2GZYA

Solution structures of the reduced form of thioredoxin from bacillus subtilis
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
104
structure length
104
Chain Sequence
MAIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin
publication title Conformational fluctuations coupled to the thiol-disulfide transfer between thioredoxin and arsenate reductase in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 35
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2gzyA00
4I2UA 2FD3A 4O7HA 4EVMA 5E59A 4TKYA 3PGTA 4KCAA 5G5FA 4K0GA 2HE3A 3H1NA 2C0GA 3UJ1A 4LLRA 2JL4A 3VPTA 3TCOA 5LNKe 4IVFA 3K8NA 4BVXA 1Z6MA 5GAND 5G31A 4ZBAA 9GSSA 3UMAA 1TK0B 4ILFA 1WWJA 4V2MA 4L5OA 2H74A 1JZOA 4MP4A 1YF0A 3KP8A 2XBQA 3LORA 2JACA 1G6WA 5F0GA 1F2EA 1TK8B 3O76A 4WXTA 2NVLA 2MMAA 3TJGA 3RHCA 3CRTA 4GSSA 2VL2A 5IM9A 2CQ9A 3IPZA 1BAYA 2JZRA 2I1UA 1M7TA 4OD7A 1VGLA 3LYKA 4X1UA 4JE1A 3VFIA 2FUG2 4I97A 22GSA 3MNGA 1J9BA 1Q98A 2IIYA 1SKRB 2LV3A 1XPVA 4F03A 2GT5A 2LSTA 1JLWA 3LGCA 2HZEB 4E8HA 3LYPA 2REMA 2H01A 4N11A 6GSTA 1F9MA 3GSSA 1JFUA 2GDRA 2X8HA 2VCVA 3ZMKA 3KD0A 3DIEA 2C3NA 3GSTA 2PGTA 4MF5A 1AQXA 1T7PB 2VL3A 1QK8A 18GSA 1ZCPA 2C3QA 3D5JA 1X5CA 1SD9A 1K0NA 1VF1A 5AISA 1WOUA 1K0MA 1B9XC 2IMEA 5C00A 1UVZA 1AW9A 2NTOA 1K3YA 2DJ1A 2AYTA 3DKSA 3UARA 1DUGA 1HYUA 4ZILA 4BA7A 2DMMA 3J7Yb 3WT1A 4FYUA 2EIRA 2HZEA 4WKWA 3DGQA 2HSYA 1S3CA 4F9ZA 3F0IA 4HOJA 5ECOB 3H4KA 2E2GA 1M0UA 1K0OA 4L0WA 2HNLA 1XIYA 1THXA 2FHEA 14GSA 5F8BA 2O7KA 3S9FA 2OACA 2RIIA 1OKTA 5LCZA 3EURA 1K0CA 4V2NA 4I2TA 3GX8A 2E2MA 3DXBA 1VRSD 1E6BA 1A23A 1O81A 1XCCA 3QOUA 4IS0A 2PBJA 5ECPB 2C3TA 4JBBA 4EUYA 4IKHA 1SL2B 3FR3A 4K8MA 3M0FA 4G2EA 4ECJA 3Q18A 3IXRA 4ECCA 3ZLPA 3F3QA 2FWHA 2GZZA 1V98A 2H76A 1GUKA 4IQAA 5DQSA 2VLVA 3C71A 5DQYA 4Q5FA 1X5EA 4HJMA 1TRVA 3APSA 5ID2B 1SYXA 2L4QA 1QFNA 2K18A 3KM6A 4TW5A 1Z7RA 3QR6A 5IO0A 1NHYA 5IPGA 2H73A 2L5OA 4IJIA 1ERVA 3H8QA 1GNEA 2VM2A 3CYNA 1OAZA 1G7EA 1Y25A 4ZL9A 4WBRD 4N10A 1PQNA 3A2WA 1SL0B 1Z9HA 1UN2A 5E4WA 2CAQA 2B1KA 3TDGA 11GSA 1KTEA 4KDXA 4F0BA 4POMA 4XS1A 2OBKA 3GRXA 2WJUA 4ZB9A 2H19A 1G6YA 5DALB 3TB2A 3ZYWA 1F3AA 2YP6A 1ON4A 2WFCA 3BCIA 1CQGA 3IV4A 3BJ5A 3HD5A 5ID2A 1NM3A 1B9YC 2OKAA 4OFNA 5HQPA 3LXTA 1TK5B 2FWEA 4ZB6A 3LJRA 1QMVA 2DLXA 4KNDA 2FWGA 4GRFA 2FY6A 4FYBA 2LRCA 4KE3A 5H5QA 1TRSA 3WGEA 4OO5A 3QFAC 1PL2A 3QMXA 1K0AA 2YWOA 1GTBA 2VCTA 5D9WA 4HUAA 1IYHA 1RK4A 1EV9A 5B8AA 2GQKA 4MZCA 1V58A 4NAXA 3GKNA 4ZXGA 2KP1A 1XZOA 1FO5A 4IW9A 2H0IA 2H70A 3L4NA 1YEXA 5LD0A 3ZIVA 2LJKA 3VWXA 4XHMA 1GSDA 4KX4A 1J0FA 2D2ZA 1X5DA 3ZIJA 1TP9A 2F9SA 1I5GA 3EWLA 5CRHA 1VF2A 3TRQA 2VLUA 2RM5A 2LQOA 2B7JA 1ZMAA 2K8VA 3HVSA 1MDJA 4TVEA 1UC7A 3VLNA 2GZPA 4LMWA 4MMMA 1ST9A 4POBA 1XW6A 4V1Ap 2AAWA 2LJRA 1WIKA 1WJKA 1XWGA 4N0VA 10GSA 1MD3A 2DIZA 4ECBA 2VAFA 2GT6A 2CVKA 2ES7A 4G9HA 4AJ7A 2XHFA 3GX0A 5CAXA 1AQVA 1A2MA 2B5YA 1SKSB 4KA0A 2LQQA 3CSJA 2B7KA 2O85A 3M9KA 1AQWA 2H8LA 1GRXA 2MMOA 4HU9A 1AAZA 7GSSA 5JWQB 3LG6A 1S3DA 4BVYA 5JWOB 2LNSA 3HJPA 4MJCA 5A5KA 1YQ1A 5EVOA 1JZDA 1XFLA 3E3EA 4K7NA 5ECLB 4CHSA 5ECIB 5J4UA 1QQ2A 1BJXA 4J57E 3D0ZA 5J9BA 5ELGA 5IMDA 3TJFA 2CAIA 3KTLA 3IA1A 4ACSA 3PH9A 4V2LA 1TRUA 2X64A 4PQHA 3US3A 2GLRA 2L57A 1TI1A 2M72A 4WEYA 4AF2A 4NV2A 1FAAA 2ON7A 2CX4A 5D93A 4NV5A 5B6NA 3P2AA 2L59A 1S3AA 3ZMLA 3BCKA 1O85A 2H66A 4K2DA 2JZSA 2WULA 3NZNA 2V41A 5CREA 4KUNA 2WZ9A 1XWAA 1M2BA 3UAPA 4D73B 3C8EA 3E0UA 4MH2A 3QAVA 4HQZA 2GSTA 3LWAA 1FHEA 2DJJA 2HZFA 1GUHA 1LU4A 3NOFA 1QGVA 3FKFA 1DBYA 1UA5A 5DAKA 1R26A 3D21A 3ERGA 2J9HA 2F51A 1T8EB 1ZL9A 3TOTA 2XBIA 2JZTA 2IFQB 5J5NA 1TTZA 3UOMA 3GL5A 1U88A 2OADA 1B4PA 2DIYA 4ML1A 3QCPA 5JCGA 3APQA 2B6MA 5AN1A 4QL9A 5JCUA 2HT9A 3ZFLA 5HFKA 3UBLA 3GYKA 2EC4A 4Q5NA 4GF0A 1SJ6A 1PX7A 2FLSA 3HJMA 5EY6A 3HDCA 3DMLA 5C04A 3MAKA 2H6ZA 1VF3A 3CBUA 2GTUA 2OBIA 1PRXA 2G0FA 1ERWA 4LL1B 4MJEA 3IDVA 1O8WA 1E2YA 5IMAA 1EP7A 1FVJA 4X43A 5DCGA 1PD21 4QL7A 3IOSA 4RQXA 3F6DA 4AJ8A 4EF0A 2O8VB 1H4OA 3IC4A 1XW5A 1MTCA 2WCIA 3EINA 3KMOA 3ZITA 3LSZA 1FG4A 1O73A 1TW9A 1Z7PA 5J9CA 5CRWA 5G30A 2VD1A 3HJOA 3D6IA 4OMVA 4AJ6A 4MLYA 4EO3A 2BTOT 2Z9SA 1AXDA 1OC3A 2LKUA 4JR6A 4K7OA 1Z5YE 3VURA 1M2AA 4FO5A 2QC7A 5IMZA 3DD3A 3A2XA 3DWVA 6GSXA 2DBCA 1OC9B 2R37A 1GLPA 3ZVJD 5IMFA 3TJBA 3KP9A 4NHZA 3BBYA 2GZYA 1EGRA 5HR1A 5JWRB 1HQOA 5G1LA 2CA8A 3UVTA 5G2ZA 2I3YA 1QUWA 3LQ7A 4NXIA 1NSWA 2K9FA 4K0NA 5JCWA 2VCZA 4EDZA 1XW9A 3N5OA 2YJHA 2LRTA 3FZ5A 1JZRA 1H75A 4NPBA 2H1GA 5CNWA 1KEBA 5IQYA 2YOIA 1TOFA 3CMIA 2C1YA 2JADA 3EC3A 1F3BA 1C72A 1X9SB 2YCDA 3NIVA 2B5EA 5KN0A 1T3BA 3CSHA 3TOUA 5EPFA 3HZ8A 1GUMA 1ZZYA 1GSSA 4MH3A 1J08A 1YF1A 5AIVA 1XVQA 1OC9A 3Q6OA 3I69A 3ZRDA 3MSZA 1GSEA 3DRNA 2AUVA 2DJ0A 5CRGA 3H79A 2L5LA 3W8SA 1YEPA 2MYGA 3U6VA 2GS3A 5A4UA 3F4RA 3TKSC 2MBSA 1PSQA 1N8JA 3Q74A 3L9SA 1SJIA 1A2JA 5D9XA 2YZUA 1O6JA 3TKSE 1BYEA 2X8GA 3EE2A 2C0FA 4HS1A 2WGRA 1B48A 1X0RA 4F82A 4HDEA 2VOCA 1OC8A 4LL4B 3VWWA 2AHEA 3HVVA 5ECKB 5IO2A 3F9UA 4NMUA 2C80A 2CVDA 1YZXA 1TJDA 3JCML 2C8UA 4MPGA 3L9UA 4BL7A 1EP8A 3EYTA 2O87A 2YANA 2PVOC 4DSSB 3M8NA 4HI7A 2KUCA 3F8UA 4IP6A 3OR5A 4PNFA 4TN8A 3DYRA 4O32A 4WF4A 2N5FA 5AIXA 2IMDA 2VO4A 4XRAA 3G7JA 1ERTA 4TRXA 4F2IA 1R7HA 1EOHA 4WBJA 3VK9A 17GSA 5CYYA 3VI5A 2N5BA 2VUPA 5D9TA 1THOA 1TDIA 5IMVA 1I9DA 4OWYA 3KEBA 3I43A 1HNCA 1GTIA 2DJ2A 2P5QA 1GP1A 4WETA 1A2LA 5KN3A 5J41A 2DC5A 3EU4A 3L0HA 3F4SA 4I5QA 4ZL7A 8GSSA 3KXOA 3GURA 4GQCA 3P8WA 5HFIA 1PKWA 5DJMA 3P7XA 4HEA2 3GNJA 1SK0A 2QSIA 2GGTA 3W8JA 1TU8A 3ZL5A 4OCFA 2VM1A 2BMXA 2YV9A 2V6KA 6GSUA 5IIZA 1K0DA 1AC1A 3GKKA 5DALA 4YQVA 1TXXA 3PR8A 5CRDA 2XPEA 1GSYA 2HRFA 3KH9A 2NDOA 2H1BA 5H5RA 4KSMA 1GTAA 4GSNA 3IHQA 3ZVJA 1V57A 5HR0A 2LEGA 1M9AA 1RQMA 2OE1A 2H72A 2JSZA 4PNGA 4YQMA 2DMLA 4MCUA 1GNWA 2L6CA 3ME7A 1X9WB 2CT6A 5G5EA 4IQ1A 2A2RA 1WRYA 2V1MA 3IAM2 3ZTLA 3LXZA 2VCQA 2CX3A 3GKXA 2YWIA 4EL1A 4GSTA 1V9WA 1CQHA 5GAPD 2TRXA 4JRRA 4KDUA 4H86A 1FW1A 3RHBA 4LMVA 3KH7A 3GH6A 2VLTA 3DEXA 4ZBBA 2VCWA 1ZGNA 2IMKA 3M1GA 4PURA 2V6OA 2GSQA 13GSA 3HHVA 3U5RE 1GTUA 3WD6A 4IN0A 2NBSA 3IAS2 3TKQA 2RUFA 4YAPA 2J23A 2L4CA 2HFDA 1AIUA 1F6MC 5CO3A 2LUSA 3N9JA 4F0CA 1IYIA 1U3IA 3EU3A 4KAEA 1TKDB 1LBKA 1M99A 3F63A 3O3TA 2P31A 3W6GA 2YPMA 4AGSA 1ZYQB 4EDYA 2OE0A 3I6AA 3ERWA 2BJXA 3L9VA 1HD2A 2KOKA 3J7Yk 4CW9A 3KZQA 4EXJA 5DDLA 3APOA 3TJJA 4Z7XA 2H6XA 4TR3A 1U6TA 4YQUA 2H0GA 4XCSA 2MBTA 3IK7A 1SK1A 3RPPA 3GN3A 2H71A 4IELA 3ZZXA 3C1SA 4FYCA 2QGVA 5AGYA 4DSQA 1TU7A 3RAZA 2LRNA 3WYWA 5F05A 3VWVA 4BWSA 2CZ3A 3KTBA 4RI7A 3IRAA 5COHA 2FNOA 1OVNA 1GWCA 4ZBDA 1K0BA 2F8AA 1EOGA 2HYXA 5ECNB 4YH2A 4XRDA 1JHBA 1QXHA 2LS5A 1AUCA 2AJQB 4CDOA 1URMA 1XOBA 5D9VA 4L5LA 2IJYA 5DCHA 1A0FA 3CRUA 5D96A 1DE2A 3V1WA 4WR5A 1PA3A 4JU5A 5F06A 2P5RA 2F3MA 2C0DA 1WPIA 2H6YA 2B5XA 3IE3A 2K6VA 1R5AA 1M2DA 4ISDA 1PX6A 1ERUA 2B1LA 5ENUA 1V40A 2AB6A 4TR1B 2AV4A 4YAVA 4IGJA 1SU9A 2H1AA 1SK2A 4D73A 1T00A 3FYGA 3TGZA 4PQIA 2R5GA 2YWMA 5J3RA 1BEDA 3MWHA 1XWKA 2MMNA 3FW2A 3G7YA 4TOPA 4ID0A 2XC2A 2VCXA 1XWCA 1KNGA 2JSYA 3TKPA 2PPTA 6GSWA 5DBQA 3ISOA 2I81A 1A24A 4GTUA 5DVBA 3TUEA 3LEFA 3D4MA 3HY2A 3FR9A 1OE8A 3QFBC 4RUVA 5HR2A 3RPNA 2IFQA 2LNTA 4L0UA 2C4JA 4MF6A 5ECQB 4Q5RA 3WGDA 1R5PA 2KP2A 2ZUPA 3ERFA 1EWXA 5B6MA 1A8YA 2FA4A 4GXZA 3M3MA 1K3LA 3QD9A 1N2AA 4HU7A 3MDKA 1DSBA 4TR1A 2A4VA 1TI3A 4KW6A 1YDKA 3D4TA 3QDNA 20GSA 4KSOA 3ZREA 1WMJA 2IMFA 1TRWA 2G2QA 4HQSA 4I6XA 4JZQA 2PU9C 5L71A 1PMTA 1EEJA 3QAWA 2CZ2A 3ME8A 2R4VA 4XIHA 1XBSA 3IR4A 2C0EA 3BD2A 2CV4A 3UIWA 3GTUB 3HA9A 3TKSA 3UBKA 1B4QA 5H5SA 2GQMA 1GSQA 2XPDA 4HZ2A 1YKAA 2LTKA 1XWBA 4K9ZA 5GSSA 4IBPA 3CTFA 2FCHA 3HCZA 3C7MA 4DVCA 4RI6A 3GFKA 3FZ9A 2WRTA 3EVIA 3HXSA 16GSA 2VL2C 4N30A 4MK3A 1U87A 3UL3A 4J2FA 4QQ7A 4GCIA 1O8XA 2HRNA 3EMPA 1WP0A 5FWGA 5FHIA 1USBA 1HNAA 3CXGA 4ML6A 4E8EA 4KGIA 4TR0A 4O5RA 1Z6NA 2JU5A 1EZKA 4WR4A 3UEMA 3GTUA 1SYRA 4RQRA 2YV7A 4LA1A 3ED3A 4BPYA 2QKEA 1T1VA 2ON5A 2VL9A 3TKRA 2PN8A 2X99A 5EL8A 3KCMA 3FZAA 3SWLA 4ULXA 3IK9A 3KMNA 4XS4B 1NW2A 5B7CA 4GQFA 1FB6A 3HZ4A 4FIWA 2KHPA 5B8BA 3HYPA 3E9JB 4MABA 1LJRA 1HNBA 1PN9A 5F07A 1VF4A 6GSYA 5ECSA 4J56E 2EIOA 3DVXA 5FT3A 3GV1A 3H93A 1EEMA 3O6TA 4BWQA 4Q5QA 2ZNMA 4EE0A 1FVKA 1MDKA 5KEJA 1PL1A 2FGXA 4GWRA 2B3SA 2I9HA 2VD0A 2FWFA 2EIQA 4POKA 1BX9A 4PX1A 3RDWA 2NPBA 1FB0A 4PQ1A 2IMIA 1GLQA 5IOWA 5ECMB 1ABAA 4XS4A 4GLTA 3GH9A 5CP1A 2R3XA 2H1DA 4ZIJA 4P3YB 5ABRA 4XS6A 5GSTA 1MD4A 2DJKA 4WF5A 3CSIA 5INYA 3Q19A 5HR3A 1A8LA 3ZFBA 4MJAA 4MJBA 4IP1A 1EV4A 4DSSA 2ALBA 2HLSA 2PVQA 2M80A 3GUSA 3RBTA 1BQ7A 2A2SA 2IWTA 4HJ2A 4OFMA 5ELAA 3FY7A 1ML6A 4ZB8A 1Z3EA 3FEUA 2O89A 2PMTA 4KB3A 2IPAA 4KH7A 1XVWA 1O7UA 2X8CA 3FK8A 2H0HA 1SD8A 1W89A 4KCEA 1NHOA 2HI7A 3G9BA 4K7IA 2GQLA 1V2AA 1GSFA 2MMZA 4ECIA 3GKMA 1PGTA 1Q4JA 4NWYA 2GSRA 4POLA 1B8XA 5ECHB 4EC0A 2F8FA 3GMFA 4I8BA 4ZL8A 4IHUA 2RLIA 1OYJA 4K1FA 1WE0A 3D22A 1G7OA 2E0QA 3A3TA 3VWUA 3A2VA 4MA9A 1OE7A 2KLXA 1OKDA 3A5WA 2R2JA 5A4VA 2E7PA 4IJ3A 4OFTA 2R6KA 1MDIA 2GVPA 1XOAA 4FH8A 4PUFC 5A4WA 4EKZA 3GIXA 3F6FA 3KGKA 2DJ3A 2N5AA 4K6XA 2K8SA 3C1RA 1JLVA 4NHWA 4OCEA 5D8IA 2TRCP 3BOAA 1M9BA 3C73A 5DJLA 3KIJA 4N0ZA 3TRXA 3R2QA 5HFGA 1T4YA 5GZZB 2OJLA 2WB9A 4MZBA 2CVBA 4TXOB 4V1Ag 3CTGA 5IMCA 2WDUA 4X0XA 19GSA 3M9JA 4HZ4A 5KN2A 5ECRB 2PERA 3QAGA 3UVHA 3I9V2 4JR4A 3FRCA 1U3AA 4KDYA 1K3OA 2L6DA 4MDCA 4DEJA 2P0GA 1SKWB 1SJZA 1F37A 3FHKA 4TXVA 3PINA 3G7IA 4DSRA 3GHAA 1ZOFA 1SL1B 2IL3A 1YJ6A 4TR4A 1X9MB 4O92A 3TJKA 3P90A 1GSUA 3KJYA 2RUEA 3VI7A 2ZCTA 1YKCA 3F4TA 3EMXA 2RM6A 1EGOA 1YY7A 2H75A 3LFLA 3FZ4A 4MF7A 1W4VA 2TIRA 4G19A 5IOXA 4XTSA 1ZYEA 2YWNA 2YNXA 2HXKA 1PKZA 1JZWA 3TRPA 2IN3A 4PGTA 4TXOA 2YJ7A 3WGXA 2V2GA 1A0RP 3HKRA 1GULA 1RW1A 2YN1A 3GL3A 2H30A 1XXUA 1G0TA 1BG5A 2PUKC 5DAKB 1SENA 4PUAA 3L78A 2DSAA 2GSSA 1R4WA 1ACVA 5KN1A 5IPHA 1GL8A 2OE3A 1KBNA 3GA4A 2VIMA 1DE1A 3FR6A 2FA8A 2WS2A 3AY8A 2PWJA 4MPFA 5G1KA 3VPQA 4OO4A 6GSVA 3QPMA 3IBHA 4L8EA 5D73A 4G10A 1T4ZA 3F3RA 1ILOA 2I4AA 2MZCA 2HSHA 4PXOA 3SBCA 2V32A 1Y6EA 4MZWA 1MEKA 2YZHA 2OA7A 3DVWA 4JEDA 3HVXA 6GSSA 2LJAA 1GH2A 12GSA 1FOVA 3WT2A 2M46A
