3TJJA

Crystal structure of human peroxiredoxin iv c245a mutant in sulfenylated form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
167
structure length
166
Chain Sequence
LSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-4
publication title Crystal Structure of Reduced and of Oxidized Peroxiredoxin IV Enzyme Reveals a Stable Oxidized Decamer and a Non-disulfide-bonded Intermediate in the Catalytic Cycle.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 59
structure length 166
sequence length 167
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tjjA00
1QMVA 4POMA 4WKWA 1TW9A 2FNOA 2ON7A 3U6VA 4F2IA 1X9WB 3GL5A 3ZFBA 1JLWA 1A0RP 1BG5A 5EPFA 5ABRA 4XS1A 1TRUA 1DBYA 1YQ1A 1YF0A 6GSTA 5CRHA 2HZFA 2WULA 1Z3EA 4CDOA 5FHIA 2H1DA 5AISA 1TKDB 3HY2A 4YH2A 5DJLA 2E2GA 3VWUA 2HZEA 1T3BA 1SJZA 3RHBA 2NPBA 3HZ8A 5DAKB 4HZ4A 1O8WA 1CQHA 4IELA 1PX7A 3PH9A 3DGQA 1QGVA 1R5AA 3ED3A 3LEFA 2RUFA 1UN2A 2YPMA 4RI6A 3Q6OA 3ZTLA 1O73A 5ECOB 2H70A 3GA4A 4IQ1A 22GSA 2BJXA 5JWRB 2VD1A 3GL3A 1XW5A 2C4JA 2V2GA 2ZNMA 1GTBA 1Z5YE 4FYCA 3J7Yk 5J41A 3LXTA 5AIXA 1A0FA 1AQVA 2X8CA 2X64A 5AN1A 4LLRA 1GTAA 3O76A 3ZMLA 3QPMA 4HS1A 4GXZA 1XXUA 3H4KA 2IMIA 1LJRA 1TP9A 1GNWA 2CA8A 3FR6A 4MK3A 3ZITA 4TR3A 3Q19A 2M46A 1BAYA 4WETA 2H0GA 2JL4A 1F9MA 1GNEA 1X9MB 3UOMA 4XRDA 1TI3A 3D22A 2IWTA 4MZCA 2MBTA 1V57A 3CYNA 2QKEA 4EXJA 1TXXA 5G31A 3PINA 5A4VA 1MD4A 4NPBA 2HZEB 5IOWA 4HZ2A 2H74A 3EYTA 1RW1A 1A8YA 4EC0A 4KGIA 4NMUA 4GSTA 2H66A 4PGTA 1FB6A 4OWYA 3WGDA 2PGTA 3ZLPA 1AC1A 5F07A 3EU3A 3KMNA 3LSZA 3QCPA 1WRYA 2HXKA 1K3OA 4PXOA 4TN8A 2DSAA 4KA0A 2LQOA 3VI7A 6GSVA 2H1AA 2J9HA 3Q18A 3BOAA 4WR5A 3KGKA 2GDRA 3A2WA 2O8VB 4FH8A 3LYKA 5GSSA 2FWGA 4ZBDA 4ZXGA 4MMMA 3KMOA 4K9ZA 3MWHA 1EWXA 4BWSA 3L0HA 2L5LA 4KE3A 2XBIA 2B5YA 4ISDA 2GT5A 3FK8A 4IJ3A 2LRCA 2LQQA 3IOSA 4IS0A 5GZZB 2XBQA 1AAZA 4WR4A 4XS6A 4I6XA 2N5FA 2YJHA 3O3TA 5D9XA 1FHEA 1K0OA 3E3EA 2GGTA 5ENUA 4TR4A 5IQYA 2YWNA 1ZCPA 3IK7A 2ON5A 2H19A 4TXOB 4MH3A 3M9JA 3AY8A 3LJRA 4NXIA 5IM9A 2PPTA 1BX9A 3F4SA 3DRNA 4ML6A 4TR1A 3TKQA 2H30A 2X8HA 3CSIA 4I8BA 2GZZA 1EOGA 4XCSA 3VPTA 4N30A 4PQ1A 4HJ2A 2MMOA 2I9HA 2VL9A 3CMIA 5G5EA 5CO3A 