEP A;  1ZYE A;  4ML6 A;  2B1L A;  2MMA A;  1TK8 B;  3TUE A;  1GTB A;  2G0F A;  1GUH A;  2HE3 A;  2OA7 A;  4PUA A;  1Q98 A;  2DIZ A;  5ABR A;  4ECI A;  4MZC A;  2OE3 A;  2OBI A;  1NHO A;  2VUP A;  1BED A;  2V6K A;  3W6G A;  1XVQ A;  4O92 A;  1U88 A;  3FY7 A;  4G9H A;  1TKD B;  4KAE A;  3F4T A;  1BG5 A;  1PMT A;  3VWX A;  4XS6 A;  3ZYW A;  4TR1 B;  2QKE A;  4MJB A;  2KP1 A;  1WIK A;  1TK5 B;  4ECC A;  4FYB A;  2NDO A;  1GTI A;  2VCZ A;  1AW9 A;  3ME8 A;  3IPZ A;  2RM5 A;  4MCU A;  4NPB A;  3KP9 A;  4K7I A;  2ALB A;  3PGT A;  5BMU A;  1WOU A;  1ON4 A;  3CTG A;  3DD3 A;  1TRS A;  3M1G A;  5IMZ A;  1XWG A;  4NV2 A;  1J9B A;  2FUG 2;  3EYT A;  3UIW A;  2R0C A;  1URM A;  1V58 A;  1M9A A;  1ERT A;  2VOC A;  4L5L A;  2E7P A;  4PQ1 A;  3TKS E;  1AC1 A;  1A8L A;  3RHB A;  4Q5N A;  3MDK A;  5B7C A;  1S3C A;  4WBR D;  4KDX A;  1B9Y C;  2CQ9 A;  3QPM A;  2PWJ A;  3A3T A;  1GNE A;  3APQ A;  3CSH A;  1TJD A;  5KOX A;  5CRG A;  5J9B A;  1X9S B;  1JZO A;  3IBH A;  2GSQ A;  2H8L A;  1DE2 A;  1DE1 A;  2XPE A;  4OFM A;  3IC4 A;  5D9X A;  3IR4 A;  1AAZ A;  2KUC A;  3EC3 A;  3DVX A;  4EIP A;  1GTU A;  1PX7 A;  4DEJ A;  3KMO A;  4GSN A;  1QXH A;  1U3A A;  5F0G A;  1GP1 A;  1HYU A;  2C0E A;  2VCT A;  2JU5 A;  5D8I A;  2VL3 A;  1PL1 A;  1M99 A;  3PIN A;  1A24 A;  3F9U A;  5C04 A;  4HDE A;  3CQF A;  5ECQ B;  2KLX A;  1BAY A;  2H30 A;  3U6V A;  4Q5F A;  4G10 A;  4I8B A;  1JHB A;  6GSS A;  3Q74 A;  2H1D A;  2N5A A;  2EIR A;  3N9J A;  1QUW A;  4BL7 B;  3ZZX A;  2X64 A;  3TDG A;  3CRU A;  3HVV A;  4HU7 A;  3ED3 A;  4ZBA A;  2YV9 A;  4HJ2 A;  2H0G A;  3TRQ A;  4J57 E;  3QMX A;  2GGT A;  3TB2 A;  3IK7 A;  3V1W A;  1F6M C;  1M2D A;  2WRT A;  2JAC A;  4FH8 A;  2HNL A;  3IE3 A;  4N30 A;  1K3Y A;  3LEF A;  2L4Q A;  5GSS A;  2LJR A;  5ECS A;  3HD5 A;  4QQ7 A;  1MDK A;  1O6J A;  2H71 A;  3GKN A;  1YY7 A;  4KCE A;  3MNG A;  2ON7 A;  1B4P A;  3C8E A;  4RQR A;  2TRC P;  1OC9 A;  2LRC A;  1KBN A;  2H0I A;  1PKZ A;  4HZ4 A;  4GF0 A;  1AQW A;  2LS5 A;  4F2I A;  2DJ3 A;  2G2Q A;  1TTZ A;  4EF0 A;  1OC3 A;  2R0P A;  1GSQ A;  2O87 A;  2HRK A;  4V2M A;  1S3D A;  4TVE A;  3R2Q A;  4JR6 A;  1ZMA A;  5IMA A;  4YQM A;  4JED A;  5HR1 A;  4EXJ A;  1MTC A;  4WBJ A;  1XW9 A;  4DSR A;  2CVK A;  3GKK A;  4ZBD A;  2LNS A;  6GSY A;  4JE1 A;  3HZ4 A;  2OKA A;  3D4M A;  3A5I A;  4EIQ A;  5CO3 A;  2MBS A;  3QD9 A;  3FW2 A;  3ZL5 A;  1NW2 A;  2VCX A;  3TCO A;  4NMU A;  2HFD A;  5G5E A;  2EIQ A;  5ELG A;  4K0N A;  3LQ7 A;  4HEA 2;  2E2G A;  3HJO A;  4ZBB A;  1VGL A;  1XWK A;  4WEY A;  2TIR A;  3OR5 A;  3G7Y A;  4N11 A;  1FHE A;  4GSS A;  4GQC A;  3VLN A;  5ECH B;  2QGV A;  4HJM A;  1TXX A;  2H6X A;  3M3M A;  4G0I A;  4BVX B;  9GSS A;  3ZRE A;  1UC7 A;  1XOA A;  3C73 A;  4L8E A;  2P5R A;  4AJ8 A;  4OO4 A;  1YQ1 A;  2M46 A;  3F63 A;  3IV4 A;  3WYW A;  4K7O A;  2HT9 A;  4K6X A;  3HJM A;  1Z7R A;  