chains in the Genus database with same CATH superfamily
4I2UA 2FD3A 4O7HA 4EVMA 5E59A 4TKYA 3PGTA 4KCAA 5G5FA 4K0GA 2HE3A 3H1NA 2C0GA 3UJ1A 4LLRA 2JL4A 3VPTA 3TCOA 5LNKe 4IVFA 3K8NA 4BVXA 1Z6MA 5GAND 5G31A 4ZBAA 9GSSA 3UMAA 1TK0B 4ILFA 1WWJA 4V2MA 4L5OA 2H74A 1JZOA 4MP4A 1YF0A 3KP8A 2XBQA 3LORA 4MNNA 2JACA 1G6WA 5F0GA 4KF9A 1F2EA 1TK8B 3O76A 4WXTA 2NVLA 2QA2A 2MMAA 3TJGA 3RHCA 3CRTA 4GSSA 2VL2A 3LW9A 5IM9A 2CQ9A 3IPZA 1BAYA 2JZRA 2I1UA 1M7TA 4OD7A 1VGLA 3LYKA 4X1UA 4JE1A 3VFIA 2FUG2 4I97A 22GSA 3MNGA 1J9BA 1Q98A 2IIYA 1SKRB 4CY6A 2LV3A 1XPVA 4F03A 2GT5A 2LSTA 1JLWA 3LGCA 2HZEB 4E8HA 3LYPA 2REMA 2H01A 4N11A 6GSTA 1F9MA 3GSSA 1JFUA 2GDRA 2X8HA 2VCVA 3ZMKA 4G0LA 3KD0A 3DIEA 2C3NA 3GSTA 2PGTA 4MF5A 1AQXA 1T7PB 2VL3A 1QK8A 18GSA 1ZCPA 5BMUA 2R0CA 2C3QA 2R0PA 3D5JA 1X5CA 1SD9A 1K0NA 1VF1A 5AISA 1WOUA 1K0MA 1B9XC 2IMEA 5C00A 1UVZA 1AW9A 2NTOA 1K3YA 2DJ1A 2AYTA 3DKSA 3UARA 1DUGA 1HYUA 4ZILA 4BA7A 2DMMA 3J7Yb 3WT1A 4FYUA 2EIRA 2HZEA 4WKWA 3DGQA 2HSYA 1S3CA 4F9ZA 3F0IA 4HOJA 5ECOB 3H4KA 2E2GA 1M0UA 1K0OA 4L0WA 2HNLA 1XIYA 2X49A 1THXA 2FHEA 14GSA 4BL7B 5F8BA 2O7KA 3S9FA 2OACA 2RIIA 1OKTA 5LCZA 3EURA 1K0CA 4V2NA 4I2TA 3GX8A 2E2MA 3DXBA 1VRSD 1E6BA 1A23A 1O81A 1XCCA 2HSMA 3QOUA 4IS0A 2PBJA 5ECPB 2C3TA 4JBBA 4EUYA 4IKHA 1SL2B 3FR3A 3CQFA 4K8MA 3M0FA 4G2EA 4ECJA 3Q18A 3IXRA 4ECCA 3ZLPA 3F3QA 2FWHA 2GZZA 1V98A 2H76A 1GUKA 4IQAA 5DQSA 2VLVA 3C71A 5DQYA 4Q5FA 1X5EA 4HJMA 1PN0A 1TRVA 3APSA 5ID2B 4YKFA 1SYXA 2L4QA 1QFNA 2K18A 3KM6A 4TW5A 1Z7RA 3QR6A 5IO0A 1NHYA 5IPGA 2H73A 2L5OA 4IJIA 1ERVA 3H8QA 1GNEA 2VM2A 3CYNA 1OAZA 1G7EA 1Y25A 4ZL9A 4WBRD 4N10A 1PQNA 3A2WA 1SL0B 1Z9HA 1UN2A 3IC8A 5E4WA 2CAQA 2B1KA 3TDGA 11GSA 1KTEA 4KDXA 4F0BA 4POMA 4XS1A 2OBKA 3GRXA 2WJUA 4EIQA 4ZB9A 2H19A 1G6YA 5DALB 4G0KA 3TB2A 3ZYWA 1F3AA 2YP6A 1ON4A 2WFCA 3BCIA 1CQGA 3IV4A 3BJ5A 3HD5A 5ID2A 1NM3A 1B9YC 2OKAA 4OFNA 5HQPA 3LXTA 1TK5B 2FWEA 4ZB6A 3LJRA 1QMVA 2DLXA 4KNDA 2FWGA 4GRFA 2FY6A 3FMWA 4FYBA 2LRCA 4KE3A 5H5QA 1TRSA 3WGEA 4OO5A 3QFAC 1PL2A 3QMXA 1K0AA 2YWOA 1GTBA 2VCTA 5D9WA 4HUAA 1IYHA 1RK4A 1EV9A 5B8AA 2GQKA 4MZCA 1V58A 4Z2TA 4NAXA 3GKNA 4ZXGA 2KP1A 1XZOA 1FO5A 4IW9A 2H0IA 2H70A 3L4NA 1YEXA 5LD0A 3IHGA 4EIPA 2DKHA 3ZIVA 2LJKA 4BIKA 3VWXA 4XHMA 1GSDA 4KX4A 1J0FA 2D2ZA 1X5DA 3ZIJA 1TP9A 2F9SA 1I5GA 3EWLA 5CRHA 1VF2A 3TRQA 4BVYB 2VLUA 2RM5A 2LQOA 2B7JA 1ZMAA 2K8VA 3HVSA 1MDJA 4TVEA 1UC7A 3VLNA 2GZPA 4LMWA 4MMMA 1ST9A 5BRTA 4POBA 1XW6A 4V1Ap 2AAWA 2LJRA 1WIKA 1WJKA 1XWGA 4N0VA 10GSA 1S3RA 1MD3A 2DIZA 4ECBA 2VAFA 2GT6A 2CVKA 2ES7A 4G9HA 4AJ7A 2XHFA 3GX0A 5CAXA 1AQVA 1A2MA 2B5YA 1SKSB 4KA0A 2LQQA 4Z2UA 3CSJA 2B7KA 2O85A 3M9KA 1AQWA 2H8LA 1GRXA 2MMOA 4HU9A 1AAZA 7GSSA 5JWQB 3LG6A 1S3DA 4BVYA 5JWOB 2LNSA 3HJPA 4MJCA 5A5KA 1YQ1A 5EVOA 1JZDA 1XFLA 3E3EA 4K7NA 5ECLB 4CHSA 5ECIB 5J4UA 1QQ2A 1BJXA 4K5SA 4J57E 3D0ZA 5J9BA 5ELGA 5IMDA 3TJFA 2CAIA 3KTLA 3IA1A 4ACSA 3PH9A 4V2LA 1TRUA 2X64A 4PQHA 4K2XA 3US3A 2GLRA 2L57A 4A5PA 1TI1A 2M72A 1M3JA 4WEYA 4AF2A 4NV2A 1FAAA 2ON7A 2CX4A 5D93A 4NV5A 5B6NA 3P2AA 2L59A 3R3EA 1S3AA 3ZMLA 3BCKA 1O85A 2H66A 4K2DA 2A2PA 2JZSA 2WULA 3NZNA 2V41A 5CREA 4KUNA 2WZ9A 1XWAA 1M2BA 3UAPA 4D73B 3C8EA 3E0UA 4MH2A 3QAVA 4HQZA 2GSTA 3LWAA 1FHEA 2DJJA 2HZFA 1GUHA 1LU4A 3NOFA 1QGVA 3FKFA 1DBYA 1UA5A 5DAKA 1R26A 3D21A 3ERGA 2J9HA 2F51A 1T8EB 1ZL9A 3TOTA 2XBIA 2JZTA 2IFQB 5J5NA 1TTZA 3UOMA 3GL5A 1U88A 2OADA 1B4PA 2DIYA 4ML1A 3QCPA 5JCGA 3APQA 2B6MA 5AN1A 4QL9A 5JCUA 2HT9A 3ZFLA 5HFKA 3UBLA 3GYKA 2EC4A 4Q5NA 4GF0A 1SJ6A 1PX7A 2HRKA 2FLSA 3HJMA 5EY6A 3HDCA 3DMLA 5C04A 3MAKA 2H6ZA 1VF3A 3CBUA 2GTUA 2OBIA 1PRXA 2G0FA 4O5UA 1ERWA 4LL1B 4MJEA 3IDVA 1O8WA 1E2YA 5IMAA 1EP7A 1FVJA 4X43A 5DCGA 1PD21 4QL7A 3IOSA 2UZ8A 4RQXA 3F6DA 4AJ8A 4EF0A 2O8VB 1H4OA 3IC4A 1XW5A 1MTCA 2WCIA 3EINA 3KMOA 3ZITA 3LSZA 1FG4A 1O73A 1TW9A 1Z7PA 5J9CA 5CRWA 5G30A 2VD1A 3HJOA 3D6IA 4OMVA 4AJ6A 4MLYA 4EO3A 2BTOT 2Z9SA 1AXDA 1OC3A 2LKUA 4JR6A 4K7OA 4CY8A 1Z5YE 3VURA 1M2AA 4FO5A 2QC7A 5IMZA 3DD3A 3A2XA 3DWVA 6GSXA 2DBCA 3EPTA 1OC9B 2R37A 1GLPA 3ZVJD 1ZYPA 5IMFA 3TJBA 3KP9A 4NHZA 3BBYA 2GZYA 1EGRA 5HR1A 5JWRB 1HQOA 5G1LA 2CA8A 3UVTA 5G2ZA 2I3YA 1QUWA 3LQ7A 4NXIA 1NSWA 2K9FA 4K0NA 5JCWA 4K5RA 2VCZA 4EDZA 1XW9A 3N5OA 2YJHA 2LRTA 3FZ5A 1JZRA 1H75A 4NPBA 2H1GA 5CNWA 1KEBA 5IQYA 2YOIA 1TOFA 3CMIA 2C1YA 2JADA 3EC3A 1F3BA 1C72A 1X9SB 2YCDA 3NIVA 2B5EA 5KN0A 1T3BA 3CSHA 3TOUA 5EPFA 3HZ8A 1GUMA 1ZZYA 1GSSA 4MH3A 1J08A 1YF1A 3A5IA 5AIVA 1XVQA 1OC9A 3Q6OA 3I69A 3ZRDA 3MSZA 1GSEA 3DRNA 2R0GA 2AUVA 2DJ0A 5CRGA 3H79A 2L5LA 3W8SA 1YEPA 2MYGA 3U6VA 2GS3A 5A4UA 3F4RA 3TKSC 2MBSA 1PSQA 1N8JA 3Q74A 3L9SA 1SJIA 1A2JA 5D9XA 2YZUA 1O6JA 3TKSE 1BYEA 2X8GA 3EE2A 2C0FA 4HS1A 2WGRA 1B48A 1X0RA 4F82A 4HDEA 2VOCA 1OC8A 4LL4B 3VWWA 2AHEA 3HVVA 5ECKB 5IO2A 3F9UA 4NMUA 2C80A 2CVDA 1YZXA 1TJDA 3JCML 1PFOA 2C8UA 4MPGA 3L9UA 4BL7A 1EP8A 3EYTA 2O87A 2YANA 2PVOC 4DSSB 3M8NA 4HI7A 2KUCA 3F8UA 4IP6A 3OR5A 4PNFA 4TN8A 3DYRA 4O32A 4WF4A 2N5FA 5AIXA 2IMDA 2VO4A 4XRAA 3G7JA 1ERTA 4TRXA 4F2IA 1R7HA 1EOHA 4WBJA 3VK9A 17GSA 5CYYA 3VI5A 2N5BA 2VUPA 5D9TA 1THOA 3HVNA 1TDIA 5IMVA 1I9DA 4OWYA 3KEBA 3I43A 4HSCX 1HNCA 1GTIA 2DJ2A 2P5QA 1GP1A 4WETA 1A2LA 5KN3A 5J41A 2DC5A 3EU4A 3L0HA 3F4SA 4FQUA 4I5QA 4ZL7A 8GSSA 3KXOA 3GURA 4GQCA 3P8WA 5HFIA 1PKWA 5DJMA 3P7XA 4HEA2 3GNJA 1SK0A 2QSIA 2GGTA 3W8JA 1TU8A 3ZL5A 4OCFA 2VM1A 2BMXA 2YV9A 2V6KA 6GSUA 5IIZA 1K0DA 1AC1A 3GKKA 5DALA 4YQVA 1TXXA 3PR8A 5CRDA 2XPEA 1GSYA 2HRFA 3KH9A 2NDOA 2H1BA 4G0IA 5H5RA 4KSMA 1GTAA 4GSNA 3IHQA 3ZVJA 1V57A 5HR0A 2LEGA 1M9AA 1RQMA 2OE1A 2H72A 2JSZA 4PNGA 4YQMA 2DMLA 4MCUA 1GNWA 2L6CA 3ME7A 1X9WB 2CT6A 5G5EA 4IQ1A 2A2RA 1WRYA 2V1MA 3IAM2 3ZTLA 3LXZA 2VCQA 2CX3A 3GKXA 2YWIA 4EL1A 4GSTA 1V9WA 1CQHA 5GAPD 2TRXA 4JRRA 4KDUA 4H86A 1FW1A 3RHBA 4LMVA 3KH7A 3GH6A 2VLTA 3DEXA 4ZBBA 2VCWA 1ZGNA 2IMKA 3M1GA 4PURA 2V6OA 2GSQA 13GSA 3HHVA 3U5RE 1GTUA 3WD6A 4IN0A 2NBSA 3IAS2 3TKQA 2RUFA 4YAPA 2J23A 2L4CA 2HFDA 1AIUA 1F6MC 5CO3A 2LUSA 3N9JA 4F0CA 1IYIA 1U3IA 3EU3A 4KAEA 1TKDB 1LBKA 1M99A 3F63A 3O3TA 2P31A 3W6GA 2YPMA 4AGSA 1ZYQB 4EDYA 2OE0A 3I6AA 3ERWA 2BJXA 3L9VA 1HD2A 2KOKA 3J7Yk 4CW9A 3KZQA 4EXJA 5DDLA 3APOA 3TJJA 4Z7XA 2H6XA 1XG8A 4TR3A 1U6TA 4YQUA 2H0GA 4XCSA 2MBTA 3IK7A 1SK1A 3RPPA 3GN3A 2H71A 4IELA 3ZZXA 3C1SA 4FYCA 2QGVA 5AGYA 4DSQA 1TU7A 3RAZA 2LRNA 4PTSA 3WYWA 5F05A 3VWVA 4BWSA 2CZ3A 3KTBA 4RI7A 3IRAA 5COHA 2FNOA 1OVNA 1GWCA 4ZBDA 1K0BA 2F8AA 1EOGA 2HYXA 5ECNB 4YH2A 4XRDA 1JHBA 3MIXA 1QXHA 2LS5A 1AUCA 4BVXB 2AJQB 4CDOA 1URMA 1XOBA 5D9VA 4L5LA 2IJYA 5DCHA 1A0FA 3CRUA 5D96A 1DE2A 3V1WA 4WR5A 1PA3A 4JU5A 5F06A 2P5RA 2F3MA 2C0DA 1WPIA 4X4JA 2H6YA 2B5XA 3IE3A 2K6VA 1R5AA 1M2DA 4ISDA 1PX6A 1ERUA 2B1LA 5ENUA 1V40A 2AB6A 4TR1B 3PPUA 2AV4A 4YAVA 4IGJA 1SU9A 2H1AA 1SK2A 4D73A 1T00A 3FYGA 3TGZA 1FOHA 4PQIA 2R5GA 2YWMA 5J3RA 1BEDA 3MWHA 1XWKA 2MMNA 3FW2A 3G7YA 4TOPA 4ID0A 2XC2A 2VCXA 1XWCA 1KNGA 2JSYA 3TKPA 2PPTA 6GSWA 5DBQA 3ISOA 2I81A 1A24A 4GTUA 5DVBA 4YKGA 3TUEA 3LEFA 3D4MA 3HY2A 4O5QA 3FR9A 1OE8A 3QFBC 4RUVA 5HR2A 3RPNA 2IFQA 2LNTA 4L0UA 2C4JA 4MF6A 5ECQB 4Q5RA 3WGDA 1R5PA 2KP2A 2ZUPA 3ERFA 1EWXA 5B6MA 1A8YA 2FA4A 4GXZA 3M3MA 1K3LA 3QD9A 1N2AA 4HU7A 3MDKA 1DSBA 1M3IA 4TR1A 2A4VA 1TI3A 4KW6A 1YDKA 3D4TA 3QDNA 20GSA 4KSOA 3ZREA 1WMJA 2IMFA 1TRWA 2G2QA 4HQSA 4I6XA 4JZQA 2PU9C 5L71A 1PMTA 1EEJA 3QAWA 2CZ2A 3ME8A 4USSA 2R4VA 4XIHA 1XBSA 3IR4A 2C0EA 3BD2A 2CV4A 3UIWA 3GTUB 3HA9A 3TKSA 3UBKA 1B4QA 5H5SA 2GQMA 1GSQA 2XPDA 4HZ2A 1YKAA 2LTKA 1XWBA 4K9ZA 5GSSA 4IBPA 3CTFA 2FCHA 3HCZA 3C7MA 4DVCA 4RI6A 3GFKA 3FZ9A 2WRTA 3EVIA 3HXSA 16GSA 2VL2C 4N30A 4MK3A 1U87A 3UL3A 4J2FA 4QQ7A 4GCIA 1O8XA 2HRNA 3EMPA 1WP0A 5FWGA 5FHIA 1USBA 1HNAA 3CXGA 4ML6A 4E8EA 4KGIA 4TR0A 4O5RA 1Z6NA 2JU5A 1EZKA 4WR4A 4ICYA 3UEMA 3GTUA 1SYRA 4RQRA 2YV7A 4LA1A 3ED3A 4BPYA 2QKEA 1T1VA 2ON5A 2VL9A 3TKRA 2PN8A 2X99A 5EL8A 3KCMA 3FZAA 3SWLA 4ULXA 3IK9A 3KMNA 4XS4B 1NW2A 5B7CA 4GQFA 1FB6A 3HZ4A 4FIWA 2KHPA 5B8BA 3HYPA 3E9JB 4MABA 5KOWA 1LJRA 1HNBA 1PN9A 5F07A 1VF4A 6GSYA 5ECSA 4J56E 1ZYNA 2EIOA 3DVXA 5FT3A 3GV1A 3H93A 1EEMA 3O6TA 4BWQA 4Q5QA 2ZNMA 4EE0A 1FVKA 1MDKA 5KEJA 1PL1A 2FGXA 4GWRA 2B3SA 2I9HA 2VD0A 2FWFA 2EIQA 4POKA 1BX9A 4PX1A 3RDWA 2NPBA 1FB0A 3MYDA 4PQ1A 2IMIA 1GLQA 5IOWA 5ECMB 1ABAA 4XS4A 4GLTA 3GH9A 5CP1A 2R3XA 2DKIA 2H1DA 4ZIJA 4P3YB 5ABRA 4XS6A 5GSTA 1MD4A 2DJKA 4WF5A 3CSIA 5INYA 3Q19A 5HR3A 1A8LA 3ZFBA 4MJAA 4MJBA 4IP1A 2X4AA 1EV4A 4DSSA 2ALBA 2HLSA 2PVQA 2M80A 3GUSA 3RBTA 1BQ7A 2A2SA 2IWTA 4HJ2A 4OFMA 5ELAA 3FY7A 1ML6A 4ZB8A 1Z3EA 3FEUA 2O89A 2PMTA 4KB3A 2IPAA 