4AGSA 1DUGA 2F51A 4ULXA 4YAPA 6GSWA 4IW9A 3I69A 2R6KA 5D9TA 2HT9A 2H01A 2J23A 4O7HA 3QFBC 2FWFA 2X8GA 2H0HA 4K7OA 3EMPA 3KXOA 2HFDA 4P3YB 1R5PA 3QMXA 1AIUA 4POLA 2YNXA 2VOCA 4H86A 4L8EA 1N8JA 3KH9A 2REMA 2YV9A 2GSTA 1KNGA 2N5BA 2EC4A 2L57A 3KJYA 5E4WA 1PA3A 1GUKA 1QFNA 1XBSA 1V2AA 2ES7A 5H5SA 1G6YA 4J57E 19GSA 2LTKA 1JZOA 4LL4B 5ECQB 5JWOB 3F0IA 2M72A 4JU5A 4XIHA 1ON4A 3TOUA 1NM3A 3LORA 1XVQA 4D73A 3GV1A 2TRXA 3QAVA 1AQXA 2AYTA 1G0TA 1Z9HA 3HKRA 1M2DA 2DJ3A 1SK0A 3TKSA 3TOTA 4NHWA 2IL3A 3NIVA 4MP4A 1TRWA 2EIQA 4TR1B 1HNAA 1A2MA 3DYRA 2A2RA 4DSRA 1FVKA 3GKKA 1VGLA 3G7IA 3DVWA 5D9WA 2VCWA 4MZBA 5ELGA 2FWHA 1GL8A 2GSSA 4OMVA 4PUFC 3TRPA 4X43A 2VLTA 6GSXA 4TKYA 4IGJA 3QD9A 5B7CA 1TK8B 3IPZA 3VLNA 2GZYA 2VM2A 2C8UA 3WGEA 3UMAA 2VL2A 1ERTA 1EV4A 2DC5A 3NOFA 3IDVA 3LWAA 1V9WA 2VO4A 1S3AA 2VCZA 5A4WA 4ZBAA 3FKFA 4WBRD 5G2ZA 1CQGA 3L9VA 1TU8A 4K8MA 2CZ3A 5D8IA 4ACSA 4KAEA 4GQCA 2PVQA 3NZNA 1MD3A 1EOHA 3KTBA 1TJDA 4F0BA 1NSWA 4ZB8A 6GSYA 2K18A 2L6CA 4O92A 1J08A 1K0NA 1EEMA 4YQVA 1K0BA 3WT1A 1K3LA 1EP8A 3HDCA 2FD3A 4D73B 4FO5A 4GLTA 5ECSA 4RQXA 2V1MA 2LJRA 3KD0A 2OA7A 5HFKA 3HA9A 3VWWA 2RM5A 4GSSA 5IOXA 3TDGA 2V41A 1M9AA 4E8EA 1TK5B 1MTCA 4RQRA 2FCHA 3F6DA 2E7PA 5CNWA 1QXHA 5B8AA 4WXTA 2B5EA 4V2MA 4N11A 4DSSA 3TKSC 4IP6A 3VPQA 4V2NA 4K0NA 3GH9A 4GRFA 4I2TA 3F8UA 4OCFA 2BTOT 2XPEA 5IMVA 1B4QA 3ZRDA 1S3CA 4XHMA 6GSUA 2WS2A 4OO5A 4PUAA 3IE3A 4PNFA 5IO0A 5KN2A 2VM1A 4AF2A 4HU9A 1G6WA 3LGCA 3CRTA 3GKXA 1GSDA 4MF5A 3FZAA 4MA9A 2L4CA 4MPGA 3ZFLA 5HR2A 2HLSA 5IMAA 3CRUA 1WMJA 3P8WA 3JCML 2FUG2 2IFQA 2PBJA 4Q5RA 2VL2C 4BPYA 3I9V2 4MJAA 4TR0A 4KX4A 18GSA 1U6TA 2I81A 1HNCA 3ZL5A 1SKRB 1MDJA 2CAQA 1F3AA 1SD8A 3CSJA 1SKSB 4E8HA 1PKZA 4HDEA 4TVEA 5HFGA 2PVOC 3APSA 1FVJA 2AB6A 3IV4A 4PQHA 3LYPA 1XWKA 1IYIA 3CTGA 2JSYA 2HRFA 3HJPA 1XOBA 4ECBA 1S3DA 4LMVA 4OFMA 4QL7A 1ML6A 3FEUA 5KN0A 4WF5A 4IBPA 3F9UA 5LCZA 5DBQA 4DSSB 4JR4A 4NHZA 2H72A 1T4ZA 1EEJA 1OC3A 2G0FA 5H5RA 4WBJA 5DCGA 4XRAA 1C72A 5D96A 1PL2A 3G7YA 2C0EA 3R2QA 4IJIA 2MMZA 3GIXA 3FHKA 1FW1A 4YQUA 3GX0A 1KBNA 2FA8A 3FZ4A 1GRXA 2YZUA 1OKTA 2X99A 1GULA 1OE8A 1TRSA 3PR8A 1WOUA 3KEBA 1X5DA 3HD5A 3BCIA 3IRAA 1K0MA 1ZYQB 