3TJJA

Crystal structure of human peroxiredoxin iv c245a mutant in sulfenylated form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
167
structure length
166
Chain Sequence
LSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Crystal Structure of Reduced and of Oxidized Peroxiredoxin IV Enzyme Reveals a Stable Oxidized Decamer and a Non-disulfide-bonded Intermediate in the Catalytic Cycle.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 166
sequence length 167
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tjjA00
2RUEA 1OE7A 1XW5A 4L5OA 4NHZA 2I81A 2RM5A 3G9BA 1XWCA 1WRYA 2MMAA 2C0GA 2LQOA 3GSTA 1B48A 3GTUB 4HQSA 4EC0A 5IO2A 3K8NA 1K0AA 2H66A 3I69A 3QFBC 3L9UA 1BEDA 2VD1A 4OMVA 2GSTA 1VF3A 3L9SA 1O8WA 1ERVA 2YZHA 3GRXA 1XWBA 2VD0A 5FWGA 4D73A 1ZYQB 1ERWA 5IMVA 2F8AA 3DRNA 4J2FA 1C72A 1BYEA 1X9WB 5F0GA 16GSA 2C4JA 2GT5A 1B9XC 2L6DA 1T7PB 1QGVA 1VF1A 3L9VA 5IPGA 3QCPA 3LGCA 5CYYA 2HI7A 2HXKA 2BMXA 3F9UA 4HU9A 3LWAA 2FY6A 1WIKA 4MJEA 5ECMB 2VCXA 4ZL7A 2OE3A 3FW2A 4L8EA 2WGRA 5A4VA 3EMPA 3LXZA 11GSA 2M72A 20GSA 3NIVA 1JLVA 4ML1A 4NWYA 3TJBA 1SL2B 1F3BA 1ERUA 5ECQB 5J4UA 2LV3A 4MZWA 3IR4A 3UOMA 1O7UA 3KTBA 4XS1A 4XHMA 10GSA 5J9BA 2LQQA 1TRSA 2O89A 3HVVA 5DQSA 2P5RA 1FW1A 1ZZYA 5ENUA 1F9MA 3F3RA 3PGTA 3JCML 2GLRA 3UBLA 2YWIA 3ZIVA 1M0UA 3U5RE 1HD2A 3GKKA 1V58A 1U88A 1ABAA 1N8JA 1K3LA 4EDZA 4HUAA 2RM6A 1Z6MA 1TP9A 3FY7A 1Z9HA 5DBQA 4MMMA 1KBNA 5ECOB 1RW1A 1F6MC 2IL3A 2B7KA 2VCQA 3EU3A 2WDUA 2VCVA 4K1FA 3NZNA 2VM2A 3EYTA 1B4QA 2B7JA 5FHIA 3W8SA 1K3OA 1OC9B 4IJ3A 2AHEA 4Q5NA 1DBYA 4ML6A 1XVWA 3N5OA 5GAPD 4TR1A 2VLTA 4HS1A 2J23A 5D9WA 5B6MA 2O7KA 3ZIJA 3M1GA 3VI7A 1Z6NA 3UAPA 3P8WA 1Y25A 1ILOA 4TKYA 5H5RA 2AJQB 3I6AA 4K7IA 4OWYA 1EGRA 1J0FA 2H0HA 2HZEB 1FB6A 2V2GA 1T4ZA 2CZ3A 2NDOA 1EEJA 2DIYA 2GVPA 1SD9A 5ECPB 5ID2B 4ISDA 1YJ6A 3M9KA 1PQNA 1VGLA 1AAZA 2I9HA 5ECRB 5D93A 2HLSA 1T00A 5D73A 5D9VA 4N10A 2R37A 1S3DA 3J7Yk 1R7HA 1ST9A 3KEBA 1JZWA 3ZZXA 3EWLA 1YY7A 4KSMA 1WPIA 2HZEA 1XIYA 2H0GA 5AIVA 3A5WA 4JE1A 5ID2A 3ZL5A 1R5AA 4GF0A 3MWHA 2OKAA 4IW9A 1A0FA 5DCHA 4ZL9A 5HR3A 3VPQA 4AF2A 5H5QA 3ZYWA 4IJIA 1XVQA 2FGXA 4MA9A 3F6FA 5J3RA 2JU5A 2KLXA 5HQPA 2NVLA 4Q5QA 2YNXA 4OFNA 1VRSD 1YEPA 3V1WA 3D6IA 1YDKA 2FD3A 1GSUA 2O87A 1DSBA 3FZ5A 3C73A 1M2AA 1OAZA 2QSIA 4GLTA 3P2AA 5E59A 4G9HA 4GXZA 5J9CA 1XWGA 1MD4A 2IMDA 2E7PA 3C71A 3DWVA 1SU9A 5CRWA 3VURA 3GUSA 4KDYA 4PX1A 2GT6A 4MDCA 2ALBA 4TW5A 19GSA 3RBTA 2WZ9A 2LS5A 4KSOA 2E0QA 4IHUA 5CREA 4DSSB 4F03A 2HRFA 4L0WA 1GSEA 1LBKA 1I5GA 2CVBA 5A4UA 2VAFA 4KNDA 3GSSA 2LUSA 4IBPA 2C3QA 3ME7A 4NV2A 3GKMA 1AXDA 1FVJA 1X0RA 4TOPA 1GSDA 1GUMA 3HHVA 4PUAA 4PNGA 2MMNA 1MEKA 1SKRB 3BCKA 4E8EA 4NPBA 1SL1B 2N5FA 2REMA 3LQ7A 3KXOA 4DSSA 4FYUA 4O7HA 4K0GA 5DALB 4RQRA 3GHAA 1T3BA 1JZDA 4HU7A 3S9FA 3GKNA 3IOSA 3UIWA 4EE0A 1HNAA 1WJKA 2TRCP 3BJ5A 1HYUA 4O92A 1F2EA 1M2BA 3ME8A 1SYRA 2B6MA 3RPNA 3SBCA 4N0ZA 2C80A 3LG6A 4Q5FA 3LJRA 2YPMA 1FG4A 2AUVA 9GSSA 2OE0A 2V1MA 3EVIA 2B5XA 4EVMA 1DE1A 1BX9A 3VK9A 1FO5A 1H4OA 4POKA 4DSQA 1H75A 5G1KA 3TJJA 22GSA 4F9ZA 2JZRA 4IQAA 2FWGA 2EIQA 1YZXA 4BWQA 3C8EA 2CT6A 4F0CA 3CSJA 3IA1A 5G31A 4X43A 3CTFA 4Q5RA 4GSNA 2VCWA 4I97A 4ZB8A 1UC7A 4KX4A 3CBUA 1SJ6A 4MH2A 5D9XA 4KW6A 2AB6A 3E3EA 3H79A 4PNFA 3M8NA 2L57A 4MF5A 3RHBA 4BVYA 1VF4A 5KN0A 3TJKA 2VUPA 2IN3A 3ZVJA 2D2ZA 3HDCA 2KHPA 4GTUA 1T8EB 1PX7A 5CO3A 6GSWA 1UVZA 4HI7A 6GSTA 3DVWA 2GZZA 1SKSB 2DJJA 3TKSA 3L0HA 14GSA 2KUCA 2O85A 2XBQA 2CA8A 2L4CA 1GTBA 1WOUA 2ZNMA 1U6TA 3HD5A 1OVNA 5JWRB 1TK0B 4MF7A 1PX6A 2PVQA 4RI7A 3EU4A 2OADA 1OE8A 4FIWA 5G30A 3OR5A 3BD2A 4ECJA 1GWCA 4MLYA 3UARA 3N9JA 5C04A 3Q74A 1K0DA 4HOJA 2K8VA 5DAKB 2VL3A 5IMZA 4DSRA 2FWHA 3FEUA 1FHEA 1Z3EA 3A2VA 1OYJA 4I8BA 1QFNA 1HNCA 4KDXA 1O6JA 4BWSA 3M0FA 4I2TA 2H1BA 2RLIA 3E9JB 1U3AA 2MBSA 1XW6A 5J41A 4MZCA 2M80A 4KCAA 1S3AA 3KP9A 3FR9A 1YKAA 5EL8A 1SKWB 4OFTA 3DMLA 1PKZA 2YN1A 4YQUA 1SJIA 3RPPA 2VCTA 2XHFA 1OC8A 3O3TA 4WETA 2JZSA 2DMLA 2A4VA 3ZMLA 1PSQA 4AJ8A 2JACA 3A3TA 2HNLA 2WJUA 3D5JA 6GSSA 1EP7A 3IE3A 2PU9C 4LA1A 3G7IA 3TKSE 4F0BA 1A2MA 2HZFA 3SWLA 2VL2C 4OO4A 1R5PA 3LEFA 4V2LA 3UMAA 2J9HA 3GTUA 3GL5A 4Z7XA 2C0EA 3IRAA 2B1LA 1X9MB 1XWKA 5GZZB 3C1SA 3MNGA 3KD0A 1AIUA 1U3IA 4MJBA 2GZPA 5CRGA 3HVSA 5HR0A 5HFGA 2C3TA 2PN8A 1BQ7A 1S3CA 3UBKA 5A5KA 3VPTA 5INYA 4JR6A 4K2DA 2EIRA 4XS4B 1XOAA 3IAS2 1NW2A 3P90A 4ZBAA 1NHOA 2MYGA 4RUVA 1PRXA 5IO0A 4ECCA 2X64A 5KN2A 3F0IA 4FO5A 1CQHA 2G0FA 4E8HA 1G7EA 3ZFLA 2WULA 3WGEA 5A4WA 4MH3A 2C0DA 2EC4A 1GL8A 3KTLA 5EY6A 5C00A 3BOAA 3DIEA 4QQ7A 1GRXA 4TVEA 4PQ1A 3VWWA 2FHEA 3ZLPA 2GSQA 1XW9A 2R3XA 2YV7A 1GTIA 2FWEA 3EINA 4KA0A 5ECIB 3H93A 4EO3A 3GV1A 5IM9A 3NOFA 2LJKA 2C3NA 1EWXA 5LCZA 3P7XA 4ZB9A 3BBYA 4XIHA 3CRTA 4P3YB 1MDIA 4RQXA 1RQMA 5CNWA 1TTZA 2R2JA 2K9FA 3EC3A 5DJMA 3DGQA 4POMA 3CSIA 3A2WA 2QC7A 3VWVA 4IN0A 3G7JA 3UVTA 4MK3A 2ES7A 2DMMA 3PH9A 5G1LA 3D0ZA 1TW9A 4NMUA 3D4MA 2G2QA 3QD9A 3ZTLA 3CSHA 2IFQB 4HJMA 4V1Ag 2H76A 3TJFA 1YF1A 3HXSA 1ACVA 1NSWA 1UN2A 3IC4A 5FT3A 4YAVA 1TDIA 3Q18A 2OBKA 1OC9A 2TIRA 2AYTA 2LRNA 4NXIA 4OD7A 3KM6A 5ECHB 2VOCA 1XPVA 3FZAA 1K0OA 2KP1A 3CTGA 5EPFA 3RDWA 4GQCA 1ZCPA 4WBJA 2PUKC 1YKCA 3KZQA 1MDJA 1M9BA 2M46A 2CV4A 4GQFA 1GP1A 4MJAA 1ZYEA 2EIOA 1AQXA 2E2GA 3F4TA 5GSSA 1R4WA 5F06A 1FAAA 3ED3A 3QAVA 1QMVA 3RHCA 5ELAA 2H74A 8GSSA 4GCIA 1HQOA 2K18A 4X0XA 3GURA 3ZRDA 4PQHA 2YWMA 2QKEA 4HEA2 4XRDA 4OO5A 1EOGA 3G7YA 4ECBA 1GULA 2WS2A 2F9SA 2DJ1A 3TGZA 2H30A 1F37A 1V9WA 4IVFA 3UL3A 5LD0A 2N5AA 4IS0A 17GSA 3LFLA 1PN9A 1GNWA 1GH2A 2CAIA 1X5DA 3LXTA 3QDNA 3R2QA 4LMWA 2LKUA 5LNKe 1HNBA 3WT1A 4TXOB 4TR0A 1GSFA 2GQLA 5B8AA 1FOVA 4ACSA 1DE2A 4JBBA 2P31A 2B5YA 3GIXA 1OC3A 1K3YA 3H1NA 2C0FA 4V2NA 5ECNB 1GTUA 4ZIJA 3DD3A 1GNEA 1EZKA 4N30A 4YQVA 2LTKA 3IPZA 4AGSA 4AJ6A 1MTCA 1SL0B 1SK2A 3FR3A 1MDKA 2GGTA 3QPMA 1GUKA 4L0UA 5B7CA 3MAKA 4TXOA 3DVXA 3FZ9A 4POLA 2X8HA 3IV4A 3WGDA 1JZRA 1NHYA 4GSSA 1LU4A 1T1VA 5GSTA 2JSZA 4HDEA 5DVBA 1EV4A 2YCDA 3IHQA 1KNGA 3IDVA 1V2AA 4ZILA 5JCWA 1BAYA 2HRNA 4J56E 1G6WA 2NPBA 5CAXA 6GSYA 2H01A 3LORA 4POBA 4GWRA 2CQ9A 1A8LA 1TI1A 2R6KA 1LJRA 3GN3A 4FYBA 4FH8A 2R4VA 4JEDA 4AJ7A 1JFUA 3HA9A 3QR6A 2FUG2 5JWOB 3QAGA 3KMOA 4MCUA 2VO4A 2NTOA 2B3SA 4EF0A 2YJHA 2VLUA 1A2LA 5IIZA 3GX8A 2DJ2A 4IGJA 5HR2A 2B5EA 3TKPA 1X5EA 5IMFA 1J08A 2JADA 1QQ2A 3HZ8A 1USBA 1Z7RA 4ID0A 4K6XA 4WXTA 2H19A 1X5CA 5DALA 4N0VA 1A0RP 1ERTA 1GSQA 4K9ZA 1OKTA 1PA3A 2WCIA 5G5FA 3U6VA 4TN8A 3HVXA 2X8CA 3HKRA 2FCHA 3H8QA 2QGVA 2XBIA 1ON4A 2GZYA 1QK8A 2MMZA 4IKHA 2PBJA 1J9BA 2IJYA 3WD6A 3CMIA 1YQ1A 2O8VB 1X9SB 1EGOA 3TB2A 3APOA 3CXGA 3UEMA 1V57A 4NHWA 4K8MA 2WB9A 3H4KA 2E2MA 4H86A 3CRUA 1ML6A 3M9JA 5HFIA 1JHBA 4MF6A 2JL4A 2H1GA 3FZ4A 2VCZA 2GQKA 1O85A 5AGYA 3IK9A 4K0NA 4NV5A 2CVKA 2BTOT 3TRQA 3L78A 3QAWA 1A24A 4XCSA 4LMVA 4WEYA 1E6BA 4KAEA 3O76A 2GDRA 4YAPA 1PGTA 1SENA 3Q6OA 5D96A 2H70A 5COHA 5IMAA 3CYNA 1IYHA 4TR3A 3VWUA 4JZQA 2B1KA 4ECIA 3ERWA 2KOKA 5DJLA 4CHSA 2DC5A 2VL9A 1SD8A 4I6XA 4YH2A 4JRRA 2CZ2A 3E0UA 4ULXA 1AW9A 4V1Ap 3EMXA 2ON5A 2P0GA 3FHKA 1TU8A 1XXUA 4QL9A 3EURA 1K0BA 4XRAA 2MZCA 1A2JA 5HFKA 4CW9A 2L5OA 4OCFA 3VFIA 4I2UA 4WKWA 5DQYA 3TRXA 2YP6A 1XOBA 1B8XA 4D73B 3APSA 1W4VA 3GNJA 1QXHA 4DVCA 3DEXA 1TU7A 5CRDA 5DAKA 1WP0A 2PVOC 2I4AA 3FKFA 1PKWA 2OE1A 1SYXA 3I9V2 1GUHA 2CAQA 3TCOA 2WFCA 4LL4B 3D22A 5JCGA 5GAND 1E2YA 3O6TA 1GLQA 2HT9A 4ZXGA 3US3A 3HJMA 1JLWA 5KN1A 4TXVA 5IOWA 2CVDA 2RIIA 3C7MA 2VM1A 4BPYA 5F05A 3DKSA 2HSHA 4QL7A 4L5LA 3ZFBA 4G10A 1TOFA 4V2MA 2PWJA 2LNSA 2JSYA 2IMEA 5KEJA 2V6OA 2XPEA 2HFDA 3M3MA 4K7OA 2DLXA 3RAZA 4ILFA 2TRXA 4MABA 4GRFA 2R5GA 3WYWA 4N11A 1F3AA 3IXRA 2DBCA 2XC2A 3GH6A 4CDOA 4WBRD 1V40A 3PINA 4G2EA 2VLVA 2OBIA 3MSZA 1A23A 2H75A 4OFMA 4XS4A 1Q98A 2F51A 2NBSA 3UJ1A 2OJLA 1TI3A 3LSZA 1EOHA 2DSAA 5IMCA 1THXA 3HY2A 3APQA 1PMTA 1B9YC 2L6CA 2GSRA 7GSSA 3QOUA 1EEMA 4HQZA 4J57E 3FRCA 4TR1B 3KIJA 2PMTA 3KP8A 1M99A 1QUWA 2V6KA 1ZMAA 4TRXA 1WMJA 3I43A 2Z9SA 5D8IA 4GSTA 4EKZA 1TJDA 2F8FA 3F4SA 2X99A 4X1UA 4BL7A 2YZUA 2FA8A 3BCIA 1R26A 2YANA 1FVKA 3L4NA 2RUFA 3TKSC 1O73A 3GMFA 4FYCA 1AUCA 1K0MA 2LRTA 5HR1A 5F8BA 3HZ4A 2CX3A 1A8YA 2YJ7A 1M7TA 4K7NA 4MJCA 1W89A 3GA4A 4I5QA 4MPFA 2FA4A 2IMKA 4ZBDA 1AQWA 4ZB6A 5JWQB 2H6XA 2AV4A 3FYGA 2H0IA 2IFQA 3WT2A 4WR5A 3TDGA 1BJXA 2LEGA 1CQGA 1K0NA 3LYPA 1N2AA 3EE2A 1EV9A 2IPAA 1TK8B 2X8GA 3ERFA 3ISOA 1GSSA 6GSVA 2CX4A 1RK4A 3W8JA 3ZITA 4KCEA 2BJXA 4EUYA 3F6DA 1EP8A 4PQIA 2ON7A 3J7Yb 2L59A 4JU5A 1T4YA 1YF0A 2L5LA 3MDKA 2DIZA 1Y6EA 5DDLA 2FNOA 4BA7A 3GKXA 2H1AA 1AC1A 3Q19A 2LJAA 1KTEA 1ZOFA 2GTUA 2LJRA 3HYPA 4EXJA 5IPHA 1WE0A 1IYIA 4F82A 3VI5A 5AISA 2ZUPA 3F63A 2A2RA 3GX0A 2C1YA 1KEBA 1GLPA 3KCMA 2V32A 1PD21 4LLRA 4BVXA 5L71A 4PGTA 4HJ2A 4PURA 1SJZA 3LYKA 1GSYA 4YQMA 5ECKB 1Z7PA 2MMOA 2C8UA 4KUNA 3GYKA 5DCGA 1GTAA 3KGKA 4OCEA 5D9TA 5AN1A 4HZ2A 1XWAA 2L4QA 1K0CA 1TRWA 3F3QA 3KMNA 3WGXA 4PXOA 3QFAC 3D4TA 18GSA 2I3YA 5H5SA 4MP4A 4NAXA 1XCCA 2I1UA 4KGIA 1DUGA 2XPDA 2K8SA 2JZTA 4EDYA 1YEXA 3F4RA 3PR8A 3IBHA 2VL2A 3DXBA 1B4PA 1NM3A 1Z5YE 5AIXA 1UA5A 1V98A 1TKDB 4XS6A 2MBTA 2OACA 1Q4JA 5CRHA 5ABRA 4JR4A 2PERA 1XFLA 2IMFA 3ZVJD 2H1DA 1O8XA 1OKDA 3IAM2 5B6NA 2V41A 4TR4A 4KH7A 2YWNA 4DEJA 2KP2A 4WF5A 12GSA 3HJOA 5ELGA 5EVOA 3ZREA 2YOIA 2PGTA 3VWXA 1TXXA 6GSXA 1FB0A 1G7OA 5ECSA 3KH9A 3TOTA 3TJGA 4RI6A 4XTSA 1I9DA 2H71A 4F2IA 4O32A 5F07A 3TUEA 4IP6A 2H72A 4G19A 3TRPA 3GFKA 3HJPA 3KJYA 3TOUA 3F8UA 5KN3A 2H73A 4MZBA 3FK8A 5IMDA 4MPGA 2HSYA 5CP1A 2IWTA 2K6VA 3ERGA 6GSUA 4IQ1A 4WR4A 4O5RA 2HE3A 2GQMA 1U87A 4KB3A 3KH7A 1MD3A 5G5EA 4HZ4A 2GSSA 2DJ3A 2F3MA 2H8LA 2YV9A 4ZBBA 2DJ0A 2H6YA 1THOA 3GH9A 3UVHA 3TKQA 2IIYA 2A2SA 2AAWA 2FLSA 3FR6A 2LSTA 5ECLB 1SK0A 2HYXA 1SK1A 1TK5B 4EL1A 1M2DA 1PL1A 1URMA 2ZCTA 4KDUA 2H6ZA 3QMXA 3ZMKA 2LRCA 1O81A 1AQVA 3D21A 5J5NA 5B8BA 2GS3A 4ZL8A 2WRTA 3AY8A 5IQYA 1M9AA 5G2ZA 1G6YA 4IELA 2P5QA 3VLNA 3TKRA 5E4WA 1WWJA 4IP1A 13GSA 2N5BA 3A2XA 5JCUA 1JZOA 1G0TA 3GL3A 1TRVA 1ZL9A 2PPTA 3IK7A 4LL1B 2YWOA 1ZGNA 2FWFA 2DJKA 1BG5A 1XBSA 1VF2A 2IMIA 3C1RA 4KE3A 1XZOA 4WF4A 3W6GA 2LNTA 4PUFC 2VIMA 1TRUA 5IOXA 1PL2A 2OA7A 3DYRA 3HCZA