4KH7A 1XVWA 1O7UA 2X8CA 3FK8A 2H0HA 1SD8A 1W89A 4KCEA 1NHOA 2HI7A 3G9BA 4K7IA 2GQLA 1V2AA 1GSFA 2MMZA 4ECIA 3GKMA 1PGTA 1Q4JA 4NWYA 2GSRA 4POLA 1B8XA 5ECHB 4EC0A 2F8FA 3GMFA 4I8BA 4ZL8A 4IHUA 2RLIA 1OYJA 4K1FA 1WE0A 3D22A 1G7OA 2E0QA 3A3TA 3VWUA 3A2VA 4MA9A 1OE7A 2KLXA 1OKDA 3A5WA 2R2JA 5A4VA 2E7PA 4IJ3A 4OFTA 5KOXA 2R6KA 1MDIA 2GVPA 1XOAA 4FH8A 4PUFC 5A4WA 4EKZA 3GIXA 3F6FA 3KGKA 2DJ3A 2N5AA 4K6XA 2K8SA 3C1RA 1JLVA 4NHWA 4OCEA 5D8IA 2TRCP 3BOAA 1M9BA 3C73A 5DJLA 3KIJA 4N0ZA 3TRXA 3R2QA 5HFGA 1T4YA 5GZZB 2A4HA 2OJLA 2WB9A 4MZBA 2CVBA 4TXOB 4V1Ag 3CTGA 5IMCA 2WDUA 4X0XA 19GSA 4Z2RA 3M9JA 4HZ4A 5KN2A 5ECRB 2PERA 3QAGA 3UVHA 3I9V2 4JR4A 3FRCA 1U3AA 4KDYA 1K3OA 2L6DA 4MDCA 4DEJA 2P0GA 1SKWB 1SJZA 1F37A 3FHKA 4TXVA 3PINA 3G7IA 4DSRA 3GHAA 1ZOFA 1SL1B 2IL3A 1YJ6A 4TR4A 1X9MB 4O92A 3TJKA 3P90A 1GSUA 3KJYA 2RUEA 3VI7A 2ZCTA 1YKCA 3F4TA 3EMXA 2RM6A 1EGOA 1YY7A 2H75A 3LFLA 3FZ4A 4MF7A 1W4VA 2TIRA 4G19A 5IOXA 4XTSA 1ZYEA 2YWNA 2YNXA 2HXKA 1PKZA 1JZWA 3TRPA 2IN3A 4PGTA 4TXOA 2QA1A 2YJ7A 3WGXA 2V2GA 1A0RP 3HKRA 1GULA 1RW1A 2YN1A 3GL3A 2H30A 1XXUA 1G0TA 1BG5A 2PUKC 5DAKB 1SENA 4PUAA 3L78A 2DSAA 2GSSA 1R4WA 1ACVA 5KN1A 5IPHA 1GL8A 2OE3A 1KBNA 3GA4A 2VIMA 1DE1A 3FR6A 2FA8A 2WS2A 3AY8A 2PWJA 4MPFA 5G1KA 3VPQA 4OO4A 6GSVA 3QPMA 3IBHA 4L8EA 5D73A 4G10A 1T4ZA 3F3RA 1ILOA 2I4AA 2MZCA 2HSHA 4PXOA 3SBCA 2V32A 1Y6EA 4MZWA 1MEKA 2YZHA 2OA7A 3DVWA 2HRAA 4JEDA 3HVXA 6GSSA 2LJAA 1GH2A 12GSA 1FOVA 3WT2A 2M46A
chains in the Genus database with same CATH topology
4I2UA 2FD3A 4O7HA 4EVMA 5E59A 4TKYA 3PGTA 4KCAA 5G5FA 4K0GA 2HE3A 3H1NA 2C0GA 3UJ1A 4LLRA 2JL4A 3VPTA 3TCOA 5LNKe 4IVFA 3K8NA 4BVXA 1Z6MA 5GAND 5G31A 4ZBAA 9GSSA 3UMAA 1TK0B 4ILFA 1WWJA 4V2MA 4L5OA 2H74A 1JZOA 4MP4A 1YF0A 3KP8A 2XBQA 3LORA 4MNNA 2JACA 1G6WA 5F0GA 4KF9A 1F2EA 1TK8B 3O76A 4WXTA 2NVLA 2QA2A 2MMAA 3TJGA 3RHCA 3CRTA 4GSSA 2VL2A 3LW9A 5IM9A 2CQ9A 3IPZA 1BAYA 2JZRA 2I1UA 1M7TA 4OD7A 1VGLA 3LYKA 4X1UA 4JE1A 3VFIA 2FUG2 4I97A 22GSA 3MNGA 1J9BA 1Q98A 2IIYA 1SKRB 4CY6A 2LV3A 1XPVA 4F03A 2GT5A 2LSTA 1JLWA 3LGCA 2HZEB 4E8HA 3LYPA 2REMA 2H01A 4N11A 6GSTA 1F9MA 3GSSA 1JFUA 2GDRA 2X8HA 2VCVA 3ZMKA 4G0LA 3KD0A 3DIEA 2C3NA 3GSTA 2PGTA 4MF5A 1AQXA 1T7PB 2VL3A 1QK8A 18GSA 1ZCPA 5BMUA 2R0CA 2C3QA 2R0PA 3D5JA 1X5CA 1SD9A 1K0NA 1VF1A 5AISA 1WOUA 1K0MA 1B9XC 2IMEA 5C00A 1UVZA 1AW9A 2NTOA 1K3YA 2DJ1A 2AYTA 3DKSA 3UARA 1DUGA 1HYUA 4ZILA 4BA7A 2DMMA 3J7Yb 3WT1A 4FYUA 2EIRA 2HZEA 4WKWA 3DGQA 2HSYA 1S3CA 4F9ZA 3F0IA 4HOJA 5ECOB 3H4KA 2E2GA 1M0UA 1K0OA 4L0WA 2HNLA 1XIYA 2X49A 1THXA 2FHEA 14GSA 4BL7B 5F8BA 2O7KA 3S9FA 2OACA 2RIIA 1OKTA 5LCZA 3EURA 1K0CA 4V2NA 4I2TA 3GX8A 2E2MA 3DXBA 1VRSD 1E6BA 1A23A 1O81A 1XCCA 2HSMA 3QOUA 4IS0A 2PBJA 5ECPB 2C3TA 4JBBA 4EUYA 4IKHA 1SL2B 3FR3A 4K8MA 3M0FA 4G2EA 4ECJA 3Q18A 3IXRA 4ECCA 3ZLPA 3F3QA 2FWHA 2GZZA 1V98A 2H76A 1GUKA 4IQAA 5DQSA 2VLVA 3C71A 5DQYA 4Q5FA 1X5EA 4HJMA 1PN0A 1TRVA 3APSA 5ID2B 4YKFA 1SYXA 2L4QA 1QFNA 2K18A 3KM6A 4TW5A 1Z7RA 3QR6A 5IO0A 1NHYA 5IPGA 2H73A 2L5OA 4IJIA 1ERVA 3H8QA 1GNEA 2VM2A 3CYNA 1OAZA 1G7EA 1Y25A 4ZL9A 4WBRD 4N10A 1PQNA 3A2WA 1SL0B 1Z9HA 1UN2A 3IC8A 5E4WA 2CAQA 2B1KA 3TDGA 11GSA 1KTEA 4KDXA 4F0BA 4POMA 4XS1A 2OBKA 3GRXA 2WJUA 4EIQA 4ZB9A 2H19A 1G6YA 5DALB 4G0KA 3TB2A 3ZYWA 1F3AA 2YP6A 1ON4A 2WFCA 3BCIA 1CQGA 3IV4A 3BJ5A 3HD5A 5ID2A 1NM3A 1B9YC 2OKAA 4OFNA 5HQPA 3LXTA 1TK5B 2FWEA 4ZB6A 3LJRA 1QMVA 2DLXA 4KNDA 2FWGA 4GRFA 2FY6A 3FMWA 4FYBA 2LRCA 4KE3A 5H5QA 1TRSA 3WGEA 4OO5A 3QFAC 1PL2A 3QMXA 1K0AA 2YWOA 1GTBA 2VCTA 5D9WA 4HUAA 1IYHA 1RK4A 1EV9A 5B8AA 2GQKA 4MZCA 1V58A 4Z2TA 4NAXA 3GKNA 4ZXGA 2KP1A 1XZOA 1FO5A 4IW9A 2H0IA 2H70A 3L4NA 1YEXA 5LD0A 3IHGA 4EIPA 2DKHA 3ZIVA 2LJKA 3VWXA 4XHMA 1GSDA 4KX4A 1J0FA 2D2ZA 1X5DA 3ZIJA 1TP9A 2F9SA 1I5GA 3EWLA 5CRHA 1VF2A 3TRQA 4BVYB 2VLUA 2RM5A 2LQOA 2B7JA 1ZMAA 2K8VA 3HVSA 1MDJA 4TVEA 1UC7A 3VLNA 2GZPA 4LMWA 4MMMA 1ST9A 5BRTA 4POBA 1XW6A 4V1Ap 2AAWA 2LJRA 1WIKA 1WJKA 1XWGA 4N0VA 10GSA 1MD3A 2DIZA 4ECBA 2VAFA 2GT6A 2CVKA 2ES7A 4G9HA 4AJ7A 2XHFA 3GX0A 5CAXA 1AQVA 1A2MA 2B5YA 1SKSB 4KA0A 2LQQA 4Z2UA 3CSJA 2B7KA 2O85A 3M9KA 1AQWA 2H8LA 1GRXA 2MMOA 4HU9A 1AAZA 7GSSA 5JWQB 3LG6A 1S3DA 4BVYA 5JWOB 2LNSA 3HJPA 4MJCA 5A5KA 1YQ1A 5EVOA 1JZDA 1XFLA 3E3EA 4K7NA 5ECLB 4CHSA 5ECIB 5J4UA 1QQ2A 1BJXA 4K5SA 4J57E 3D0ZA 5J9BA 5ELGA 5IMDA 3TJFA 2CAIA 3KTLA 3IA1A 4ACSA 3PH9A 4V2LA 1TRUA 2X64A 4PQHA 4K2XA 3US3A 2GLRA 2L57A 4A5PA 1TI1A 2M72A 4WEYA 4AF2A 4NV2A 1FAAA 2ON7A 2CX4A 5D93A 4NV5A 5B6NA 3P2AA 2L59A 3R3EA 1S3AA 3ZMLA 3BCKA 1O85A 2H66A 4K2DA 2A2PA 2JZSA 2WULA 3NZNA 2V41A 5CREA 4KUNA 2WZ9A 1XWAA 1M2BA 3UAPA 4D73B 3C8EA 3E0UA 4MH2A 3QAVA 4HQZA 2GSTA 3LWAA 1FHEA 2DJJA 2HZFA 1GUHA 1LU4A 3NOFA 1QGVA 3FKFA 1DBYA 1UA5A 5DAKA 1R26A 3D21A 3ERGA 2J9HA 2F51A 1T8EB 1ZL9A 3TOTA 2XBIA 2JZTA 2IFQB 5J5NA 1TTZA 3UOMA 3GL5A 1U88A 2OADA 1B4PA 2DIYA 4ML1A 3QCPA 5JCGA 3APQA 2B6MA 5AN1A 4QL9A 5JCUA 2HT9A 3ZFLA 5HFKA 3UBLA 3GYKA 2EC4A 4Q5NA 4GF0A 1SJ6A 1PX7A 2HRKA 2FLSA 3HJMA 5EY6A 3HDCA 3DMLA 5C04A 3MAKA 2H6ZA 1VF3A 3CBUA 2GTUA 2OBIA 1PRXA 2G0FA 4O5UA 1ERWA 4LL1B 4MJEA 3IDVA 1O8WA 1E2YA 5IMAA 1EP7A 1FVJA 4X43A 5DCGA 1PD21 4QL7A 3IOSA 2UZ8A 4RQXA 3F6DA 4AJ8A 4EF0A 2O8VB 1H4OA 3IC4A 1XW5A 1MTCA 2WCIA 3EINA 3KMOA 3ZITA 3LSZA 1FG4A 1O73A 1TW9A 1Z7PA 5J9CA 5CRWA 5G30A 2VD1A 3HJOA 3D6IA 4OMVA 4AJ6A 4MLYA 4EO3A 2BTOT 2Z9SA 1AXDA 1OC3A 2LKUA 4JR6A 4K7OA 4CY8A 1Z5YE 3VURA 1M2AA 4FO5A 2QC7A 5IMZA 3DD3A 3A2XA 3DWVA 6GSXA 2DBCA 3EPTA 1OC9B 2R37A 1GLPA 3ZVJD 1ZYPA 5IMFA 3TJBA 3KP9A 4NHZA 3BBYA 2GZYA 1EGRA 5HR1A 5JWRB 1HQOA 5G1LA 2CA8A 3UVTA 5G2ZA 2I3YA 1QUWA 3LQ7A 4NXIA 1NSWA 2K9FA 4K0NA 5JCWA 4K5RA 2VCZA 4EDZA 1XW9A 3N5OA 2YJHA 2LRTA 3FZ5A 1JZRA 1H75A 4NPBA 2H1GA 5CNWA 1KEBA 5IQYA 2YOIA 1TOFA 3CMIA 2C1YA 2JADA 3EC3A 1F3BA 1C72A 1X9SB 2YCDA 3NIVA 2B5EA 5KN0A 1T3BA 3CSHA 3TOUA 5EPFA 3HZ8A 1GUMA 1ZZYA 1GSSA 4MH3A 1J08A 1YF1A 3A5IA 5AIVA 1XVQA 1OC9A 3Q6OA 3I69A 3ZRDA 3MSZA 1GSEA 3DRNA 2R0GA 2AUVA 2DJ0A 5CRGA 3H79A 2L5LA 3W8SA 1YEPA 2MYGA 3U6VA 2GS3A 5A4UA 3F4RA 3TKSC 2MBSA 1PSQA 1N8JA 3Q74A 3L9SA 1SJIA 1A2JA 5D9XA 2YZUA 1O6JA 3TKSE 1BYEA 2X8GA 3EE2A 2C0FA 4HS1A 2WGRA 1B48A 1X0RA 4F82A 4HDEA 2VOCA 1OC8A 4LL4B 3VWWA 2AHEA 3HVVA 5ECKB 5IO2A 3F9UA 4NMUA 2C80A 2CVDA 1YZXA 1TJDA 3JCML 2C8UA 4MPGA 3L9UA 4BL7A 1EP8A 3EYTA 2O87A 2YANA 2PVOC 4DSSB 3M8NA 4HI7A 2KUCA 3F8UA 4IP6A 3OR5A 4PNFA 4TN8A 3DYRA 4O32A 4WF4A 2N5FA 5AIXA 2IMDA 2VO4A 4XRAA 3G7JA 1ERTA 4TRXA 4F2IA 1R7HA 1EOHA 4WBJA 3VK9A 17GSA 5CYYA 3VI5A 2N5BA 2VUPA 5D9TA 1THOA 1TDIA 5IMVA 1I9DA 4OWYA 3KEBA 3I43A 1HNCA 1GTIA 2DJ2A 2P5QA 1GP1A 4WETA 1A2LA 5KN3A 5J41A 2DC5A 3EU4A 3L0HA 3F4SA 4FQUA 4I5QA 4ZL7A 8GSSA 3KXOA 3GURA 4GQCA 3P8WA 5HFIA 1PKWA 5DJMA 3P7XA 4HEA2 3GNJA 1SK0A 2QSIA 2GGTA 3W8JA 1TU8A 3ZL5A 4OCFA 2VM1A 2BMXA 2YV9A 2V6KA 6GSUA 5IIZA 1K0DA 1AC1A 3GKKA 5DALA 4YQVA 1TXXA 3PR8A 5CRDA 2XPEA 1GSYA 2HRFA 3KH9A 2NDOA 2H1BA 4G0IA 5H5RA 4KSMA 1GTAA 4GSNA 3IHQA 3ZVJA 1V57A 5HR0A 2LEGA 1M9AA 1RQMA 2OE1A 2H72A 2JSZA 4PNGA 4YQMA 2DMLA 4MCUA 1GNWA 2L6CA 3ME7A 1X9WB 2CT6A 5G5EA 4IQ1A 2A2RA 1WRYA 2V1MA 3IAM2 3ZTLA 3LXZA 2VCQA 2CX3A 3GKXA 2YWIA 4EL1A 4GSTA 1V9WA 1CQHA 5GAPD 2TRXA 4JRRA 4KDUA 4H86A 1FW1A 3RHBA 4LMVA 3KH7A 3GH6A 2VLTA 3DEXA 4ZBBA 2VCWA 1ZGNA 2IMKA 3M1GA 4PURA 2V6OA 2GSQA 13GSA 3HHVA 3U5RE 1GTUA 3WD6A 4IN0A 2NBSA 3IAS2 3TKQA 2RUFA 4YAPA 2J23A 2L4CA 2HFDA 1AIUA 1F6MC 5CO3A 2LUSA 3N9JA 4F0CA 1IYIA 1U3IA 3EU3A 4KAEA 1TKDB 1LBKA 1M99A 3F63A 3O3TA 2P31A 3W6GA 2YPMA 4AGSA 1ZYQB 4EDYA 2OE0A 3I6AA 3ERWA 2BJXA 3L9VA 1HD2A 2KOKA 3J7Yk 4CW9A 3KZQA 4EXJA 5DDLA 3APOA 3TJJA 4Z7XA 2H6XA 4TR3A 1U6TA 4YQUA 2H0GA 4XCSA 2MBTA 3IK7A 1SK1A 3RPPA 3GN3A 2H71A 4IELA 3ZZXA 3C1SA 4FYCA 2QGVA 5AGYA 4DSQA 1TU7A 3RAZA 2LRNA 4PTSA 3WYWA 5F05A 3VWVA 4BWSA 2CZ3A 3KTBA 4RI7A 3IRAA 5COHA 2FNOA 1OVNA 1GWCA 4ZBDA 1K0BA 2F8AA 1EOGA 2HYXA 5ECNB 4YH2A 4XRDA 1JHBA 3MIXA 1QXHA 2LS5A 1AUCA 4BVXB 2AJQB 4CDOA 1URMA 1XOBA 5D9VA 4L5LA 2IJYA 5DCHA 1A0FA 3CRUA 5D96A 1DE2A 3V1WA 4WR5A 1PA3A 4JU5A 5F06A 2P5RA 2F3MA 2C0DA 1WPIA 4X4JA 2H6YA 2B5XA 3IE3A 2K6VA 1R5AA 1M2DA 4ISDA 1PX6A 1ERUA 2B1LA 5ENUA 1V40A 2AB6A 4TR1B 3PPUA 2AV4A 4YAVA 4IGJA 1SU9A 2H1AA 1SK2A 4D73A 1T00A 3FYGA 3TGZA 1FOHA 4PQIA 2R5GA 2YWMA 5J3RA 1BEDA 3MWHA 1XWKA 2MMNA 3FW2A 3G7YA 4TOPA 4ID0A 2XC2A 2VCXA 1XWCA 1KNGA 2JSYA 3TKPA 2PPTA 6GSWA 5DBQA 3ISOA 2I81A 1A24A 4GTUA 5DVBA 4YKGA 3TUEA 3LEFA 3D4MA 3HY2A 4O5QA 3FR9A 1OE8A 3QFBC 4RUVA 5HR2A 3RPNA 2IFQA 2LNTA 4L0UA 2C4JA 4MF6A 5ECQB 4Q5RA 3WGDA 1R5PA 2KP2A 2ZUPA 3ERFA 1EWXA 5B6MA 1A8YA 2FA4A 4GXZA 3M3MA 1K3LA 3QD9A 1N2AA 4HU7A 3MDKA 1DSBA 4TR1A 2A4VA 1TI3A 4KW6A 1YDKA 3D4TA 3QDNA 20GSA 4KSOA 3ZREA 1WMJA 2IMFA 1TRWA 2G2QA 4HQSA 4I6XA 4JZQA 2PU9C 5L71A 1PMTA 1EEJA 3QAWA 2CZ2A 3ME8A 4USSA 2R4VA 4XIHA 1XBSA 3IR4A 2C0EA 3BD2A 2CV4A 3UIWA 3GTUB 3HA9A 3TKSA 3UBKA 1B4QA 5H5SA 2GQMA 1GSQA 2XPDA 4HZ2A 1YKAA 2LTKA 1XWBA 4K9ZA 5GSSA 4IBPA 3CTFA 2FCHA 3HCZA 3C7MA 4DVCA 4RI6A 3GFKA 3FZ9A 2WRTA 3EVIA 3HXSA 16GSA 2VL2C 4N30A 4MK3A 1U87A 3UL3A 4J2FA 4QQ7A 4GCIA 1O8XA 2HRNA 3EMPA 1WP0A 5FWGA 5FHIA 1USBA 1HNAA 3CXGA 4ML6A 4E8EA 4KGIA 4TR0A 4O5RA 1Z6NA 2JU5A 1EZKA 4WR4A 4ICYA 3UEMA 3GTUA 1SYRA 4RQRA 2YV7A 4LA1A 3ED3A 4BPYA 2QKEA 1T1VA 2ON5A 2VL9A 3TKRA 2PN8A 2X99A 5EL8A 3KCMA 3FZAA 3SWLA 4ULXA 3IK9A 