2IFQB 5ECRB 7GSSA 2VIMA 3G9BA 3N5OA 2PWJA 4WF4A 3D21A 4HU7A 5GAPD 3IAM2 4MJEA 4NAXA 1H4OA 4WEYA 1G7OA 4OO4A 1O81A 3QR6A 2B7JA 4F03A 1BEDA 3Q74A 2VCVA 1FG4A 1U3IA 4HEA2 3KIJA 4ZB6A 3M1GA 2DJ1A 4LMWA 5IMZA 3APQA 1OVNA 2DBCA 1GSFA 2H6YA 1Y25A 4EDYA 3KP9A 2LNSA 1RQMA 3IK9A 3UBKA 3C1SA 3F6FA 5G1LA 3TJGA 1A2LA 2AUVA 5HR1A 1Z7PA 2WZ9A 2JU5A 3IXRA 3ZVJD 4L0UA 4JE1A 2C3TA 1M2AA 4TW5A 3SBCA 4GQFA 1M99A 2C3NA 1URMA 2LKUA 5JCGA 3VFIA 1HQOA 4L0WA 1V58A 1KEBA 3TJKA 1XW6A 4GF0A 1HD2A 1F6MC 4J2FA 5G5FA 1SK2A 1RK4A 3TKSE 2C3QA 5KN1A 2LJKA 2FGXA 3GTUA 1UVZA 4MABA 4KUNA 4I2UA 4EVMA 1PMTA 5A4UA 3C1RA 2ZUPA 3DKSA 1HYUA 5INYA 4NV2A 3TJJA 1LU4A 2B1KA 5ECHB 1V40A 5B6MA 4ZBBA 1ZZYA 3GKMA 2YZHA 3GHAA 9GSSA 2CX4A 1TOFA 3HHVA 1O85A 3ISOA 1F3BA 4JRRA 5ECKB 1Y6EA 2E0QA 3K8NA 4HUAA 1K3YA 2OACA 1XIYA 4CW9A 1EZKA 2PUKC 1XVWA 4KB3A 8GSSA 3GRXA 3CSHA 1GUHA 3H1NA 4K1FA 2A4VA 4XS4A 1F2EA 3HVXA 3FR3A 5DDLA 3ZYWA 1M9BA 1J0FA 3EWLA 5HR0A 3LQ7A 3HJOA 2FY6A 1YF1A 3ERWA 2VAFA 5IPHA 2L5OA 2WJUA 2YWMA 1GSUA 1A23A 2YWOA 4GTUA 4G10A 1SK1A 2VLUA 2OE3A 2R2JA 5COHA 4Q5FA 1PQNA 3A2VA 1XW9A 2L6DA 4EKZA 4KCAA 5J9BA 1ZYEA 3H93A 3H79A 3TKPA 1PL1A 4KDYA 5CAXA 4OD7A 2NBSA 3TCOA 5HQPA 3RBTA 3GTUB 3LXZA 2FA4A 2B6MA 1T4YA 3KZQA 1XWCA 2HI7A 4ILFA 4NWYA 3BCKA 4BVXA 2AHEA 4HI7A 2FHEA 1VF2A 3DMLA 5D73A 3D4TA 4IP1A 4L5OA 2G2QA 3FZ5A 3ME7A 1DSBA 1Q98A 3HZ4A 5EL8A 2WRTA 3DVXA 3HVVA 5IMCA 5B8BA 3EC3A 2VLVA 5F0GA 2K6VA 2IMDA 1GSYA 1K0CA 5EVOA 3W8JA 4O5RA 3A3TA 10GSA 3O6TA 1XPVA 2ZCTA 3QOUA 2H1BA 2C80A 2CX3A 2KHPA 2QGVA 4XS4B 16GSA 1H75A 2VCTA 3TKRA 5ID2A 2V6KA 3H8QA 3HVSA 3MAKA 3KH7A 2KUCA 3QAWA 3DEXA 2IMFA 1TU7A 4F9ZA 2LEGA 4Z7XA 3APOA 4QQ7A 5IMFA 2JZRA 3CTFA 2K8SA 3V1WA 4KDXA 3L9UA 1OYJA 3F63A 3KP8A 3L9SA 1PN9A 3EMXA 1NW2A 5DQSA 3GKNA 1YJ6A 2O85A 1ST9A 2WFCA 1XWBA 2AV4A 2MZCA 2LRNA 2VD0A 5CRWA 2A2SA 5H5QA 2DJ0A 3TJFA 4MF7A 4JBBA 2LV3A 2E2MA 1J9BA 3WYWA 3KM6A 1XCCA 3F3QA 3ZIJA 3IR4A 5JWQB 1T1VA 5B6NA 2RUEA 5CYYA 1SKWB 2AJQB 4MLYA 2NDOA 3RPPA 5DVBA 2H75A 2O87A 4G2EA 1QK8A 4PQIA 1K0DA 5HR3A 1SD9A 5AGYA 3L4NA 5FWGA 2YWIA 1TK0B 1WE0A 3UEMA 2KOKA 3N9JA 3MSZA 3CXGA 5ECNB 1ERUA 2HRNA 1Z7RA 1A2JA 4DSQA 1T00A 4N0VA 1JHBA 1EV9A 