chains in the Genus database with same CATH superfamily
2RUEA 1OE7A 1XW5A 4L5OA 1M3JA 4Z2TA 4NHZA 2I81A 2RM5A 3G9BA 1XWCA 1WRYA 2MMAA 2C0GA 2LQOA 3GSTA 1B48A 3GTUB 4HQSA 4EC0A 5IO2A 3K8NA 1K0AA 2H66A 3I69A 3QFBC 3L9UA 1BEDA 2VD1A 4OMVA 2GSTA 1VF3A 3L9SA 1O8WA 1ERVA 2YZHA 3GRXA 1XWBA 2VD0A 4ICYA 5FWGA 4D73A 1ZYQB 1ERWA 5IMVA 2F8AA 3DRNA 4J2FA 1C72A 1BYEA 1X9WB 5F0GA 16GSA 2C4JA 2GT5A 1B9XC 2L6DA 1T7PB 1QGVA 1VF1A 3L9VA 5IPGA 3QCPA 3LGCA 5CYYA 2HI7A 2HXKA 2BMXA 3F9UA 4HU9A 3LWAA 2FY6A 1WIKA 4MJEA 5ECMB 2VCXA 4ZL7A 2OE3A 3FW2A 4L8EA 2WGRA 5A4VA 3EMPA 3LXZA 11GSA 5KOXA 2M72A 20GSA 3NIVA 1JLVA 4ML1A 4NWYA 3TJBA 4MNNA 1SL2B 1F3BA 1ERUA 5ECQB 5J4UA 2LV3A 4MZWA 3IR4A 3UOMA 1O7UA 3KTBA 4XS1A 4XHMA 10GSA 5J9BA 2LQQA 1TRSA 2O89A 3HVVA 5DQSA 2P5RA 1FW1A 1ZZYA 5ENUA 1F9MA 3F3RA 3PGTA 3JCML 2GLRA 3UBLA 2YWIA 3ZIVA 1M0UA 3U5RE 1HD2A 3GKKA 1V58A 1U88A 1ABAA 1N8JA 1K3LA 4EDZA 4HUAA 2RM6A 1Z6MA 1TP9A 3FY7A 1Z9HA 5DBQA 4MMMA 1KBNA 5ECOB 1RW1A 1F6MC 2IL3A 2B7KA 2VCQA 3EU3A 2WDUA 2A4HA 2VCVA 4K1FA 3NZNA 2VM2A 3EYTA 1B4QA 2B7JA 5FHIA 3W8SA 1K3OA 1OC9B 2HRKA 4IJ3A 2AHEA 4Q5NA 1DBYA 4ML6A 1XVWA 3N5OA 5GAPD 4TR1A 2VLTA 4HS1A 2J23A 5D9WA 5B6MA 2O7KA 3ZIJA 3M1GA 3VI7A 1Z6NA 3UAPA 3P8WA 1Y25A 1ILOA 4TKYA 5H5RA 2AJQB 3I6AA 4K7IA 4OWYA 1EGRA 1J0FA 2H0HA 2HZEB 1FB6A 2V2GA 1T4ZA 2CZ3A 2NDOA 1EEJA 2DIYA 2GVPA 1SD9A 5ECPB 5ID2B 4ISDA 1YJ6A 3M9KA 1PQNA 1VGLA 1AAZA 2I9HA 5ECRB 5D93A 2HLSA 1T00A 5D73A 5D9VA 4N10A 2R37A 1S3DA 3J7Yk 1R7HA 1ST9A 3KEBA 1JZWA 3ZZXA 3EWLA 1YY7A 4KSMA 1WPIA 1XG8A 2HZEA 1XIYA 2H0GA 5AIVA 3A5WA 4JE1A 5ID2A 3ZL5A 1R5AA 4GF0A 3MWHA 2OKAA 4IW9A 1A0FA 5DCHA 4ZL9A 5HR3A 3VPQA 4AF2A 5H5QA 1ZYPA 3ZYWA 4IJIA 1XVQA 2FGXA 4MA9A 3F6FA 5J3RA 2JU5A 2KLXA 5HQPA 2NVLA 4Q5QA 2YNXA 4OFNA 1VRSD 1YEPA 3V1WA 3D6IA 1YDKA 2FD3A 1GSUA 2O87A 1DSBA 3FZ5A 3C73A 1M2AA 1OAZA 2QSIA 4GLTA 3P2AA 5E59A 4G9HA 4GXZA 5J9CA 1XWGA 1MD4A 3CQFA 2IMDA 2E7PA 3C71A 3DWVA 1SU9A 5CRWA 3VURA 3GUSA 4KDYA 4PX1A 2GT6A 4MDCA 2ALBA 4TW5A 19GSA 3RBTA 2WZ9A 2LS5A 4KSOA 2E0QA 4IHUA 5CREA 4DSSB 4F03A 2HRFA 4L0WA 1GSEA 1LBKA 1I5GA 2CVBA 5A4UA 2VAFA 4KNDA 3GSSA 2LUSA 4IBPA 2C3QA 3ME7A 4NV2A 3GKMA 1AXDA 1FVJA 1X0RA 4TOPA 1GSDA 1GUMA 3HHVA 4PUAA 4PNGA 2MMNA 1MEKA 1SKRB 4USSA 3BCKA 4E8EA 4NPBA 1SL1B 2N5FA 2REMA 3LQ7A 3KXOA 4DSSA 4FYUA 4O7HA 4K0GA 5DALB 4RQRA 3GHAA 3A5IA 1T3BA 1JZDA 4HU7A 3S9FA 3GKNA 3IOSA 3UIWA 2R0PA 4EE0A 1HNAA 1WJKA 2TRCP 3BJ5A 1HYUA 4O92A 1F2EA 1M2BA 3ME8A 1SYRA 2B6MA 3RPNA 3SBCA 4N0ZA 2C80A 3LG6A 4Q5FA 3LJRA 2YPMA 1FG4A 2AUVA 9GSSA 1ZYNA 2OE0A 2V1MA 3EVIA 2B5XA 4EVMA 1DE1A 1BX9A 3VK9A 1FO5A 1H4OA 4POKA 4DSQA 1H75A 5G1KA 3TJJA 22GSA 4HSCX 4EIQA 4F9ZA 2JZRA 4IQAA 2FWGA 2EIQA 1YZXA 4BWQA 3C8EA 2CT6A 4F0CA 3CSJA 3IA1A 5G31A 4X43A 3CTFA 4Q5RA 4GSNA 2VCWA 4I97A 4ZB8A 1UC7A 4KX4A 3CBUA 1SJ6A 4MH2A 5D9XA 4KW6A 2AB6A 3E3EA 3H79A 4PNFA 3M8NA 2L57A 4MF5A 3RHBA 4BVYA 1VF4A 5KN0A 3TJKA 2VUPA 2IN3A 3ZVJA 2D2ZA 3HDCA 2KHPA 4GTUA 1T8EB 1PX7A 5CO3A 6GSWA 1UVZA 4HI7A 6GSTA 3DVWA 2GZZA 1SKSB 2DJJA 3TKSA 3L0HA 14GSA 2KUCA 2O85A 2XBQA 2CA8A 2L4CA 1GTBA 1WOUA 2ZNMA 1U6TA 3HD5A 1OVNA 5JWRB 1TK0B 4MF7A 1PX6A 2PVQA 4RI7A 3EU4A 2OADA 1OE8A 4FIWA 5G30A 3OR5A 3BD2A 4ECJA 1GWCA 4MLYA 3UARA 3N9JA 5C04A 3Q74A 1K0DA 4HOJA 2K8VA 5DAKB 2VL3A 5IMZA 4DSRA 2FWHA 3FEUA 1FHEA 1Z3EA 3A2VA 1OYJA 4I8BA 1QFNA 1HNCA 4KDXA 1O6JA 4BWSA 3M0FA 4I2TA 2H1BA 2RLIA 3E9JB 1U3AA 2MBSA 1XW6A 5J41A 4MZCA 2M80A 4KCAA 1S3AA 3KP9A 3FR9A 1YKAA 2DKHA 5EL8A 1SKWB 4OFTA 3DMLA 1PKZA 2YN1A 4YQUA 1SJIA 3FMWA 3RPPA 2VCTA 2XHFA 1OC8A 3O3TA 4WETA 2JZSA 2DMLA 2A4VA 3ZMLA 1PSQA 4AJ8A 2JACA 3A3TA 2HNLA 2WJUA 3D5JA 6GSSA 1EP7A 3IE3A 2PU9C 4LA1A 3G7IA 3TKSE 4F0BA 1A2MA 2HZFA 3SWLA 2VL2C 4OO4A 1R5PA 3LEFA 4V2LA 3UMAA 2J9HA 3GTUA 3GL5A 4Z7XA 2C0EA 3IRAA 2B1LA 1X9MB 1XWKA 5GZZB 3C1SA 3MNGA 3KD0A 4A5PA 1AIUA 1U3IA 3IHGA 2GZPA 4MJBA 5CRGA 3HVSA 5HR0A 5HFGA 2C3TA 2PN8A 1BQ7A 1S3CA 3UBKA 5A5KA 3VPTA 5INYA 5BMUA 4JR6A 4K2DA 2EIRA 4XS4B 1XOAA 3IAS2 1NW2A 3P90A 4ZBAA 1NHOA 2MYGA 4KF9A 4RUVA 1PRXA 5IO0A 4ECCA 2X64A 5KN2A 3F0IA 4K5SA 4FO5A 1CQHA 2G0FA 4E8HA 1G7EA 3ZFLA 2WULA 3WGEA 5A4WA 4MH3A 2C0DA 2EC4A 1GL8A 3KTLA 5EY6A 5C00A 3BOAA 3DIEA 4O5QA 4QQ7A 1GRXA 4TVEA 4PQ1A 3VWWA 2FHEA 3ZLPA 2GSQA 1XW9A 2R3XA 2YV7A 1GTIA 2FWEA 3EINA 1PFOA 4KA0A 5ECIB 3H93A 4BL7B 4EO3A 3GV1A 5IM9A 3NOFA 2LJKA 2C3NA 1EWXA 5LCZA 3P7XA 4ZB9A 3BBYA 4XIHA 3CRTA 4P3YB 1MDIA 4RQXA 1RQMA 5CNWA 1TTZA 2R2JA 2K9FA 3EC3A 5DJMA 3DGQA 4POMA 3CSIA 3A2WA 2QC7A 3VWVA 4IN0A 3G7JA 3UVTA 4MK3A 2ES7A 4G0KA 2DMMA 3PH9A 5G1LA 3D0ZA 1S3RA 1TW9A 4NMUA 3D4MA 2G2QA 3QD9A 3ZTLA 3CSHA 2IFQB 4HJMA 4V1Ag 2H76A 3TJFA 1YF1A 3HXSA 1ACVA 1NSWA 1UN2A 3IC4A 5FT3A 4YAVA 1TDIA 3Q18A 2OBKA 1OC9A 2TIRA 2AYTA 2LRNA 4NXIA 4OD7A 3KM6A 5ECHB 2VOCA 1XPVA 3FZAA 1K0OA 2KP1A 3CTGA 5EPFA 3RDWA 4GQCA 1ZCPA 4WBJA 2PUKC 1YKCA 3KZQA 1MDJA 1M9BA 2M46A 2CV4A 4GQFA 1GP1A 4MJAA 1ZYEA 2EIOA 1AQXA 1PN0A 2E2GA 3F4TA 5GSSA 1R4WA 5F06A 1FAAA 3ED3A 3QAVA 1QMVA 3RHCA 5ELAA 2H74A 8GSSA 3PPUA 4GCIA 1HQOA 2K18A 4X0XA 3GURA 3ZRDA 4PQHA 2YWMA 2QKEA 4HEA2 4XRDA 4OO5A 1EOGA 3G7YA 4ECBA 1GULA 2WS2A 2F9SA 2DJ1A 3TGZA 2H30A 1F37A 1V9WA 4IVFA 3UL3A 5LD0A 4K2XA 2N5AA 4IS0A 17GSA 3LFLA 1PN9A 1GNWA 1GH2A 2CAIA 1X5DA 3LXTA 3QDNA 3R2QA 4LMWA 2LKUA 5LNKe 1HNBA 3WT1A 4TXOB 4BIKA 4TR0A 1GSFA 2GQLA 5B8AA 1FOVA 4ACSA 1DE2A 4JBBA 2P31A 2B5YA 3GIXA 1OC3A 1K3YA 3H1NA 2C0FA 4V2NA 5ECNB 1GTUA 4ZIJA 3DD3A 1GNEA 4X4JA 1EZKA 4N30A 4YQVA 2LTKA 3IPZA 4AGSA 4AJ6A 1MTCA 1SL0B 1SK2A 3FR3A 1MDKA 2GGTA 3QPMA 1GUKA 4L0UA 5B7CA 3MAKA 4TXOA 3DVXA 3FZ9A 4POLA 2X8HA 3IV4A 3WGDA 1JZRA 1NHYA 4GSSA 1LU4A 1T1VA 5GSTA 2JSZA 4HDEA 5DVBA 1EV4A 2YCDA 3IHQA 1KNGA 3IDVA 1V2AA 4Z2UA 3IC8A 4ZILA 5JCWA 1BAYA 2HRNA 4J56E 1G6WA 2NPBA 5CAXA 6GSYA 2H01A 3LORA 4POBA 4GWRA 2CQ9A 1A8LA 1TI1A 2R6KA 1LJRA 3GN3A 2R0GA 4FYBA 4FH8A 4YKGA 2R4VA 4JEDA 4AJ7A 1JFUA 3HA9A 3QR6A 2FUG2 5JWOB 3QAGA 3KMOA 2QA1A 4MCUA 2VO4A 3MIXA 2NTOA 2B3SA 4EF0A 2YJHA 2VLUA 1A2LA 5IIZA 3GX8A 2DJ2A 4IGJA 5HR2A 2B5EA 3TKPA 1X5EA 5IMFA 1J08A 2JADA 1QQ2A 3HZ8A 1USBA 1Z7RA 4ID0A 4K6XA 4WXTA 2H19A 1X5CA 5DALA 4N0VA 1A0RP 1ERTA 1GSQA 4K9ZA 1OKTA 1PA3A 2WCIA 5G5FA 3U6VA 4TN8A 3HVXA 2X8CA 3HKRA 2FCHA 3H8QA 2QGVA 2XBIA 1ON4A 2GZYA 1QK8A 2MMZA 4IKHA 2PBJA 1J9BA 2IJYA 3WD6A 3CMIA 1YQ1A 2O8VB 1X9SB 1EGOA 3TB2A 3APOA 3CXGA 3UEMA 1V57A 4NHWA 4K8MA 2WB9A 3H4KA 2E2MA 4H86A 3CRUA 1ML6A 3M9JA 5HFIA 1JHBA 2HRAA 4MF6A 2JL4A 2H1GA 3FZ4A 2VCZA 2GQKA 3MYDA 1O85A 5AGYA 3IK9A 4K0NA 4NV5A 2CVKA 2BTOT 3TRQA 3L78A 3QAWA 1A24A 4XCSA 4LMVA 4WEYA 1E6BA 4KAEA 3O76A 2GDRA 4YAPA 1PGTA 1SENA 3Q6OA 1M3IA 5D96A 2H70A 5COHA 5IMAA 3CYNA 1IYHA 4TR3A 3VWUA 4JZQA 2B1KA 4ECIA 3ERWA 2KOKA 5DJLA 4CHSA 2DC5A 2VL9A 1SD8A 4I6XA 4YH2A 4JRRA 2CZ2A 3E0UA 4ULXA 1AW9A 4V1Ap 3EMXA 2ON5A 2P0GA 3FHKA 1TU8A 1XXUA 4QL9A 3EURA 1K0BA 4XRAA 2MZCA 1A2JA 5HFKA 4CW9A 2L5OA 4OCFA 3VFIA 4I2UA 4WKWA 5DQYA 3TRXA 2YP6A 1XOBA 1B8XA 4D73B 3APSA 1W4VA 3GNJA 1QXHA 4DVCA 3DEXA 1TU7A 5CRDA 5DAKA 1WP0A 2PVOC 2I4AA 3FKFA 1PKWA 2OE1A 1SYXA 3I9V2 1GUHA 2CAQA 3TCOA 2WFCA 4LL4B 3D22A 5JCGA 5GAND 1E2YA 3O6TA 1GLQA 2HT9A 4ZXGA 3US3A 3HJMA 1JLWA 5KN1A 4TXVA 5IOWA 2CVDA 2RIIA 3C7MA 2VM1A 4BPYA 5F05A 2R0CA 3DKSA 2HSHA 4QL7A 4L5LA 3ZFBA 4G10A 1TOFA 4V2MA 2PWJA 2LNSA 2JSYA 2IMEA 5KEJA 2V6OA 2XPEA 2HFDA 3M3MA 4K7OA 4Z2RA 2DLXA 3RAZA 4ILFA 2TRXA 4MABA 4GRFA 2R5GA 3WYWA 4N11A 1F3AA 3IXRA 2DBCA 2XC2A 3GH6A 4CDOA 4WBRD 1V40A 3PINA 4G2EA 2VLVA 2OBIA 3MSZA 1A23A 2H75A 4OFMA 4XS4A 1Q98A 2F51A 2NBSA 3UJ1A 2OJLA 1TI3A 3LSZA 1EOHA 2DSAA 5IMCA 3HVNA 1THXA 3HY2A 3APQA 1PMTA 1B9YC 2L6CA 2X4AA 2GSRA 7GSSA 3QOUA 1EEMA 4G0LA 4HQZA 4J57E 3FRCA 4TR1B 3KIJA 2PMTA 3KP8A 1M99A 1QUWA 2V6KA 1ZMAA 4TRXA 1WMJA 3I43A 2Z9SA 5D8IA 4GSTA 4EKZA 1TJDA 2F8FA 3F4SA 2X99A 4X1UA 4BL7A 2YZUA 2FA8A 3BCIA 1R26A 2YANA 1FVKA 3L4NA 2RUFA 3TKSC 1O73A 3GMFA 4FYCA 1AUCA 5KOWA 2DKIA 1K0MA 2LRTA 5HR1A 5F8BA 3HZ4A 2CX3A 1A8YA 2YJ7A 1M7TA 4K7NA 4MJCA 1W89A 3GA4A 4I5QA 4MPFA 2FA4A 2IMKA 4ZBDA 2UZ8A 1AQWA 4ZB6A 5JWQB 2H6XA 2AV4A 3FYGA 2H0IA 2IFQA 3WT2A 4WR5A 3TDGA 1BJXA 2LEGA 1CQGA 1K0NA 3LYPA 1N2AA 3EE2A 1EV9A 4O5UA 2IPAA 1TK8B 2X8GA 3ERFA 3ISOA 1GSSA 6GSVA 2CX4A 1RK4A 3W8JA 3ZITA 4KCEA 2BJXA 4EUYA 3F6DA 1EP8A 4PQIA 2ON7A 3J7Yb 2L59A 4JU5A 1T4YA 1YF0A 2L5LA 3MDKA 2DIZA 1Y6EA 5DDLA 4BVXB 2FNOA 1FOHA 4BA7A 3GKXA 2H1AA 1AC1A 3Q19A 2LJAA 1KTEA 1ZOFA 2GTUA 2LJRA 3HYPA 4EXJA 5IPHA 1WE0A 1IYIA 4F82A 3VI5A 5AISA 2ZUPA 3EPTA 3F63A 2A2RA 3GX0A 2C1YA 1KEBA 1GLPA 3KCMA 2V32A 1PD21 4LLRA 