3KMNA 4XS4B 1NW2A 5B7CA 4GQFA 1FB6A 3HZ4A 4FIWA 2KHPA 5B8BA 3HYPA 3E9JB 4MABA 5KOWA 1LJRA 1HNBA 1PN9A 5F07A 1VF4A 6GSYA 5ECSA 4J56E 1ZYNA 2EIOA 3DVXA 5FT3A 3GV1A 3H93A 1EEMA 3O6TA 4BWQA 4Q5QA 2ZNMA 4EE0A 1FVKA 1MDKA 5KEJA 1PL1A 2FGXA 4GWRA 2B3SA 2I9HA 2VD0A 2FWFA 2EIQA 4POKA 1BX9A 4PX1A 3RDWA 2NPBA 1FB0A 3MYDA 4PQ1A 2IMIA 1GLQA 5IOWA 5ECMB 1ABAA 4XS4A 4GLTA 3GH9A 5CP1A 2R3XA 2DKIA 2H1DA 4ZIJA 4P3YB 5ABRA 4XS6A 5GSTA 1MD4A 2DJKA 4WF5A 3CSIA 5INYA 3Q19A 5HR3A 1A8LA 3ZFBA 4MJAA 4MJBA 4IP1A 2X4AA 1EV4A 4DSSA 2ALBA 2HLSA 2PVQA 2M80A 3GUSA 3RBTA 1BQ7A 2A2SA 2IWTA 4HJ2A 4OFMA 5ELAA 3FY7A 1ML6A 4ZB8A 1Z3EA 3FEUA 2O89A 2PMTA 4KB3A 2IPAA 4KH7A 1XVWA 1O7UA 2X8CA 3FK8A 2H0HA 1SD8A 1W89A 4KCEA 1NHOA 2HI7A 3G9BA 4K7IA 2GQLA 1V2AA 1GSFA 2MMZA 4ECIA 3GKMA 1PGTA 1Q4JA 4NWYA 2GSRA 4POLA 1B8XA 5ECHB 4EC0A 2F8FA 3GMFA 4I8BA 4ZL8A 4IHUA 2RLIA 1OYJA 4K1FA 1WE0A 3D22A 1G7OA 2E0QA 3A3TA 3VWUA 3A2VA 4MA9A 1OE7A 2KLXA 1OKDA 3A5WA 2R2JA 5A4VA 2E7PA 4IJ3A 4OFTA 5KOXA 2R6KA 1MDIA 2GVPA 1XOAA 4FH8A 4PUFC 5A4WA 4EKZA 3GIXA 3F6FA 3KGKA 2DJ3A 2N5AA 4K6XA 2K8SA 3C1RA 1JLVA 4NHWA 4OCEA 5D8IA 2TRCP 3BOAA 1M9BA 3C73A 5DJLA 3KIJA 4N0ZA 3TRXA 3R2QA 5HFGA 1T4YA 5GZZB 2A4HA 2OJLA 2WB9A 4MZBA 2CVBA 4TXOB 4V1Ag 3CTGA 5IMCA 2WDUA 4X0XA 19GSA 4Z2RA 3M9JA 4HZ4A 5KN2A 5ECRB 2PERA 3QAGA 3UVHA 3I9V2 4JR4A 3FRCA 1U3AA 4KDYA 1K3OA 2L6DA 4MDCA 4DEJA 2P0GA 1SKWB 1SJZA 1F37A 3FHKA 4TXVA 3PINA 3G7IA 4DSRA 3GHAA 1ZOFA 1SL1B 2IL3A 1YJ6A 4TR4A 1X9MB 4O92A 3TJKA 3P90A 1GSUA 3KJYA 2RUEA 3VI7A 2ZCTA 1YKCA 3F4TA 3EMXA 2RM6A 1EGOA 1YY7A 2H75A 3LFLA 3FZ4A 4MF7A 1W4VA 2TIRA 4G19A 5IOXA 4XTSA 1ZYEA 2YWNA 2YNXA 2HXKA 1PKZA 1JZWA 3TRPA 2IN3A 4PGTA 4TXOA 2QA1A 2YJ7A 3WGXA 2V2GA 1A0RP 3HKRA 1GULA 1RW1A 2YN1A 3GL3A 2H30A 1XXUA 1G0TA 1BG5A 2PUKC 5DAKB 1SENA 4PUAA 3L78A 2DSAA 2GSSA 1R4WA 1ACVA 5KN1A 5IPHA 1GL8A 2OE3A 1KBNA 3GA4A 2VIMA 1DE1A 3FR6A 2FA8A 2WS2A 3AY8A 2PWJA 4MPFA 5G1KA 3VPQA 4OO4A 6GSVA 3QPMA 3IBHA 4L8EA 5D73A 4G10A 1T4ZA 3F3RA 1ILOA 2I4AA 2MZCA 2HSHA 4PXOA 3SBCA 2V32A 1Y6EA 4MZWA 1MEKA 2YZHA 2OA7A 3DVWA 2HRAA 4JEDA 3HVXA 6GSSA 2LJAA 1GH2A 12GSA 1FOVA 3WT2A 2M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2U A;  2FD3 A;  4O7H A;  4EVM A;  5E59 A;  4TKY A;  3PGT A;  4KCA A;  5G5F A;  4K0G A;  2HE3 A;  3H1N A;  2C0G A;  3UJ1 A;  4LLR A;  2JL4 A;  3VPT A;  3TCO A;  5LNK e;  4IVF A;  3K8N A;  4BVX A;  1Z6M A;  5GAN D;  5G31 A;  4ZBA A;  9GSS A;  3UMA A;  1TK0 B;  4ILF A;  1WWJ A;  4V2M A;  4L5O A;  2H74 A;  1JZO A;  4MP4 A;  1YF0 A;  3KP8 A;  2XBQ A;  3LOR A;  2JAC A;  1G6W A;  5F0G A;  1F2E A;  1TK8 B;  3O76 A;  4WXT A;  2NVL A;  2MMA A;  3TJG A;  3RHC A;  3CRT A;  4GSS A;  2VL2 A;  5IM9 A;  2CQ9 A;  3IPZ A;  1BAY A;  2JZR A;  2I1U A;  1M7T A;  4OD7 A;  1VGL A;  3LYK A;  4X1U A;  4JE1 A;  3VFI A;  2FUG 2;  4I97 A;  22GS A;  3MNG A;  1J9B A;  1Q98 A;  2IIY A;  1SKR B;  2LV3 A;  1XPV A;  4F03 A;  2GT5 A;  2LST A;  1JLW A;  3LGC A;  2HZE B;  4E8H A;  3LYP A;  2REM A;  2H01 A;  4N11 A;  6GST A;  1F9M A;  3GSS A;  1JFU A;  2GDR A;  2X8H A;  2VCV A;  3ZMK A;  3KD0 A;  3DIE A;  2C3N A;  3GST A;  2PGT A;  4MF5 A;  1AQX A;  1T7P B;  2VL3 A;  1QK8 A;  18GS A;  1ZCP A;  2C3Q A;  3D5J A;  1X5C A;  1SD9 A;  1K0N A;  1VF1 A;  5AIS A;  1WOU A;  1K0M A;  1B9X C;  2IME A;  5C00 A;  1UVZ A;  1AW9 A;  2NTO A;  1K3Y A;  2DJ1 A;  2AYT A;  3DKS A;  3UAR A;  1DUG A;  1HYU A;  4ZIL A;  4BA7 A;  2DMM A;  3J7Y b;  3WT1 A;  4FYU A;  2EIR A;  2HZE A;  4WKW A;  3DGQ A;  2HSY A;  1S3C A;  4F9Z A;  3F0I A;  4HOJ A;  5ECO B;  3H4K A;  2E2G A;  1M0U A;  1K0O A;  4L0W A;  2HNL A;  1XIY A;  1THX A;  2FHE A;  14GS A;  5F8B A;  2O7K A;  3S9F A;  2OAC A;  2RII A;  1OKT A;  5LCZ A;  3EUR A;  1K0C A;  4V2N A;  4I2T A;  3GX8 A;  2E2M A;  3DXB A;  1VRS D;  1E6B A;  1A23 A;  1O81 A;  1XCC A;  3QOU A;  4IS0 A;  2PBJ A;  5ECP B;  2C3T A;  4JBB A;  4EUY A;  4IKH A;  1SL2 B;  3FR3 A;  4K8M A;  3M0F A;  4G2E A;  4ECJ A;  3Q18 A;  3IXR A;  4ECC A;  3ZLP A;  3F3Q A;  2FWH A;  2GZZ A;  1V98 A;  2H76 A;  1GUK A;  4IQA A;  5DQS A;  2VLV A;  3C71 A;  5DQY A;  4Q5F A;  1X5E A;  4HJM A;  1TRV A;  3APS A;  5ID2 B;  1SYX A;  2L4Q A;  1QFN A;  2K18 A;  3KM6 A;  4TW5 A;  1Z7R A;  3QR6 A;  5IO0 A;  1NHY A;  5IPG A;  2H73 A;  2L5O A;  4IJI A;  1ERV A;  3H8Q A;  1GNE A;  2VM2 A;  3CYN A;  1OAZ A;  1G7E A;  1Y25 A;  4ZL9 A;  4WBR D;  4N10 A;  1PQN A;  3A2W A;  1SL0 B;  1Z9H A;  1UN2 A;  5E4W A;  2CAQ A;  2B1K A;  3TDG A;  11GS A;  1KTE A;  4KDX A;  4F0B A;  4POM A;  4XS1 A;  2OBK A;  3GRX A;  2WJU A;  4ZB9 A;  2H19 A;  1G6Y A;  5DAL B;  3TB2 A;  3ZYW A;  1F3A A;  2YP6 A;  1ON4 A;  2WFC A;  3BCI A;  1CQG A;  3IV4 A;  3BJ5 A;  3HD5 A;  5ID2 A;  1NM3 A;  1B9Y C;  2OKA A;  4OFN A;  5HQP A;  3LXT A;  1TK5 B;  2FWE A;  4ZB6 A;  3LJR A;  1QMV A;  2DLX A;  4KND A;  2FWG A;  4GRF A;  2FY6 A;  4FYB A;  2LRC A;  4KE3 A;  5H5Q A;  1TRS A;  3WGE A;  4OO5 A;  3QFA C;  1PL2 A;  3QMX A;  1K0A A;  2YWO A;  1GTB A;  2VCT A;  5D9W A;  4HUA A;  1IYH A;  1RK4 A;  1EV9 A;  5B8A A;  2GQK A;  4MZC A;  1V58 A;  4NAX A;  3GKN A;  4ZXG A;  2KP1 A;  1XZO A;  1FO5 A;  4IW9 A;  2H0I A;  2H70 A;  3L4N A;  1YEX A;  5LD0 A;  3ZIV A;  2LJK A;  3VWX A;  4XHM A;  1GSD A;  4KX4 A;  1J0F A;  2D2Z A;  1X5D A;  3ZIJ A;  1TP9 A;  2F9S A;  1I5G A;  3EWL A;  5CRH A;  1VF2 A;  3TRQ A;  2VLU A;  2RM5 A;  2LQO A;  2B7J A;  1ZMA A;  2K8V A;  3HVS A;  1MDJ A;  4TVE A;  1UC7 A;  3VLN A;  2GZP A;  4LMW A;  4MMM A;  1ST9 A;  4POB A;  1XW6 A;  4V1A p;  2AAW A;  2LJR A;  1WIK A;  1WJK A;  1XWG A;  4N0V A;  10GS A;  1MD3 A;  2DIZ A;  4ECB A;  2VAF A;  2GT6 A;  2CVK A;  2ES7 A;  4G9H A;  4AJ7 A;  2XHF A;  3GX0 A;  5CAX A;  1AQV A;  1A2M A;  2B5Y A;  1SKS B;  4KA0 A;  2LQQ A;  3CSJ A;  2B7K A;  2O85 A;  3M9K A;  1AQW A;  2H8L A;  1GRX A;  2MMO A;  4HU9 A;  1AAZ A;  7GSS A;  5JWQ B;  3LG6 A;  1S3D A;  4BVY A;  5JWO B;  2LNS A;  3HJP A;  4MJC A;  5A5K A;  1YQ1 A;  5EVO A;  1JZD A;  1XFL A;  3E3E A;  4K7N A;  5ECL B;  4CHS A;  5ECI B;  5J4U A;  1QQ2 A;  1BJX A;  4J57 E;  3D0Z A;  5J9B A;  5ELG A;  5IMD A;  3TJF A;  2CAI A;  3KTL A;  3IA1 A;  4ACS A;  3PH9 A;  4V2L A;  1TRU A;  2X64 A;  4PQH A;  3US3 A;  2GLR A;  2L57 A;  1TI1 A;  2M72 A;  4WEY A;  4AF2 A;  4NV2 A;  1FAA A;  2ON7 A;  2CX4 A;  5D93 A;  4NV5 A;  5B6N A;  3P2A A;  2L59 A;  1S3A A;  3ZML A;  3BCK A;  1O85 A;  2H66 A;  4K2D A;  2JZS A;  2WUL A;  3NZN A;  2V41 A;  5CRE A;  4KUN A;  2WZ9 A;  1XWA A;  1M2B A;  3UAP A;  4D73 B;  3C8E A;  3E0U A;  4MH2 A;  3QAV A;  4HQZ A;  2GST A;  3LWA A;  1FHE A;  2DJJ A;  2HZF A;  1GUH A;  1LU4 A;  3NOF A;  1QGV A;  3FKF A;  1DBY A;  1UA5 A;  5DAK A;  1R26 A;  3D21 A;  3ERG A;  2J9H A;  2F51 A;  1T8E B;  1ZL9 A;  3TOT A;  2XBI A;  2JZT A;  2IFQ B;  5J5N A;  1TTZ A;  3UOM A;  3GL5 A;  1U88 A;  2OAD A;  1B4P A;  2DIY A;  4ML1 A;  3QCP A;  5JCG A;  3APQ A;  2B6M A;  5AN1 A;  4QL9 A;  5JCU A;  2HT9 A;  3ZFL A;  5HFK A;  3UBL A;  3GYK A;  2EC4 A;  4Q5N A;  4GF0 A;  1SJ6 A;  1PX7 A;  2FLS A;  3HJM A;  5EY6 A;  3HDC A;  3DML A;  5C04 A;  3MAK A;  2H6Z A;  1VF3 A;  3CBU A;  2GTU A;  2OBI A;  1PRX A;  2G0F A;  1ERW A;  4LL1 B;  4MJE A;  3IDV A;  1O8W A;  1E2Y A;  5IMA A;  1EP7 A;  1FVJ A;  4X43 A;  5DCG A;  1PD2 1;  4QL7 A;  3IOS A;  4RQX A;  3F6D A;  4AJ8 A;  4EF0 A;  2O8V B;  1H4O A;  3IC4 A;  1XW5 A;  1MTC A;  2WCI A;  3EIN A;  3KMO A;  3ZIT A;  3LSZ A;  1FG4 A;  1O73 A;  1TW9 A;  1Z7P A;  5J9C A;  5CRW A;  5G30 A;  2VD1 A;  3HJO A;  3D6I A;  4OMV A;  4AJ6 A;  4MLY A;  4EO3 A;  2BTO T;  2Z9S A;  1AXD A;  1OC3 A;  2LKU A;  4JR6 A;  4K7O A;  1Z5Y E;  3VUR A;  1M2A A;  4FO5 A;  2QC7 A;  5IMZ A;  3DD3 A;  3A2X A;  3DWV A;  6GSX A;  2DBC A;  1OC9 B;  2R37 A;  1GLP A;  3ZVJ D;  5IMF A;  3TJB A;  3KP9 A;  4NHZ A;  3BBY A;  2GZY A;  1EGR A;  5HR1 A;  5JWR B;  1HQO A;  5G1L A;  2CA8 A;  3UVT A;  5G2Z A;  2I3Y A;  1QUW A;  3LQ7 A;  4NXI A;  1NSW A;  2K9F A;  4K0N A;  5JCW A;  2VCZ A;  4EDZ A;  1XW9 A;  3N5O A;  2YJH A;  2LRT A;  3FZ5 A;  1JZR A;  1H75 A;  4NPB A;  2H1G A;  5CNW A;  1KEB A;  5IQY A;  2YOI A;  1TOF A;  3CMI A;  2C1Y A;  2JAD A;  3EC3 A;  1F3B A;  1C72 A;  1X9S B;  2YCD A;  3NIV A;  2B5E A;  5KN0 A;  1T3B A;  3CSH A;  3TOU A;  5EPF A;  3HZ8 A;  1GUM A;  1ZZY A;  1GSS A;  4MH3 A;  1J08 A;  1YF1 A;  5AIV A;  1XVQ A;  1OC9 A;  3Q6O A;  3I69 A;  3ZRD A;  3MSZ A;  1GSE A;  3DRN A;  2AUV A;  2DJ0 A;  5CRG A;  3H79 A;  2L5L A;  3W8S A;  1YEP A;  2MYG A;  3U6V A;  2GS3 A;  5A4U A;  3F4R A;  3TKS C;  2MBS A;  1PSQ A;  1N8J A;  3Q74 A;  3L9S A;  1SJI A;  1A2J A;  5D9X A;  2YZU A;  1O6J A;  3TKS E;  1BYE A;  2X8G A;  3EE2 A;  2C0F A;  4HS1 A;  2WGR A;  1B48 A;  1X0R A;  4F82 A;  4HDE A;  2VOC A;  1OC8 A;  4LL4 B;  3VWW A;  2AHE A;  3HVV A;  5ECK B;  5IO2 A;  3F9U A;  4NMU A;  2C80 A;  2CVD A;  1YZX A;  1TJD A;  3JCM L;  2C8U A;  4MPG A;  3L9U A;  4BL7 A;  1EP8 A;  3EYT A;  2O87 A;  2YAN A;  2PVO C;  4DSS B;  3M8N A;  4HI7 A;  2KUC A;  3F8U A;  4IP6 A;  3OR5 A;  4PNF A;  4TN8 A;  3DYR A;  4O32 A;  4WF4 A;  2N5F A;  5AIX A;  2IMD A;  2VO4 A;  4XRA A;  3G7J A;  1ERT A;  4TRX A;  4F2I A;  1R7H A;  1EOH A;  4WBJ A;  3VK9 A;  17GS A;  5CYY A;  3VI5 A;  2N5B A;  