2JSZ A;  2GT6 A;  4ZB6 A;  1O8X A;  1RW1 A;  1V2A A;  5FHI A;  3FHK A;  1GWC A;  2FCH A;  3A2W A;  4AGS A;  2MMZ A;  5INY A;  2FY6 A;  2I4A A;  4L0W A;  3RBT A;  3UEM A;  3ZRD A;  5ENU A;  1AIU A;  2CZ2 A;  2LV3 A;  5JWO B;  1VRS D;  2LJK A;  3CXG A;  3GKM A;  2HRN A;  4AJ7 A;  1OE8 A;  1NHY A;  2GTU A;  2YZU A;  1SD8 A;  3KEB A;  3LOR A;  3VWW A;  4PUF C;  3IA1 A;  1YDK A;  2VAF A;  4FYU A;  1EWX A;  4BVY A;  2DMM A;  2C8U A;  4JZQ A;  2HZE B;  3O3T A;  3J7Y b;  4PQI A;  3L9S A;  5AIX A;  1SK0 A;  3HCZ A;  4KB3 A;  2E0Q A;  2R6K A;  2C3N A;  4X1U A;  2HXK A;  4A5P A;  4I2U A;  4EO3 A;  3G7I A;  3TJB A;  4MH3 A;  2DIY A;  5LCZ A;  5CRE A;  1T3B A;  2DJ0 A;  3QFA C;  2IFQ B;  4G0L A;  3GL3 A;  3RAZ A;  1EP7 A;  1K0D A;  1VF4 A;  1T00 A;  1EP8 A;  5G31 A;  5F05 A;  3A5W A;  2F8A A;  2CA8 A;  2WFC A;  5GAP D;  2XHF A;  5DJL A;  3I6A A;  1MEK A;  4L5O A;  1EV9 A;  5CNW A;  3IHQ A;  4PTS A;  2J23 A;  3VI7 A;  1N2A A;  4PXO A;  1K0C A;  2B7K A;  1XIY A;  3M9K A;  3ZIT A;  1Q4J A;  5H5Q A;  2C3T A;  4I5Q A;  1W89 A;  4GWR A;  3TKP A;  2PER A;  4Q5Q A;  1JZR A;  2XPD A;  1OC8 A;  4I2T A;  1TU7 A;  4E8H A;  3KGK A;  1GH2 A;  4ZIJ A;  2PU9 C;  3GV1 A;  2LRN A;  5KN0 A;  5G30 A;  2OE0 A;  3VWV A;  2GDR A;  2LTK A;  4XRA A;  4O7H A;  2OBK A;  2DC5 A;  5D9V A;  5EPF A;  2QC7 A;  3QOU A;  4YH2 A;  2VCQ A;  3RPP A;  1OVN A;  3NIV A;  3LW9 A;  3UVH A;  3KZQ A;  1TI3 A;  5F06 A;  2B5X A;  1WPI A;  1JZW A;  1GTA A;  5IMC A;  3VWU A;  5HR3 A;  4WR5 A;  3IDV A;  3KM6 A;  1Z5Y E;  1SJI A;  4USS A;  4OCF A;  2GVP A;  2VCW A;  1FVJ A;  2RUE A;  4TR1 A;  2AJQ B;  2X99 A;  1ABA A;  4OO5 A;  1B9X C;  4NAX A;  1K3L A;  3KJY A;  3WT1 A;  1FW1 A;  3W8J A;  3FEU A;  3ZTL A;  3ZVJ D;  3VFI A;  2H6Z A;  1R4W A;  1PGT A;  2VIM A;  4HSC X;  5A5K A;  4YKG A;  4K5R A;  2FLS A;  4ML1 A;  3GHA A;  5KEJ A;  3LXZ A;  4RI6 A;  1YF0 A;  3CRT A;  4GQF A;  1WWJ A;  2MMN A;  5ECK B;  1UN2 A;  4O5Q A;  5JCG A;  4N0Z A;  3FRC A;  2VL2 C;  1PRX A;  1EOH A;  2HYX A;  2I1U A;  2EIO A;  3F0I A;  2IMD A;  4XRD A;  1TK0 B;  4MF6 A;  2HRA A;  3KH7 A;  4YQV A;  3MWH A;  4HUA A;  2I9H A;  2FD3 A;  4TR0 A;  2VL2 A;  5J3R A;  3BBY A;  4TN8 A;  4IS0 A;  3IAM 2;  1K3O A;  3ZLP A;  3CYN A;  1SD9 A;  4KH7 A;  3HXS A;  3APS A;  1PN9 A;  2WCI A;  4GXZ A;  3QAG A;  4ECJ A;  3BCK A;  2WDU A;  1M7T A;  1HQO A;  2DBC A;  3D0Z A;  3PPU A;  3UVT A;  1SJZ A;  3FKF A;  3TOT A;  4EDY A;  4X0X A;  4TW5 A;  4MPG A;  2IMK A;  1J08 A;  5D73 A;  4POL A;  5J9C A;  1KNG A;  3UAR A;  4CY8 A;  3HA9 A;  1JZD A;  1ZZY A;  5C00 A;  4ECB A;  1THO A;  3DVW A;  2CVB A;  4D73 A;  4XCS A;  22GS A;  1B8X A;  19GS A;  2YJ7 A;  5DAK A;  2H1B A;  3AY8 A;  3C1R A;  16GS A;  2H66 A;  2X4A A;  4O5R A;  3L4N A;  4POM A;  4XHM A;  3GYK A;  2YJH A;  3IOS A;  4O32 A;  2YPM A;  4NV5 A;  4EUY A;  3LYK A;  2B5E A;  5HFI A;  2QA2 