4BVXA 5L71A 4PGTA 4HJ2A 4PURA 1SJZA 3LYKA 1GSYA 4YQMA 5ECKB 4FQUA 1Z7PA 2MMOA 5BRTA 2C8UA 4KUNA 3GYKA 4YKFA 5DCGA 1GTAA 3KGKA 4OCEA 5D9TA 5AN1A 4HZ2A 1XWAA 2L4QA 1K0CA 1TRWA 3F3QA 3KMNA 3WGXA 4PXOA 3QFAC 3D4TA 18GSA 2I3YA 5H5SA 4MP4A 4NAXA 1XCCA 2I1UA 4KGIA 1DUGA 2XPDA 2QA2A 2K8SA 2JZTA 4K5RA 2A2PA 4EDYA 1YEXA 3F4RA 3PR8A 3IBHA 2VL2A 2HSMA 3DXBA 1B4PA 1NM3A 1Z5YE 5AIXA 1UA5A 1V98A 1TKDB 4XS6A 2MBTA 2OACA 1Q4JA 5CRHA 5ABRA 4JR4A 2PERA 1XFLA 2IMFA 3ZVJD 2H1DA 1O8XA 1OKDA 3IAM2 5B6NA 2V41A 4TR4A 4KH7A 2YWNA 4DEJA 2KP2A 4WF5A 12GSA 3HJOA 5ELGA 5EVOA 3ZREA 2YOIA 2PGTA 4CY6A 3VWXA 4EIPA 1TXXA 6GSXA 4CY8A 1FB0A 1G7OA 5ECSA 3KH9A 3TOTA 3TJGA 4RI6A 4XTSA 4PTSA 1I9DA 2H71A 4F2IA 2X49A 4O32A 5F07A 3TUEA 4IP6A 2H72A 4G19A 3TRPA 3GFKA 3HJPA 3KJYA 3TOUA 3F8UA 5KN3A 2H73A 4MZBA 3FK8A 5IMDA 4MPGA 2HSYA 5CP1A 2IWTA 2K6VA 3ERGA 6GSUA 4IQ1A 4WR4A 4BVYB 4O5RA 2HE3A 2GQMA 1U87A 4KB3A 3KH7A 1MD3A 5G5EA 4HZ4A 2GSSA 2DJ3A 2F3MA 2H8LA 2YV9A 4ZBBA 2DJ0A 2H6YA 1THOA 3GH9A 3UVHA 3TKQA 2IIYA 2A2SA 2AAWA 2FLSA 3FR6A 2LSTA 5ECLB 1SK0A 2HYXA 1SK1A 1TK5B 3LW9A 4EL1A 1M2DA 1PL1A 1URMA 2ZCTA 4KDUA 2H6ZA 3QMXA 3ZMKA 4G0IA 2LRCA 1O81A 1AQVA 3D21A 5J5NA 5B8BA 2GS3A 4ZL8A 2WRTA 3AY8A 5IQYA 1M9AA 5G2ZA 1G6YA 3R3EA 4IELA 2P5QA 3VLNA 3TKRA 5E4WA 1WWJA 4IP1A 13GSA 2N5BA 3A2XA 5JCUA 1JZOA 1G0TA 3GL3A 1TRVA 1ZL9A 2PPTA 3IK7A 4LL1B 2YWOA 1ZGNA 2FWFA 2DJKA 1BG5A 1XBSA 1VF2A 2IMIA 3C1RA 4KE3A 1XZOA 4WF4A 3W6GA 2LNTA 4PUFC 2VIMA 1TRUA 5IOXA 1PL2A 2OA7A 3DYRA 3HCZA
chains in the Genus database with same CATH topology
2RUEA 1OE7A 1XW5A 4L5OA 4Z2TA 4NHZA 2I81A 2RM5A 3G9BA 1XWCA 1WRYA 2MMAA 2C0GA 2LQOA 3GSTA 1B48A 3GTUB 4HQSA 4EC0A 5IO2A 3K8NA 1K0AA 2H66A 3I69A 3QFBC 3L9UA 1BEDA 2VD1A 4OMVA 2GSTA 1VF3A 3L9SA 1O8WA 1ERVA 2YZHA 3GRXA 1XWBA 2VD0A 4ICYA 5FWGA 4D73A 1ZYQB 1ERWA 5IMVA 2F8AA 3DRNA 4J2FA 1C72A 1BYEA 1X9WB 5F0GA 16GSA 2C4JA 2GT5A 1B9XC 2L6DA 1T7PB 1QGVA 1VF1A 3L9VA 5IPGA 3QCPA 3LGCA 5CYYA 2HI7A 2HXKA 2BMXA 3F9UA 4HU9A 3LWAA 2FY6A 1WIKA 4MJEA 5ECMB 2VCXA 4ZL7A 2OE3A 3FW2A 4L8EA 2WGRA 5A4VA 3EMPA 3LXZA 11GSA 5KOXA 2M72A 20GSA 3NIVA 1JLVA 4ML1A 4NWYA 3TJBA 4MNNA 1SL2B 1F3BA 1ERUA 5ECQB 5J4UA 2LV3A 4MZWA 3IR4A 3UOMA 1O7UA 3KTBA 4XS1A 4XHMA 10GSA 5J9BA 2LQQA 1TRSA 2O89A 3HVVA 5DQSA 2P5RA 1FW1A 1ZZYA 5ENUA 1F9MA 3F3RA 3PGTA 3JCML 2GLRA 3UBLA 2YWIA 3ZIVA 1M0UA 3U5RE 1HD2A 3GKKA 1V58A 1U88A 1ABAA 1N8JA 1K3LA 4EDZA 4HUAA 2RM6A 1Z6MA 1TP9A 3FY7A 1Z9HA 5DBQA 4MMMA 1KBNA 5ECOB 1RW1A 1F6MC 2IL3A 2B7KA 2VCQA 3EU3A 2WDUA 2A4HA 2VCVA 4K1FA 3NZNA 2VM2A 3EYTA 1B4QA 2B7JA 5FHIA 3W8SA 1K3OA 1OC9B 2HRKA 4IJ3A 2AHEA 4Q5NA 1DBYA 4ML6A 1XVWA 3N5OA 5GAPD 4TR1A 2VLTA 4HS1A 2J23A 5D9WA 5B6MA 2O7KA 3ZIJA 3M1GA 3VI7A 1Z6NA 3UAPA 3P8WA 1Y25A 1ILOA 4TKYA 5H5RA 2AJQB 3I6AA 4K7IA 4OWYA 1EGRA 1J0FA 2H0HA 2HZEB 1FB6A 2V2GA 1T4ZA 2CZ3A 2NDOA 1EEJA 2DIYA 2GVPA 1SD9A 5ECPB 5ID2B 4ISDA 1YJ6A 3M9KA 1PQNA 1VGLA 1AAZA 2I9HA 5ECRB 5D93A 2HLSA 1T00A 5D73A 5D9VA 4N10A 2R37A 1S3DA 3J7Yk 1R7HA 1ST9A 3KEBA 1JZWA 3ZZXA 3EWLA 1YY7A 4KSMA 1WPIA 2HZEA 1XIYA 2H0GA 5AIVA 3A5WA 4JE1A 5ID2A 3ZL5A 1R5AA 4GF0A 3MWHA 2OKAA 4IW9A 1A0FA 5DCHA 4ZL9A 5HR3A 3VPQA 4AF2A 5H5QA 1ZYPA 3ZYWA 4IJIA 1XVQA 2FGXA 4MA9A 3F6FA 5J3RA 2JU5A 2KLXA 5HQPA 2NVLA 4Q5QA 2YNXA 4OFNA 1VRSD 1YEPA 3V1WA 3D6IA 1YDKA 2FD3A 1GSUA 2O87A 1DSBA 3FZ5A 3C73A 1M2AA 1OAZA 2QSIA 4GLTA 3P2AA 5E59A 4G9HA 4GXZA 5J9CA 1XWGA 1MD4A 2IMDA 2E7PA 3C71A 3DWVA 1SU9A 5CRWA 3VURA 3GUSA 4KDYA 4PX1A 2GT6A 4MDCA 2ALBA 4TW5A 19GSA 3RBTA 2WZ9A 2LS5A 4KSOA 2E0QA 4IHUA 5CREA 4DSSB 4F03A 2HRFA 4L0WA 1GSEA 1LBKA 1I5GA 2CVBA 5A4UA 2VAFA 4KNDA 3GSSA 2LUSA 4IBPA 2C3QA 3ME7A 4NV2A 3GKMA 1AXDA 1FVJA 1X0RA 4TOPA 1GSDA 1GUMA 3HHVA 4PUAA 4PNGA 2MMNA 1MEKA 1SKRB 4USSA 3BCKA 4E8EA 4NPBA 1SL1B 2N5FA 2REMA 3LQ7A 3KXOA 4DSSA 4FYUA 4O7HA 4K0GA 5DALB 4RQRA 3GHAA 3A5IA 1T3BA 1JZDA 4HU7A 3S9FA 3GKNA 3IOSA 3UIWA 2R0PA 4EE0A 1HNAA 1WJKA 2TRCP 3BJ5A 1HYUA 4O92A 1F2EA 1M2BA 3ME8A 1SYRA 2B6MA 3RPNA 3SBCA 4N0ZA 2C80A 3LG6A 4Q5FA 3LJRA 2YPMA 1FG4A 2AUVA 9GSSA 1ZYNA 2OE0A 2V1MA 3EVIA 2B5XA 4EVMA 1DE1A 1BX9A 3VK9A 1FO5A 1H4OA 4POKA 4DSQA 1H75A 5G1KA 3TJJA 22GSA 4EIQA 4F9ZA 2JZRA 4IQAA 2FWGA 2EIQA 1YZXA 4BWQA 3C8EA 2CT6A 4F0CA 3CSJA 3IA1A 5G31A 4X43A 3CTFA 4Q5RA 4GSNA 2VCWA 4I97A 4ZB8A 1UC7A 4KX4A 3CBUA 1SJ6A 4MH2A 5D9XA 4KW6A 2AB6A 3E3EA 3H79A 4PNFA 3M8NA 2L57A 4MF5A 3RHBA 4BVYA 1VF4A 5KN0A 3TJKA 2VUPA 2IN3A 3ZVJA 2D2ZA 3HDCA 2KHPA 4GTUA 1T8EB 1PX7A 5CO3A 6GSWA 1UVZA 4HI7A 6GSTA 3DVWA 2GZZA 1SKSB 2DJJA 3TKSA 3L0HA 14GSA 2KUCA 2O85A 2XBQA 2CA8A 2L4CA 1GTBA 1WOUA 2ZNMA 1U6TA 3HD5A 1OVNA 5JWRB 1TK0B 4MF7A 1PX6A 2PVQA 4RI7A 3EU4A 2OADA 1OE8A 4FIWA 5G30A 3OR5A 3BD2A 4ECJA 1GWCA 4MLYA 3UARA 3N9JA 5C04A 3Q74A 1K0DA 4HOJA 2K8VA 5DAKB 2VL3A 5IMZA 4DSRA 2FWHA 3FEUA 1FHEA 1Z3EA 3A2VA 1OYJA 4I8BA 1QFNA 1HNCA 4KDXA 1O6JA 4BWSA 3M0FA 4I2TA 2H1BA 2RLIA 3E9JB 1U3AA 2MBSA 1XW6A 5J41A 4MZCA 2M80A 4KCAA 1S3AA 3KP9A 3FR9A 1YKAA 2DKHA 5EL8A 1SKWB 4OFTA 3DMLA 1PKZA 2YN1A 4YQUA 1SJIA 3FMWA 3RPPA 2VCTA 2XHFA 1OC8A 3O3TA 4WETA 2JZSA 2DMLA 2A4VA 3ZMLA 1PSQA 4AJ8A 2JACA 3A3TA 2HNLA 2WJUA 3D5JA 6GSSA 1EP7A 3IE3A 2PU9C 4LA1A 3G7IA 3TKSE 4F0BA 1A2MA 2HZFA 3SWLA 2VL2C 4OO4A 1R5PA 3LEFA 4V2LA 3UMAA 2J9HA 3GTUA 3GL5A 4Z7XA 2C0EA 3IRAA 2B1LA 1X9MB 1XWKA 5GZZB 3C1SA 3MNGA 3KD0A 4A5PA 1AIUA 1U3IA 3IHGA 2GZPA 4MJBA 5CRGA 3HVSA 5HR0A 5HFGA 2C3TA 2PN8A 1BQ7A 1S3CA 3UBKA 5A5KA 3VPTA 5INYA 5BMUA 4JR6A 4K2DA 2EIRA 4XS4B 1XOAA 3IAS2 1NW2A 3P90A 4ZBAA 1NHOA 2MYGA 4KF9A 4RUVA 1PRXA 5IO0A 4ECCA 2X64A 5KN2A 3F0IA 4K5SA 4FO5A 1CQHA 2G0FA 4E8HA 1G7EA 3ZFLA 2WULA 3WGEA 5A4WA 4MH3A 2C0DA 2EC4A 1GL8A 3KTLA 5EY6A 5C00A 3BOAA 3DIEA 4O5QA 4QQ7A 1GRXA 4TVEA 4PQ1A 3VWWA 2FHEA 3ZLPA 2GSQA 1XW9A 2R3XA 2YV7A 1GTIA 2FWEA 3EINA 4KA0A 5ECIB 3H93A 4BL7B 4EO3A 3GV1A 5IM9A 3NOFA 2LJKA 2C3NA 1EWXA 5LCZA 3P7XA 4ZB9A 3BBYA 4XIHA 3CRTA 4P3YB 1MDIA 4RQXA 1RQMA 5CNWA 1TTZA 2R2JA 2K9FA 3EC3A 5DJMA 3DGQA 4POMA 3CSIA 3A2WA 2QC7A 3VWVA 4IN0A 3G7JA 3UVTA 4MK3A 2ES7A 4G0KA 2DMMA 3PH9A 5G1LA 3D0ZA 1TW9A 4NMUA 3D4MA 2G2QA 3QD9A 3ZTLA 3CSHA 2IFQB 4HJMA 4V1Ag 2H76A 3TJFA 1YF1A 3HXSA 1ACVA 1NSWA 1UN2A 3IC4A 5FT3A 4YAVA 1TDIA 3Q18A 2OBKA 1OC9A 2TIRA 2AYTA 2LRNA 4NXIA 4OD7A 3KM6A 5ECHB 2VOCA 1XPVA 3FZAA 1K0OA 2KP1A 3CTGA 5EPFA 3RDWA 4GQCA 1ZCPA 4WBJA 2PUKC 1YKCA 3KZQA 1MDJA 1M9BA 2M46A 2CV4A 4GQFA 1GP1A 4MJAA 1ZYEA 2EIOA 1AQXA 1PN0A 2E2GA 3F4TA 5GSSA 1R4WA 5F06A 1FAAA 3ED3A 3QAVA 1QMVA 3RHCA 5ELAA 2H74A 8GSSA 3PPUA 4GCIA 1HQOA 2K18A 4X0XA 3GURA 3ZRDA 4PQHA 2YWMA 2QKEA 4HEA2 4XRDA 4OO5A 1EOGA 3G7YA 4ECBA 1GULA 2WS2A 2F9SA 2DJ1A 3TGZA 2H30A 1F37A 1V9WA 4IVFA 3UL3A 5LD0A 4K2XA 2N5AA 4IS0A 17GSA 3LFLA 1PN9A 1GNWA 1GH2A 2CAIA 1X5DA 3LXTA 3QDNA 3R2QA 4LMWA 2LKUA 5LNKe 1HNBA 3WT1A 4TXOB 4TR0A 1GSFA 2GQLA 5B8AA 1FOVA 4ACSA 1DE2A 4JBBA 2P31A 2B5YA 3GIXA 1OC3A 1K3YA 3H1NA 2C0FA 4V2NA 5ECNB 1GTUA 4ZIJA 3DD3A 1GNEA 4X4JA 1EZKA 4N30A 4YQVA 2LTKA 3IPZA 4AGSA 4AJ6A 1MTCA 1SL0B 1SK2A 3FR3A 1MDKA 2GGTA 3QPMA 1GUKA 4L0UA 5B7CA 3MAKA 4TXOA 3DVXA 3FZ9A 4POLA 2X8HA 3IV4A 3WGDA 1JZRA 1NHYA 4GSSA 1LU4A 1T1VA 5GSTA 2JSZA 4HDEA 5DVBA 1EV4A 2YCDA 3IHQA 1KNGA 3IDVA 1V2AA 4Z2UA 3IC8A 4ZILA 5JCWA 1BAYA 2HRNA 4J56E 1G6WA 2NPBA 5CAXA 6GSYA 2H01A 3LORA 4POBA 4GWRA 2CQ9A 1A8LA 1TI1A 2R6KA 1LJRA 3GN3A 2R0GA 4FYBA 4FH8A 4YKGA 2R4VA 4JEDA 4AJ7A 1JFUA 3HA9A 3QR6A 2FUG2 5JWOB 3QAGA 3KMOA 2QA1A 4MCUA 2VO4A 3MIXA 2NTOA 2B3SA 4EF0A 2YJHA 2VLUA 1A2LA 5IIZA 3GX8A 2DJ2A 4IGJA 5HR2A 2B5EA 3TKPA 1X5EA 5IMFA 1J08A 2JADA 1QQ2A 3HZ8A 1USBA 1Z7RA 4ID0A 4K6XA 4WXTA 2H19A 1X5CA 5DALA 4N0VA 1A0RP 1ERTA 1GSQA 4K9ZA 1OKTA 1PA3A 2WCIA 5G5FA 3U6VA 4TN8A 3HVXA 2X8CA 3HKRA 2FCHA 3H8QA 2QGVA 2XBIA 1ON4A 2GZYA 1QK8A 2MMZA 4IKHA 2PBJA 1J9BA 2IJYA 3WD6A 3CMIA 1YQ1A 2O8VB 1X9SB 1EGOA 3TB2A 3APOA 3CXGA 3UEMA 1V57A 4NHWA 4K8MA 2WB9A 3H4KA 2E2MA 4H86A 3CRUA 1ML6A 3M9JA 5HFIA 1JHBA 2HRAA 4MF6A 2JL4A 2H1GA 3FZ4A 2VCZA 2GQKA 3MYDA 1O85A 5AGYA 3IK9A 4K0NA 4NV5A 2CVKA 2BTOT 3TRQA 3L78A 3QAWA 1A24A 4XCSA 4LMVA 4WEYA 1E6BA 4KAEA 3O76A 2GDRA 4YAPA 1PGTA 1SENA 3Q6OA 5D96A 2H70A 5COHA 5IMAA 3CYNA 1IYHA 4TR3A 3VWUA 4JZQA 2B1KA 4ECIA 3ERWA 2KOKA 5DJLA 4CHSA 2DC5A 2VL9A 1SD8A 4I6XA 4YH2A 4JRRA 2CZ2A 3E0UA 4ULXA 1AW9A 4V1Ap 3EMXA 2ON5A 2P0GA 3FHKA 1TU8A 1XXUA 4QL9A 3EURA 1K0BA 4XRAA 2MZCA 1A2JA 5HFKA 4CW9A 2L5OA 4OCFA 3VFIA 4I2UA 4WKWA 5DQYA 3TRXA 2YP6A 1XOBA 1B8XA 4D73B 3APSA 1W4VA 3GNJA 1QXHA 4DVCA 3DEXA 1TU7A 5CRDA 5DAKA 1WP0A 2PVOC 2I4AA 3FKFA 1PKWA 2OE1A 1SYXA 3I9V2 1GUHA 2CAQA 3TCOA 2WFCA 4LL4B 3D22A 5JCGA 5GAND 1E2YA 3O6TA 1GLQA 2HT9A 4ZXGA 3US3A 3HJMA 1JLWA 5KN1A 4TXVA 5IOWA 2CVDA 2RIIA 3C7MA 2VM1A 4BPYA 5F05A 2R0CA 3DKSA 2HSHA 4QL7A 4L5LA 3ZFBA 4G10A 1TOFA 4V2MA 2PWJA 2LNSA 2JSYA 2IMEA 5KEJA 2V6OA 2XPEA 2HFDA 3M3MA 4K7OA 4Z2RA 2DLXA 3RAZA 4ILFA 2TRXA 4MABA 4GRFA 2R5GA 3WYWA 4N11A 1F3AA 3IXRA 2DBCA 2XC2A 3GH6A 4CDOA 4WBRD 1V40A 3PINA 4G2EA 2VLVA 2OBIA 3MSZA 1A23A 2H75A 4OFMA 4XS4A 1Q98A 2F51A 2NBSA 3UJ1A 2OJLA 1TI3A 3LSZA 1EOHA 2DSAA 5IMCA 1THXA 3HY2A 3APQA 1PMTA 1B9YC 2L6CA 2X4AA 2GSRA 7GSSA 3QOUA 1EEMA 4G0LA 4HQZA 4J57E 3FRCA 4TR1B 3KIJA 2PMTA 3KP8A 1M99A 1QUWA 2V6KA 1ZMAA 4TRXA 1WMJA 3I43A 2Z9SA 5D8IA 4GSTA 4EKZA 1TJDA 2F8FA 3F4SA 2X99A 4X1UA 4BL7A 2YZUA 2FA8A 3BCIA 1R26A 2YANA 1FVKA 3L4NA 2RUFA 3TKSC 1O73A 