2VUP A;  5D9T A;  1THO A;  1TDI A;  5IMV A;  1I9D A;  4OWY A;  3KEB A;  3I43 A;  1HNC A;  1GTI A;  2DJ2 A;  2P5Q A;  1GP1 A;  4WET A;  1A2L A;  5KN3 A;  5J41 A;  2DC5 A;  3EU4 A;  3L0H A;  3F4S A;  4I5Q A;  4ZL7 A;  8GSS A;  3KXO A;  3GUR A;  4GQC A;  3P8W A;  5HFI A;  1PKW A;  5DJM A;  3P7X A;  4HEA 2;  3GNJ A;  1SK0 A;  2QSI A;  2GGT A;  3W8J A;  1TU8 A;  3ZL5 A;  4OCF A;  2VM1 A;  2BMX A;  2YV9 A;  2V6K A;  6GSU A;  5IIZ A;  1K0D A;  1AC1 A;  3GKK A;  5DAL A;  4YQV A;  1TXX A;  3PR8 A;  5CRD A;  2XPE A;  1GSY A;  2HRF A;  3KH9 A;  2NDO A;  2H1B A;  5H5R A;  4KSM A;  1GTA A;  4GSN A;  3IHQ A;  3ZVJ A;  1V57 A;  5HR0 A;  2LEG A;  1M9A A;  1RQM A;  2OE1 A;  2H72 A;  2JSZ A;  4PNG A;  4YQM A;  2DML A;  4MCU A;  1GNW A;  2L6C A;  3ME7 A;  1X9W B;  2CT6 A;  5G5E A;  4IQ1 A;  2A2R A;  1WRY A;  2V1M A;  3IAM 2;  3ZTL A;  3LXZ A;  2VCQ A;  2CX3 A;  3GKX A;  2YWI A;  4EL1 A;  4GST A;  1V9W A;  1CQH A;  5GAP D;  2TRX A;  4JRR A;  4KDU A;  4H86 A;  1FW1 A;  3RHB A;  4LMV A;  3KH7 A;  3GH6 A;  2VLT A;  3DEX A;  4ZBB A;  2VCW A;  1ZGN A;  2IMK A;  3M1G A;  4PUR A;  2V6O A;  2GSQ A;  13GS A;  3HHV A;  3U5R E;  1GTU A;  3WD6 A;  4IN0 A;  2NBS A;  3IAS 2;  3TKQ A;  2RUF A;  4YAP A;  2J23 A;  2L4C A;  2HFD A;  1AIU A;  1F6M C;  5CO3 A;  2LUS A;  3N9J A;  4F0C A;  1IYI A;  1U3I A;  3EU3 A;  4KAE A;  1TKD B;  1LBK A;  1M99 A;  3F63 A;  3O3T A;  2P31 A;  3W6G A;  2YPM A;  4AGS A;  1ZYQ B;  4EDY A;  2OE0 A;  3I6A A;  3ERW A;  2BJX A;  3L9V A;  1HD2 A;  2KOK A;  3J7Y k;  4CW9 A;  3KZQ A;  4EXJ A;  5DDL A;  3APO A;  3TJJ A;  4Z7X A;  2H6X A;  4TR3 A;  1U6T A;  4YQU A;  2H0G A;  4XCS A;  2MBT A;  3IK7 A;  1SK1 A;  3RPP A;  3GN3 A;  2H71 A;  4IEL A;  3ZZX A;  3C1S A;  4FYC A;  2QGV A;  5AGY A;  4DSQ A;  1TU7 A;  3RAZ A;  2LRN A;  3WYW A;  5F05 A;  3VWV A;  4BWS A;  2CZ3 A;  3KTB A;  4RI7 A;  3IRA A;  5COH A;  2FNO A;  1OVN A;  1GWC A;  4ZBD A;  1K0B A;  2F8A A;  1EOG A;  2HYX A;  5ECN B;  4YH2 A;  4XRD A;  1JHB A;  1QXH A;  2LS5 A;  1AUC A;  2AJQ B;  4CDO A;  1URM A;  1XOB A;  5D9V A;  4L5L A;  2IJY A;  5DCH A;  1A0F A;  3CRU A;  5D96 A;  1DE2 A;  3V1W A;  4WR5 A;  1PA3 A;  4JU5 A;  5F06 A;  2P5R A;  2F3M A;  2C0D A;  1WPI A;  2H6Y A;  2B5X A;  3IE3 A;  2K6V A;  1R5A A;  1M2D A;  4ISD A;  1PX6 A;  1ERU A;  2B1L A;  5ENU A;  1V40 A;  2AB6 A;  4TR1 B;  2AV4 A;  4YAV A;  4IGJ A;  1SU9 A;  2H1A A;  1SK2 A;  4D73 A;  1T00 A;  3FYG A;  3TGZ A;  4PQI A;  2R5G A;  2YWM A;  5J3R A;  1BED A;  3MWH A;  1XWK A;  2MMN A;  3FW2 A;  3G7Y A;  4TOP A;  4ID0 A;  2XC2 A;  2VCX A;  1XWC A;  1KNG A;  2JSY A;  3TKP A;  2PPT A;  6GSW A;  5DBQ A;  3ISO A;  2I81 A;  1A24 A;  4GTU A;  5DVB A;  3TUE A;  3LEF A;  3D4M A;  3HY2 A;  3FR9 A;  1OE8 A;  3QFB C;  4RUV A;  5HR2 A;  3RPN A;  2IFQ A;  2LNT A;  4L0U A;  2C4J A;  4MF6 A;  5ECQ B;  4Q5R A;  3WGD A;  1R5P A;  2KP2 A;  2ZUP A;  3ERF A;  1EWX A;  5B6M A;  1A8Y A;  2FA4 A;  4GXZ A;  3M3M A;  1K3L A;  3QD9 A;  1N2A A;  4HU7 A;  3MDK A;  1DSB A;  4TR1 A;  2A4V A;  1TI3 A;  4KW6 A;  1YDK A;  3D4T A;  3QDN A;  20GS A;  4KSO A;  3ZRE A;  1WMJ A;  2IMF A;  1TRW A;  2G2Q A;  4HQS A;  4I6X A;  4JZQ A;  2PU9 C;  5L71 A;  1PMT A;  1EEJ A;  3QAW A;  2CZ2 A;  3ME8 A;  2R4V A;  4XIH A;  1XBS A;  3IR4 A;  2C0E A;  3BD2 A;  2CV4 A;  3UIW A;  3GTU B;  3HA9 A;  3TKS A;  3UBK A;  1B4Q A;  5H5S A;  2GQM A;  1GSQ A;  2XPD A;  4HZ2 A;  1YKA A;  2LTK A;  1XWB A;  4K9Z A;  5GSS A;  4IBP A;  3CTF A;  2FCH A;  3HCZ A;  3C7M A;  4DVC A;  4RI6 A;  3GFK A;  3FZ9 A;  2WRT A;  3EVI A;  3HXS A;  16GS A;  2VL2 C;  4N30 A;  4MK3 A;  1U87 A;  3UL3 A;  4J2F A;  4QQ7 A;  4GCI A;  1O8X A;  2HRN A;  3EMP A;  1WP0 A;  5FWG A;  5FHI A;  1USB A;  1HNA A;  3CXG A;  4ML6 A;  4E8E A;  4KGI A;  4TR0 A;  4O5R A;  1Z6N A;  2JU5 A;  1EZK A;  4WR4 A;  3UEM A;  3GTU A;  1SYR A;  4RQR A;  2YV7 A;  4LA1 A;  3ED3 A;  4BPY A;  2QKE A;  1T1V A;  2ON5 A;  2VL9 A;  3TKR A;  2PN8 A;  2X99 A;  5EL8 A;  3KCM A;  3FZA A;  3SWL A;  4ULX A;  3IK9 A;  3KMN A;  4XS4 B;  1NW2 A;  5B7C A;  4GQF A;  1FB6 A;  3HZ4 A;  4FIW A;  2KHP A;  5B8B A;  3HYP A;  3E9J B;  4MAB A;  1LJR A;  1HNB A;  1PN9 A;  5F07 A;  1VF4 A;  6GSY A;  5ECS A;  4J56 E;  2EIO A;  3DVX A;  5FT3 A;  3GV1 A;  3H93 A;  1EEM A;  3O6T A;  4BWQ A;  4Q5Q A;  2ZNM A;  4EE0 A;  1FVK A;  1MDK A;  5KEJ A;  1PL1 A;  2FGX A;  4GWR A;  2B3S A;  2I9H A;  2VD0 A;  2FWF A;  2EIQ A;  4POK A;  1BX9 A;  4PX1 A;  3RDW A;  2NPB A;  1FB0 A;  4PQ1 A;  2IMI A;  1GLQ A;  5IOW A;  5ECM B;  1ABA A;  4XS4 A;  4GLT A;  3GH9 A;  5CP1 A;  2R3X A;  2H1D A;  4ZIJ A;  4P3Y B;  5ABR A;  4XS6 A;  5GST A;  1MD4 A;  2DJK A;  4WF5 A;  3CSI A;  5INY A;  3Q19 A;  5HR3 A;  1A8L A;  3ZFB A;  4MJA A;  4MJB A;  4IP1 A;  1EV4 A;  4DSS A;  2ALB A;  2HLS A;  2PVQ A;  2M80 A;  3GUS A;  3RBT A;  1BQ7 A;  2A2S A;  2IWT A;  4HJ2 A;  4OFM A;  5ELA A;  3FY7 A;  1ML6 A;  4ZB8 A;  1Z3E A;  3FEU A;  2O89 A;  2PMT A;  4KB3 A;  2IPA A;  4KH7 A;  1XVW A;  1O7U A;  2X8C A;  3FK8 A;  2H0H A;  1SD8 A;  1W89 A;  4KCE A;  1NHO A;  2HI7 A;  3G9B A;  4K7I A;  2GQL A;  1V2A A;  1GSF A;  2MMZ A;  4ECI A;  3GKM A;  1PGT A;  1Q4J A;  4NWY A;  2GSR A;  4POL A;  1B8X A;  5ECH B;  4EC0 A;  2F8F A;  3GMF A;  4I8B A;  4ZL8 A;  4IHU A;  2RLI A;  1OYJ A;  4K1F A;  1WE0 A;  3D22 A;  1G7O A;  2E0Q A;  3A3T A;  3VWU A;  3A2V A;  4MA9 A;  1OE7 A;  2KLX A;  1OKD A;  3A5W A;  2R2J A;  5A4V A;  2E7P A;  4IJ3 A;  4OFT A;  2R6K A;  1MDI A;  2GVP A;  1XOA A;  4FH8 A;  4PUF C;  5A4W A;  4EKZ A;  3GIX A;  3F6F A;  3KGK A;  2DJ3 A;  2N5A A;  4K6X A;  2K8S A;  3C1R A;  1JLV A;  4NHW A;  4OCE A;  5D8I A;  2TRC P;  3BOA A;  1M9B A;  3C73 A;  5DJL A;  3KIJ A;  4N0Z A;  3TRX A;  3R2Q A;  5HFG A;  1T4Y A;  5GZZ B;  2OJL A;  2WB9 A;  4MZB A;  2CVB A;  4TXO B;  4V1A g;  3CTG A;  5IMC A;  2WDU A;  4X0X A;  19GS A;  3M9J A;  4HZ4 A;  5KN2 A;  5ECR B;  2PER A;  3QAG A;  3UVH A;  3I9V 2;  4JR4 A;  3FRC A;  1U3A A;  4KDY A;  1K3O A;  2L6D A;  4MDC A;  4DEJ A;  2P0G A;  1SKW B;  1SJZ A;  1F37 A;  3FHK A;  4TXV A;  3PIN A;  3G7I A;  4DSR A;  3GHA A;  1ZOF A;  1SL1 B;  2IL3 A;  1YJ6 A;  4TR4 A;  1X9M B;  4O92 A;  3TJK A;  3P90 A;  1GSU A;  3KJY A;  2RUE A;  3VI7 A;  2ZCT A;  1YKC A;  3F4T A;  3EMX A;  2RM6 A;  1EGO A;  1YY7 A;  2H75 A;  3LFL A;  3FZ4 A;  4MF7 A;  1W4V A;  2TIR A;  4G19 A;  5IOX A;  4XTS A;  1ZYE A;  2YWN A;  2YNX A;  2HXK A;  1PKZ A;  1JZW A;  3TRP A;  2IN3 A;  4PGT A;  4TXO A;  2YJ7 A;  3WGX A;  2V2G A;  1A0R P;  3HKR A;  1GUL A;  1RW1 A;  2YN1 A;  3GL3 A;  2H30 A;  1XXU A;  1G0T A;  1BG5 A;  2PUK C;  5DAK B;  1SEN A;  4PUA A;  3L78 A;  2DSA A;  2GSS A;  1R4W A;  1ACV A;  5KN1 A;  5IPH A;  1GL8 A;  2OE3 A;  1KBN A;  3GA4 A;  2VIM A;  1DE1 A;  3FR6 A;  2FA8 A;  2WS2 A;  3AY8 A;  2PWJ A;  4MPF A;  5G1K A;  3VPQ A;  4OO4 A;  6GSV A;  3QPM A;  3IBH A;  4L8E A;  5D73 A;  4G10 A;  1T4Z A;  3F3R A;  1ILO A;  2I4A A;  2MZC A;  2HSH A;  4PXO A;  3SBC A;  2V32 A;  1Y6E A;  4MZW A;  1MEK A;  2YZH A;  2OA7 A;  3DVW A;  4JED A;  3HVX A;  6GSS A;  2LJA A;  1GH2 A;  12GS A;  1FOV A;  3WT2 A;  2M46 A; 
#chains in the Genus database with same CATH topology
 4I2U A;  2FD3 A;  4O7H A;  4EVM A;  5E59 A;  4TKY A;  3PGT A;  4KCA A;  5G5F A;  4K0G A;  2HE3 A;  3H1N A;  2C0G A;  3UJ1 A;  4LLR A;  2JL4 A;  3VPT A;  3TCO A;  5LNK e;  4IVF A;  3K8N A;  4BVX A;  1Z6M A;  5GAN D;  5G31 A;  4ZBA A;  9GSS A;  3UMA A;  1TK0 B;  4ILF A;  1WWJ A;  4V2M A;  4L5O A;  2H74 A;  1JZO A;  4MP4 A;  1YF0 A;  3KP8 A;  2XBQ A;  3LOR A;  4MNN A;  2JAC A;  1G6W A;  5F0G A;  4KF9 A;  1F2E A;  1TK8 B;  3O76 A;  4WXT A;  2NVL A;  2QA2 A;  2MMA A;  3TJG A;  3RHC A;  3CRT A;  4GSS A;  2VL2 A;  3LW9 A;  5IM9 A;  2CQ9 A;  3IPZ A;  1BAY A;  2JZR A;  2I1U A;  1M7T A;  4OD7 A;  1VGL A;  3LYK A;  4X1U A;  4JE1 A;  3VFI A;  2FUG 2;  4I97 A;  22GS A;  3MNG A;  1J9B A;  1Q98 A;  2IIY A;  1SKR B;  4CY6 A;  2LV3 A;  1XPV A;  4F03 A;  2GT5 A;  2LST A;  1JLW A;  3LGC A;  2HZE B;  4E8H A;  3LYP A;  2REM A;  2H01 A;  4N11 A;  6GST A;  1F9M A;  3GSS A;  1JFU A;  2GDR A;  2X8H A;  2VCV A;  3ZMK A;  4G0L A;  3KD0 A;  3DIE A;  2C3N A;  3GST A;  2PGT A;  4MF5 A;  1AQX A;  1T7P B;  2VL3 A;  1QK8 A;  18GS A;  1ZCP A;  5BMU A;  2R0C A;  2C3Q A;  2R0P A;  3D5J A;  1X5C A;  1SD9 A;  1K0N A;  1VF1 A;  5AIS A;  1WOU A;  1K0M A;  1B9X C;  2IME A;  5C00 A;  1UVZ A;  1AW9 A;  2NTO A;  1K3Y A;  2DJ1 A;  2AYT A;  3DKS A;  3UAR A;  1DUG A;  1HYU A;  4ZIL A;  4BA7 A;  2DMM A;  3J7Y b;  3WT1 A;  4FYU A;  2EIR A;  2HZE A;  4WKW A;  3DGQ A;  2HSY A;  1S3C A;  4F9Z A;  3F0I A;  4HOJ A;  5ECO B;  3H4K A;  2E2G A;  1M0U A;  1K0O A;  4L0W A;  2HNL A;  1XIY A;  2X49 A;  1THX A;  2FHE A;  14GS A;  4BL7 B;  5F8B A;  2O7K A;  3S9F A;  2OAC A;  2RII A;  1OKT A;  5LCZ A;  3EUR A;  1K0C A;  4V2N A;  4I2T A;  3GX8 A;  2E2M A;  3DXB A;  1VRS D;  1E6B A;  1A23 A;  1O81 A;  1XCC A;  2HSM A;  3QOU A;  4IS0 A;  2PBJ A;  5ECP B;  2C3T A;  4JBB A;  4EUY A;  4IKH A;  1SL2 B;  3FR3 A;  3CQF A;  4K8M A;  3M0F A;  4G2E A;  4ECJ A;  3Q18 A;  3IXR A;  4ECC A;  3ZLP A;  3F3Q A;  2FWH A;  2GZZ A;  1V98 A;  2H76 A;  1GUK A;  4IQA A;  5DQS A;  2VLV A;  3C71 