A;  3LG6 A;  2YOI A;  4OFT A;  7GSS A;  1RK4 A;  1V57 A;  5AIV A;  5GZZ B;  2CZ3 A;  4X43 A;  3DEX A;  1A8Y A;  1AQX A;  3HDC A;  3QCP A;  4IW9 A;  1X9M B;  4MH2 A;  4K9Z A;  1O7U A;  2NTO A;  3GA4 A;  4JU5 A;  4JRR A;  2GZY A;  4PGT A;  2L6D A;  2K18 A;  4QL9 A;  4YQU A;  5DDL A;  2X49 A;  1SL0 B;  1CQG A;  2GS3 A;  2L5L A;  1T7P B;  2PGT A;  5D9W A;  1BYE A;  3BD2 A;  2AB6 A;  4G19 A;  1USB A;  3L0H A;  4HOJ A;  4TRX A;  2AAW A;  5J5N A;  4K7N A;  3GH9 A;  3LJR A;  2P0G A;  3F4R A;  5ECR B;  4F0B A;  1SKS B;  4K5S A;  3EU3 A;  4PNG A;  4J2F A;  4OWY A;  3O76 A;  4OCE A;  1MDJ A;  1ACV A;  3HY2 A;  4ZL9 A;  3F8U A;  2CVD A;  2CV4 A;  3H93 A;  2L5O A;  1T4Y A;  2V6O A;  1WRY A;  3H1N A;  1EGO A;  2B5Y A;  4TXO B;  3GFK A;  1U6T A;  2FWE A;  5IM9 A;  5DQY A;  1THX A;  1Z6N A;  1XFL A;  1XG8 A;  1LBK A;  2O85 A;  1QGV A;  3CTF A;  3FR3 A;  4Z2T A;  3S9F A;  3SBC A;  4MF5 A;  2F51 A;  3FMW A;  3IAS 2;  4BVX A;  11GS A;  2NVL A;  4K1F A;  4BA7 A;  2H73 A;  3EE2 A;  5KN2 A;  5IO2 A;  3EVI A;  2HSM A;  4WKW A;  3HHV A;  1MDI A;  4KUN A;  3I69 A;  4LL1 B;  4AF2 A;  2B3S A;  4FO5 A;  1F37 A;  5AN1 A;  1SJ6 A;  4G2E A;  1S3A A;  2LJA A;  3IK9 A;  3ZFB A;  3GH6 A;  3I9V 2;  5AIS A;  2DSA A;  4ZIL A;  2R4V A;  4Q5R A;  4GRF A;  4K0G A;  2FGX A;  4DSS B;  3GL5 A;  2N5B A;  5DQS A;  1XVW A;  2CX3 A;  1YF1 A;  3GIX A;  4P3Y B;  3TJF A;  3GN3 A;  2JL4 A;  4ISD A;  3P7X A;  8GSS A;  2YNX A;  3ZMK A;  1W4V A;  4V1A p;  1NSW A;  1SL2 B;  2WS2 A;  2PVO C;  1WJK A;  2HZE A;  5IPG A;  1EEM A;  1V40 A;  2IME A;  2IMI A;  3DKS A;  5CP1 A;  1Y25 A;  4I6X A;  3F3Q A;  3UBK A;  2A4H A;  2V2G A;  3QDN A;  3E9J B;  1XWB A;  1AUC A;  2IMF A;  2YAN A;  4RQX A;  1ZYQ B;  2IFQ A;  1EV4 A;  5DAL A;  1M0U A;  1QK8 A;  3J7Y k;  4IN0 A;  3GRX A;  5CYY A;  1XXU A;  2R5G A;  4POK A;  1JLW A;  1V98 A;  4V1A g;  5BRT A;  4F0C A;  18GS A;  3GST A;  4WF4 A;  4KF9 A;  2FWH A;  4TOP A;  1M3I A;  1WP0 A;  2C3Q A;  5JWR B;  2X8C A;  5GAN D;  6GST A;  17GS A;  2H19 A;  3GTU B;  3VPT A;  5ECI B;  3EPT A;  3FR9 A;  3CMI A;  3M8N A;  2QA1 A;  2K8S A;  4MP4 A;  2BTO T;  2OE1 A;  4GTU A;  3KIJ A;  2GSS A;  4G0K A;  3VK9 A;  3TJJ A;  2TRX A;  3DYR A;  5IQY A;  3N5O A;  4PUR A;  3WGX A;  2B1K A;  5J41 A;  1IYI A;  1OC9 B;  1Z7P A;  3EU4 A;  2OAD A;  1UA5 A;  2F9S A;  2IWT A;  3TJG A;  2JZS A;  2DJK A;  2A2S A;  4K2X A;  2B6M A;  4DVC A;  3RHC A;  1YZX A;  2NPB A;  1AQV A;  3E0U A;  5A4U A;  3VPQ A;  3GKX A;  4HQZ A;  4EDZ A;  1M2B A;  4I97 A;  1ZYP A; 
#chains in the Genus database with same CATH homology