3GMFA 4FYCA 1AUCA 5KOWA 2DKIA 1K0MA 2LRTA 5HR1A 5F8BA 3HZ4A 2CX3A 1A8YA 2YJ7A 1M7TA 4K7NA 4MJCA 1W89A 3GA4A 4I5QA 4MPFA 2FA4A 2IMKA 4ZBDA 2UZ8A 1AQWA 4ZB6A 5JWQB 2H6XA 2AV4A 3FYGA 2H0IA 2IFQA 3WT2A 4WR5A 3TDGA 1BJXA 2LEGA 1CQGA 1K0NA 3LYPA 1N2AA 3EE2A 1EV9A 4O5UA 2IPAA 1TK8B 2X8GA 3ERFA 3ISOA 1GSSA 6GSVA 2CX4A 1RK4A 3W8JA 3ZITA 4KCEA 2BJXA 4EUYA 3F6DA 1EP8A 4PQIA 2ON7A 3J7Yb 2L59A 4JU5A 1T4YA 1YF0A 2L5LA 3MDKA 2DIZA 1Y6EA 5DDLA 4BVXB 2FNOA 1FOHA 4BA7A 3GKXA 2H1AA 1AC1A 3Q19A 2LJAA 1KTEA 1ZOFA 2GTUA 2LJRA 3HYPA 4EXJA 5IPHA 1WE0A 1IYIA 4F82A 3VI5A 5AISA 2ZUPA 3EPTA 3F63A 2A2RA 3GX0A 2C1YA 1KEBA 1GLPA 3KCMA 2V32A 1PD21 4LLRA 4BVXA 5L71A 4PGTA 4HJ2A 4PURA 1SJZA 3LYKA 1GSYA 4YQMA 5ECKB 4FQUA 1Z7PA 2MMOA 5BRTA 2C8UA 4KUNA 3GYKA 4YKFA 5DCGA 1GTAA 3KGKA 4OCEA 5D9TA 5AN1A 4HZ2A 1XWAA 2L4QA 1K0CA 1TRWA 3F3QA 3KMNA 3WGXA 4PXOA 3QFAC 3D4TA 18GSA 2I3YA 5H5SA 4MP4A 4NAXA 1XCCA 2I1UA 4KGIA 1DUGA 2XPDA 2QA2A 2K8SA 2JZTA 4K5RA 2A2PA 4EDYA 1YEXA 3F4RA 3PR8A 3IBHA 2VL2A 2HSMA 3DXBA 1B4PA 1NM3A 1Z5YE 5AIXA 1UA5A 1V98A 1TKDB 4XS6A 2MBTA 2OACA 1Q4JA 5CRHA 5ABRA 4JR4A 2PERA 1XFLA 2IMFA 3ZVJD 2H1DA 1O8XA 1OKDA 3IAM2 5B6NA 2V41A 4TR4A 4KH7A 2YWNA 4DEJA 2KP2A 4WF5A 12GSA 3HJOA 5ELGA 5EVOA 3ZREA 2YOIA 2PGTA 4CY6A 3VWXA 4EIPA 1TXXA 6GSXA 4CY8A 1FB0A 1G7OA 5ECSA 3KH9A 3TOTA 3TJGA 4RI6A 4XTSA 4PTSA 1I9DA 2H71A 4F2IA 2X49A 4O32A 5F07A 3TUEA 4IP6A 2H72A 4G19A 3TRPA 3GFKA 3HJPA 3KJYA 3TOUA 3F8UA 5KN3A 2H73A 4MZBA 3FK8A 5IMDA 4MPGA 2HSYA 5CP1A 2IWTA 2K6VA 3ERGA 6GSUA 4IQ1A 4WR4A 4BVYB 4O5RA 2HE3A 2GQMA 1U87A 4KB3A 3KH7A 1MD3A 5G5EA 4HZ4A 2GSSA 2DJ3A 2F3MA 2H8LA 2YV9A 4ZBBA 2DJ0A 2H6YA 1THOA 3GH9A 3UVHA 3TKQA 2IIYA 2A2SA 2AAWA 2FLSA 3FR6A 2LSTA 5ECLB 1SK0A 2HYXA 1SK1A 1TK5B 3LW9A 4EL1A 1M2DA 1PL1A 1URMA 2ZCTA 4KDUA 2H6ZA 3QMXA 3ZMKA 4G0IA 2LRCA 1O81A 1AQVA 3D21A 5J5NA 5B8BA 2GS3A 4ZL8A 2WRTA 3AY8A 5IQYA 1M9AA 5G2ZA 1G6YA 3R3EA 4IELA 2P5QA 3VLNA 3TKRA 5E4WA 1WWJA 4IP1A 13GSA 2N5BA 3A2XA 5JCUA 1JZOA 1G0TA 3GL3A 1TRVA 1ZL9A 2PPTA 3IK7A 4LL1B 2YWOA 1ZGNA 2FWFA 2DJKA 1BG5A 1XBSA 1VF2A 2IMIA 3C1RA 4KE3A 1XZOA 4WF4A 3W6GA 2LNTA 4PUFC 2VIMA 1TRUA 5IOXA 1PL2A 2OA7A 3DYRA 3HCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RUE A;  1OE7 A;  1XW5 A;  4L5O A;  4NHZ A;  2I81 A;  2RM5 A;  3G9B A;  1XWC A;  1WRY A;  2MMA A;  2C0G A;  2LQO A;  3GST A;  1B48 A;  3GTU B;  4HQS A;  4EC0 A;  5IO2 A;  3K8N A;  1K0A A;  2H66 A;  3I69 A;  3QFB C;  3L9U A;  1BED A;  2VD1 A;  4OMV A;  2GST A;  1VF3 A;  3L9S A;  1O8W A;  1ERV A;  2YZH A;  3GRX A;  1XWB A;  2VD0 A;  5FWG A;  4D73 A;  1ZYQ B;  1ERW A;  5IMV A;  2F8A A;  3DRN A;  4J2F A;  1C72 A;  1BYE A;  1X9W B;  5F0G A;  16GS A;  2C4J A;  2GT5 A;  1B9X C;  2L6D A;  1T7P B;  1QGV A;  1VF1 A;  3L9V A;  5IPG A;  3QCP A;  3LGC A;  5CYY A;  2HI7 A;  2HXK A;  2BMX A;  3F9U A;  4HU9 A;  3LWA A;  2FY6 A;  1WIK A;  4MJE A;  5ECM B;  2VCX A;  4ZL7 A;  2OE3 A;  3FW2 A;  4L8E A;  2WGR A;  5A4V A;  3EMP A;  3LXZ A;  11GS A;  2M72 A;  20GS A;  3NIV A;  1JLV A;  4ML1 A;  4NWY A;  3TJB A;  1SL2 B;  1F3B A;  1ERU A;  5ECQ B;  5J4U A;  2LV3 A;  4MZW A;  3IR4 A;  3UOM A;  1O7U A;  3KTB A;  4XS1 A;  4XHM A;  10GS A;  5J9B A;  2LQQ A;  1TRS A;  2O89 A;  3HVV A;  5DQS A;  2P5R A;  1FW1 A;  1ZZY A;  5ENU A;  1F9M A;  3F3R A;  3PGT A;  3JCM L;  2GLR A;  3UBL A;  2YWI A;  3ZIV A;  1M0U A;  3U5R E;  1HD2 A;  3GKK A;  1V58 A;  1U88 A;  1ABA A;  1N8J A;  1K3L A;  4EDZ A;  4HUA A;  2RM6 A;  1Z6M A;  1TP9 A;  3FY7 A;  1Z9H A;  5DBQ A;  4MMM A;  1KBN A;  5ECO B;  1RW1 A;  1F6M C;  2IL3 A;  2B7K A;  2VCQ A;  3EU3 A;  2WDU A;  2VCV A;  4K1F A;  3NZN A;  2VM2 A;  3EYT A;  1B4Q A;  2B7J A;  5FHI A;  3W8S A;  1K3O A;  1OC9 B;  4IJ3 A;  2AHE A;  4Q5N A;  1DBY A;  4ML6 A;  1XVW A;  3N5O A;  5GAP D;  4TR1 A;  2VLT A;  4HS1 A;  2J23 A;  5D9W A;  5B6M A;  2O7K A;  3ZIJ A;  3M1G A;  3VI7 A;  1Z6N A;  3UAP A;  3P8W A;  1Y25 A;  1ILO A;  4TKY A;  5H5R A;  2AJQ B;  3I6A A;  4K7I A;  4OWY A;  1EGR A;  1J0F A;  2H0H A;  2HZE B;  1FB6 A;  2V2G A;  1T4Z A;  2CZ3 A;  2NDO A;  1EEJ A;  2DIY A;  2GVP A;  1SD9 A;  5ECP B;  5ID2 B;  4ISD A;  1YJ6 A;  3M9K A;  1PQN A;  1VGL A;  1AAZ A;  2I9H A;  5ECR B;  5D93 A;  2HLS A;  1T00 A;  5D73 A;  5D9V A;  4N10 A;  2R37 A;  1S3D A;  3J7Y k;  1R7H A;  1ST9 A;  3KEB A;  1JZW A;  3ZZX A;  3EWL A;  1YY7 A;  4KSM A;  1WPI A;  2HZE A;  1XIY A;  2H0G A;  5AIV A;  3A5W A;  4JE1 A;  5ID2 A;  3ZL5 A;  1R5A A;  4GF0 A;  3MWH A;  2OKA A;  4IW9 A;  1A0F A;  5DCH A;  4ZL9 A;  5HR3 A;  3VPQ A;  4AF2 A;  5H5Q A;  3ZYW A;  4IJI A;  1XVQ A;  2FGX A;  4MA9 A;  3F6F A;  5J3R A;  2JU5 A;  2KLX A;  5HQP A;  2NVL A;  4Q5Q A;  2YNX A;  4OFN A;  1VRS D;  1YEP A;  3V1W A;  3D6I A;  1YDK A;  2FD3 A;  1GSU A;  2O87 A;  1DSB A;  3FZ5 A;  3C73 A;  1M2A A;  1OAZ A;  2QSI A;  4GLT A;  3P2A A;  5E59 A;  4G9H A;  4GXZ A;  5J9C A;  1XWG A;  1MD4 A;  2IMD A;  2E7P A;  3C71 A;  3DWV A;  1SU9 A;  5CRW A;  3VUR A;  3GUS A;  4KDY A;  4PX1 A;  2GT6 A;  4MDC A;  2ALB A;  4TW5 A;  19GS A;  3RBT A;  2WZ9 A;  2LS5 A;  4KSO A;  2E0Q A;  4IHU A;  5CRE A;  4DSS B;  4F03 A;  2HRF A;  4L0W A;  1GSE A;  1LBK A;  1I5G A;  2CVB A;  5A4U A;  2VAF A;  4KND A;  3GSS A;  2LUS A;  4IBP A;  2C3Q A;  3ME7 A;  4NV2 A;  3GKM A;  1AXD A;  1FVJ A;  1X0R A;  4TOP A;  1GSD A;  1GUM A;  3HHV A;  4PUA A;  4PNG A;  2MMN A;  1MEK A;  1SKR B;  3BCK A;  4E8E A;  4NPB A;  1SL1 B;  2N5F A;  2REM A;  3LQ7 A;  3KXO A;  4DSS A;  4FYU A;  4O7H A;  4K0G A;  5DAL B;  4RQR A;  3GHA A;  1T3B A;  1JZD A;  4HU7 A;  3S9F A;  3GKN A;  3IOS A;  3UIW A;  4EE0 A;  1HNA A;  1WJK A;  2TRC P;  3BJ5 A;  1HYU A;  4O92 A;  1F2E A;  1M2B A;  3ME8 A;  1SYR A;  2B6M A;  3RPN A;  3SBC A;  4N0Z A;  2C80 A;  3LG6 A;  4Q5F A;  3LJR A;  2YPM A;  1FG4 A;  2AUV A;  9GSS A;  2OE0 A;  2V1M A;  3EVI A;  2B5X A;  4EVM A;  1DE1 A;  1BX9 A;  3VK9 A;  1FO5 A;  1H4O A;  4POK A;  4DSQ A;  1H75 A;  5G1K A;  3TJJ A;  22GS A;  4F9Z A;  2JZR A;  4IQA A;  2FWG A;  2EIQ A;  1YZX A;  4BWQ A;  3C8E A;  2CT6 A;  4F0C A;  3CSJ A;  3IA1 A;  5G31 A;  4X43 A;  3CTF A;  4Q5R A;  4GSN A;  2VCW A;  4I97 A;  4ZB8 A;  1UC7 A;  4KX4 A;  3CBU A;  1SJ6 A;  4MH2 A;  5D9X A;  4KW6 A;  2AB6 A;  3E3E A;  3H79 A;  4PNF A;  3M8N A;  2L57 A;  4MF5 A;  3RHB A;  4BVY A;  1VF4 A;  5KN0 A;  3TJK A;  2VUP A;  2IN3 A;  3ZVJ A;  2D2Z A;  3HDC A;  2KHP A;  4GTU A;  1T8E B;  1PX7 A;  5CO3 A;  6GSW A;  1UVZ A;  4HI7 A;  6GST A;  3DVW A;  2GZZ A;  1SKS B;  2DJJ A;  3TKS A;  3L0H A;  14GS A;  2KUC A;  2O85 A;  2XBQ A;  2CA8 A;  2L4C A;  1GTB A;  1WOU A;  2ZNM A;  1U6T A;  3HD5 A;  1OVN A;  5JWR B;  1TK0 B;  4MF7 A;  1PX6 A;  2PVQ A;  4RI7 A;  3EU4 A;  2OAD A;  1OE8 A;  4FIW A;  5G30 A;  3OR5 A;  3BD2 A;  4ECJ A;  1GWC A;  4MLY A;  3UAR A;  3N9J A;  5C04 A;  3Q74 A;  1K0D A;  4HOJ A;  2K8V A;  5DAK B;  2VL3 A;  5IMZ A;  4DSR A;  2FWH A;  3FEU A;  1FHE A;  1Z3E A;  3A2V A;  1OYJ A;  4I8B A;  1QFN A;  1HNC A;  4KDX A;  1O6J A;  4BWS A;  3M0F A;  4I2T A;  2H1B A;  2RLI A;  3E9J B;  1U3A A;  2MBS A;  1XW6 A;  5J41 A;  4MZC A;  2M80 A;  4KCA A;  1S3A A;  3KP9 A;  3FR9 A;  1YKA A;  5EL8 A;  1SKW B;  4OFT A;  3DML A;  1PKZ A;  2YN1 A;  4YQU A;  1SJI A;  3RPP A;  2VCT A;  2XHF A;  1OC8 A;  3O3T A;  4WET A;  2JZS A;  2DML A;  2A4V A;  3ZML A;  1PSQ A;  4AJ8 A;  2JAC A;  3A3T A;  2HNL A;  2WJU A;  3D5J A;  6GSS A;  1EP7 A;  3IE3 A;  2PU9 C;  4LA1 A;  3G7I A;  3TKS E;  4F0B A;  1A2M A;  2HZF A;  3SWL A;  2VL2 C;  4OO4 A;  1R5P A;  3LEF A;  4V2L A;  3UMA A;  2J9H A;  3GTU A;  3GL5 A;  4Z7X A;  2C0E A;  3IRA A;  2B1L A;  1X9M B;  1XWK A;  5GZZ B;  3C1S A;  3MNG A;  3KD0 A;  1AIU A;  1U3I A;  4MJB A;  2GZP A;  5CRG A;  3HVS A;  5HR0 A;  5HFG A;  2C3T A;  2PN8 A;  1BQ7 A;  1S3C A;  3UBK A;  5A5K A;  3VPT A;  5INY A;  4JR6 A;  4K2D A;  2EIR A;  4XS4 B;  1XOA A;  3IAS 2;  1NW2 A;  3P90 A;  4ZBA A;  1NHO A;  2MYG A;  4RUV A;  1PRX A;  5IO0 A;  4ECC A;  2X64 A;  5KN2 A;  3F0I A;  4FO5 A;  1CQH A;  2G0F A;  4E8H A;  1G7E A;  3ZFL A;  2WUL A;  3WGE A;  5A4W A;  4MH3 A;  2C0D A;  2EC4 A;  1GL8 A;  3KTL A;  5EY6 A;  5C00 A;  3BOA A;  3DIE A;  4QQ7 A;  1GRX A;  4TVE A;  4PQ1 A;  3VWW A;  2FHE A;  3ZLP A;  2GSQ A;  1XW9 A;  2R3X A;  2YV7 A;  1GTI A;  2FWE A;  3EIN A;  4KA0 A;  5ECI B;  3H93 A;  4EO3 A;  3GV1 A;  5IM9 A;  3NOF A;  2LJK A;  2C3N A;  1EWX A;  5LCZ A;  3P7X A;  4ZB9 A;  3BBY A;  4XIH A;  3CRT A;  4P3Y B;  1MDI A;  4RQX A;  1RQM A;  5CNW A;  1TTZ A;  2R2J A;  2K9F A;  3EC3 A;  5DJM A;  3DGQ A;  4POM A;  3CSI A;  3A2W A;  2QC7 A;  3VWV A;  4IN0 A;  3G7J A;  3UVT A;  4MK3 A;  2ES7 A;  2DMM A;  3PH9 A;  5G1L A;  3D0Z A;  1TW9 A;  4NMU A;  3D4M A;  2G2Q A;  3QD9 A;  3ZTL A;  3CSH A;  2IFQ B;  4HJM A;  4V1A g;  2H76 A;  3TJF A;  1YF1 A;  3HXS A;  1ACV A;  1NSW A;  1UN2 A;  3IC4 A;  5FT3 A;  4YAV A;  1TDI A;  3Q18 A;  2OBK A;  1OC9 A;  2TIR A;  2AYT A;  2LRN A;  4NXI A;  4OD7 A;  3KM6 A;  5ECH B;  2VOC A;  1XPV A;  3FZA A;  1K0O A;  2KP1 A;  3CTG A;  5EPF A;  3RDW A;  4GQC A;  1ZCP A;  4WBJ A;  2PUK C;  1YKC A;  3KZQ A;  1MDJ A;  1M9B A;  2M46 A;  2CV4 A;  4GQF A;  1GP1 A;  4MJA A;  1ZYE A;  2EIO A;  1AQX A;  2E2G A;  3F4T A;  5GSS A;  1R4W A;  5F06 A;  