3ME8A 2WDUA 5CP1A 2P0GA 5CRGA 3QFAC 4K0GA 1SYXA 4POKA 5AIVA 1ZL9A 3GH6A 1YZXA 1XZOA 4LL1B 3GYKA 2IMEA 3P2AA 4NV5A 1O6JA 2M80A 2R3XA 1JZDA 4XTSA 1FAAA 1I9DA 1GTUA 3EURA 2LUSA 1GTIA 3ZVJA 5J9CA 1YKAA 2HSYA 4KNDA 2I3YA 2CVDA 1R7HA 4ZL7A 4AJ7A 2LS5A 1GLPA 2R37A 4K7IA 2C0DA 3HXSA 4ZIJA 1ABAA 1BJXA 1YEPA 4HQZA 3DD3A 2RLIA 1ZOFA 2R4VA 2N5AA 2DMLA 2B1LA 1F37A 5GSTA 2EIOA 2YP6A 3GX8A 4X0XA 3L78A 1NHOA 2B5XA 1JFUA 1GP1A 2CAIA 4GWRA 4KW6A 1VF4A 3GNJA 2IIYA 1R4WA 1YKCA 5DCHA 1U3AA 2NTOA 1Q4JA 3TUEA 1B8XA 3UIWA 1XWGA 1PKWA 2XHFA 1GSSA 1U88A 2O7KA 5C00A 3KTLA 1BQ7A 3M9KA 2I4AA 5JCWA 1MEKA 3GFKA 4O32A 3F3RA 4OCEA 3IHQA 1GUMA 4L5LA 2YN1A 2KLXA 2OJLA 2YANA 5LD0A 5J4UA 4EO3A 4BVYA 5ECIB 1SENA 3MNGA 4IQAA 4HQSA 1E6BA 4G9HA 3GSTA 2YJ7A 3P7XA 4I97A 2GSRA 5LNKe 4IKHA 3D6IA 2F8FA 2OBKA 1EGRA 1B9YC 1XWAA 1OE7A 1X9SB 3P90A 5F06A 4JEDA 2WCIA 3EVIA 4Q5NA 1AW9A 2HYXA 1AUCA 4N0ZA 2CV4A 2VCXA 1SYRA 3GUSA 4GSNA 1PGTA 1FB0A 1TTZA 2PMTA 2JZTA 2V6OA 3PGTA 1T7PB 2C0GA 2DJKA 1K0AA 2CZ2A 1OC8A 3WT2A 1B4PA 1WIKA 3VWVA 2DMMA 3GSSA 2XC2A 14GSA 4DVCA 1IYHA 5KN3A 1I5GA 4PX1A 5JCUA 20GSA 2JSZA 4K7NA 3KCMA 5ECMB 2B7KA 4IN0A 2K9FA 13GSA 1N2AA 1LBKA 2LJAA 4V2LA 1UC7A 2QC7A 1DE1A 5F8BA 1YY7A 4X1UA 1ACVA 4TXOA 2IPAA 5DALA 4EL1A 4MJBA 2DLXA 3BJ5A 4ECIA 4DEJA 2H6ZA 2GSQA 3U5RE 4ECCA 4CHSA 3IA1A 1FOVA 1GWCA 1SU9A 2K8VA 2P31A 3UBLA 2MBSA 3E9JB 1SJ6A 2VL3A 3HJMA 2L59A 1NHYA 6GSSA 2OADA 3UVHA 5IPGA 3C8EA 1PRXA 1WWJA 2LSTA 1M0UA 4IVFA 2KP1A 3ZMKA 3ERFA 4POBA 1BYEA 1M7TA 3MDKA 3I6AA 3BD2A 5J5NA 1MDIA 3RDWA 1DE2A 2GQMA 1JZRA 1USBA 1E2YA 4YQMA 3ZREA 2LRTA 4MPFA 3US3A 1EP7A 2FWEA 1A8LA 2GTUA 3RHCA 1GSEA 3BBYA 12GSA 3FW2A 3IBHA 3FY7A 2L4QA 2MYGA 4JR6A 1W89A 4MZWA 1THXA 4KDUA 1ERWA 4ID0A 4N10A 1OAZA 3EINA 4TRXA 2RM6A 2AAWA 3TB2A 4KCEA 4V1Ap 4I5QA 4TOPA 3WD6A 2KP2A 2JZSA 3UJ1A 2P5RA 2TIRA 2PERA 2YCDA 2EIRA 4J56E 4BL7A 4ZL9A 4MH2A 3G7JA 1AQWA 5FT3A 4MJCA 1O7UA 1VF3A 4K2DA 3C73A 2BMXA 5DALB 1B9XC 3ZZXA 2GLRA 1SJIA 1ERVA 2GT6A 1SL0B 2B3SA 2IN3A 5G1KA 2DJJA 2HE3A 3GMFA 4EUYA 4FIWA 2HNLA 4TXVA 4OFNA 2GS3A 5G30A 3ZIVA 3VURA 5EY6A 4OFTA 3F4TA 2IJYA 4FYUA 2C0FA 2H76A 2CT6A 4ZB9A 3FRCA 1M2BA 3FR9A 5IMDA 1U87A 4ML1A 