 1TOF A;  1ST9 A;  2H0H A;  5IOW A;  2IIY A;  3GSS A;  2GLR A;  1G6Y A;  4KGI A;  1PN0 A;  2L6C A;  3ZFL A;  4FQU A;  3HVS A;  2PVQ A;  5DVB A;  1IYH A;  14GS A;  3G9B A;  5H5S A;  5JCU A;  4WF5 A;  2LNT A;  4IKH A;  3U5R E;  3P2A A;  4IP1 A;  1I5G A;  3QAW A;  3QAV A;  1BQ7 A;  2EC4 A;  3BOA A;  5IO0 A;  1K0B A;  2H1A A;  2C0F A;  2H74 A;  2JSY A;  2V1M A;  2ZNM A;  2YP6 A;  4BPY A;  2GZZ A;  3BCI A;  4HI7 A;  3PR8 A;  1DBY A;  3GX8 A;  1ZYN A;  4RUV A;  4TR3 A;  3D6I A;  1GUL A;  1JLV A;  2XC2 A;  1HNA A;  2F3M A;  3UBL A;  2LKU A;  4KDU A;  2DJJ A;  5LD0 A;  4FYC A;  2PMT A;  1GNW A;  2CX4 A;  1HD2 A;  2FWG A;  5CRH A;  4V2N A;  3FYG A;  2YWN A;  2P31 A;  3TRP A;  1GUM A;  2LQQ A;  1TRU A;  1O85 A;  1X5D A;  2LUS A;  1T8E B;  4N10 A;  4K2D A;  1GRX A;  5G5F A;  5B8B A;  2GQM A;  4ICY A;  4NHW A;  1DSB A;  3TOU A;  4BVY B;  1ERU A;  2E2M A;  2YWO A;  2V41 A;  1K0M A;  1N8J A;  1K0O A;  3DXB A;  13GS A;  1JFU A;  2IPA A;  3ISO A;  4TKY A;  3DIE A;  1FOH A;  2WJU A;  1TI1 A;  1PSQ A;  2LEG A;  1ML6 A;  2GSR A;  1OE7 A;  2C0G A;  5D9T A;  1GSU A;  1FOV A;  2GQK A;  5ID2 B;  2VCV A;  1TRW A;  2PBJ A;  2C80 A;  4IQ1 A;  2FNO A;  5E59 A;  3EMX A;  2AV4 A;  4J56 E;  4OMV A;  5B6M A;  5IMD A;  1PQN A;  5HFG A;  3TKR A;  2PPT A;  3WGD A;  1E2Y A;  4HU9 A;  1XCC A;  4WR4 A;  1UVZ A;  2IJY A;  2V32 A;  3MAK A;  3GNJ A;  1GLP A;  5G2Z A;  3UOM A;  1U3I A;  3E3E A;  1XPV A;  4XS4 B;  4LMV A;  1B4Q A;  4MPF A;  1R5P A;  3CSJ A;  2YWI A;  3FR6 A;  1TU8 A;  2XBQ A;  5ECO B;  1TP9 A;  1WMJ A;  3CSI A;  3LGC A;  1ZOF A;  3H8Q A;  4HQS A;  3UJ1 A;  3ERW A;  5H5R A;  2BJX A;  1VF2 A;  1F3B A;  4CDO A;  2FHE A;  4F9Z A;  4ZB9 A;  3P8W A;  4CY6 A;  3IRA A;  2VM1 A;  4KX4 A;  3RDW A;  3WD6 A;  4RI7 A;  2NBS A;  3TRX A;  5FWG A;  1GLQ A;  4CW9 A;  2ZCT A;  4EL1 A;  2N5F A;  3HKR A;  4PX1 A;  4TXO A;  1XZO A;  4MAB A;  4N0V A;  3LWA A;  4KND A;  2O8V B;  3APO A;  1OYJ A;  1RQM A;  1LJR A;  5LNK e;  2GQL A;  1M9B A;  2HSH A;  2HRF A;  3A2V A;  1J0F A;  1FO5 A;  5GST A;  1FVK A;  2H76 A;  3IC8 A;  1ZGN A;  3KTL A;  4X4J A;  4BL7 A;  5IMV A;  2CT6 A;  1O8W A;  2C0D A;  4PQH A;  5ECN B;  5DJM A;  2K8V A;  1XWC A;  4GCI A;  4KA0 A;  1R5A A;  5A4W A;  5B8A A;  3MIX A;  1MD4 A;  1G0T A;  1A0F A;  3TGZ A;  1EEJ A;  2HI7 A;  4EE0 A;  2BMX A;  3KMN A;  4O5U A;  10GS A;  2RUF A;  3NOF A;  4IP6 A;  3UAP A;  2KP2 A;  4HS1 A;  2HZF A;  2VD1 A;  2VL9 A;  3Q19 A;  1I9D A;  5L71 A;  3D22 A;  1Y6E A;  2RLI A;  1U87 A;  3ERG A;  4NXI A;  4DSS A;  3LXT A;  3DGQ A;  3F4S A;  1R7H A;  3FZ9 A;  1FG4 A;  2M72 A;  4MNN A;  2C4J A;  4MJE A;  3KD0 A;  2YCD A;  1F3A A;  2GT5 A;  4BWS A;  2ZUP A;  4ZXG A;  3LSZ A;  4MA9 A;  3ZIV A;  1SU9 A;  1B48 A;  3HZ8 A;  2FA8 A;  2O7K A;  4Z2U A;  3EWL A;  1SKW B;  5ECM B;  2A4V A;  3FZA A;  1AXD A;  4FIW A;  1PX6 A;  3HYP A;  4JBB A;  1GSE A;  1O81 A;  1X0R A;  4WET A;  4MF7 A;  5KOW A;  2ES7 A;  1GSS A;  1GSY A;  20GS A;  2DKI A;  3H4K A;  2H70 A;  4F82 A;  1BX9 A;  1TDI A;  5JCW A;  4AJ6 A;  1FAA A;  1GL8 A;  3KXO A;  1GSF A;  3H79 A;  5E4W A;  2AUV A;  2HSY A;  4YKF A;  3O6T A;  1F2E A;  3FZ5 A;  4D73 B;  2FA4 A;  