A;  5DQY A;  4Q5F A;  1X5E A;  4HJM A;  1PN0 A;  1TRV A;  3APS A;  5ID2 B;  4YKF A;  1SYX A;  2L4Q A;  1QFN A;  2K18 A;  3KM6 A;  4TW5 A;  1Z7R A;  3QR6 A;  5IO0 A;  1NHY A;  5IPG A;  2H73 A;  2L5O A;  4IJI A;  1ERV A;  3H8Q A;  1GNE A;  2VM2 A;  3CYN A;  1OAZ A;  1G7E A;  1Y25 A;  4ZL9 A;  4WBR D;  4N10 A;  1PQN A;  3A2W A;  1SL0 B;  1Z9H A;  1UN2 A;  3IC8 A;  5E4W A;  2CAQ A;  2B1K A;  3TDG A;  11GS A;  1KTE A;  4KDX A;  4F0B A;  4POM A;  4XS1 A;  2OBK A;  3GRX A;  2WJU A;  4EIQ A;  4ZB9 A;  2H19 A;  1G6Y A;  5DAL B;  4G0K A;  3TB2 A;  3ZYW A;  1F3A A;  2YP6 A;  1ON4 A;  2WFC A;  3BCI A;  1CQG A;  3IV4 A;  3BJ5 A;  3HD5 A;  5ID2 A;  1NM3 A;  1B9Y C;  2OKA A;  4OFN A;  5HQP A;  3LXT A;  1TK5 B;  2FWE A;  4ZB6 A;  3LJR A;  1QMV A;  2DLX A;  4KND A;  2FWG A;  4GRF A;  2FY6 A;  3FMW A;  4FYB A;  2LRC A;  4KE3 A;  5H5Q A;  1TRS A;  3WGE A;  4OO5 A;  3QFA C;  1PL2 A;  3QMX A;  1K0A A;  2YWO A;  1GTB A;  2VCT A;  5D9W A;  4HUA A;  1IYH A;  1RK4 A;  1EV9 A;  5B8A A;  2GQK A;  4MZC A;  1V58 A;  4Z2T A;  4NAX A;  3GKN A;  4ZXG A;  2KP1 A;  1XZO A;  1FO5 A;  4IW9 A;  2H0I A;  2H70 A;  3L4N A;  1YEX A;  5LD0 A;  3IHG A;  4EIP A;  2DKH A;  3ZIV A;  2LJK A;  4BIK A;  3VWX A;  4XHM A;  1GSD A;  4KX4 A;  1J0F A;  2D2Z A;  1X5D A;  3ZIJ A;  1TP9 A;  2F9S A;  1I5G A;  3EWL A;  5CRH A;  1VF2 A;  3TRQ A;  4BVY B;  2VLU A;  2RM5 A;  2LQO A;  2B7J A;  1ZMA A;  2K8V A;  3HVS A;  1MDJ A;  4TVE A;  1UC7 A;  3VLN A;  2GZP A;  4LMW A;  4MMM A;  1ST9 A;  5BRT A;  4POB A;  1XW6 A;  4V1A p;  2AAW A;  2LJR A;  1WIK A;  1WJK A;  1XWG A;  4N0V A;  10GS A;  1S3R A;  1MD3 A;  2DIZ A;  4ECB A;  2VAF A;  2GT6 A;  2CVK A;  2ES7 A;  4G9H A;  4AJ7 A;  2XHF A;  3GX0 A;  5CAX A;  1AQV A;  1A2M A;  2B5Y A;  1SKS B;  4KA0 A;  2LQQ A;  4Z2U A;  3CSJ A;  2B7K A;  2O85 A;  3M9K A;  1AQW A;  2H8L A;  1GRX A;  2MMO A;  4HU9 A;  1AAZ A;  7GSS A;  5JWQ B;  3LG6 A;  1S3D A;  4BVY A;  5JWO B;  2LNS A;  3HJP A;  4MJC A;  5A5K A;  1YQ1 A;  5EVO A;  1JZD A;  1XFL A;  3E3E A;  4K7N A;  5ECL B;  4CHS A;  5ECI B;  5J4U A;  1QQ2 A;  1BJX A;  4K5S A;  4J57 E;  3D0Z A;  5J9B A;  5ELG A;  5IMD A;  3TJF A;  2CAI A;  3KTL A;  3IA1 A;  4ACS A;  3PH9 A;  4V2L A;  1TRU A;  2X64 A;  4PQH A;  4K2X A;  3US3 A;  2GLR A;  2L57 A;  4A5P A;  1TI1 A;  2M72 A;  1M3J A;  4WEY A;  4AF2 A;  4NV2 A;  1FAA A;  2ON7 A;  2CX4 A;  5D93 A;  4NV5 A;  5B6N A;  3P2A A;  2L59 A;  3R3E A;  1S3A A;  3ZML A;  3BCK A;  1O85 A;  2H66 A;  4K2D A;  2A2P A;  2JZS A;  2WUL A;  3NZN A;  2V41 A;  5CRE A;  4KUN A;  2WZ9 A;  1XWA A;  1M2B A;  3UAP A;  4D73 B;  3C8E A;  3E0U A;  4MH2 A;  3QAV A;  4HQZ A;  2GST A;  3LWA A;  1FHE A;  2DJJ A;  2HZF A;  1GUH A;  1LU4 A;  3NOF A;  1QGV A;  3FKF A;  1DBY A;  1UA5 A;  5DAK A;  1R26 A;  3D21 A;  3ERG A;  2J9H A;  2F51 A;  1T8E B;  1ZL9 A;  3TOT A;  2XBI A;  2JZT A;  2IFQ B;  5J5N A;  1TTZ A;  3UOM A;  3GL5 A;  1U88 A;  2OAD A;  1B4P A;  2DIY A;  4ML1 A;  3QCP A;  5JCG A;  3APQ A;  2B6M A;  5AN1 A;  4QL9 A;  5JCU A;  2HT9 A;  3ZFL A;  5HFK A;  3UBL A;  3GYK A;  2EC4 A;  4Q5N A;  4GF0 A;  1SJ6 A;  1PX7 A;  2HRK A;  2FLS A;  3HJM A;  5EY6 A;  3HDC A;  3DML A;  5C04 A;  3MAK A;  2H6Z A;  1VF3 A;  3CBU A;  2GTU A;  2OBI A;  1PRX A;  2G0F A;  4O5U A;  1ERW A;  4LL1 B;  4MJE A;  3IDV A;  1O8W A;  1E2Y A;  5IMA A;  1EP7 A;  1FVJ A;  4X43 A;  5DCG A;  1PD2 1;  4QL7 A;  3IOS A;  2UZ8 A;  4RQX A;  3F6D A;  4AJ8 A;  4EF0 A;  2O8V B;  1H4O A;  3IC4 A;  1XW5 A;  1MTC A;  2WCI A;  3EIN A;  3KMO A;  3ZIT A;  3LSZ A;  1FG4 A;  1O73 A;  1TW9 A;  1Z7P A;  5J9C A;  5CRW A;  5G30 A;  2VD1 A;  3HJO A;  3D6I A;  4OMV A;  4AJ6 A;  4MLY A;  4EO3 A;  2BTO T;  2Z9S A;  1AXD A;  1OC3 A;  2LKU A;  4JR6 A;  4K7O A;  4CY8 A;  1Z5Y E;  3VUR A;  1M2A A;  4FO5 A;  2QC7 A;  5IMZ A;  3DD3 A;  3A2X A;  3DWV A;  6GSX A;  2DBC A;  3EPT A;  1OC9 B;  2R37 A;  1GLP A;  3ZVJ D;  1ZYP A;  5IMF A;  3TJB A;  3KP9 A;  4NHZ A;  3BBY A;  2GZY A;  1EGR A;  5HR1 A;  5JWR B;  1HQO A;  5G1L A;  2CA8 A;  3UVT A;  5G2Z A;  2I3Y A;  1QUW A;  3LQ7 A;  4NXI A;  1NSW A;  2K9F A;  4K0N A;  5JCW A;  4K5R A;  2VCZ A;  4EDZ A;  1XW9 A;  3N5O A;  2YJH A;  2LRT A;  3FZ5 A;  1JZR A;  1H75 A;  4NPB A;  2H1G A;  5CNW A;  1KEB A;  5IQY A;  2YOI A;  1TOF A;  3CMI A;  2C1Y A;  2JAD A;  3EC3 A;  1F3B A;  1C72 A;  1X9S B;  2YCD A;  3NIV A;  2B5E A;  5KN0 A;  1T3B A;  3CSH A;  3TOU A;  5EPF A;  3HZ8 A;  1GUM A;  1ZZY A;  1GSS A;  4MH3 A;  1J08 A;  1YF1 A;  3A5I A;  5AIV A;  1XVQ A;  1OC9 A;  3Q6O A;  3I69 A;  3ZRD A;  3MSZ A;  1GSE A;  3DRN A;  2R0G A;  2AUV A;  2DJ0 A;  5CRG A;  3H79 A;  2L5L A;  3W8S A;  1YEP A;  2MYG A;  3U6V A;  2GS3 A;  5A4U A;  3F4R A;  3TKS C;  2MBS A;  1PSQ A;  1N8J A;  3Q74 A;  3L9S A;  1SJI A;  1A2J A;  5D9X A;  2YZU A;  1O6J A;  3TKS E;  1BYE A;  2X8G A;  3EE2 A;  2C0F A;  4HS1 A;  2WGR A;  1B48 A;  1X0R A;  4F82 A;  4HDE A;  2VOC A;  1OC8 A;  4LL4 B;  3VWW A;  2AHE A;  3HVV A;  5ECK B;  5IO2 A;  3F9U A;  4NMU A;  2C80 A;  2CVD A;  1YZX A;  1TJD A;  3JCM L;  1PFO A;  2C8U A;  4MPG A;  3L9U A;  4BL7 A;  1EP8 A;  3EYT A;  2O87 A;  2YAN A;  2PVO C;  4DSS B;  3M8N A;  4HI7 A;  2KUC A;  3F8U A;  4IP6 A;  3OR5 A;  4PNF A;  4TN8 A;  3DYR A;  4O32 A;  4WF4 A;  2N5F A;  5AIX A;  2IMD A;  2VO4 A;  4XRA A;  3G7J A;  1ERT A;  4TRX A;  4F2I A;  1R7H A;  1EOH A;  4WBJ A;  3VK9 A;  17GS A;  5CYY A;  3VI5 A;  2N5B A;  2VUP A;  5D9T A;  1THO A;  3HVN A;  1TDI A;  5IMV A;  1I9D A;  4OWY A;  3KEB A;  3I43 A;  4HSC X;  1HNC A;  1GTI A;  2DJ2 A;  2P5Q A;  1GP1 A;  4WET A;  1A2L A;  5KN3 A;  5J41 A;  2DC5 A;  3EU4 A;  3L0H A;  3F4S A;  4FQU A;  4I5Q A;  4ZL7 A;  8GSS A;  3KXO A;  3GUR A;  4GQC A;  3P8W A;  5HFI A;  1PKW A;  5DJM A;  3P7X A;  4HEA 2;  3GNJ A;  1SK0 A;  2QSI A;  2GGT A;  3W8J A;  1TU8 A;  3ZL5 A;  4OCF A;  2VM1 A;  2BMX A;  2YV9 A;  2V6K A;  6GSU A;  5IIZ A;  1K0D A;  1AC1 A;  3GKK A;  5DAL A;  4YQV A;  1TXX A;  3PR8 A;  5CRD A;  2XPE A;  1GSY A;  2HRF A;  3KH9 A;  2NDO A;  2H1B A;  4G0I A;  5H5R A;  4KSM A;  1GTA A;  4GSN A;  3IHQ A;  3ZVJ A;  1V57 A;  5HR0 A;  2LEG A;  1M9A A;  1RQM A;  2OE1 A;  2H72 A;  2JSZ A;  4PNG A;  4YQM A;  2DML A;  4MCU A;  1GNW A;  2L6C A;  3ME7 A;  1X9W B;  2CT6 A;  5G5E A;  4IQ1 A;  2A2R A;  1WRY A;  2V1M A;  3IAM 2;  3ZTL A;  3LXZ A;  2VCQ A;  2CX3 A;  3GKX A;  2YWI A;  4EL1 A;  4GST A;  1V9W A;  1CQH A;  5GAP D;  2TRX A;  4JRR A;  4KDU A;  4H86 A;  1FW1 A;  3RHB A;  4LMV A;  3KH7 A;  3GH6 A;  2VLT A;  3DEX A;  4ZBB A;  2VCW A;  1ZGN A;  2IMK A;  3M1G A;  4PUR A;  2V6O A;  2GSQ A;  13GS A;  3HHV A;  3U5R E;  1GTU A;  3WD6 A;  4IN0 A;  2NBS A;  3IAS 2;  3TKQ A;  2RUF A;  4YAP A;  2J23 A;  2L4C A;  2HFD A;  1AIU A;  1F6M C;  5CO3 A;  2LUS A;  3N9J A;  4F0C A;  1IYI A;  1U3I A;  3EU3 A;  4KAE A;  1TKD B;  1LBK A;  1M99 A;  3F63 A;  3O3T A;  2P31 A;  3W6G A;  2YPM A;  4AGS A;  1ZYQ B;  4EDY A;  2OE0 A;  3I6A A;  3ERW A;  2BJX A;  3L9V A;  1HD2 A;  2KOK A;  3J7Y k;  4CW9 A;  3KZQ A;  4EXJ A;  5DDL A;  3APO A;  3TJJ A;  4Z7X A;  2H6X A;  1XG8 A;  4TR3 A;  1U6T A;  4YQU A;  2H0G A;  4XCS A;  2MBT A;  3IK7 A;  1SK1 A;  3RPP A;  3GN3 A;  2H71 A;  4IEL A;  3ZZX A;  3C1S A;  4FYC A;  2QGV A;  5AGY A;  4DSQ A;  1TU7 A;  3RAZ A;  2LRN A;  4PTS A;  3WYW A;  5F05 A;  3VWV A;  4BWS A;  2CZ3 A;  3KTB A;  4RI7 A;  3IRA A;  5COH A;  2FNO A;  1OVN A;  1GWC A;  4ZBD A;  1K0B A;  2F8A A;  1EOG A;  2HYX A;  5ECN B;  4YH2 A;  4XRD A;  1JHB A;  3MIX A;  1QXH A;  2LS5 A;  1AUC A;  4BVX B;  2AJQ B;  4CDO A;  1URM A;  1XOB A;  5D9V A;  4L5L A;  2IJY A;  5DCH A;  1A0F A;  3CRU A;  5D96 A;  1DE2 A;  3V1W A;  4WR5 A;  1PA3 A;  4JU5 A;  5F06 A;  2P5R A;  2F3M A;  2C0D A;  1WPI A;  4X4J A;  2H6Y A;  2B5X A;  3IE3 A;  2K6V A;  1R5A A;  1M2D A;  4ISD A;  1PX6 A;  1ERU A;  2B1L A;  5ENU A;  1V40 A;  2AB6 A;  4TR1 B;  3PPU A;  2AV4 A;  4YAV A;  4IGJ A;  1SU9 A;  2H1A A;  1SK2 A;  4D73 A;  1T00 A;  3FYG A;  3TGZ A;  1FOH A;  4PQI A;  2R5G A;  2YWM A;  5J3R A;  1BED A;  3MWH A;  1XWK A;  2MMN A;  3FW2 A;  3G7Y A;  4TOP A;  4ID0 A;  2XC2 A;  2VCX A;  1XWC A;  1KNG A;  2JSY A;  3TKP A;  2PPT A;  6GSW A;  5DBQ A;  3ISO A;  2I81 A;  1A24 A;  4GTU A;  5DVB A;  4YKG A;  3TUE A;  3LEF A;  3D4M A;  3HY2 A;  4O5Q A;  3FR9 A;  1OE8 A;  3QFB C;  4RUV A;  5HR2 A;  3RPN A;  2IFQ A;  2LNT A;  4L0U A;  2C4J A;  4MF6 A;  5ECQ B;  4Q5R A;  3WGD A;  1R5P A;  2KP2 A;  2ZUP A;  3ERF A;  1EWX A;  5B6M A;  1A8Y A;  2FA4 A;  4GXZ A;  3M3M A;  1K3L A;  3QD9 A;  1N2A A;  4HU7 A;  3MDK A;  1DSB A;  1M3I A;  4TR1 A;  2A4V A;  1TI3 A;  4KW6 A;  1YDK A;  3D4T A;  3QDN A;  20GS A;  4KSO A;  3ZRE A;  1WMJ A;  2IMF A;  1TRW A;  2G2Q A;  4HQS A;  4I6X A;  4JZQ A;  2PU9 C;  5L71 A;  1PMT A;  1EEJ A;  3QAW A;  2CZ2 A;  3ME8 A;  4USS A;  2R4V A;  4XIH A;  1XBS A;  3IR4 A;  2C0E A;  3BD2 A;  2CV4 A;  3UIW A;  3GTU B;  3HA9 A;  3TKS A;  3UBK A;  1B4Q A;  5H5S A;  2GQM A;  1GSQ A;  2XPD A;  4HZ2 A;  1YKA A;  2LTK A;  1XWB A;  4K9Z A;  5GSS A;  4IBP A;  3CTF A;  2FCH A;  3HCZ A;  3C7M A;  4DVC A;  4RI6 A;  3GFK A;  3FZ9 A;  2WRT A;  3EVI A;  3HXS A;  16GS A;  2VL2 C;  4N30 A;  4MK3 A;  1U87 A;  3UL3 A;  4J2F A;  4QQ7 