1TRVA 3M3MA 2MMAA 4RUVA 2Z9SA 3TGZA 1OC9A 3SWLA 2QSIA 2GZPA 1KTEA 1T8EB 5E59A 3UARA 4G19A 2OE1A 1Z6NA 2OE0A 1VF1A 5J3RA 2OKAA 5A5KA 3QDNA 4GCIA 4IHUA 2OBIA 3D0ZA 4BWQA 1MDKA 4HJMA 5DJMA 1AXDA 2IMKA 3GN3A 2H8LA 3D5JA 1YDKA 4RI7A 5ECLB 1XFLA 1ZGNA 1JZWA 4F82A 3ERGA 1TDIA 2F9SA 2CVBA 4ZILA 5ECPB 1EGOA 1SL1B 2DIYA 3OR5A 5C04A 3W6GA 4HOJA 5GAND 1X0RA 2F8AA 1W4VA 3IAS2 2WGRA 2YV7A 5ELAA 2DIZA 3DXBA 4MDCA 1PSQA 3FZ9A 3UVTA 1V98A 1G7EA 3TRXA 4FYBA 3TJBA 17GSA 3RAZA 1Z6MA 5D93A 2PN8A 2FLSA 1PX6A 5IIZA 3RPNA 5IO2A 3A2XA 1WJKA 1WP0A 3F4RA 3DIEA 4EE0A 3E0UA 3LG6A 3EU4A 2I1UA 1X5CA 2HSHA 1O8XA 1QQ2A 1WPIA 1JLVA 3VI5A 2C1YA 3QAGA 3M8NA 1GH2A 2VUPA 2RIIA 5HFIA 2NVLA 3HYPA 2GQKA 4PURA 2GQLA 4ZL8A 1OC9B 3LFLA 2WB9A 2LNTA 2CVKA 1B48A 1R26A 2YOIA 2O89A 4Q5QA 3FYGA 2H73A 5KEJA 3D4MA 5D9VA 2H71A 4F0CA 2JACA 3VK9A 3UAPA 3C71A 2F3MA 1THOA 5L71A 1ZMAA 1QUWA 2PU9C 3A5WA 2D2ZA 1YEXA 3HCZA 5ID2B 1TI1A 3S9FA 3CBUA 3DWVA 1FO5A 5DQYA 2MMNA 3C7MA 4MF6A 2P5QA 2H6XA 4K6XA 1PD21 2TRCP 2ALBA 5F05A 2H0IA 3M0FA 4QL9A 4PNGA 3WGXA 2R5GA 5DAKA 4V1Ag 2JADA 4LA1A 1OKDA 3GURA 1XOAA 3IC4A 1SL2B 3UL3A 5CRDA 11GSA 4KH7A 4ECJA 4EDZA 4KSOA 4JZQA 1ILOA 1X5EA 3I43A 4EF0A 2CQ9A 2VCQA 4BA7A 1HNBA 4KSMA 3EE2A 3VWXA 2H1GA 1VRSD 2V32A 4YAVA 3W8SA 1A24A 4AJ8A 2XPDA 5CREA 1UA5A 2GVPA 1GLQA 4MCUA 3TRQA 1GSQA 4AJ6A 2DJ2A 3J7Yb
chains in the Genus database with same CATH superfamily
1QMVA 2X49A 4K5RA 2X4AA 4POMA 4WKWA 1TW9A 2FNOA 2ON7A 3U6VA 4F2IA 4CY8A 1X9WB 3GL5A 3ZFBA 1JLWA 1A0RP 1BG5A 5EPFA 5ABRA 4XS1A 1TRUA 4HSCX 1DBYA 3A5IA 1YQ1A 1YF0A 6GSTA 5CRHA 2HZFA 2WULA 1Z3EA 4CDOA 5FHIA 2H1DA 5AISA 1TKDB 3HY2A 4YH2A 5DJLA 2E2GA 3VWUA 2HZEA 1T3BA 1SJZA 3RHBA 2NPBA 3HZ8A 5DAKB 4HZ4A 1O8WA 1CQHA 4IELA 1PX7A 3PH9A 3DGQA 1QGVA 1R5AA 3ED3A 3LEFA 2RUFA 1UN2A 2YPMA 4RI6A 3Q6OA 3ZTLA 1O73A 5ECOB 2H70A 3GA4A 4IQ1A 22GSA 2BJXA 5JWRB 2VD1A 3GL3A 1XW5A 2C4JA 2V2GA 2ZNMA 1GTBA 1Z5YE 4FYCA 3J7Yk 5J41A 3LXTA 5AIXA 1A0FA 1AQVA 2X8CA 2X64A 5AN1A 4LLRA 1GTAA 3O76A 3ZMLA 3QPMA 4HS1A 4GXZA 1XXUA 3H4KA 2IMIA 1LJRA 1TP9A 1GNWA 2CA8A 3FR6A 4MK3A 3ZITA 4TR3A 3Q19A 2M46A 1BAYA 4WETA 2H0GA 2JL4A 1F9MA 1GNEA 1X9MB 3UOMA 4XRDA 1TI3A 3D22A 