1DUG A;  2AHE A;  1A2L A;  3L9V A;  2UZ8 A;  5DAK B;  2PUK C;  4LLR A;  3BJ5 A;  1XW6 A;  1C72 A;  4MZW A;  3Q6O A;  2L59 A;  1PD2 1;  1SKR B;  6GSU A;  3GTU A;  5CAX A;  2LST A;  1WE0 A;  3QFB C;  3KP8 A;  1MD3 A;  3HVX A;  4IEL A;  4H86 A;  2MBT A;  5IOX A;  4LA1 A;  1X9W B;  12GS A;  5DCH A;  4IBP A;  1YKA A;  5JWQ B;  1OKD A;  4POB A;  2VO4 A;  2H01 A;  2YZH A;  4LL4 B;  1EOG A;  5ECP B;  1X5C A;  1KTE A;  4IGJ A;  1YJ6 A;  3I43 A;  3UMA A;  5AGY A;  5DCG A;  3W8S A;  2VLU A;  3WGE A;  1BJX A;  2WGR A;  1EZK A;  4CHS A;  2DJ1 A;  4TXV A;  3F6D A;  3LFL A;  5EVO A;  2MMO A;  3KH9 A;  5HR2 A;  2X8G A;  5HQP A;  1VF1 A;  6GSX A;  4DSQ A;  3EUR A;  4MDC A;  3HJP A;  4L0U A;  1K0A A;  4BWQ A;  4PNF A;  3EIN A;  2X8H A;  2F8F A;  1OKT A;  2YWM A;  1QMV A;  5CRW A;  4Z2R A;  4MJA A;  3P90 A;  2K6V A;  1HNB A;  2JAD A;  1G6W A;  4KCA A;  5CRD A;  2R3X A;  4KW6 A;  1YKC A;  2B7J A;  3LYP A;  3PH9 A;  2YN1 A;  3FZ4 A;  4KSO A;  2LRT A;  1SYR A;  1X5E A;  4NHZ A;  1XBS A;  4JR4 A;  3R3E A;  2VM2 A;  2IL3 A;  1XW5 A;  3K8N A;  5G1L A;  1EGR A;  5F07 A;  5EL8 A;  4EC0 A;  1V9W A;  4ZL8 A;  4YAV A;  4EKZ A;  5IPH A;  1E6B A;  2HLS A;  5HFK A;  4MK3 A;  2RII A;  3L9U A;  3ZVJ A;  5D96 A;  1ERW A;  3C7M A;  4QL7 A;  2FWF A;  1Z6M A;  4V2L A;  2R0G A;  4MLY A;  3QR6 A;  1QFN A;  5ELA A;  2XBI A;  3GX0 A;  2MZC A;  3DWV A;  5KN3 A;  4NWY A;  3SWL A;  4MZB A;  5FT3 A;  3FK8 A;  3D21 A;  3GUS A;  2R37 A;  3UL3 A;  5A4V A;  1TW9 A;  2VLT A;  2RM6 A;  5ID2 A;  1H75 A;  2L4C A;  4EVM A;  4ILF A;  2AYT A;  3ZML A;  2O89 A;  5DAL B;  2QSI A;  3C1S A;  2GZP A;  4KE3 A;  4ULX A;  2OAC A;  3F6F A;  2DJ2 A;  3ERF A;  3G7J A;  4TR4 A;  3CBU A;  2CAQ A;  3VUR A;  2JZR A;  2DLX A;  2KHP A;  5D93 A;  4OD7 A;  4XIH A;  1ILO A;  3KTB A;  4XS1 A;  2PN8 A;  5G1K A;  4KSM A;  4IJI A;  1A2J A;  1A2M A;  1PL2 A;  1GUK A;  1R26 A;  1M2A A;  3JCM L;  4XS4 A;  2LQO A;  5IIZ A;  2GST A;  6GSV A;  2I81 A;  4GST A;  4WXT A;  3VI5 A;  3KCM A;  3TJK A;  1XWA A;  4K8M A;  5J4U A;  4ZL7 A;  1T4Z A;  4IJ3 A;  3US3 A;  1SEN A;  2VLV A;  3GMF A;  2KOK A;  4F03 A;  5HR0 A;  4ACS A;  4ID0 A;  5ECL B;  1F9M A;  1GSD A;  3F3R A;  2WZ9 A;  2H1G A;  2DML A;  2Z9S A;  2A2R A;  4GLT A;  1ZL9 A;  3NZN A;  4YAP A;  3Q18 A;  1FB0 A;  2MYG A;  3M0F A;  1G7O A;  1A0R P;  1SK1 A;  1QQ2 A;  1KEB A;  2DKH A;  1Z3E A;  4XTS A;  1SK2 A;  1PA3 A;  1FB6 A;  2VD0 A;  3TKQ A;  1OAZ A;  2YV7 A;  5KN1 A;  1T1V A;  3ZIJ A;  1LU4 A;  4HZ2 A;  5B6N A;  2C1Y A;  2WB9 A;  5DBQ A;  4MMM A;  1HNC A;  2H75 A;  5COH A;  3WT2 A;  1O73 A;  4IQA A;  5EY6 A;  2IN3 A;  4OFN A;  4LMW A;  5F8B A;  1ZCP A;  2P5Q A;  2H6Y A;  3DML A;  2A2P A;  3IXR A;  1TRV A;  2JZT A;  1CQH A;  3IHG A;  1VF3 A;  2ON5 A;  2J9H A;  3RPN A;  3ME7 A;  3GUR A;  2I3Y A;  2R2J A;  1ERV A;  2CAI A;  1G7E A;  4IHU A;  3D4T A;  4E8E A;  2K9F