1FAA A;  3ED3 A;  3QAV A;  1QMV A;  3RHC A;  5ELA A;  2H74 A;  8GSS A;  4GCI A;  1HQO A;  2K18 A;  4X0X A;  3GUR A;  3ZRD A;  4PQH A;  2YWM A;  2QKE A;  4HEA 2;  4XRD A;  4OO5 A;  1EOG A;  3G7Y A;  4ECB A;  1GUL A;  2WS2 A;  2F9S A;  2DJ1 A;  3TGZ A;  2H30 A;  1F37 A;  1V9W A;  4IVF A;  3UL3 A;  5LD0 A;  2N5A A;  4IS0 A;  17GS A;  3LFL A;  1PN9 A;  1GNW A;  1GH2 A;  2CAI A;  1X5D A;  3LXT A;  3QDN A;  3R2Q A;  4LMW A;  2LKU A;  5LNK e;  1HNB A;  3WT1 A;  4TXO B;  4TR0 A;  1GSF A;  2GQL A;  5B8A A;  1FOV A;  4ACS A;  1DE2 A;  4JBB A;  2P31 A;  2B5Y A;  3GIX A;  1OC3 A;  1K3Y A;  3H1N A;  2C0F A;  4V2N A;  5ECN B;  1GTU A;  4ZIJ A;  3DD3 A;  1GNE A;  1EZK A;  4N30 A;  4YQV A;  2LTK A;  3IPZ A;  4AGS A;  4AJ6 A;  1MTC A;  1SL0 B;  1SK2 A;  3FR3 A;  1MDK A;  2GGT A;  3QPM A;  1GUK A;  4L0U A;  5B7C A;  3MAK A;  4TXO A;  3DVX A;  3FZ9 A;  4POL A;  2X8H A;  3IV4 A;  3WGD A;  1JZR A;  1NHY A;  4GSS A;  1LU4 A;  1T1V A;  5GST A;  2JSZ A;  4HDE A;  5DVB A;  1EV4 A;  2YCD A;  3IHQ A;  1KNG A;  3IDV A;  1V2A A;  4ZIL A;  5JCW A;  1BAY A;  2HRN A;  4J56 E;  1G6W A;  2NPB A;  5CAX A;  6GSY A;  2H01 A;  3LOR A;  4POB A;  4GWR A;  2CQ9 A;  1A8L A;  1TI1 A;  2R6K A;  1LJR A;  3GN3 A;  4FYB A;  4FH8 A;  2R4V A;  4JED A;  4AJ7 A;  1JFU A;  3HA9 A;  3QR6 A;  2FUG 2;  5JWO B;  3QAG A;  3KMO A;  4MCU A;  2VO4 A;  2NTO A;  2B3S A;  4EF0 A;  2YJH A;  2VLU A;  1A2L A;  5IIZ A;  3GX8 A;  2DJ2 A;  4IGJ A;  5HR2 A;  2B5E A;  3TKP A;  1X5E A;  5IMF A;  1J08 A;  2JAD A;  1QQ2 A;  3HZ8 A;  1USB A;  1Z7R A;  4ID0 A;  4K6X A;  4WXT A;  2H19 A;  1X5C A;  5DAL A;  4N0V A;  1A0R P;  1ERT A;  1GSQ A;  4K9Z A;  1OKT A;  1PA3 A;  2WCI A;  5G5F A;  3U6V A;  4TN8 A;  3HVX A;  2X8C A;  3HKR A;  2FCH A;  3H8Q A;  2QGV A;  2XBI A;  1ON4 A;  2GZY A;  1QK8 A;  2MMZ A;  4IKH A;  2PBJ A;  1J9B A;  2IJY A;  3WD6 A;  3CMI A;  1YQ1 A;  2O8V B;  1X9S B;  1EGO A;  3TB2 A;  3APO A;  3CXG A;  3UEM A;  1V57 A;  4NHW A;  4K8M A;  2WB9 A;  3H4K A;  2E2M A;  4H86 A;  3CRU A;  1ML6 A;  3M9J A;  5HFI A;  1JHB A;  4MF6 A;  2JL4 A;  2H1G A;  3FZ4 A;  2VCZ A;  2GQK A;  1O85 A;  5AGY A;  3IK9 A;  4K0N A;  4NV5 A;  2CVK A;  2BTO T;  3TRQ A;  3L78 A;  3QAW A;  1A24 A;  4XCS A;  4LMV A;  4WEY A;  1E6B A;  4KAE A;  3O76 A;  2GDR A;  4YAP A;  1PGT A;  1SEN A;  3Q6O A;  5D96 A;  2H70 A;  5COH A;  5IMA A;  3CYN A;  1IYH A;  4TR3 A;  3VWU A;  4JZQ A;  2B1K A;  4ECI A;  3ERW A;  2KOK A;  5DJL A;  4CHS A;  2DC5 A;  2VL9 A;  1SD8 A;  4I6X A;  4YH2 A;  4JRR A;  2CZ2 A;  3E0U A;  4ULX A;  1AW9 A;  4V1A p;  3EMX A;  2ON5 A;  2P0G A;  3FHK A;  1TU8 A;  1XXU A;  4QL9 A;  3EUR A;  1K0B A;  4XRA A;  2MZC A;  1A2J A;  5HFK A;  4CW9 A;  2L5O A;  4OCF A;  3VFI A;  4I2U A;  4WKW A;  5DQY A;  3TRX A;  2YP6 A;  1XOB A;  1B8X A;  4D73 B;  3APS A;  1W4V A;  3GNJ A;  1QXH A;  4DVC A;  3DEX A;  1TU7 A;  5CRD A;  5DAK A;  1WP0 A;  2PVO C;  2I4A A;  3FKF A;  1PKW A;  2OE1 A;  1SYX A;  3I9V 2;  1GUH A;  2CAQ A;  3TCO A;  2WFC A;  4LL4 B;  3D22 A;  5JCG A;  5GAN D;  1E2Y A;  3O6T A;  1GLQ A;  2HT9 A;  4ZXG A;  3US3 A;  3HJM A;  1JLW A;  5KN1 A;  4TXV A;  5IOW A;  2CVD A;  2RII A;  3C7M A;  2VM1 A;  4BPY A;  5F05 A;  3DKS A;  2HSH A;  4QL7 A;  4L5L A;  3ZFB A;  4G10 A;  1TOF A;  4V2M A;  2PWJ A;  2LNS A;  2JSY A;  2IME A;  5KEJ A;  2V6O A;  2XPE A;  2HFD A;  3M3M A;  4K7O A;  2DLX A;  3RAZ A;  4ILF A;  2TRX A;  4MAB A;  4GRF A;  2R5G A;  3WYW A;  4N11 A;  1F3A A;  3IXR A;  2DBC A;  2XC2 A;  3GH6 A;  4CDO A;  4WBR D;  1V40 A;  3PIN A;  4G2E A;  2VLV A;  2OBI A;  3MSZ A;  1A23 A;  2H75 A;  4OFM A;  4XS4 A;  1Q98 A;  2F51 A;  2NBS A;  3UJ1 A;  2OJL A;  1TI3 A;  3LSZ A;  1EOH A;  2DSA A;  5IMC A;  1THX A;  3HY2 A;  3APQ A;  1PMT A;  1B9Y C;  2L6C A;  2GSR A;  7GSS A;  3QOU A;  1EEM A;  4HQZ A;  4J57 E;  3FRC A;  4TR1 B;  3KIJ A;  2PMT A;  3KP8 A;  1M99 A;  1QUW A;  2V6K A;  1ZMA A;  4TRX A;  1WMJ A;  3I43 A;  2Z9S A;  5D8I A;  4GST A;  4EKZ A;  1TJD A;  2F8F A;  3F4S A;  2X99 A;  4X1U A;  4BL7 A;  2YZU A;  2FA8 A;  3BCI A;  1R26 A;  2YAN A;  1FVK A;  3L4N A;  2RUF A;  3TKS C;  1O73 A;  3GMF A;  4FYC A;  1AUC A;  1K0M A;  2LRT A;  5HR1 A;  5F8B A;  3HZ4 A;  2CX3 A;  1A8Y A;  2YJ7 A;  1M7T A;  4K7N A;  4MJC A;  1W89 A;  3GA4 A;  4I5Q A;  4MPF A;  2FA4 A;  2IMK A;  4ZBD A;  1AQW A;  4ZB6 A;  5JWQ B;  2H6X A;  2AV4 A;  3FYG A;  2H0I A;  2IFQ A;  3WT2 A;  4WR5 A;  3TDG A;  1BJX A;  2LEG A;  1CQG A;  1K0N A;  3LYP A;  1N2A A;  3EE2 A;  1EV9 A;  2IPA A;  1TK8 B;  2X8G A;  3ERF A;  3ISO A;  1GSS A;  6GSV A;  2CX4 A;  1RK4 A;  3W8J A;  3ZIT A;  4KCE A;  2BJX A;  4EUY A;  3F6D A;  1EP8 A;  4PQI A;  2ON7 A;  3J7Y b;  2L59 A;  4JU5 A;  1T4Y A;  1YF0 A;  2L5L A;  3MDK A;  2DIZ A;  1Y6E A;  5DDL A;  2FNO A;  4BA7 A;  3GKX A;  2H1A A;  1AC1 A;  3Q19 A;  2LJA A;  1KTE A;  1ZOF A;  2GTU A;  2LJR A;  3HYP A;  4EXJ A;  5IPH A;  1WE0 A;  1IYI A;  4F82 A;  3VI5 A;  5AIS A;  2ZUP A;  3F63 A;  2A2R A;  3GX0 A;  2C1Y A;  1KEB A;  1GLP A;  3KCM A;  2V32 A;  1PD2 1;  4LLR A;  4BVX A;  5L71 A;  4PGT A;  4HJ2 A;  4PUR A;  1SJZ A;  3LYK A;  1GSY A;  4YQM A;  5ECK B;  1Z7P A;  2MMO A;  2C8U A;  4KUN A;  3GYK A;  5DCG A;  1GTA A;  3KGK A;  4OCE A;  5D9T A;  5AN1 A;  4HZ2 A;  1XWA A;  2L4Q A;  1K0C A;  1TRW A;  3F3Q A;  3KMN A;  3WGX A;  4PXO A;  3QFA C;  3D4T A;  18GS A;  2I3Y A;  5H5S A;  4MP4 A;  4NAX A;  1XCC A;  2I1U A;  4KGI A;  1DUG A;  2XPD A;  2K8S A;  2JZT A;  4EDY A;  1YEX A;  3F4R A;  3PR8 A;  3IBH A;  2VL2 A;  3DXB A;  1B4P A;  1NM3 A;  1Z5Y E;  5AIX A;  1UA5 A;  1V98 A;  1TKD B;  4XS6 A;  2MBT A;  2OAC A;  1Q4J A;  5CRH A;  5ABR A;  4JR4 A;  2PER A;  1XFL A;  2IMF A;  3ZVJ D;  2H1D A;  1O8X A;  1OKD A;  3IAM 2;  5B6N A;  2V41 A;  4TR4 A;  4KH7 A;  2YWN A;  4DEJ A;  2KP2 A;  4WF5 A;  12GS A;  3HJO A;  5ELG A;  5EVO A;  3ZRE A;  2YOI A;  2PGT A;  3VWX A;  1TXX A;  6GSX A;  1FB0 A;  1G7O A;  5ECS A;  3KH9 A;  3TOT A;  3TJG A;  4RI6 A;  4XTS A;  1I9D A;  2H71 A;  4F2I A;  4O32 A;  5F07 A;  3TUE A;  4IP6 A;  2H72 A;  4G19 A;  3TRP A;  3GFK A;  3HJP A;  3KJY A;  3TOU A;  3F8U A;  5KN3 A;  2H73 A;  4MZB A;  3FK8 A;  5IMD A;  4MPG A;  2HSY A;  5CP1 A;  2IWT A;  2K6V A;  3ERG A;  6GSU A;  4IQ1 A;  4WR4 A;  4O5R A;  2HE3 A;  2GQM A;  1U87 A;  4KB3 A;  3KH7 A;  1MD3 A;  5G5E A;  4HZ4 A;  2GSS A;  2DJ3 A;  2F3M A;  2H8L A;  2YV9 A;  4ZBB A;  2DJ0 A;  2H6Y A;  1THO A;  3GH9 A;  3UVH A;  3TKQ A;  2IIY A;  2A2S A;  2AAW A;  2FLS A;  3FR6 A;  2LST A;  5ECL B;  1SK0 A;  2HYX A;  1SK1 A;  1TK5 B;  4EL1 A;  1M2D A;  1PL1 A;  1URM A;  2ZCT A;  4KDU A;  2H6Z A;  3QMX A;  3ZMK A;  2LRC A;  1O81 A;  1AQV A;  3D21 A;  5J5N A;  5B8B A;  2GS3 A;  4ZL8 A;  2WRT A;  3AY8 A;  5IQY A;  1M9A A;  5G2Z A;  1G6Y A;  4IEL A;  2P5Q A;  3VLN A;  3TKR A;  5E4W A;  1WWJ A;  4IP1 A;  13GS A;  2N5B A;  3A2X A;  5JCU A;  1JZO A;  1G0T A;  3GL3 A;  1TRV A;  1ZL9 A;  2PPT A;  3IK7 A;  4LL1 B;  2YWO A;  1ZGN A;  2FWF A;  2DJK A;  1BG5 A;  1XBS A;  1VF2 A;  2IMI A;  3C1R A;  4KE3 A;  1XZO A;  4WF4 A;  3W6G A;  2LNT A;  4PUF C;  2VIM A;  1TRU A;  5IOX A;  1PL2 A;  2OA7 A;  3DYR A;  3HCZ A; 
#chains in the Genus database with same CATH topology
 2RUE A;  1OE7 A;  1XW5 A;  4L5O A;  1M3J A;  4Z2T A;  4NHZ A;  2I81 A;  2RM5 A;  3G9B A;  1XWC A;  1WRY A;  2MMA A;  2C0G A;  2LQO A;  3GST A;  1B48 A;  3GTU B;  4HQS A;  4EC0 A;  5IO2 A;  3K8N A;  1K0A A;  2H66 A;  3I69 A;  3QFB C;  3L9U A;  1BED A;  2VD1 A;  4OMV A;  2GST A;  1VF3 A;  3L9S A;  1O8W A;  1ERV A;  2YZH A;  3GRX A;  1XWB A;  2VD0 A;  4ICY A;  5FWG A;  4D73 A;  1ZYQ B;  1ERW A;  5IMV A;  2F8A A;  3DRN A;  4J2F A;  1C72 A;  1BYE A;  1X9W B;  5F0G A;  16GS A;  2C4J A;  2GT5 A;  1B9X C;  2L6D A;  1T7P B;  1QGV A;  1VF1 A;  3L9V A;  5IPG A;  3QCP A;  3LGC A;  5CYY A;  2HI7 A;  2HXK A;  2BMX A;  3F9U A;  4HU9 A;  3LWA A;  2FY6 A;  1WIK A;  4MJE A;  5ECM B;  2VCX A;  4ZL7 A;  2OE3 A;  3FW2 A;  4L8E A;  2WGR A;  5A4V A;  3EMP A;  3LXZ A;  11GS A;  5KOX A;  2M72 A;  20GS A;  3NIV A;  1JLV A;  4ML1 A;  4NWY A;  3TJB A;  4MNN A;  1SL2 B;  1F3B A;  1ERU A;  5ECQ B;  5J4U A;  2LV3 A;  4MZW A;  3IR4 A;  3UOM A;  1O7U A;  3KTB A;  4XS1 A;  4XHM A;  10GS A;  5J9B A;  2LQQ A;  1TRS A;  2O89 A;  3HVV A;  5DQS A;  2P5R A;  1FW1 A;  1ZZY A;  5ENU A;  1F9M A;  3F3R A;  3PGT A;  3JCM L;  2GLR A;  3UBL A;  2YWI A;  3ZIV A;  1M0U A;  3U5R E;  1HD2 A;  3GKK A;  1V58 A;  1U88 A;  1ABA A;  1N8J A;  1K3L A;  4EDZ A;  4HUA A;  2RM6 A;  1Z6M A;  1TP9 A;  3FY7 A;  1Z9H A;  5DBQ A;  4MMM A;  1KBN A;  5ECO B;  1RW1 A;  1F6M C;  2IL3 A;  2B7K A;  2VCQ A;  3EU3 A;  2WDU A;  2A4H A;  2VCV A;  4K1F A;  3NZN A;  2VM2 A;  3EYT A;  1B4Q A;  2B7J A;  5FHI A;  3W8S A;  1K3O A;  1OC9 B;  2HRK A;  4IJ3 A;  2AHE A;  4Q5N A;  1DBY A;  4ML6 A;  1XVW A;  3N5O A;  5GAP D;  4TR1 A;  2VLT A;  4HS1 A;  2J23 A;  5D9W A;  5B6M A;  2O7K A;  3ZIJ A;  3M1G A;  3VI7 A;  1Z6N A;  3UAP A;  3P8W A;  1Y25 A;  1ILO A;  4TKY A;  5H5R A;  2AJQ B;  3I6A A;  4K7I A;  4OWY A;  1EGR A;  1J0F A;  2H0H A;  2HZE B;  1FB6 A;  2V2G A;  1T4Z A;  2CZ3 A;  2NDO A;  1EEJ A;  2DIY A;  2GVP A;  1SD9 A;  5ECP B;  5ID2 B;  4ISD A;  1YJ6 A;  3M9K A;  1PQN