4A5PA 2IWTA 4MZCA 2MBTA 1V57A 3CYNA 2QKEA 1ZYNA 4EXJA 1TXXA 5G31A 3PINA 5A4VA 1MD4A 4NPBA 2HZEB 5IOWA 1M3JA 4HZ2A 2H74A 3EYTA 1RW1A 1A8YA 4EC0A 4KGIA 4NMUA 4GSTA 2H66A 4PGTA 1FB6A 4OWYA 3WGDA 2PGTA 3ZLPA 1AC1A 5F07A 3EU3A 3KMNA 2R0GA 3LSZA 3QCPA 1WRYA 2HXKA 1K3OA 4PXOA 4TN8A 2DSAA 4KA0A 2LQOA 3VI7A 6GSVA 2H1AA 2J9HA 3Q18A 3BOAA 4WR5A 3KGKA 2GDRA 3A2WA 4G0LA 2O8VB 4FH8A 3LYKA 5GSSA 2FWGA 4ZBDA 4ZXGA 4X4JA 4MMMA 3KMOA 4K9ZA 3MWHA 1EWXA 4BWSA 3L0HA 2L5LA 4KE3A 2XBIA 2B5YA 4ISDA 2GT5A 3FK8A 4IJ3A 2LRCA 2LQQA 3IOSA 4IS0A 5GZZB 2XBQA 1AAZA 4WR4A 4XS6A 4I6XA 2N5FA 2YJHA 3O3TA 5D9XA 1FHEA 1K0OA 3E3EA 3MIXA 2GGTA 5ENUA 4TR4A 5IQYA 3LW9A 2YWNA 1ZCPA 3IK7A 2ON5A 2H19A 4TXOB 4MH3A 3M9JA 3AY8A 3LJRA 4NXIA 5IM9A 2PPTA 1BX9A 3F4SA 3DRNA 4ML6A 4TR1A 3TKQA 2H30A 2X8HA 3CSIA 1PFOA 2UZ8A 4I8BA 2GZZA 1EOGA 3R3EA 4XCSA 3VPTA 4N30A 4PQ1A 4HJ2A 2MMOA 2I9HA 2VL9A 3CMIA 5G5EA 4Z2RA 5CO3A 4AGSA 1DUGA 2F51A 4ULXA 4YAPA 6GSWA 4IW9A 3I69A 2R6KA 5D9TA 2HT9A 2H01A 2J23A 4O7HA 3QFBC 2FWFA 2X8GA 2H0HA 4K7OA 3EMPA 3KXOA 2HFDA 4P3YB 1R5PA 3QMXA 1AIUA 3PPUA 4POLA 2YNXA 2VOCA 4H86A 4L8EA 1N8JA 3KH9A 2REMA 2YV9A 2GSTA 1KNGA 2N5BA 2EC4A 2L57A 3KJYA 5E4WA 1PA3A 1GUKA 1QFNA 1XBSA 1V2AA 2ES7A 5H5SA 1G6YA 4J57E 19GSA 2LTKA 1JZOA 4LL4B 5ECQB 5JWOB 3F0IA 4EIQA 2M72A 4JU5A 4XIHA 1ON4A 3TOUA 1NM3A 3LORA 1XVQA 4D73A 3GV1A 2TRXA 4YKGA 3QAVA 1AQXA 2AYTA 1G0TA 1Z9HA 3HKRA 1M2DA 2DJ3A 1SK0A 3TKSA 3TOTA 4NHWA 2IL3A 3NIVA 4MP4A 1TRWA 2EIQA 4TR1B 1HNAA 1A2MA 3DYRA 2A2RA 4DSRA 1FVKA 3GKKA 1VGLA 3G7IA 3DVWA 5D9WA 2VCWA 4MZBA 5ELGA 2FWHA 1GL8A 2GSSA 4OMVA 4PUFC 3TRPA 4X43A 2VLTA 6GSXA 4TKYA 4IGJA 3QD9A 5B7CA 1TK8B 3IPZA 3VLNA 2GZYA 2VM2A 2C8UA 3WGEA 3UMAA 2VL2A 1ERTA 1EV4A 2DC5A 3NOFA 3IDVA 2R0PA 3LWAA 1V9WA 2VO4A 1S3AA 2VCZA 5A4WA 4ZBAA 3FKFA 4WBRD 5G2ZA 1CQGA 3L9VA 1TU8A 4K8MA 2CZ3A 5D8IA 4ACSA 4KAEA 4GQCA 2PVQA 3NZNA 1MD3A 1EOHA 3KTBA 1TJDA 4F0BA 1NSWA 4ZB8A 6GSYA 2K18A 2L6CA 4O92A 1J08A 1K0NA 1EEMA 4YQVA 1K0BA 3WT1A 1K3LA 1EP8A 3HDCA 2FD3A 4D73B 4FO5A 4GLTA 5ECSA 4RQXA 2V1MA 2LJRA 3KD0A 2OA7A 5HFKA 3HA9A 3VWWA 2RM5A 4GSSA 5IOXA 3TDGA 2V41A 1M9AA 4E8EA 1TK5B 1MTCA 4RQRA 2FCHA 3F6DA 2E7PA 5CNWA 1QXHA 