A;  3TKS C;  4IVF A;  1K0N A;  4ZB8 A;  2WUL A;  1XOB A;  4KDY A;  3EMP A;  3L78 A;  3DRN A;  1YEX A;  2L57 A;  2M80 A;  2H72 A;  2OJL A;  2REM A;  3MYD A;  1A23 A;  3C71 A;  1SYX A;  4Z7X A;  6GSW A;  3TKS A;  3M9J A;  4MJC A;  3A2X A;  1PKW A;  2D2Z A;  5IMF A;  3MSZ A;  1NM3 A;  1SL1 B;  3D5J A;  1H4O A;  1Z9H A;  1YEP A;  1ZYE A;  4ML6 A;  2B1L A;  2MMA A;  1TK8 B;  3TUE A;  1GTB A;  2G0F A;  1GUH A;  2HE3 A;  2OA7 A;  4PUA A;  1Q98 A;  2DIZ A;  5ABR A;  4ECI A;  4MZC A;  2OE3 A;  2OBI A;  1NHO A;  2VUP A;  1BED A;  2V6K A;  3W6G A;  1XVQ A;  4O92 A;  1U88 A;  3FY7 A;  4G9H A;  1TKD B;  4KAE A;  3F4T A;  1BG5 A;  1PMT A;  3VWX A;  4XS6 A;  3ZYW A;  4TR1 B;  2QKE A;  4MJB A;  2KP1 A;  1WIK A;  1TK5 B;  4ECC A;  4FYB A;  2NDO A;  1GTI A;  2VCZ A;  1AW9 A;  3ME8 A;  3IPZ A;  2RM5 A;  4MCU A;  4NPB A;  3KP9 A;  4K7I A;  2ALB A;  3PGT A;  5BMU A;  1WOU A;  1ON4 A;  3CTG A;  3DD3 A;  1TRS A;  3M1G A;  5IMZ A;  1XWG A;  4NV2 A;  1J9B A;  2FUG 2;  3EYT A;  3UIW A;  2R0C A;  1URM A;  1V58 A;  1M9A A;  1ERT A;  2VOC A;  4L5L A;  2E7P A;  4PQ1 A;  3TKS E;  1AC1 A;  1A8L A;  3RHB A;  4Q5N A;  3MDK A;  5B7C A;  1S3C A;  4WBR D;  4KDX A;  1B9Y C;  2CQ9 A;  3QPM A;  2PWJ A;  3A3T A;  1GNE A;  3APQ A;  3CSH A;  1TJD A;  5KOX A;  5CRG A;  5J9B A;  1X9S B;  1JZO A;  3IBH A;  2GSQ A;  2H8L A;  1DE2 A;  1DE1 A;  2XPE A;  4OFM A;  3IC4 A;  5D9X A;  3IR4 A;  1AAZ A;  2KUC A;  3EC3 A;  3DVX A;  4EIP A;  1GTU A;  1PX7 A;  4DEJ A;  3KMO A;  4GSN A;  1QXH A;  1U3A A;  5F0G A;  1GP1 A;  1HYU A;  2C0E A;  2VCT A;  2JU5 A;  5D8I A;  2VL3 A;  1PL1 A;  1M99 A;  3PIN A;  1A24 A;  3F9U A;  5C04 A;  4HDE A;  5ECQ B;  2KLX A;  1BAY A;  2H30 A;  3U6V A;  4Q5F A;  4G10 A;  4I8B A;  1JHB A;  6GSS A;  3Q74 A;  2H1D A;  2N5A A;  2EIR A;  3N9J A;  1QUW A;  4BL7 B;  3ZZX A;  2X64 A;  3TDG A;  3CRU A;  3HVV A;  4HU7 A;  3ED3 A;  4ZBA A;  2YV9 A;  4HJ2 A;  2H0G A;  3TRQ A;  4J57 E;  3QMX A;  2GGT A;  3TB2 A;  3IK7 A;  3V1W A;  1F6M C;  1M2D A;  2WRT A;  2JAC A;  4FH8 A;  2HNL A;  3IE3 A;  4N30 A;  1K3Y A;  3LEF A;  2L4Q A;  5GSS A;  2LJR A;  5ECS A;  3HD5 A;  4QQ7 A;  1MDK A;  1O6J A;  2H71 A;  3GKN A;  1YY7 A;  4KCE A;  3MNG A;  2ON7 A;  1B4P A;  3C8E A;  4RQR A;  2TRC P;  1OC9 A;  2LRC A;  1KBN A;  2H0I A;  1PKZ A;  4HZ4 A;  4GF0 A;  1AQW A;  2LS5 A;  4F2I A;  2DJ3 A;  2G2Q A;  1TTZ A;  4EF0 A;  1OC3 A;  2R0P A;  1GSQ A;  2O87 A;  2HRK A;  4V2M A;  1S3D A;  4TVE A;  3R2Q A;  4JR6 A;  1ZMA A;  5IMA A;  4YQM A;  4JED A;  5HR1 A;  4EXJ A;  1MTC A;  4WBJ A;  1XW9 A;  4DSR A;  2CVK A;  3GKK A;  4ZBD A;  2LNS A;  6GSY A;  4JE1 A;  3HZ4 A;  2OKA A;  3D4M A;  3A5I A;  4EIQ A;  5CO3 A;  2MBS A;  3QD9 A;  3FW2 A;  3ZL5 A;  1NW2 A;  2VCX A;  3TCO A;  4NMU A;  2HFD A;  5G5E A;  2EIQ A;  5ELG A;  4K0N A;  3LQ7 A;  4HEA 2;  2E2G A;  3HJO A;  4ZBB A;  1VGL A;  1XWK A;  4WEY A;  