A;  1VGL A;  1AAZ A;  2I9H A;  5ECR B;  5D93 A;  2HLS A;  1T00 A;  5D73 A;  5D9V A;  4N10 A;  2R37 A;  1S3D A;  3J7Y k;  1R7H A;  1ST9 A;  3KEB A;  1JZW A;  3ZZX A;  3EWL A;  1YY7 A;  4KSM A;  1WPI A;  1XG8 A;  2HZE A;  1XIY A;  2H0G A;  5AIV A;  3A5W A;  4JE1 A;  5ID2 A;  3ZL5 A;  1R5A A;  4GF0 A;  3MWH A;  2OKA A;  4IW9 A;  1A0F A;  5DCH A;  4ZL9 A;  5HR3 A;  3VPQ A;  4AF2 A;  5H5Q A;  1ZYP A;  3ZYW A;  4IJI A;  1XVQ A;  2FGX A;  4MA9 A;  3F6F A;  5J3R A;  2JU5 A;  2KLX A;  5HQP A;  2NVL A;  4Q5Q A;  2YNX A;  4OFN A;  1VRS D;  1YEP A;  3V1W A;  3D6I A;  1YDK A;  2FD3 A;  1GSU A;  2O87 A;  1DSB A;  3FZ5 A;  3C73 A;  1M2A A;  1OAZ A;  2QSI A;  4GLT A;  3P2A A;  5E59 A;  4G9H A;  4GXZ A;  5J9C A;  1XWG A;  1MD4 A;  3CQF A;  2IMD A;  2E7P A;  3C71 A;  3DWV A;  1SU9 A;  5CRW A;  3VUR A;  3GUS A;  4KDY A;  4PX1 A;  2GT6 A;  4MDC A;  2ALB A;  4TW5 A;  19GS A;  3RBT A;  2WZ9 A;  2LS5 A;  4KSO A;  2E0Q A;  4IHU A;  5CRE A;  4DSS B;  4F03 A;  2HRF A;  4L0W A;  1GSE A;  1LBK A;  1I5G A;  2CVB A;  5A4U A;  2VAF A;  4KND A;  3GSS A;  2LUS A;  4IBP A;  2C3Q A;  3ME7 A;  4NV2 A;  3GKM A;  1AXD A;  1FVJ A;  1X0R A;  4TOP A;  1GSD A;  1GUM A;  3HHV A;  4PUA A;  4PNG A;  2MMN A;  1MEK A;  1SKR B;  4USS A;  3BCK A;  4E8E A;  4NPB A;  1SL1 B;  2N5F A;  2REM A;  3LQ7 A;  3KXO A;  4DSS A;  4FYU A;  4O7H A;  4K0G A;  5DAL B;  4RQR A;  3GHA A;  3A5I A;  1T3B A;  1JZD A;  4HU7 A;  3S9F A;  3GKN A;  3IOS A;  3UIW A;  2R0P A;  4EE0 A;  1HNA A;  1WJK A;  2TRC P;  3BJ5 A;  1HYU A;  4O92 A;  1F2E A;  1M2B A;  3ME8 A;  1SYR A;  2B6M A;  3RPN A;  3SBC A;  4N0Z A;  2C80 A;  3LG6 A;  4Q5F A;  3LJR A;  2YPM A;  1FG4 A;  2AUV A;  9GSS A;  1ZYN A;  2OE0 A;  2V1M A;  3EVI A;  2B5X A;  4EVM A;  1DE1 A;  1BX9 A;  3VK9 A;  1FO5 A;  1H4O A;  4POK A;  4DSQ A;  1H75 A;  5G1K A;  3TJJ A;  22GS A;  4HSC X;  4EIQ A;  4F9Z A;  2JZR A;  4IQA A;  2FWG A;  2EIQ A;  1YZX A;  4BWQ A;  3C8E A;  2CT6 A;  4F0C A;  3CSJ A;  3IA1 A;  5G31 A;  4X43 A;  3CTF A;  4Q5R A;  4GSN A;  2VCW A;  4I97 A;  4ZB8 A;  1UC7 A;  4KX4 A;  3CBU A;  1SJ6 A;  4MH2 A;  5D9X A;  4KW6 A;  2AB6 A;  3E3E A;  3H79 A;  4PNF A;  3M8N A;  2L57 A;  4MF5 A;  3RHB A;  4BVY A;  1VF4 A;  5KN0 A;  3TJK A;  2VUP A;  2IN3 A;  3ZVJ A;  2D2Z A;  3HDC A;  2KHP A;  4GTU A;  1T8E B;  1PX7 A;  5CO3 A;  6GSW A;  1UVZ A;  4HI7 A;  6GST A;  3DVW A;  2GZZ A;  1SKS B;  2DJJ A;  3TKS A;  3L0H A;  14GS A;  2KUC A;  2O85 A;  2XBQ A;  2CA8 A;  2L4C A;  1GTB A;  1WOU A;  2ZNM A;  1U6T A;  3HD5 A;  1OVN A;  5JWR B;  1TK0 B;  4MF7 A;  1PX6 A;  2PVQ A;  4RI7 A;  3EU4 A;  2OAD A;  1OE8 A;  4FIW A;  5G30 A;  3OR5 A;  3BD2 A;  4ECJ A;  1GWC A;  4MLY A;  3UAR A;  3N9J A;  5C04 A;  3Q74 A;  1K0D A;  4HOJ A;  2K8V A;  5DAK B;  2VL3 A;  5IMZ A;  4DSR A;  2FWH A;  3FEU A;  1FHE A;  1Z3E A;  3A2V A;  1OYJ A;  4I8B A;  1QFN A;  1HNC A;  4KDX A;  1O6J A;  4BWS A;  3M0F A;  4I2T A;  2H1B A;  2RLI A;  3E9J B;  1U3A A;  2MBS A;  1XW6 A;  5J41 A;  4MZC A;  2M80 A;  4KCA A;  1S3A A;  3KP9 A;  3FR9 A;  1YKA A;  2DKH A;  5EL8 A;  1SKW B;  4OFT A;  3DML A;  1PKZ A;  2YN1 A;  4YQU A;  1SJI A;  3FMW A;  3RPP A;  2VCT A;  2XHF A;  1OC8 A;  3O3T A;  4WET A;  2JZS A;  2DML A;  2A4V A;  3ZML A;  1PSQ A;  4AJ8 A;  2JAC A;  3A3T A;  2HNL A;  2WJU A;  3D5J A;  6GSS A;  1EP7 A;  3IE3 A;  2PU9 C;  4LA1 A;  3G7I A;  3TKS E;  4F0B A;  1A2M A;  2HZF A;  3SWL A;  2VL2 C;  4OO4 A;  1R5P A;  3LEF A;  4V2L A;  3UMA A;  2J9H A;  3GTU A;  3GL5 A;  4Z7X A;  2C0E A;  3IRA A;  2B1L A;  1X9M B;  1XWK A;  5GZZ B;  3C1S A;  3MNG A;  3KD0 A;  4A5P A;  1AIU A;  1U3I A;  3IHG A;  2GZP A;  4MJB A;  5CRG A;  3HVS A;  5HR0 A;  5HFG A;  2C3T A;  2PN8 A;  1BQ7 A;  1S3C A;  3UBK A;  5A5K A;  3VPT A;  5INY A;  5BMU A;  4JR6 A;  4K2D A;  2EIR A;  4XS4 B;  1XOA A;  3IAS 2;  1NW2 A;  3P90 A;  4ZBA A;  1NHO A;  2MYG A;  4KF9 A;  4RUV A;  1PRX A;  5IO0 A;  4ECC A;  2X64 A;  5KN2 A;  3F0I A;  4K5S A;  4FO5 A;  1CQH A;  2G0F A;  4E8H A;  1G7E A;  3ZFL A;  2WUL A;  3WGE A;  5A4W A;  4MH3 A;  2C0D A;  2EC4 A;  1GL8 A;  3KTL A;  5EY6 A;  5C00 A;  3BOA A;  3DIE A;  4O5Q A;  4QQ7 A;  1GRX A;  4TVE A;  4PQ1 A;  3VWW A;  2FHE A;  3ZLP A;  2GSQ A;  1XW9 A;  2R3X A;  2YV7 A;  1GTI A;  2FWE A;  3EIN A;  1PFO A;  4KA0 A;  5ECI B;  3H93 A;  4BL7 B;  4EO3 A;  3GV1 A;  5IM9 A;  3NOF A;  2LJK A;  2C3N A;  1EWX A;  5LCZ A;  3P7X A;  4ZB9 A;  3BBY A;  4XIH A;  3CRT A;  4P3Y B;  1MDI A;  4RQX A;  1RQM A;  5CNW A;  1TTZ A;  2R2J A;  2K9F A;  3EC3 A;  5DJM A;  3DGQ A;  4POM A;  3CSI A;  3A2W A;  2QC7 A;  3VWV A;  4IN0 A;  3G7J A;  3UVT A;  4MK3 A;  2ES7 A;  4G0K A;  2DMM A;  3PH9 A;  5G1L A;  3D0Z A;  1S3R A;  1TW9 A;  4NMU A;  3D4M A;  2G2Q A;  3QD9 A;  3ZTL A;  3CSH A;  2IFQ B;  4HJM A;  4V1A g;  2H76 A;  3TJF A;  1YF1 A;  3HXS A;  1ACV A;  1NSW A;  1UN2 A;  3IC4 A;  5FT3 A;  4YAV A;  1TDI A;  3Q18 A;  2OBK A;  1OC9 A;  2TIR A;  2AYT A;  2LRN A;  4NXI A;  4OD7 A;  3KM6 A;  5ECH B;  2VOC A;  1XPV A;  3FZA A;  1K0O A;  2KP1 A;  3CTG A;  5EPF A;  3RDW A;  4GQC A;  1ZCP A;  4WBJ A;  2PUK C;  1YKC A;  3KZQ A;  1MDJ A;  1M9B A;  2M46 A;  2CV4 A;  4GQF A;  1GP1 A;  4MJA A;  1ZYE A;  2EIO A;  1AQX A;  1PN0 A;  2E2G A;  3F4T A;  5GSS A;  1R4W A;  5F06 A;  1FAA A;  3ED3 A;  3QAV A;  1QMV A;  3RHC A;  5ELA A;  2H74 A;  8GSS A;  3PPU A;  4GCI A;  1HQO A;  2K18 A;  4X0X A;  3GUR A;  3ZRD A;  4PQH A;  2YWM A;  2QKE A;  4HEA 2;  4XRD A;  4OO5 A;  1EOG A;  3G7Y A;  4ECB A;  1GUL A;  2WS2 A;  2F9S A;  2DJ1 A;  3TGZ A;  2H30 A;  1F37 A;  1V9W A;  4IVF A;  3UL3 A;  5LD0 A;  4K2X A;  2N5A A;  4IS0 A;  17GS A;  3LFL A;  1PN9 A;  1GNW A;  1GH2 A;  2CAI A;  1X5D A;  3LXT A;  3QDN A;  3R2Q A;  4LMW A;  2LKU A;  5LNK e;  1HNB A;  3WT1 A;  4TXO B;  4BIK A;  4TR0 A;  1GSF A;  2GQL A;  5B8A A;  1FOV A;  4ACS A;  1DE2 A;  4JBB A;  2P31 A;  2B5Y A;  3GIX A;  1OC3 A;  1K3Y A;  3H1N A;  2C0F A;  4V2N A;  5ECN B;  1GTU A;  4ZIJ A;  3DD3 A;  1GNE A;  4X4J A;  1EZK A;  4N30 A;  4YQV A;  2LTK A;  3IPZ A;  4AGS A;  4AJ6 A;  1MTC A;  1SL0 B;  1SK2 A;  3FR3 A;  1MDK A;  2GGT A;  3QPM A;  1GUK A;  4L0U A;  5B7C A;  3MAK A;  4TXO A;  3DVX A;  3FZ9 A;  4POL A;  2X8H A;  3IV4 A;  3WGD A;  1JZR A;  1NHY A;  4GSS A;  1LU4 A;  1T1V A;  5GST A;  2JSZ A;  4HDE A;  5DVB A;  1EV4 A;  2YCD A;  3IHQ A;  1KNG A;  3IDV A;  1V2A A;  4Z2U A;  3IC8 A;  4ZIL A;  5JCW A;  1BAY A;  2HRN A;  4J56 E;  1G6W A;  2NPB A;  5CAX A;  6GSY A;  2H01 A;  3LOR A;  4POB A;  4GWR A;  2CQ9 A;  1A8L A;  1TI1 A;  2R6K A;  1LJR A;  3GN3 A;  2R0G A;  4FYB A;  4FH8 A;  4YKG A;  2R4V A;  4JED A;  4AJ7 A;  1JFU A;  3HA9 A;  3QR6 A;  2FUG 2;  5JWO B;  3QAG A;  3KMO A;  2QA1 A;  4MCU A;  2VO4 A;  3MIX A;  2NTO A;  2B3S A;  4EF0 A;  2YJH A;  2VLU A;  1A2L A;  5IIZ A;  3GX8 A;  2DJ2 A;  4IGJ A;  5HR2 A;  2B5E A;  3TKP A;  1X5E A;  5IMF A;  1J08 A;  2JAD A;  1QQ2 A;  3HZ8 A;  1USB A;  1Z7R A;  4ID0 A;  4K6X A;  4WXT A;  2H19 A;  1X5C A;  5DAL A;  4N0V A;  1A0R P;  1ERT A;  1GSQ A;  4K9Z A;  1OKT A;  1PA3 A;  2WCI A;  5G5F A;  3U6V A;  4TN8 A;  3HVX A;  2X8C A;  3HKR A;  2FCH A;  3H8Q A;  2QGV A;  2XBI A;  1ON4 A;  2GZY A;  1QK8 A;  2MMZ A;  4IKH A;  2PBJ A;  1J9B A;  2IJY A;  3WD6 A;  3CMI A;  1YQ1 A;  2O8V B;  1X9S B;  1EGO A;  3TB2 A;  3APO A;  3CXG A;  3UEM A;  1V57 A;  4NHW A;  4K8M A;  2WB9 A;  3H4K A;  2E2M A;  4H86 A;  3CRU A;  1ML6 A;  3M9J A;  5HFI A;  1JHB A;  2HRA A;  4MF6 A;  2JL4 A;  2H1G A;  3FZ4 A;  2VCZ A;  2GQK A;  3MYD A;  1O85 A;  5AGY A;  3IK9 A;  4K0N A;  4NV5 A;  2CVK A;  2BTO T;  3TRQ A;  3L78 A;  3QAW A;  1A24 A;  4XCS A;  4LMV A;  4WEY A;  1E6B A;  4KAE A;  3O76 A;  2GDR A;  4YAP A;  1PGT A;  1SEN A;  3Q6O A;  1M3I A;  5D96 A;  2H70 A;  5COH A;  5IMA A;  3CYN A;  1IYH A;  4TR3 A;  3VWU A;  4JZQ A;  2B1K A;  4ECI A;  3ERW A;  2KOK A;  5DJL A;  4CHS A;  2DC5 A;  2VL9 A;  1SD8 A;  4I6X A;  4YH2 A;  4JRR A;  2CZ2 A;  3E0U A;  4ULX A;  1AW9 A;  4V1A p;  3EMX A;  2ON5 A;  2P0G A;  3FHK A;  1TU8 A;  1XXU A;  4QL9 A;  3EUR A;  1K0B A;  4XRA A;  2MZC A;  1A2J A;  5HFK A;  4CW9 A;  2L5O A;  4OCF A;  3VFI A;  4I2U A;  4WKW A;  5DQY A;  3TRX A;  2YP6 A;  1XOB A;  1B8X A;  4D73 B;  3APS A;  1W4V A;  3GNJ A;  1QXH A;  4DVC A;  3DEX A;  1TU7 A;  5CRD A;  5DAK A;  1WP0 A;  2PVO C;  2I4A A;  3FKF A;  1PKW A;  2OE1 A;  1SYX A;  3I9V 2;  1GUH A;  2CAQ A;  3TCO A;  2WFC A;  4LL4 B;  3D22 A;  5JCG A;  5GAN D;  1E2Y A;  3O6T A;  1GLQ A;  2HT9 A;  4ZXG A;  3US3 A;  3HJM A;  1JLW A;  5KN1 A;  4TXV A;  5IOW A;  2CVD A;  2RII A;  3C7M A;  2VM1 A;  4BPY A;  5F05 A;  2R0C A;  3DKS A;  2HSH A;  4QL7 A;  4L5L A;  3ZFB A;  4G10 A;  1TOF A;  4V2M A;  2PWJ A;  2LNS A;  2JSY A;  2IME A;  5KEJ A;  2V6O A;  2XPE A;  2HFD A;  3M3M A;  4K7O A;  4Z2R A;  2DLX A;  3RAZ A;  4ILF A;  2TRX A;  4MAB A;  4GRF A;  2R5G A;  3WYW A;  4N11 A;  1F3A A;  3IXR A;  2DBC A;  2XC2 A;  3GH6 A;  4CDO A;  4WBR D;  1V40 A;  3PIN A;  4G2E A;  2VLV A;  2OBI A;  3MSZ A;  1A23 A;  2H75 A;  4OFM A;  4XS4 A;  1Q98 A;  2F51 A;  2NBS A;  3UJ1 A;  2OJL A;  1TI3 A;  3LSZ A;  1EOH A;  2DSA A;  5IMC A;  3HVN A;  1THX A;  3HY2 A;  3APQ A;  1PMT A;  1B9Y C;  2L6C A;  2X4A A;  2GSR A;  7GSS