5B8AA 4WXTA 2B5EA 4V2MA 4N11A 4DSSA 3TKSC 4IP6A 3VPQA 4V2NA 4K0NA 3GH9A 4GRFA 4I2TA 3F8UA 4OCFA 2BTOT 2XPEA 5IMVA 1B4QA 3ZRDA 1S3CA 4XHMA 6GSUA 2WS2A 4OO5A 4PUAA 3IE3A 4PNFA 5IO0A 5KN2A 2VM1A 4AF2A 4HU9A 1G6WA 3LGCA 3CRTA 3GKXA 1GSDA 4MF5A 3FZAA 4MA9A 2L4CA 4MPGA 3ZFLA 5HR2A 2HLSA 5IMAA 3CRUA 1WMJA 3P8WA 3JCML 2FUG2 2IFQA 2PBJA 4Q5RA 2VL2C 4BPYA 3I9V2 4MJAA 4TR0A 4KX4A 18GSA 1U6TA 2I81A 1HNCA 3ZL5A 1SKRB 1MDJA 2CAQA 1F3AA 1SD8A 3CSJA 1SKSB 4E8HA 1PKZA 4HDEA 4TVEA 5HFGA 2PVOC 3APSA 1FVJA 2AB6A 3IV4A 4PQHA 3LYPA 1XWKA 1IYIA 3CTGA 2A4HA 2JSYA 2HRFA 3HJPA 1XOBA 4ECBA 1S3DA 4LMVA 4OFMA 4QL7A 1ML6A 3FEUA 5KN0A 4WF5A 4IBPA 3F9UA 5LCZA 5DBQA 4DSSB 4JR4A 4NHZA 2H72A 1T4ZA 1EEJA 1OC3A 2G0FA 5H5RA 4WBJA 5DCGA 4XRAA 1C72A 5D96A 1PL2A 3G7YA 2C0EA 3R2QA 4IJIA 2MMZA 3GIXA 3FHKA 1FW1A 4YQUA 3GX0A 1KBNA 2FA8A 3FZ4A 4FQUA 1GRXA 2YZUA 1OKTA 2X99A 1GULA 1OE8A 1TRSA 3PR8A 1WOUA 3KEBA 1X5DA 3HD5A 3BCIA 4K2XA 3IRAA 1K0MA 1ZYQB 2IFQB 5ECRB 7GSSA 2VIMA 3G9BA 3N5OA 2PWJA 4WF4A 3D21A 4HU7A 5GAPD 4NAXA 3IAM2 4MJEA 1H4OA 4WEYA 1G7OA 4OO4A 1O81A 3QR6A 2B7JA 4F03A 1BEDA 3Q74A 2VCVA 1FG4A 1U3IA 4HEA2 3KIJA 4ZB6A 3M1GA 2DJ1A 4LMWA 5IMZA 3APQA 1OVNA 2DBCA 1GSFA 2H6YA 1Y25A 4EDYA 3FMWA 3KP9A 2LNSA 1RQMA 3IK9A 3UBKA 3C1SA 3F6FA 5G1LA 3TJGA 1A2LA 2AUVA 5HR1A 1Z7PA 2WZ9A 2JU5A 3IXRA 3IHGA 3ZVJD 4L0UA 4JE1A 2C3TA 1M2AA 4TW5A 3SBCA 4GQFA 1M99A 2C3NA 1URMA 2LKUA 5JCGA 3VFIA 1HQOA 4L0WA 1V58A 1KEBA 3TJKA 1XW6A 4GF0A 1HD2A 1F6MC 4J2FA 5G5FA 1SK2A 1RK4A 3TKSE 2C3QA 5KN1A 2LJKA 2FGXA 3GTUA 1UVZA 4MABA 4KUNA 4I2UA 4EVMA 1PMTA 5A4UA 3C1RA 2ZUPA 3DKSA 5BMUA 1HYUA 5INYA 4NV2A 3TJJA 1LU4A 2B1KA 5ECHB 1V40A 5B6MA 4BIKA 4ZBBA 1ZZYA 3GKMA 2YZHA 4KF9A 3GHAA 9GSSA 2CX4A 1TOFA 3HHVA 1O85A 3ISOA 1F3BA 4JRRA 5ECKB 1Y6EA 2E0QA 3K8NA 4HUAA 1K3YA 2OACA 1XIYA 4CW9A 1EZKA 2PUKC 1XVWA 4KB3A 8GSSA 3GRXA 3CSHA 1GUHA 3H1NA 4K1FA 4PTSA 2A4VA 4XS4A 1F2EA 3HVXA 3FR3A 5DDLA 3ZYWA 1M9BA 1J0FA 3EWLA 5HR0A 3LQ7A 3HJOA 2FY6A 1YF1A 3ERWA 2VAFA 5IPHA 2L5OA 2WJUA 2YWMA 1GSUA 1A23A 2YWOA 4GTUA 4G10A 1SK1A 2VLUA 2OE3A 2R2JA 5COHA 4Q5FA 1PQNA 3A2VA 1XW9A 2L6DA 4EKZA 4KCAA 5J9BA 1ZYEA 3H93A 3H79A 3TKPA 1PL1A 4KDYA 5CAXA 4OD7A 