2TIR A;  3OR5 A;  3G7Y A;  4N11 A;  1FHE A;  4GSS A;  4GQC A;  3VLN A;  5ECH B;  2QGV A;  4HJM A;  1TXX A;  2H6X A;  3M3M A;  4G0I A;  4BVX B;  9GSS A;  3ZRE A;  1UC7 A;  1XOA A;  3C73 A;  4L8E A;  2P5R A;  4AJ8 A;  4OO4 A;  1YQ1 A;  2M46 A;  3F63 A;  3IV4 A;  3WYW A;  4K7O A;  2HT9 A;  4K6X A;  3HJM A;  1Z7R A;  2JSZ A;  2GT6 A;  4ZB6 A;  1O8X A;  1RW1 A;  1V2A A;  5FHI A;  3FHK A;  1GWC A;  2FCH A;  3A2W A;  4AGS A;  2MMZ A;  5INY A;  2FY6 A;  2I4A A;  4L0W A;  3RBT A;  3UEM A;  3ZRD A;  5ENU A;  1AIU A;  2CZ2 A;  2LV3 A;  5JWO B;  1VRS D;  2LJK A;  3CXG A;  3GKM A;  2HRN A;  4AJ7 A;  1OE8 A;  1NHY A;  2GTU A;  2YZU A;  1SD8 A;  3KEB A;  3LOR A;  3VWW A;  4PUF C;  3IA1 A;  1YDK A;  2VAF A;  4FYU A;  1EWX A;  4BVY A;  2DMM A;  2C8U A;  4JZQ A;  2HZE B;  3O3T A;  3J7Y b;  4PQI A;  3L9S A;  5AIX A;  1SK0 A;  3HCZ A;  4KB3 A;  2E0Q A;  2R6K A;  2C3N A;  4X1U A;  2HXK A;  4A5P A;  4I2U A;  4EO3 A;  3G7I A;  3TJB A;  4MH3 A;  2DIY A;  5LCZ A;  5CRE A;  1T3B A;  2DJ0 A;  3QFA C;  2IFQ B;  4G0L A;  3GL3 A;  3RAZ A;  1EP7 A;  1K0D A;  1VF4 A;  1T00 A;  1EP8 A;  5G31 A;  5F05 A;  3A5W A;  2F8A A;  2CA8 A;  2WFC A;  5GAP D;  2XHF A;  5DJL A;  3I6A A;  1MEK A;  4L5O A;  1EV9 A;  5CNW A;  3IHQ A;  4PTS A;  2J23 A;  3VI7 A;  1N2A A;  4PXO A;  1K0C A;  2B7K A;  1XIY A;  3M9K A;  3ZIT A;  1Q4J A;  5H5Q A;  2C3T A;  4I5Q A;  1W89 A;  4GWR A;  3TKP A;  2PER A;  4Q5Q A;  1JZR A;  2XPD A;  1OC8 A;  4I2T A;  1TU7 A;  4E8H A;  3KGK A;  1GH2 A;  4ZIJ A;  2PU9 C;  3GV1 A;  2LRN A;  5KN0 A;  5G30 A;  2OE0 A;  3VWV A;  2GDR A;  2LTK A;  4XRA A;  4O7H A;  2OBK A;  2DC5 A;  5D9V A;  5EPF A;  2QC7 A;  3QOU A;  4YH2 A;  2VCQ A;  3RPP A;  1OVN A;  3NIV A;  3LW9 A;  3UVH A;  3KZQ A;  1TI3 A;  5F06 A;  2B5X A;  1WPI A;  1JZW A;  1GTA A;  5IMC A;  3VWU A;  5HR3 A;  4WR5 A;  3IDV A;  3KM6 A;  1Z5Y E;  1SJI A;  4USS A;  4OCF A;  2GVP A;  2VCW A;  1FVJ A;  2RUE A;  4TR1 A;  2AJQ B;  2X99 A;  1ABA A;  4OO5 A;  1B9X C;  4NAX A;  1K3L A;  3KJY A;  3WT1 A;  1FW1 A;  3W8J A;  3FEU A;  3ZTL A;  3ZVJ D;  3VFI A;  2H6Z A;  1R4W A;  1PGT A;  2VIM A;  5A5K A;  4YKG A;  4K5R A;  2FLS A;  4ML1 A;  3GHA A;  5KEJ A;  3LXZ A;  4RI6 A;  1YF0 A;  3CRT A;  4GQF A;  1WWJ A;  2MMN A;  5ECK B;  1UN2 A;  4O5Q A;  5JCG A;  4N0Z A;  3FRC A;  2VL2 C;  1PRX A;  1EOH A;  2HYX A;  2I1U A;  2EIO A;  3F0I A;  2IMD A;  4XRD A;  1TK0 B;  4MF6 A;  2HRA A;  3KH7 A;  4YQV A;  3MWH A;  4HUA A;  2I9H A;  2FD3 A;  4TR0 A;  2VL2 A;  5J3R A;  3BBY A;  4TN8 A;  4IS0 A;  3IAM 2;  1K3O A;  3ZLP A;  3CYN A;  1SD9 A;  4KH7 A;  3HXS A;  3APS A;  1PN9 A;  2WCI A;  4GXZ A;  3QAG A;  4ECJ A;  3BCK A;  2WDU A;  1M7T A;  1HQO A;  2DBC A;  3D0Z A;  3PPU A;  3UVT A;  1SJZ A;  3FKF A;  3TOT A;  4EDY A;  4X0X A;  4TW5 A;  4MPG A;  2IMK A;  1J08 A;  5D73 A;  4POL A;  5J9C A;  1KNG A;  3UAR A;  4CY8 A;  3HA9 A;  1JZD A;  