A;  4GCI A;  1O8X A;  2HRN A;  3EMP A;  1WP0 A;  5FWG A;  5FHI A;  1USB A;  1HNA A;  3CXG A;  4ML6 A;  4E8E A;  4KGI A;  4TR0 A;  4O5R A;  1Z6N A;  2JU5 A;  1EZK A;  4WR4 A;  4ICY A;  3UEM A;  3GTU A;  1SYR A;  4RQR A;  2YV7 A;  4LA1 A;  3ED3 A;  4BPY A;  2QKE A;  1T1V A;  2ON5 A;  2VL9 A;  3TKR A;  2PN8 A;  2X99 A;  5EL8 A;  3KCM A;  3FZA A;  3SWL A;  4ULX A;  3IK9 A;  3KMN A;  4XS4 B;  1NW2 A;  5B7C A;  4GQF A;  1FB6 A;  3HZ4 A;  4FIW A;  2KHP A;  5B8B A;  3HYP A;  3E9J B;  4MAB A;  5KOW A;  1LJR A;  1HNB A;  1PN9 A;  5F07 A;  1VF4 A;  6GSY A;  5ECS A;  4J56 E;  1ZYN A;  2EIO A;  3DVX A;  5FT3 A;  3GV1 A;  3H93 A;  1EEM A;  3O6T A;  4BWQ A;  4Q5Q A;  2ZNM A;  4EE0 A;  1FVK A;  1MDK A;  5KEJ A;  1PL1 A;  2FGX A;  4GWR A;  2B3S A;  2I9H A;  2VD0 A;  2FWF A;  2EIQ A;  4POK A;  1BX9 A;  4PX1 A;  3RDW A;  2NPB A;  1FB0 A;  3MYD A;  4PQ1 A;  2IMI A;  1GLQ A;  5IOW A;  5ECM B;  1ABA A;  4XS4 A;  4GLT A;  3GH9 A;  5CP1 A;  2R3X A;  2DKI A;  2H1D A;  4ZIJ A;  4P3Y B;  5ABR A;  4XS6 A;  5GST A;  1MD4 A;  2DJK A;  4WF5 A;  3CSI A;  5INY A;  3Q19 A;  5HR3 A;  1A8L A;  3ZFB A;  4MJA A;  4MJB A;  4IP1 A;  2X4A A;  1EV4 A;  4DSS A;  2ALB A;  2HLS A;  2PVQ A;  2M80 A;  3GUS A;  3RBT A;  1BQ7 A;  2A2S A;  2IWT A;  4HJ2 A;  4OFM A;  5ELA A;  3FY7 A;  1ML6 A;  4ZB8 A;  1Z3E A;  3FEU A;  2O89 A;  2PMT A;  4KB3 A;  2IPA A;  4KH7 A;  1XVW A;  1O7U A;  2X8C A;  3FK8 A;  2H0H A;  1SD8 A;  1W89 A;  4KCE A;  1NHO A;  2HI7 A;  3G9B A;  4K7I A;  2GQL A;  1V2A A;  1GSF A;  2MMZ A;  4ECI A;  3GKM A;  1PGT A;  1Q4J A;  4NWY A;  2GSR A;  4POL A;  1B8X A;  5ECH B;  4EC0 A;  2F8F A;  3GMF A;  4I8B A;  4ZL8 A;  4IHU A;  2RLI A;  1OYJ A;  4K1F A;  1WE0 A;  3D22 A;  1G7O A;  2E0Q A;  3A3T A;  3VWU A;  3A2V A;  4MA9 A;  1OE7 A;  2KLX A;  1OKD A;  3A5W A;  2R2J A;  5A4V A;  2E7P A;  4IJ3 A;  4OFT A;  5KOX A;  2R6K A;  1MDI A;  2GVP A;  1XOA A;  4FH8 A;  4PUF C;  5A4W A;  4EKZ A;  3GIX A;  3F6F A;  3KGK A;  2DJ3 A;  2N5A A;  4K6X A;  2K8S A;  3C1R A;  1JLV A;  4NHW A;  4OCE A;  5D8I A;  2TRC P;  3BOA A;  1M9B A;  3C73 A;  5DJL A;  3KIJ A;  4N0Z A;  3TRX A;  3R2Q A;  5HFG A;  1T4Y A;  5GZZ B;  2A4H A;  2OJL A;  2WB9 A;  4MZB A;  2CVB A;  4TXO B;  4V1A g;  3CTG A;  5IMC A;  2WDU A;  4X0X A;  19GS A;  4Z2R A;  3M9J A;  4HZ4 A;  5KN2 A;  5ECR B;  2PER A;  3QAG A;  3UVH A;  3I9V 2;  4JR4 A;  3FRC A;  1U3A A;  4KDY A;  1K3O A;  2L6D A;  4MDC A;  4DEJ A;  2P0G A;  1SKW B;  1SJZ A;  1F37 A;  3FHK A;  4TXV A;  3PIN A;  3G7I A;  4DSR A;  3GHA A;  1ZOF A;  1SL1 B;  2IL3 A;  1YJ6 A;  4TR4 A;  1X9M B;  4O92 A;  3TJK A;  3P90 A;  1GSU A;  3KJY A;  2RUE A;  3VI7 A;  2ZCT A;  1YKC A;  3F4T A;  3EMX A;  2RM6 A;  1EGO A;  1YY7 A;  2H75 A;  3LFL A;  3FZ4 A;  4MF7 A;  1W4V A;  2TIR A;  4G19 A;  5IOX A;  4XTS A;  1ZYE A;  2YWN A;  2YNX A;  2HXK A;  1PKZ A;  1JZW A;  3TRP A;  2IN3 A;  4PGT A;  4TXO A;  2QA1 A;  2YJ7 A;  3WGX A;  2V2G A;  1A0R P;  3HKR A;  1GUL A;  1RW1 A;  2YN1 A;  3GL3 A;  2H30 A;  1XXU A;  1G0T A;  1BG5 A;  2PUK C;  5DAK B;  1SEN A;  4PUA A;  3L78 A;  2DSA A;  2GSS A;  1R4W A;  1ACV A;  5KN1 A;  5IPH A;  1GL8 A;  2OE3 A;  1KBN A;  3GA4 A;  2VIM A;  1DE1 A;  3FR6 A;  2FA8 A;  2WS2 A;  3AY8 A;  2PWJ A;  4MPF A;  5G1K A;  3VPQ A;  4OO4 A;  6GSV A;  3QPM A;  3IBH A;  4L8E A;  5D73 A;  4G10 A;  1T4Z A;  3F3R A;  1ILO A;  2I4A A;  2MZC A;  2HSH A;  4PXO A;  3SBC A;  2V32 A;  1Y6E A;  4MZW A;  1MEK A;  2YZH A;  2OA7 A;  3DVW A;  2HRA A;  4JED A;  3HVX A;  6GSS A;  2LJA A;  1GH2 A;  12GS A;  1FOV A;  3WT2 A;  2M46 A; 
#chains in the Genus database with same CATH homology
 4I2U A;  2FD3 A;  4O7H A;  4EVM A;  5E59 A;  4TKY A;  3PGT A;  4KCA A;  5G5F A;  4K0G A;  2HE3 A;  3H1N A;  2C0G A;  3UJ1 A;  4LLR A;  2JL4 A;  3VPT A;  3TCO A;  5LNK e;  4IVF A;  3K8N A;  4BVX A;  1Z6M A;  5GAN D;  5G31 A;  4ZBA A;  9GSS A;  3UMA A;  1TK0 B;  4ILF A;  1WWJ A;  4V2M A;  4L5O A;  2H74 A;  1JZO A;  4MP4 A;  1YF0 A;  3KP8 A;  2XBQ A;  3LOR A;  4MNN A;  2JAC A;  1G6W A;  5F0G A;  4KF9 A;  1F2E A;  1TK8 B;  3O76 A;  4WXT A;  2NVL A;  2QA2 A;  2MMA A;  3TJG A;  3RHC A;  3CRT A;  4GSS A;  2VL2 A;  3LW9 A;  5IM9 A;  2CQ9 A;  3IPZ A;  1BAY A;  2JZR A;  2I1U A;  1M7T A;  4OD7 A;  1VGL A;  3LYK A;  4X1U A;  4JE1 A;  3VFI A;  2FUG 2;  4I97 A;  22GS A;  3MNG A;  1J9B A;  1Q98 A;  2IIY A;  1SKR B;  4CY6 A;  2LV3 A;  1XPV A;  4F03 A;  2GT5 A;  2LST A;  1JLW A;  3LGC A;  2HZE B;  4E8H A;  3LYP A;  2REM A;  2H01 A;  4N11 A;  6GST A;  1F9M A;  3GSS A;  1JFU A;  2GDR A;  2X8H A;  2VCV A;  3ZMK A;  4G0L A;  3KD0 A;  3DIE A;  2C3N A;  3GST A;  2PGT A;  4MF5 A;  1AQX A;  1T7P B;  2VL3 A;  1QK8 A;  18GS A;  1ZCP A;  5BMU A;  2R0C A;  2C3Q A;  2R0P A;  3D5J A;  1X5C A;  1SD9 A;  1K0N A;  1VF1 A;  5AIS A;  1WOU A;  1K0M A;  1B9X C;  2IME A;  5C00 A;  1UVZ A;  1AW9 A;  2NTO A;  1K3Y A;  2DJ1 A;  2AYT A;  3DKS A;  3UAR A;  1DUG A;  1HYU A;  4ZIL A;  4BA7 A;  2DMM A;  3J7Y b;  3WT1 A;  4FYU A;  2EIR A;  2HZE A;  4WKW A;  3DGQ A;  2HSY A;  1S3C A;  4F9Z A;  3F0I A;  4HOJ A;  5ECO B;  3H4K A;  2E2G A;  1M0U A;  1K0O A;  4L0W A;  2HNL A;  1XIY A;  2X49 A;  1THX A;  2FHE A;  14GS A;  4BL7 B;  5F8B A;  2O7K A;  3S9F A;  2OAC A;  2RII A;  1OKT A;  5LCZ A;  3EUR A;  1K0C A;  4V2N A;  4I2T A;  3GX8 A;  2E2M A;  3DXB A;  1VRS D;  1E6B A;  1A23 A;  1O81 A;  1XCC A;  2HSM A;  3QOU A;  4IS0 A;  2PBJ A;  5ECP B;  2C3T A;  4JBB A;  4EUY A;  4IKH A;  1SL2 B;  3FR3 A;  4K8M A;  3M0F A;  4G2E A;  4ECJ A;  3Q18 A;  3IXR A;  4ECC A;  3ZLP A;  3F3Q A;  2FWH A;  2GZZ A;  1V98 A;  2H76 A;  1GUK A;  4IQA A;  5DQS A;  2VLV A;  3C71 A;  5DQY A;  4Q5F A;  1X5E A;  4HJM A;  1PN0 A;  1TRV A;  3APS A;  5ID2 B;  4YKF A;  1SYX A;  2L4Q A;  1QFN A;  2K18 A;  3KM6 A;  4TW5 A;  1Z7R A;  3QR6 A;  5IO0 A;  1NHY A;  5IPG A;  2H73 A;  2L5O A;  4IJI A;  1ERV A;  3H8Q A;  1GNE A;  2VM2 A;  3CYN A;  1OAZ A;  1G7E A;  1Y25 A;  4ZL9 A;  4WBR D;  4N10 A;  1PQN A;  3A2W A;  1SL0 B;  1Z9H A;  1UN2 A;  3IC8 A;  5E4W A;  2CAQ A;  2B1K A;  3TDG A;  11GS A;  1KTE A;  4KDX A;  4F0B A;  4POM A;  4XS1 A;  2OBK A;  3GRX A;  2WJU A;  4EIQ A;  4ZB9 A;  2H19 A;  1G6Y A;  5DAL B;  4G0K A;  3TB2 A;  3ZYW A;  1F3A A;  2YP6 A;  1ON4 A;  2WFC A;  3BCI A;  1CQG A;  3IV4 A;  3BJ5 A;  3HD5 A;  5ID2 A;  1NM3 A;  1B9Y C;  2OKA A;  4OFN A;  5HQP A;  3LXT A;  1TK5 B;  2FWE A;  4ZB6 A;  3LJR A;  1QMV A;  2DLX A;  4KND A;  2FWG A;  4GRF A;  2FY6 A;  3FMW A;  4FYB A;  2LRC A;  4KE3 A;  5H5Q A;  1TRS A;  3WGE A;  4OO5 A;  3QFA C;  1PL2 A;  3QMX A;  1K0A A;  2YWO A;  1GTB A;  2VCT A;  5D9W A;  4HUA A;  1IYH A;  1RK4 A;  1EV9 A;  5B8A A;  2GQK A;  4MZC A;  1V58 A;  4Z2T A;  4NAX A;  3GKN A;  4ZXG A;  2KP1 A;  1XZO A;  1FO5 A;  4IW9 A;  2H0I A;  2H70 A;  3L4N A;  1YEX A;  5LD0 A;  3IHG A;  4EIP A;  2DKH A;  3ZIV A;  2LJK A;  3VWX A;  4XHM A;  1GSD A;  4KX4 A;  1J0F A;  2D2Z A;  1X5D A;  3ZIJ A;  1TP9 A;  2F9S A;  1I5G A;  3EWL A;  5CRH A;  1VF2 A;  3TRQ A;  4BVY B;  2VLU A;  2RM5 A;  2LQO A;  2B7J A;  1ZMA A;  2K8V A;  3HVS A;  1MDJ A;  4TVE A;  1UC7 A;  3VLN A;  2GZP A;  4LMW A;  4MMM A;  1ST9 A;  5BRT A;  4POB A;  1XW6 A;  4V1A p;  2AAW A;  2LJR A;  1WIK A;  1WJK A;  1XWG A;  4N0V A;  10GS A;  1MD3 A;  2DIZ A;  4ECB A;  2VAF A;  2GT6 A;  2CVK A;  2ES7 A;  4G9H A;  4AJ7 A;  2XHF A;  3GX0 A;  5CAX A;  1AQV A;  1A2M A;  2B5Y A;  1SKS B;  4KA0 A;  2LQQ A;  4Z2U A;  3CSJ A;  2B7K A;  2O85 A;  3M9K A;  1AQW A;  2H8L A;  1GRX A;  2MMO A;  4HU9 A;  1AAZ A;  7GSS A;  5JWQ B;  3LG6 A;  1S3D A;  4BVY A;  5JWO B;  2LNS A;  3HJP A;  4MJC A;  5A5K A;  1YQ1 A;  5EVO A;  1JZD A;  1XFL A;  3E3E A;  4K7N A;  5ECL B;  4CHS A;  5ECI B;  5J4U A;  1QQ2 A;  1BJX A;  4K5S A;  4J57 E;  3D0Z A;  5J9B A;  5ELG A;  5IMD A;  3TJF A;  2CAI A;  3KTL A;  3IA1 A;  4ACS A;  3PH9 A;  4V2L A;  1TRU A;  2X64 A;  4PQH A;  4K2X A;  3US3 A;  2GLR A;  2L57 A;  4A5P A;  1TI1 A;  2M72 A;  4WEY A;  4AF2 A;  4NV2 A;  1FAA A;  2ON7 A;  2CX4 A;  5D93 A;  4NV5 A;  5B6N A;  3P2A A;  2L59 A;  3R3E A;  1S3A A;  3ZML A;  3BCK A;  1O85 A;  2H66 A;  4K2D A;  2A2P A;  2JZS A;  2WUL A;  3NZN A;  2V41 A;  5CRE A;  4KUN A;  2WZ9 A;  1XWA A;  1M2B A;  3UAP A;  4D73 B;  3C8E A;  3E0U A;  4MH2 A;  3QAV A;  4HQZ A;  2GST A;  3LWA A;  1FHE A;  2DJJ A;  2HZF A;  1GUH A;  1LU4 A;  3NOF A;  1QGV A;  3FKF A;  1DBY A;  1UA5 A;  5DAK A;  1R26 A;  3D21 A;  3ERG A;  2J9H A;  2F51 A;  1T8E B;  1ZL9 A;  3TOT A;  2XBI A;  2JZT A;  2IFQ B;  5J5N A;  1TTZ A;  3UOM A;  3GL5 A;  1U88 A;  2OAD A;  1B4P A;  2DIY A;  4ML1 A;  3QCP A;  5JCG A;  3APQ A;  2B6M A;  5AN1 A;  4QL9 A;  5JCU A;  2HT9 A;  3ZFL A;  5HFK A;  3UBL A;  3GYK A;  2EC4 A;  4Q5N A;  4GF0 A;  1SJ6 A;  1PX7 A;  2HRK A;  2FLS A;  3HJM A;  5EY6 A;  3HDC A;  3DML A;  5C04 A;  3MAK A;  2H6Z A;  1VF3 A;  3CBU A;  2GTU A;  2OBI A;  1PRX A;  2G0F A;  4O5U A;  1ERW A;  4LL1 B;  4MJE A;  3IDV A;  1O8W A;  1E2Y A;  5IMA A;  1EP7 A;  1FVJ A;  4X43 A;  5DCG A;  1PD2 1;  4QL7 A;  3IOS A;  2UZ8 A;  4RQX A;  3F6D A;  4AJ8 A;  4EF0 A;  2O8V B;  1H4O A;  3IC4 A;  1XW5 A;  1MTC A;  2WCI A;  3EIN A;  3KMO A;  3ZIT A;  3LSZ A;  1FG4 A;  1O73 A;  1TW9 A;  1Z7P