A;  3QOU A;  1EEM A;  4G0L A;  4HQZ A;  4J57 E;  3FRC A;  4TR1 B;  3KIJ A;  2PMT A;  3KP8 A;  1M99 A;  1QUW A;  2V6K A;  1ZMA A;  4TRX A;  1WMJ A;  3I43 A;  2Z9S A;  5D8I A;  4GST A;  4EKZ A;  1TJD A;  2F8F A;  3F4S A;  2X99 A;  4X1U A;  4BL7 A;  2YZU A;  2FA8 A;  3BCI A;  1R26 A;  2YAN A;  1FVK A;  3L4N A;  2RUF A;  3TKS C;  1O73 A;  3GMF A;  4FYC A;  1AUC A;  5KOW A;  2DKI A;  1K0M A;  2LRT A;  5HR1 A;  5F8B A;  3HZ4 A;  2CX3 A;  1A8Y A;  2YJ7 A;  1M7T A;  4K7N A;  4MJC A;  1W89 A;  3GA4 A;  4I5Q A;  4MPF A;  2FA4 A;  2IMK A;  4ZBD A;  2UZ8 A;  1AQW A;  4ZB6 A;  5JWQ B;  2H6X A;  2AV4 A;  3FYG A;  2H0I A;  2IFQ A;  3WT2 A;  4WR5 A;  3TDG A;  1BJX A;  2LEG A;  1CQG A;  1K0N A;  3LYP A;  1N2A A;  3EE2 A;  1EV9 A;  4O5U A;  2IPA A;  1TK8 B;  2X8G A;  3ERF A;  3ISO A;  1GSS A;  6GSV A;  2CX4 A;  1RK4 A;  3W8J A;  3ZIT A;  4KCE A;  2BJX A;  4EUY A;  3F6D A;  1EP8 A;  4PQI A;  2ON7 A;  3J7Y b;  2L59 A;  4JU5 A;  1T4Y A;  1YF0 A;  2L5L A;  3MDK A;  2DIZ A;  1Y6E A;  5DDL A;  4BVX B;  2FNO A;  1FOH A;  4BA7 A;  3GKX A;  2H1A A;  1AC1 A;  3Q19 A;  2LJA A;  1KTE A;  1ZOF A;  2GTU A;  2LJR A;  3HYP A;  4EXJ A;  5IPH A;  1WE0 A;  1IYI A;  4F82 A;  3VI5 A;  5AIS A;  2ZUP A;  3EPT A;  3F63 A;  2A2R A;  3GX0 A;  2C1Y A;  1KEB A;  1GLP A;  3KCM A;  2V32 A;  1PD2 1;  4LLR A;  4BVX A;  5L71 A;  4PGT A;  4HJ2 A;  4PUR A;  1SJZ A;  3LYK A;  1GSY A;  4YQM A;  5ECK B;  4FQU A;  1Z7P A;  2MMO A;  5BRT A;  2C8U A;  4KUN A;  3GYK A;  4YKF A;  5DCG A;  1GTA A;  3KGK A;  4OCE A;  5D9T A;  5AN1 A;  4HZ2 A;  1XWA A;  2L4Q A;  1K0C A;  1TRW A;  3F3Q A;  3KMN A;  3WGX A;  4PXO A;  3QFA C;  3D4T A;  18GS A;  2I3Y A;  5H5S A;  4MP4 A;  4NAX A;  1XCC A;  2I1U A;  4KGI A;  1DUG A;  2XPD A;  2QA2 A;  2K8S A;  2JZT A;  4K5R A;  2A2P A;  4EDY A;  1YEX A;  3F4R A;  3PR8 A;  3IBH A;  2VL2 A;  2HSM A;  3DXB A;  1B4P A;  1NM3 A;  1Z5Y E;  5AIX A;  1UA5 A;  1V98 A;  1TKD B;  4XS6 A;  2MBT A;  2OAC A;  1Q4J A;  5CRH A;  5ABR A;  4JR4 A;  2PER A;  1XFL A;  2IMF A;  3ZVJ D;  2H1D A;  1O8X A;  1OKD A;  3IAM 2;  5B6N A;  2V41 A;  4TR4 A;  4KH7 A;  2YWN A;  4DEJ A;  2KP2 A;  4WF5 A;  12GS A;  3HJO A;  5ELG A;  5EVO A;  3ZRE A;  2YOI A;  2PGT A;  4CY6 A;  3VWX A;  4EIP A;  1TXX A;  6GSX A;  4CY8 A;  1FB0 A;  1G7O A;  5ECS A;  3KH9 A;  3TOT A;  3TJG A;  4RI6 A;  4XTS A;  4PTS A;  1I9D A;  2H71 A;  4F2I A;  2X49 A;  4O32 A;  5F07 A;  3TUE A;  4IP6 A;  2H72 A;  4G19 A;  3TRP A;  3GFK A;  3HJP A;  3KJY A;  3TOU A;  3F8U A;  5KN3 A;  2H73 A;  4MZB A;  3FK8 A;  5IMD A;  4MPG A;  2HSY A;  5CP1 A;  2IWT A;  2K6V A;  3ERG A;  6GSU A;  4IQ1 A;  4WR4 A;  4BVY B;  4O5R A;  2HE3 A;  2GQM A;  1U87 A;  4KB3 A;  3KH7 A;  1MD3 A;  5G5E A;  4HZ4 A;  2GSS A;  2DJ3 A;  2F3M A;  2H8L A;  2YV9 A;  4ZBB A;  2DJ0 A;  2H6Y A;  1THO A;  3GH9 A;  3UVH A;  3TKQ A;  2IIY A;  2A2S A;  2AAW A;  2FLS A;  3FR6 A;  2LST A;  5ECL B;  1SK0 A;  2HYX A;  1SK1 A;  1TK5 B;  3LW9 A;  4EL1 A;  1M2D A;  1PL1 A;  1URM A;  2ZCT A;  4KDU A;  2H6Z A;  3QMX A;  3ZMK A;  4G0I A;  2LRC A;  1O81 A;  1AQV A;  3D21 A;  5J5N A;  5B8B A;  2GS3 A;  4ZL8 A;  2WRT A;  3AY8 A;  5IQY A;  1M9A A;  5G2Z A;  1G6Y A;  3R3E A;  4IEL A;  2P5Q A;  3VLN A;  3TKR A;  5E4W A;  1WWJ A;  4IP1 A;  13GS A;  2N5B A;  3A2X A;  5JCU A;  1JZO A;  1G0T A;  3GL3 A;  1TRV A;  1ZL9 A;  2PPT A;  3IK7 A;  4LL1 B;  2YWO A;  1ZGN A;  2FWF A;  2DJK A;  1BG5 A;  1XBS A;  1VF2 A;  2IMI A;  3C1R A;  4KE3 A;  1XZO A;  4WF4 A;  3W6G A;  2LNT A;  4PUF C;  2VIM A;  1TRU A;  5IOX A;  1PL2 A;  2OA7 A;  3DYR A;  3HCZ A; 
#chains in the Genus database with same CATH homology
 2RUE A;  1OE7 A;  1XW5 A;  4L5O A;  4Z2T A;  4NHZ A;  2I81 A;  2RM5 A;  3G9B A;  1XWC A;  1WRY A;  2MMA A;  2C0G A;  2LQO A;  3GST A;  1B48 A;  3GTU B;  4HQS A;  4EC0 A;  5IO2 A;  3K8N A;  1K0A A;  2H66 A;  3I69 A;  3QFB C;  3L9U A;  1BED A;  2VD1 A;  4OMV A;  2GST A;  1VF3 A;  3L9S A;  1O8W A;  1ERV A;  2YZH A;  3GRX A;  1XWB A;  2VD0 A;  4ICY A;  5FWG A;  4D73 A;  1ZYQ B;  1ERW A;  5IMV A;  2F8A A;  3DRN A;  4J2F A;  1C72 A;  1BYE A;  1X9W B;  5F0G A;  16GS A;  2C4J A;  2GT5 A;  1B9X C;  2L6D A;  1T7P B;  1QGV A;  1VF1 A;  3L9V A;  5IPG A;  3QCP A;  3LGC A;  5CYY A;  2HI7 A;  2HXK A;  2BMX A;  3F9U A;  4HU9 A;  3LWA A;  2FY6 A;  1WIK A;  4MJE A;  5ECM B;  2VCX A;  4ZL7 A;  2OE3 A;  3FW2 A;  4L8E A;  2WGR A;  5A4V A;  3EMP A;  3LXZ A;  11GS A;  5KOX A;  2M72 A;  20GS A;  3NIV A;  1JLV A;  4ML1 A;  4NWY A;  3TJB A;  4MNN A;  1SL2 B;  1F3B A;  1ERU A;  5ECQ B;  5J4U A;  2LV3 A;  4MZW A;  3IR4 A;  3UOM A;  1O7U A;  3KTB A;  4XS1 A;  4XHM A;  10GS A;  5J9B A;  2LQQ A;  1TRS A;  2O89 A;  3HVV A;  5DQS A;  2P5R A;  1FW1 A;  1ZZY A;  5ENU A;  1F9M A;  3F3R A;  3PGT A;  3JCM L;  2GLR A;  3UBL A;  2YWI A;  3ZIV A;  1M0U A;  3U5R E;  1HD2 A;  3GKK A;  1V58 A;  1U88 A;  1ABA A;  1N8J A;  1K3L A;  4EDZ A;  4HUA A;  2RM6 A;  1Z6M A;  1TP9 A;  3FY7 A;  1Z9H A;  5DBQ A;  4MMM A;  1KBN A;  5ECO B;  1RW1 A;  1F6M C;  2IL3 A;  2B7K A;  2VCQ A;  3EU3 A;  2WDU A;  2A4H A;  2VCV A;  4K1F A;  3NZN A;  2VM2 A;  3EYT A;  1B4Q A;  2B7J A;  5FHI A;  3W8S A;  1K3O A;  1OC9 B;  2HRK A;  4IJ3 A;  2AHE A;  4Q5N A;  1DBY A;  4ML6 A;  1XVW A;  3N5O A;  5GAP D;  4TR1 A;  2VLT A;  4HS1 A;  2J23 A;  5D9W A;  5B6M A;  2O7K A;  3ZIJ A;  3M1G A;  3VI7 A;  1Z6N A;  3UAP A;  3P8W A;  1Y25 A;  1ILO A;  4TKY A;  5H5R A;  2AJQ B;  3I6A A;  4K7I A;  4OWY A;  1EGR A;  1J0F A;  2H0H A;  2HZE B;  1FB6 A;  2V2G A;  1T4Z A;  2CZ3 A;  2NDO A;  1EEJ A;  2DIY A;  2GVP A;  1SD9 A;  5ECP B;  5ID2 B;  4ISD A;  1YJ6 A;  3M9K A;  1PQN A;  1VGL A;  1AAZ A;  2I9H A;  5ECR B;  5D93 A;  2HLS A;  1T00 A;  5D73 A;  5D9V A;  4N10 A;  2R37 A;  1S3D A;  3J7Y k;  1R7H A;  1ST9 A;  3KEB A;  1JZW A;  3ZZX A;  3EWL A;  1YY7 A;  4KSM A;  1WPI A;  2HZE A;  1XIY A;  2H0G A;  5AIV A;  3A5W A;  4JE1 A;  5ID2 A;  3ZL5 A;  1R5A A;  4GF0 A;  3MWH A;  2OKA A;  4IW9 A;  1A0F A;  5DCH A;  4ZL9 A;  5HR3 A;  3VPQ A;  4AF2 A;  5H5Q A;  1ZYP A;  3ZYW A;  4IJI A;  1XVQ A;  2FGX A;  4MA9 A;  3F6F A;  5J3R A;  2JU5 A;  2KLX A;  5HQP A;  2NVL A;  4Q5Q A;  2YNX A;  4OFN A;  1VRS D;  1YEP A;  3V1W A;  3D6I A;  1YDK A;  2FD3 A;  1GSU A;  2O87 A;  1DSB A;  3FZ5 A;  3C73 A;  1M2A A;  1OAZ A;  2QSI A;  4GLT A;  3P2A A;  5E59 A;  4G9H A;  4GXZ A;  5J9C A;  1XWG A;  1MD4 A;  2IMD A;  2E7P A;  3C71 A;  3DWV A;  1SU9 A;  5CRW A;  3VUR A;  3GUS A;  4KDY A;  4PX1 A;  2GT6 A;  4MDC A;  2ALB A;  4TW5 A;  19GS A;  3RBT A;  2WZ9 A;  2LS5 A;  4KSO A;  2E0Q A;  4IHU A;  5CRE A;  4DSS B;  4F03 A;  2HRF A;  4L0W A;  1GSE A;  1LBK A;  1I5G A;  2CVB A;  5A4U A;  2VAF A;  4KND A;  3GSS A;  2LUS A;  4IBP A;  2C3Q A;  3ME7 A;  4NV2 A;  3GKM A;  1AXD A;  1FVJ A;  1X0R A;  4TOP A;  1GSD A;  1GUM A;  3HHV A;  4PUA A;  4PNG A;  2MMN A;  1MEK A;  1SKR B;  4USS A;  3BCK A;  4E8E A;  4NPB A;  1SL1 B;  2N5F A;  2REM A;  3LQ7 A;  3KXO A;  4DSS A;  4FYU A;  4O7H A;  4K0G A;  5DAL B;  4RQR A;  3GHA A;  3A5I A;  1T3B A;  1JZD A;  4HU7 A;  3S9F A;  3GKN A;  3IOS A;  3UIW A;  2R0P A;  4EE0 A;  1HNA A;  1WJK A;  2TRC P;  3BJ5 A;  1HYU A;  4O92 A;  1F2E A;  1M2B A;  3ME8 A;  1SYR A;  2B6M A;  3RPN A;  3SBC A;  4N0Z A;  2C80 A;  3LG6 A;  4Q5F A;  3LJR A;  2YPM A;  1FG4 A;  2AUV A;  9GSS A;  1ZYN A;  2OE0 A;  2V1M A;  3EVI A;  2B5X A;  4EVM A;  1DE1 A;  1BX9 A;  3VK9 A;  1FO5 A;  1H4O A;  4POK A;  4DSQ A;  1H75 A;  5G1K A;  3TJJ A;  22GS A;  4EIQ A;  4F9Z A;  2JZR A;  4IQA A;  2FWG A;  2EIQ A;  1YZX A;  4BWQ A;  3C8E A;  2CT6 A;  4F0C A;  3CSJ A;  3IA1 A;  5G31 A;  4X43 A;  3CTF A;  4Q5R A;  4GSN A;  2VCW A;  4I97 A;  4ZB8 A;  1UC7 A;  4KX4 A;  3CBU A;  1SJ6 A;  4MH2 A;  5D9X A;  4KW6 A;  2AB6 A;  3E3E A;  3H79 A;  4PNF A;  3M8N A;  2L57 A;  4MF5 A;  3RHB A;  4BVY A;  1VF4 A;  5KN0 A;  3TJK A;  2VUP A;  2IN3 A;  3ZVJ A;  2D2Z A;  3HDC A;  2KHP A;  4GTU A;  1T8E B;  1PX7 A;  5CO3 A;  6GSW A;  1UVZ A;  4HI7 A;  6GST A;  3DVW A;  2GZZ A;  1SKS B;  2DJJ A;  3TKS A;  3L0H A;  14GS A;  2KUC A;  2O85 A;  2XBQ A;  2CA8 A;  2L4C A;  1GTB A;  1WOU A;  2ZNM A;  1U6T A;  3HD5 A;  1OVN A;  5JWR B;  1TK0 B;  4MF7 A;  1PX6 A;  2PVQ A;  4RI7 A;  3EU4 A;  2OAD A;  1OE8 A;  4FIW A;  5G30 A;  3OR5 A;  3BD2 A;  4ECJ A;  1GWC A;  4MLY A;  3UAR A;  3N9J A;  5C04 A;  3Q74 A;  1K0D A;  4HOJ A;  2K8V A;  5DAK B;  2VL3 A;  5IMZ A;  4DSR A;  2FWH A;  3FEU A;  1FHE A;  1Z3E A;  3A2V A;  1OYJ A;  4I8B A;  1QFN A;  1HNC A;  4KDX A;  1O6J A;  4BWS A;  3M0F A;  4I2T A;  2H1B A;  2RLI A;  3E9J B;  1U3A A;  2MBS A;  1XW6 A;  5J41 A;  4MZC A;  2M80 A;  4KCA A;  1S3A A;  3KP9 A;  3FR9 A;  1YKA A;  2DKH A;  5EL8 A;  1SKW B;  4OFT A;  3DML A;  1PKZ A;  2YN1 A;  4YQU A;  1SJI A;  3FMW A;  3RPP A;  2VCT A;  2XHF A;  1OC8 A;  3O3T A;  4WET A;  2JZS A;  2DML A;  2A4V A;  3ZML A;  1PSQ A;  4AJ8 A;  2JAC A;  3A3T A;  2HNL A;  2WJU A;  3D5J A;  6GSS A;  1EP7 A;  3IE3 A;  2PU9 C;  4LA1 A;  3G7I A;  3TKS E;  4F0B A;  1A2M A;  2HZF A;  3SWL A;  2VL2 C;  4OO4 A;  1R5P A;  3LEF A;  4V2L A;  3UMA A;  2J9H A;  3GTU A;  3GL5 A;  4Z7X A;  2C0E A;  3IRA A;  2B1L A;  1X9M B;  1XWK A;  5GZZ B;  3C1S A;  3MNG A;  3KD0 A;  