1ZZY A;  5C00 A;  4ECB A;  1THO A;  3DVW A;  2CVB A;  4D73 A;  4XCS A;  22GS A;  1B8X A;  19GS A;  2YJ7 A;  5DAK A;  2H1B A;  3AY8 A;  3C1R A;  16GS A;  2H66 A;  2X4A A;  4O5R A;  3L4N A;  4POM A;  4XHM A;  3GYK A;  2YJH A;  3IOS A;  4O32 A;  2YPM A;  4NV5 A;  4EUY A;  3LYK A;  2B5E A;  5HFI A;  2QA2 A;  3LG6 A;  2YOI A;  4OFT A;  7GSS A;  1RK4 A;  1V57 A;  5AIV A;  5GZZ B;  2CZ3 A;  4X43 A;  3DEX A;  1A8Y A;  1AQX A;  3HDC A;  3QCP A;  4IW9 A;  1X9M B;  4MH2 A;  4K9Z A;  1O7U A;  2NTO A;  3GA4 A;  4JU5 A;  4JRR A;  2GZY A;  4PGT A;  2L6D A;  2K18 A;  4QL9 A;  4YQU A;  5DDL A;  2X49 A;  1SL0 B;  1CQG A;  2GS3 A;  2L5L A;  1T7P B;  2PGT A;  5D9W A;  1BYE A;  3BD2 A;  2AB6 A;  4G19 A;  1USB A;  3L0H A;  4HOJ A;  4TRX A;  2AAW A;  5J5N A;  4K7N A;  3GH9 A;  3LJR A;  2P0G A;  3F4R A;  5ECR B;  4F0B A;  1SKS B;  4K5S A;  3EU3 A;  4PNG A;  4J2F A;  4OWY A;  3O76 A;  4OCE A;  1MDJ A;  1ACV A;  3HY2 A;  4ZL9 A;  3F8U A;  2CVD A;  2CV4 A;  3H93 A;  2L5O A;  1T4Y A;  2V6O A;  1WRY A;  3H1N A;  1EGO A;  2B5Y A;  4TXO B;  3GFK A;  1U6T A;  2FWE A;  5IM9 A;  5DQY A;  1THX A;  1Z6N A;  1XFL A;  1LBK A;  2O85 A;  1QGV A;  3CTF A;  3FR3 A;  4Z2T A;  3S9F A;  3SBC A;  4MF5 A;  2F51 A;  3FMW A;  3IAS 2;  4BVX A;  11GS A;  2NVL A;  4K1F A;  4BA7 A;  2H73 A;  3EE2 A;  5KN2 A;  5IO2 A;  3EVI A;  2HSM A;  4WKW A;  3HHV A;  1MDI A;  4KUN A;  3I69 A;  4LL1 B;  4AF2 A;  2B3S A;  4FO5 A;  1F37 A;  5AN1 A;  1SJ6 A;  4G2E A;  1S3A A;  2LJA A;  3IK9 A;  3ZFB A;  3GH6 A;  3I9V 2;  5AIS A;  2DSA A;  4ZIL A;  2R4V A;  4Q5R A;  4GRF A;  4K0G A;  2FGX A;  4DSS B;  3GL5 A;  2N5B A;  5DQS A;  1XVW A;  2CX3 A;  1YF1 A;  3GIX A;  4P3Y B;  3TJF A;  3GN3 A;  2JL4 A;  4ISD A;  3P7X A;  8GSS A;  2YNX A;  3ZMK A;  1W4V A;  4V1A p;  1NSW A;  1SL2 B;  2WS2 A;  2PVO C;  1WJK A;  2HZE A;  5IPG A;  1EEM A;  1V40 A;  2IME A;  2IMI A;  3DKS A;  5CP1 A;  1Y25 A;  4I6X A;  3F3Q A;  3UBK A;  2A4H A;  2V2G A;  3QDN A;  3E9J B;  1XWB A;  1AUC A;  2IMF A;  2YAN A;  4RQX A;  1ZYQ B;  2IFQ A;  1EV4 A;  5DAL A;  1M0U A;  1QK8 A;  3J7Y k;  4IN0 A;  3GRX A;  5CYY A;  1XXU A;  2R5G A;  4POK A;  1JLW A;  1V98 A;  4V1A g;  5BRT A;  4F0C A;  18GS A;  3GST A;  4WF4 A;  4KF9 A;  2FWH A;  4TOP A;  1WP0 A;  2C3Q A;  5JWR B;  2X8C A;  5GAN D;  6GST A;  17GS A;  2H19 A;  3GTU B;  3VPT A;  5ECI B;  3EPT A;  3FR9 A;  3CMI A;  3M8N A;  2QA1 A;  2K8S A;  4MP4 A;  2BTO T;  2OE1 A;  4GTU A;  3KIJ A;  2GSS A;  4G0K A;  3VK9 A;  3TJJ A;  2TRX A;  3DYR A;  5IQY A;  3N5O A;  4PUR A;  3WGX A;  2B1K A;  5J41 A;  1IYI A;  1OC9 B;  1Z7P A;  3EU4 A;  2OAD A;  1UA5 A;  2F9S A;  2IWT A;  3TJG A;  2JZS A;  2DJK A;  2A2S A;  4K2X A;  2B6M A;  4DVC A;  3RHC A;  1YZX A;  2NPB A;  1AQV A;  3E0U A;  5A4U A;  3VPQ A;  3GKX A;  4HQZ A;  4EDZ A;  1M2B A;  4I97 A;  1ZYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...