A;  5J9C A;  5CRW A;  5G30 A;  2VD1 A;  3HJO A;  3D6I A;  4OMV A;  4AJ6 A;  4MLY A;  4EO3 A;  2BTO T;  2Z9S A;  1AXD A;  1OC3 A;  2LKU A;  4JR6 A;  4K7O A;  4CY8 A;  1Z5Y E;  3VUR A;  1M2A A;  4FO5 A;  2QC7 A;  5IMZ A;  3DD3 A;  3A2X A;  3DWV A;  6GSX A;  2DBC A;  3EPT A;  1OC9 B;  2R37 A;  1GLP A;  3ZVJ D;  1ZYP A;  5IMF A;  3TJB A;  3KP9 A;  4NHZ A;  3BBY A;  2GZY A;  1EGR A;  5HR1 A;  5JWR B;  1HQO A;  5G1L A;  2CA8 A;  3UVT A;  5G2Z A;  2I3Y A;  1QUW A;  3LQ7 A;  4NXI A;  1NSW A;  2K9F A;  4K0N A;  5JCW A;  4K5R A;  2VCZ A;  4EDZ A;  1XW9 A;  3N5O A;  2YJH A;  2LRT A;  3FZ5 A;  1JZR A;  1H75 A;  4NPB A;  2H1G A;  5CNW A;  1KEB A;  5IQY A;  2YOI A;  1TOF A;  3CMI A;  2C1Y A;  2JAD A;  3EC3 A;  1F3B A;  1C72 A;  1X9S B;  2YCD A;  3NIV A;  2B5E A;  5KN0 A;  1T3B A;  3CSH A;  3TOU A;  5EPF A;  3HZ8 A;  1GUM A;  1ZZY A;  1GSS A;  4MH3 A;  1J08 A;  1YF1 A;  3A5I A;  5AIV A;  1XVQ A;  1OC9 A;  3Q6O A;  3I69 A;  3ZRD A;  3MSZ A;  1GSE A;  3DRN A;  2R0G A;  2AUV A;  2DJ0 A;  5CRG A;  3H79 A;  2L5L A;  3W8S A;  1YEP A;  2MYG A;  3U6V A;  2GS3 A;  5A4U A;  3F4R A;  3TKS C;  2MBS A;  1PSQ A;  1N8J A;  3Q74 A;  3L9S A;  1SJI A;  1A2J A;  5D9X A;  2YZU A;  1O6J A;  3TKS E;  1BYE A;  2X8G A;  3EE2 A;  2C0F A;  4HS1 A;  2WGR A;  1B48 A;  1X0R A;  4F82 A;  4HDE A;  2VOC A;  1OC8 A;  4LL4 B;  3VWW A;  2AHE A;  3HVV A;  5ECK B;  5IO2 A;  3F9U A;  4NMU A;  2C80 A;  2CVD A;  1YZX A;  1TJD A;  3JCM L;  2C8U A;  4MPG A;  3L9U A;  4BL7 A;  1EP8 A;  3EYT A;  2O87 A;  2YAN A;  2PVO C;  4DSS B;  3M8N A;  4HI7 A;  2KUC A;  3F8U A;  4IP6 A;  3OR5 A;  4PNF A;  4TN8 A;  3DYR A;  4O32 A;  4WF4 A;  2N5F A;  5AIX A;  2IMD A;  2VO4 A;  4XRA A;  3G7J A;  1ERT A;  4TRX A;  4F2I A;  1R7H A;  1EOH A;  4WBJ A;  3VK9 A;  17GS A;  5CYY A;  3VI5 A;  2N5B A;  2VUP A;  5D9T A;  1THO A;  1TDI A;  5IMV A;  1I9D A;  4OWY A;  3KEB A;  3I43 A;  1HNC A;  1GTI A;  2DJ2 A;  2P5Q A;  1GP1 A;  4WET A;  1A2L A;  5KN3 A;  5J41 A;  2DC5 A;  3EU4 A;  3L0H A;  3F4S A;  4FQU A;  4I5Q A;  4ZL7 A;  8GSS A;  3KXO A;  3GUR A;  4GQC A;  3P8W A;  5HFI A;  1PKW A;  5DJM A;  3P7X A;  4HEA 2;  3GNJ A;  1SK0 A;  2QSI A;  2GGT A;  3W8J A;  1TU8 A;  3ZL5 A;  4OCF A;  2VM1 A;  2BMX A;  2YV9 A;  2V6K A;  6GSU A;  5IIZ A;  1K0D A;  1AC1 A;  3GKK A;  5DAL A;  4YQV A;  1TXX A;  3PR8 A;  5CRD A;  2XPE A;  1GSY A;  2HRF A;  3KH9 A;  2NDO A;  2H1B A;  4G0I A;  5H5R A;  4KSM A;  1GTA A;  4GSN A;  3IHQ A;  3ZVJ A;  1V57 A;  5HR0 A;  2LEG A;  1M9A A;  1RQM A;  2OE1 A;  2H72 A;  2JSZ A;  4PNG A;  4YQM A;  2DML A;  4MCU A;  1GNW A;  2L6C A;  3ME7 A;  1X9W B;  2CT6 A;  5G5E A;  4IQ1 A;  2A2R A;  1WRY A;  2V1M A;  3IAM 2;  3ZTL A;  3LXZ A;  2VCQ A;  2CX3 A;  3GKX A;  2YWI A;  4EL1 A;  4GST A;  1V9W A;  1CQH A;  5GAP D;  2TRX A;  4JRR A;  4KDU A;  4H86 A;  1FW1 A;  3RHB A;  4LMV A;  3KH7 A;  3GH6 A;  2VLT A;  3DEX A;  4ZBB A;  2VCW A;  1ZGN A;  2IMK A;  3M1G A;  4PUR A;  2V6O A;  2GSQ A;  13GS A;  3HHV A;  3U5R E;  1GTU A;  3WD6 A;  4IN0 A;  2NBS A;  3IAS 2;  3TKQ A;  2RUF A;  4YAP A;  2J23 A;  2L4C A;  2HFD A;  1AIU A;  1F6M C;  5CO3 A;  2LUS A;  3N9J A;  4F0C A;  1IYI A;  1U3I A;  3EU3 A;  4KAE A;  1TKD B;  1LBK A;  1M99 A;  3F63 A;  3O3T A;  2P31 A;  3W6G A;  2YPM A;  4AGS A;  1ZYQ B;  4EDY A;  2OE0 A;  3I6A A;  3ERW A;  2BJX A;  3L9V A;  1HD2 A;  2KOK A;  3J7Y k;  4CW9 A;  3KZQ A;  4EXJ A;  5DDL A;  3APO A;  3TJJ A;  4Z7X A;  2H6X A;  4TR3 A;  1U6T A;  4YQU A;  2H0G A;  4XCS A;  2MBT A;  3IK7 A;  1SK1 A;  3RPP A;  3GN3 A;  2H71 A;  4IEL A;  3ZZX A;  3C1S A;  4FYC A;  2QGV A;  5AGY A;  4DSQ A;  1TU7 A;  3RAZ A;  2LRN A;  4PTS A;  3WYW A;  5F05 A;  3VWV A;  4BWS A;  2CZ3 A;  3KTB A;  4RI7 A;  3IRA A;  5COH A;  2FNO A;  1OVN A;  1GWC A;  4ZBD A;  1K0B A;  2F8A A;  1EOG A;  2HYX A;  5ECN B;  4YH2 A;  4XRD A;  1JHB A;  3MIX A;  1QXH A;  2LS5 A;  1AUC A;  4BVX B;  2AJQ B;  4CDO A;  1URM A;  1XOB A;  5D9V A;  4L5L A;  2IJY A;  5DCH A;  1A0F A;  3CRU A;  5D96 A;  1DE2 A;  3V1W A;  4WR5 A;  1PA3 A;  4JU5 A;  5F06 A;  2P5R A;  2F3M A;  2C0D A;  1WPI A;  4X4J A;  2H6Y A;  2B5X A;  3IE3 A;  2K6V A;  1R5A A;  1M2D A;  4ISD A;  1PX6 A;  1ERU A;  2B1L A;  5ENU A;  1V40 A;  2AB6 A;  4TR1 B;  3PPU A;  2AV4 A;  4YAV A;  4IGJ A;  1SU9 A;  2H1A A;  1SK2 A;  4D73 A;  1T00 A;  3FYG A;  3TGZ A;  1FOH A;  4PQI A;  2R5G A;  2YWM A;  5J3R A;  1BED A;  3MWH A;  1XWK A;  2MMN A;  3FW2 A;  3G7Y A;  4TOP A;  4ID0 A;  2XC2 A;  2VCX A;  1XWC A;  1KNG A;  2JSY A;  3TKP A;  2PPT A;  6GSW A;  5DBQ A;  3ISO A;  2I81 A;  1A24 A;  4GTU A;  5DVB A;  4YKG A;  3TUE A;  3LEF A;  3D4M A;  3HY2 A;  4O5Q A;  3FR9 A;  1OE8 A;  3QFB C;  4RUV A;  5HR2 A;  3RPN A;  2IFQ A;  2LNT A;  4L0U A;  2C4J A;  4MF6 A;  5ECQ B;  4Q5R A;  3WGD A;  1R5P A;  2KP2 A;  2ZUP A;  3ERF A;  1EWX A;  5B6M A;  1A8Y A;  2FA4 A;  4GXZ A;  3M3M A;  1K3L A;  3QD9 A;  1N2A A;  4HU7 A;  3MDK A;  1DSB A;  4TR1 A;  2A4V A;  1TI3 A;  4KW6 A;  1YDK A;  3D4T A;  3QDN A;  20GS A;  4KSO A;  3ZRE A;  1WMJ A;  2IMF A;  1TRW A;  2G2Q A;  4HQS A;  4I6X A;  4JZQ A;  2PU9 C;  5L71 A;  1PMT A;  1EEJ A;  3QAW A;  2CZ2 A;  3ME8 A;  4USS A;  2R4V A;  4XIH A;  1XBS A;  3IR4 A;  2C0E A;  3BD2 A;  2CV4 A;  3UIW A;  3GTU B;  3HA9 A;  3TKS A;  3UBK A;  1B4Q A;  5H5S A;  2GQM A;  1GSQ A;  2XPD A;  4HZ2 A;  1YKA A;  2LTK A;  1XWB A;  4K9Z A;  5GSS A;  4IBP A;  3CTF A;  2FCH A;  3HCZ A;  3C7M A;  4DVC A;  4RI6 A;  3GFK A;  3FZ9 A;  2WRT A;  3EVI A;  3HXS A;  16GS A;  2VL2 C;  4N30 A;  4MK3 A;  1U87 A;  3UL3 A;  4J2F A;  4QQ7 A;  4GCI A;  1O8X A;  2HRN A;  3EMP A;  1WP0 A;  5FWG A;  5FHI A;  1USB A;  1HNA A;  3CXG A;  4ML6 A;  4E8E A;  4KGI A;  4TR0 A;  4O5R A;  1Z6N A;  2JU5 A;  1EZK A;  4WR4 A;  4ICY A;  3UEM A;  3GTU A;  1SYR A;  4RQR A;  2YV7 A;  4LA1 A;  3ED3 A;  4BPY A;  2QKE A;  1T1V A;  2ON5 A;  2VL9 A;  3TKR A;  2PN8 A;  2X99 A;  5EL8 A;  3KCM A;  3FZA A;  3SWL A;  4ULX A;  3IK9 A;  3KMN A;  4XS4 B;  1NW2 A;  5B7C A;  4GQF A;  1FB6 A;  3HZ4 A;  4FIW A;  2KHP A;  5B8B A;  3HYP A;  3E9J B;  4MAB A;  5KOW A;  1LJR A;  1HNB A;  1PN9 A;  5F07 A;  1VF4 A;  6GSY A;  5ECS A;  4J56 E;  1ZYN A;  2EIO A;  3DVX A;  5FT3 A;  3GV1 A;  3H93 A;  1EEM A;  3O6T A;  4BWQ A;  4Q5Q A;  2ZNM A;  4EE0 A;  1FVK A;  1MDK A;  5KEJ A;  1PL1 A;  2FGX A;  4GWR A;  2B3S A;  2I9H A;  2VD0 A;  2FWF A;  2EIQ A;  4POK A;  1BX9 A;  4PX1 A;  3RDW A;  2NPB A;  1FB0 A;  3MYD A;  4PQ1 A;  2IMI A;  1GLQ A;  5IOW A;  5ECM B;  1ABA A;  4XS4 A;  4GLT A;  3GH9 A;  5CP1 A;  2R3X A;  2DKI A;  2H1D A;  4ZIJ A;  4P3Y B;  5ABR A;  4XS6 A;  5GST A;  1MD4 A;  2DJK A;  4WF5 A;  3CSI A;  5INY A;  3Q19 A;  5HR3 A;  1A8L A;  3ZFB A;  4MJA A;  4MJB A;  4IP1 A;  2X4A A;  1EV4 A;  4DSS A;  2ALB A;  2HLS A;  2PVQ A;  2M80 A;  3GUS A;  3RBT A;  1BQ7 A;  2A2S A;  2IWT A;  4HJ2 A;  4OFM A;  5ELA A;  3FY7 A;  1ML6 A;  4ZB8 A;  1Z3E A;  3FEU A;  2O89 A;  2PMT A;  4KB3 A;  2IPA A;  4KH7 A;  1XVW A;  1O7U A;  2X8C A;  3FK8 A;  2H0H A;  1SD8 A;  1W89 A;  4KCE A;  1NHO A;  2HI7 A;  3G9B A;  4K7I A;  2GQL A;  1V2A A;  1GSF A;  2MMZ A;  4ECI A;  3GKM A;  1PGT A;  1Q4J A;  4NWY A;  2GSR A;  4POL A;  1B8X A;  5ECH B;  4EC0 A;  2F8F A;  3GMF A;  4I8B A;  4ZL8 A;  4IHU A;  2RLI A;  1OYJ A;  4K1F A;  1WE0 A;  3D22 A;  1G7O A;  2E0Q A;  3A3T A;  3VWU A;  3A2V A;  4MA9 A;  1OE7 A;  2KLX A;  1OKD A;  3A5W A;  2R2J A;  5A4V A;  2E7P A;  4IJ3 A;  4OFT A;  5KOX A;  2R6K A;  1MDI A;  2GVP A;  1XOA A;  4FH8 A;  4PUF C;  5A4W A;  4EKZ A;  3GIX A;  3F6F A;  3KGK A;  2DJ3 A;  2N5A A;  4K6X A;  2K8S A;  3C1R A;  1JLV A;  4NHW A;  4OCE A;  5D8I A;  2TRC P;  3BOA A;  1M9B A;  3C73 A;  5DJL A;  3KIJ A;  4N0Z A;  3TRX A;  3R2Q A;  5HFG A;  1T4Y A;  5GZZ B;  2A4H A;  2OJL A;  2WB9 A;  4MZB A;  2CVB A;  4TXO B;  4V1A g;  3CTG A;  5IMC A;  2WDU A;  4X0X A;  19GS A;  4Z2R A;  3M9J A;  4HZ4 A;  5KN2 A;  5ECR B;  2PER A;  3QAG A;  3UVH A;  3I9V 2;  4JR4 A;  3FRC A;  1U3A A;  4KDY A;  1K3O A;  2L6D A;  4MDC A;  4DEJ A;  2P0G A;  1SKW B;  1SJZ A;  1F37 A;  3FHK A;  4TXV A;  3PIN A;  3G7I A;  4DSR A;  3GHA A;  1ZOF A;  1SL1 B;  2IL3 A;  1YJ6 A;  4TR4 A;  1X9M B;  4O92 A;  3TJK A;  3P90 A;  1GSU A;  3KJY A;  2RUE A;  3VI7 A;  2ZCT A;  1YKC A;  3F4T A;  3EMX A;  2RM6 A;  1EGO A;  1YY7 A;  2H75 A;  3LFL A;  3FZ4 A;  4MF7 A;  1W4V A;  2TIR A;  4G19 A;  5IOX A;  4XTS A;  1ZYE A;  2YWN A;  2YNX A;  2HXK A;  1PKZ A;  1JZW A;  3TRP A;  2IN3 A;  4PGT A;  4TXO A;  2QA1 A;  2YJ7 A;  3WGX A;  2V2G A;  1A0R P;  3HKR A;  1GUL A;  1RW1 A;  2YN1 A;  3GL3 A;  2H30 A;  1XXU A;  1G0T A;  1BG5 A;  2PUK C;  5DAK B;  1SEN A;  4PUA A;  3L78 A;  2DSA A;  2GSS A;  1R4W A;  1ACV A;  5KN1 A;  5IPH A;  1GL8 A;  2OE3 A;  1KBN A;  3GA4 A;  2VIM A;  1DE1 A;  3FR6 A;  2FA8 A;  2WS2 A;  3AY8 A;  2PWJ A;  4MPF A;  5G1K A;  3VPQ A;  4OO4 A;  6GSV A;  3QPM A;  3IBH A;  4L8E A;  5D73 A;  4G10 A;  1T4Z A;  3F3R A;  1ILO A;  2I4A A;  2MZC A;  2HSH A;  4PXO A;  3SBC A;  2V32 A;  1Y6E A;  4MZW A;  1MEK A;  2YZH A;  2OA7 A;  3DVW A;  2HRA A;  4JED A;  3HVX A;  6GSS A;  2LJA A;  1GH2 A;  12GS A;  1FOV A;  3WT2 A;  2M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...