4A5P A;  1AIU A;  1U3I A;  3IHG A;  2GZP A;  4MJB A;  5CRG A;  3HVS A;  5HR0 A;  5HFG A;  2C3T A;  2PN8 A;  1BQ7 A;  1S3C A;  3UBK A;  5A5K A;  3VPT A;  5INY A;  5BMU A;  4JR6 A;  4K2D A;  2EIR A;  4XS4 B;  1XOA A;  3IAS 2;  1NW2 A;  3P90 A;  4ZBA A;  1NHO A;  2MYG A;  4KF9 A;  4RUV A;  1PRX A;  5IO0 A;  4ECC A;  2X64 A;  5KN2 A;  3F0I A;  4K5S A;  4FO5 A;  1CQH A;  2G0F A;  4E8H A;  1G7E A;  3ZFL A;  2WUL A;  3WGE A;  5A4W A;  4MH3 A;  2C0D A;  2EC4 A;  1GL8 A;  3KTL A;  5EY6 A;  5C00 A;  3BOA A;  3DIE A;  4O5Q A;  4QQ7 A;  1GRX A;  4TVE A;  4PQ1 A;  3VWW A;  2FHE A;  3ZLP A;  2GSQ A;  1XW9 A;  2R3X A;  2YV7 A;  1GTI A;  2FWE A;  3EIN A;  4KA0 A;  5ECI B;  3H93 A;  4BL7 B;  4EO3 A;  3GV1 A;  5IM9 A;  3NOF A;  2LJK A;  2C3N A;  1EWX A;  5LCZ A;  3P7X A;  4ZB9 A;  3BBY A;  4XIH A;  3CRT A;  4P3Y B;  1MDI A;  4RQX A;  1RQM A;  5CNW A;  1TTZ A;  2R2J A;  2K9F A;  3EC3 A;  5DJM A;  3DGQ A;  4POM A;  3CSI A;  3A2W A;  2QC7 A;  3VWV A;  4IN0 A;  3G7J A;  3UVT A;  4MK3 A;  2ES7 A;  4G0K A;  2DMM A;  3PH9 A;  5G1L A;  3D0Z A;  1TW9 A;  4NMU A;  3D4M A;  2G2Q A;  3QD9 A;  3ZTL A;  3CSH A;  2IFQ B;  4HJM A;  4V1A g;  2H76 A;  3TJF A;  1YF1 A;  3HXS A;  1ACV A;  1NSW A;  1UN2 A;  3IC4 A;  5FT3 A;  4YAV A;  1TDI A;  3Q18 A;  2OBK A;  1OC9 A;  2TIR A;  2AYT A;  2LRN A;  4NXI A;  4OD7 A;  3KM6 A;  5ECH B;  2VOC A;  1XPV A;  3FZA A;  1K0O A;  2KP1 A;  3CTG A;  5EPF A;  3RDW A;  4GQC A;  1ZCP A;  4WBJ A;  2PUK C;  1YKC A;  3KZQ A;  1MDJ A;  1M9B A;  2M46 A;  2CV4 A;  4GQF A;  1GP1 A;  4MJA A;  1ZYE A;  2EIO A;  1AQX A;  1PN0 A;  2E2G A;  3F4T A;  5GSS A;  1R4W A;  5F06 A;  1FAA A;  3ED3 A;  3QAV A;  1QMV A;  3RHC A;  5ELA A;  2H74 A;  8GSS A;  3PPU A;  4GCI A;  1HQO A;  2K18 A;  4X0X A;  3GUR A;  3ZRD A;  4PQH A;  2YWM A;  2QKE A;  4HEA 2;  4XRD A;  4OO5 A;  1EOG A;  3G7Y A;  4ECB A;  1GUL A;  2WS2 A;  2F9S A;  2DJ1 A;  3TGZ A;  2H30 A;  1F37 A;  1V9W A;  4IVF A;  3UL3 A;  5LD0 A;  4K2X A;  2N5A A;  4IS0 A;  17GS A;  3LFL A;  1PN9 A;  1GNW A;  1GH2 A;  2CAI A;  1X5D A;  3LXT A;  3QDN A;  3R2Q A;  4LMW A;  2LKU A;  5LNK e;  1HNB A;  3WT1 A;  4TXO B;  4TR0 A;  1GSF A;  2GQL A;  5B8A A;  1FOV A;  4ACS A;  1DE2 A;  4JBB A;  2P31 A;  2B5Y A;  3GIX A;  1OC3 A;  1K3Y A;  3H1N A;  2C0F A;  4V2N A;  5ECN B;  1GTU A;  4ZIJ A;  3DD3 A;  1GNE A;  4X4J A;  1EZK A;  4N30 A;  4YQV A;  2LTK A;  3IPZ A;  4AGS A;  4AJ6 A;  1MTC A;  1SL0 B;  1SK2 A;  3FR3 A;  1MDK A;  2GGT A;  3QPM A;  1GUK A;  4L0U A;  5B7C A;  3MAK A;  4TXO A;  3DVX A;  3FZ9 A;  4POL A;  2X8H A;  3IV4 A;  3WGD A;  1JZR A;  1NHY A;  4GSS A;  1LU4 A;  1T1V A;  5GST A;  2JSZ A;  4HDE A;  5DVB A;  1EV4 A;  2YCD A;  3IHQ A;  1KNG A;  3IDV A;  1V2A A;  4Z2U A;  3IC8 A;  4ZIL A;  5JCW A;  1BAY A;  2HRN A;  4J56 E;  1G6W A;  2NPB A;  5CAX A;  6GSY A;  2H01 A;  3LOR A;  4POB A;  4GWR A;  2CQ9 A;  1A8L A;  1TI1 A;  2R6K A;  1LJR A;  3GN3 A;  2R0G A;  4FYB A;  4FH8 A;  4YKG A;  2R4V A;  4JED A;  4AJ7 A;  1JFU A;  3HA9 A;  3QR6 A;  2FUG 2;  5JWO B;  3QAG A;  3KMO A;  2QA1 A;  4MCU A;  2VO4 A;  3MIX A;  2NTO A;  2B3S A;  4EF0 A;  2YJH A;  2VLU A;  1A2L A;  5IIZ A;  3GX8 A;  2DJ2 A;  4IGJ A;  5HR2 A;  2B5E A;  3TKP A;  1X5E A;  5IMF A;  1J08 A;  2JAD A;  1QQ2 A;  3HZ8 A;  1USB A;  1Z7R A;  4ID0 A;  4K6X A;  4WXT A;  2H19 A;  1X5C A;  5DAL A;  4N0V A;  1A0R P;  1ERT A;  1GSQ A;  4K9Z A;  1OKT A;  1PA3 A;  2WCI A;  5G5F A;  3U6V A;  4TN8 A;  3HVX A;  2X8C A;  3HKR A;  2FCH A;  3H8Q A;  2QGV A;  2XBI A;  1ON4 A;  2GZY A;  1QK8 A;  2MMZ A;  4IKH A;  2PBJ A;  1J9B A;  2IJY A;  3WD6 A;  3CMI A;  1YQ1 A;  2O8V B;  1X9S B;  1EGO A;  3TB2 A;  3APO A;  3CXG A;  3UEM A;  1V57 A;  4NHW A;  4K8M A;  2WB9 A;  3H4K A;  2E2M A;  4H86 A;  3CRU A;  1ML6 A;  3M9J A;  5HFI A;  1JHB A;  2HRA A;  4MF6 A;  2JL4 A;  2H1G A;  3FZ4 A;  2VCZ A;  2GQK A;  3MYD A;  1O85 A;  5AGY A;  3IK9 A;  4K0N A;  4NV5 A;  2CVK A;  2BTO T;  3TRQ A;  3L78 A;  3QAW A;  1A24 A;  4XCS A;  4LMV A;  4WEY A;  1E6B A;  4KAE A;  3O76 A;  2GDR A;  4YAP A;  1PGT A;  1SEN A;  3Q6O A;  5D96 A;  2H70 A;  5COH A;  5IMA A;  3CYN A;  1IYH A;  4TR3 A;  3VWU A;  4JZQ A;  2B1K A;  4ECI A;  3ERW A;  2KOK A;  5DJL A;  4CHS A;  2DC5 A;  2VL9 A;  1SD8 A;  4I6X A;  4YH2 A;  4JRR A;  2CZ2 A;  3E0U A;  4ULX A;  1AW9 A;  4V1A p;  3EMX A;  2ON5 A;  2P0G A;  3FHK A;  1TU8 A;  1XXU A;  4QL9 A;  3EUR A;  1K0B A;  4XRA A;  2MZC A;  1A2J A;  5HFK A;  4CW9 A;  2L5O A;  4OCF A;  3VFI A;  4I2U A;  4WKW A;  5DQY A;  3TRX A;  2YP6 A;  1XOB A;  1B8X A;  4D73 B;  3APS A;  1W4V A;  3GNJ A;  1QXH A;  4DVC A;  3DEX A;  1TU7 A;  5CRD A;  5DAK A;  1WP0 A;  2PVO C;  2I4A A;  3FKF A;  1PKW A;  2OE1 A;  1SYX A;  3I9V 2;  1GUH A;  2CAQ A;  3TCO A;  2WFC A;  4LL4 B;  3D22 A;  5JCG A;  5GAN D;  1E2Y A;  3O6T A;  1GLQ A;  2HT9 A;  4ZXG A;  3US3 A;  3HJM A;  1JLW A;  5KN1 A;  4TXV A;  5IOW A;  2CVD A;  2RII A;  3C7M A;  2VM1 A;  4BPY A;  5F05 A;  2R0C A;  3DKS A;  2HSH A;  4QL7 A;  4L5L A;  3ZFB A;  4G10 A;  1TOF A;  4V2M A;  2PWJ A;  2LNS A;  2JSY A;  2IME A;  5KEJ A;  2V6O A;  2XPE A;  2HFD A;  3M3M A;  4K7O A;  4Z2R A;  2DLX A;  3RAZ A;  4ILF A;  2TRX A;  4MAB A;  4GRF A;  2R5G A;  3WYW A;  4N11 A;  1F3A A;  3IXR A;  2DBC A;  2XC2 A;  3GH6 A;  4CDO A;  4WBR D;  1V40 A;  3PIN A;  4G2E A;  2VLV A;  2OBI A;  3MSZ A;  1A23 A;  2H75 A;  4OFM A;  4XS4 A;  1Q98 A;  2F51 A;  2NBS A;  3UJ1 A;  2OJL A;  1TI3 A;  3LSZ A;  1EOH A;  2DSA A;  5IMC A;  1THX A;  3HY2 A;  3APQ A;  1PMT A;  1B9Y C;  2L6C A;  2X4A A;  2GSR A;  7GSS A;  3QOU A;  1EEM A;  4G0L A;  4HQZ A;  4J57 E;  3FRC A;  4TR1 B;  3KIJ A;  2PMT A;  3KP8 A;  1M99 A;  1QUW A;  2V6K A;  1ZMA A;  4TRX A;  1WMJ A;  3I43 A;  2Z9S A;  5D8I A;  4GST A;  4EKZ A;  1TJD A;  2F8F A;  3F4S A;  2X99 A;  4X1U A;  4BL7 A;  2YZU A;  2FA8 A;  3BCI A;  1R26 A;  2YAN A;  1FVK A;  3L4N A;  2RUF A;  3TKS C;  1O73 A;  3GMF A;  4FYC A;  1AUC A;  5KOW A;  2DKI A;  1K0M A;  2LRT A;  5HR1 A;  5F8B A;  3HZ4 A;  2CX3 A;  1A8Y A;  2YJ7 A;  1M7T A;  4K7N A;  4MJC A;  1W89 A;  3GA4 A;  4I5Q A;  4MPF A;  2FA4 A;  2IMK A;  4ZBD A;  2UZ8 A;  1AQW A;  4ZB6 A;  5JWQ B;  2H6X A;  2AV4 A;  3FYG A;  2H0I A;  2IFQ A;  3WT2 A;  4WR5 A;  3TDG A;  1BJX A;  2LEG A;  1CQG A;  1K0N A;  3LYP A;  1N2A A;  3EE2 A;  1EV9 A;  4O5U A;  2IPA A;  1TK8 B;  2X8G A;  3ERF A;  3ISO A;  1GSS A;  6GSV A;  2CX4 A;  1RK4 A;  3W8J A;  3ZIT A;  4KCE A;  2BJX A;  4EUY A;  3F6D A;  1EP8 A;  4PQI A;  2ON7 A;  3J7Y b;  2L59 A;  4JU5 A;  1T4Y A;  1YF0 A;  2L5L A;  3MDK A;  2DIZ A;  1Y6E A;  5DDL A;  4BVX B;  2FNO A;  1FOH A;  4BA7 A;  3GKX A;  2H1A A;  1AC1 A;  3Q19 A;  2LJA A;  1KTE A;  1ZOF A;  2GTU A;  2LJR A;  3HYP A;  4EXJ A;  5IPH A;  1WE0 A;  1IYI A;  4F82 A;  3VI5 A;  5AIS A;  2ZUP A;  3EPT A;  3F63 A;  2A2R A;  3GX0 A;  2C1Y A;  1KEB A;  1GLP A;  3KCM A;  2V32 A;  1PD2 1;  4LLR A;  4BVX A;  5L71 A;  4PGT A;  4HJ2 A;  4PUR A;  1SJZ A;  3LYK A;  1GSY A;  4YQM A;  5ECK B;  4FQU A;  1Z7P A;  2MMO A;  5BRT A;  2C8U A;  4KUN A;  3GYK A;  4YKF A;  5DCG A;  1GTA A;  3KGK A;  4OCE A;  5D9T A;  5AN1 A;  4HZ2 A;  1XWA A;  2L4Q A;  1K0C A;  1TRW A;  3F3Q A;  3KMN A;  3WGX A;  4PXO A;  3QFA C;  3D4T A;  18GS A;  2I3Y A;  5H5S A;  4MP4 A;  4NAX A;  1XCC A;  2I1U A;  4KGI A;  1DUG A;  2XPD A;  2QA2 A;  2K8S A;  2JZT A;  4K5R A;  2A2P A;  4EDY A;  1YEX A;  3F4R A;  3PR8 A;  3IBH A;  2VL2 A;  2HSM A;  3DXB A;  1B4P A;  1NM3 A;  1Z5Y E;  5AIX A;  1UA5 A;  1V98 A;  1TKD B;  4XS6 A;  2MBT A;  2OAC A;  1Q4J A;  5CRH A;  5ABR A;  4JR4 A;  2PER A;  1XFL A;  2IMF A;  3ZVJ D;  2H1D A;  1O8X A;  1OKD A;  3IAM 2;  5B6N A;  2V41 A;  4TR4 A;  4KH7 A;  2YWN A;  4DEJ A;  2KP2 A;  4WF5 A;  12GS A;  3HJO A;  5ELG A;  5EVO A;  3ZRE A;  2YOI A;  2PGT A;  4CY6 A;  3VWX A;  4EIP A;  1TXX A;  6GSX A;  4CY8 A;  1FB0 A;  1G7O A;  5ECS A;  3KH9 A;  3TOT A;  3TJG A;  4RI6 A;  4XTS A;  4PTS A;  1I9D A;  2H71 A;  4F2I A;  2X49 A;  4O32 A;  5F07 A;  3TUE A;  4IP6 A;  2H72 A;  4G19 A;  3TRP A;  3GFK A;  3HJP A;  3KJY A;  3TOU A;  3F8U A;  5KN3 A;  2H73 A;  4MZB A;  3FK8 A;  5IMD A;  4MPG A;  2HSY A;  5CP1 A;  2IWT A;  2K6V A;  3ERG A;  6GSU A;  4IQ1 A;  4WR4 A;  4BVY B;  4O5R A;  2HE3 A;  2GQM A;  1U87 A;  4KB3 A;  3KH7 A;  1MD3 A;  5G5E A;  4HZ4 A;  2GSS A;  2DJ3 A;  2F3M A;  2H8L A;  2YV9 A;  4ZBB A;  2DJ0 A;  2H6Y A;  1THO A;  3GH9 A;  3UVH A;  3TKQ A;  2IIY A;  2A2S A;  2AAW A;  2FLS A;  3FR6 A;  2LST A;  5ECL B;  1SK0 A;  2HYX A;  1SK1 A;  1TK5 B;  3LW9 A;  4EL1 A;  1M2D A;  1PL1 A;  1URM A;  2ZCT A;  4KDU A;  2H6Z A;  3QMX A;  3ZMK A;  4G0I A;  2LRC A;  1O81 A;  1AQV A;  3D21 A;  5J5N A;  5B8B A;  2GS3 A;  4ZL8 A;  2WRT A;  3AY8 A;  5IQY A;  1M9A A;  5G2Z A;  1G6Y A;  3R3E A;  4IEL A;  2P5Q A;  3VLN A;  3TKR A;  5E4W A;  1WWJ A;  4IP1 A;  13GS A;  2N5B A;  3A2X A;  5JCU A;  1JZO A;  1G0T A;  3GL3 A;  1TRV A;  1ZL9 A;  2PPT A;  3IK7 A;  4LL1 B;  2YWO A;  1ZGN A;  2FWF A;  2DJK A;  1BG5 A;  1XBS A;  1VF2 A;  2IMI A;  3C1R A;  4KE3 A;  1XZO A;  4WF4 A;  3W6G A;  2LNT A;  4PUF C;  2VIM A;  1TRU A;  5IOX A;  1PL2 A;  2OA7 A;  3DYR A;  3HCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...