2NBSA 3TCOA 5HQPA 3RBTA 3GTUB 3LXZA 2FA4A 2B6MA 1T4YA 3KZQA 1XWCA 2HI7A 4ILFA 4NWYA 3BCKA 4BVXA 2AHEA 4HI7A 2FHEA 1VF2A 3DMLA 5D73A 2HSMA 3D4TA 4IP1A 4L5OA 2G2QA 3FZ5A 3ME7A 1DSBA 2QA1A 1Q98A 3HZ4A 5EL8A 2WRTA 3DVXA 3HVVA 5IMCA 5B8BA 3EC3A 2VLVA 5F0GA 5KOWA 2K6VA 2IMDA 1GSYA 1K0CA 5EVOA 3W8JA 4O5RA 3A3TA 10GSA 2HRKA 3O6TA 1XPVA 2ZCTA 3QOUA 2H1BA 2C80A 2CX3A 2KHPA 2QGVA 4XS4B 16GSA 1H75A 2VCTA 3TKRA 5ID2A 2V6KA 3H8QA 3HVSA 3MAKA 3KH7A 2KUCA 3QAWA 3DEXA 2IMFA 1TU7A 4F9ZA 2LEGA 4Z7XA 5KOXA 3APOA 4QQ7A 5IMFA 2JZRA 3CTFA 2K8SA 3V1WA 4KDXA 3L9UA 1OYJA 3F63A 3KP8A 3L9SA 1PN9A 3EMXA 1NW2A 5DQSA 3GKNA 1YJ6A 2O85A 3IC8A 1ST9A 2WFCA 1XWBA 2AV4A 2MZCA 2LRNA 2VD0A 5CRWA 2A2SA 5H5QA 2DJ0A 3TJFA 4MF7A 4JBBA 2LV3A 2E2MA 1J9BA 3WYWA 3KM6A 1XCCA 3F3QA 3ZIJA 3IR4A 5JWQB 1T1VA 5B6NA 2RUEA 5CYYA 1SKWB 2AJQB 4MLYA 2NDOA 3RPPA 5DVBA 2H75A 2O87A 4G2EA 1QK8A 4PQIA 1K0DA 5HR3A 1SD9A 5AGYA 3L4NA 5FWGA 2YWIA 1TK0B 1WE0A 3UEMA 2KOKA 3N9JA 3MSZA 3CXGA 5ECNB 1ERUA 2HRNA 1Z7RA 1A2JA 4DSQA 1T00A 4N0VA 1JHBA 1EV9A 3ME8A 2WDUA 5CP1A 2P0GA 2R0CA 5CRGA 3QFAC 4K0GA 1SYXA 4POKA 5AIVA 1ZL9A 3GH6A 1YZXA 1XZOA 4LL1B 3GYKA 2IMEA 3P2AA 4NV5A 1O6JA 4K5SA 2M80A 2R3XA 1JZDA 4XTSA 1FAAA 1I9DA 1GTUA 3EURA 2LUSA 1GTIA 3ZVJA 5J9CA 1YKAA 2HSYA 4KNDA 3CQFA 2I3YA 2CVDA 4MNNA 1R7HA 4ZL7A 4AJ7A 2LS5A 1GLPA 2R37A 4K7IA 2DKIA 2C0DA 3HXSA 4ZIJA 1ABAA 1BJXA 1YEPA 4HQZA 3DD3A 2RLIA 1ZOFA 2R4VA 2N5AA 2DMLA 2B1LA 1F37A 5GSTA 2EIOA 2YP6A 3GX8A 4X0XA 3L78A 1NHOA 2B5XA 1JFUA 1GP1A 2CAIA 4GWRA 4KW6A 1VF4A 3GNJA 2IIYA 1R4WA 1YKCA 5DCHA 1U3AA 2NTOA 1Q4JA 3TUEA 1B8XA 3UIWA 1XWGA 1PKWA 2XHFA 1GSSA 1U88A 2O7KA 5C00A 3KTLA 1BQ7A 3M9KA 5BRTA 2I4AA 5JCWA 1MEKA 3GFKA 4O32A 3F3RA 4OCEA 3IHQA 1GUMA 4L5LA 2YN1A 2KLXA 2OJLA 2YANA 5LD0A 5J4UA 4EO3A 4BVYA 5ECIB 1SENA 3MNGA 4IQAA 4HQSA 1E6BA 4G9HA 3GSTA 2YJ7A 3P7XA 4I97A 2GSRA 5LNKe 4IKHA 3D6IA 2F8FA 2OBKA 1EGRA 1B9YC 1XWAA 1OE7A 3HVNA 1X9SB 3P90A 5F06A 1XG8A 4JEDA 2WCIA 3EVIA 4Q5NA 1AW9A 2HYXA 1AUCA 4N0ZA 2CV4A 2VCXA 1SYRA 3GUSA 4GSNA 1PGTA 1FB0A 1TTZA 2PMTA 2JZTA 2V6OA 3PGTA 1T7PB 2C0GA 2DJKA 1K0AA 2CZ2A 1OC8A 3WT2A 1B4PA 1WIKA 1M3IA 3VWVA 2DMMA 3GSSA 2XC2A 14GSA 4DVCA 1IYHA 5KN3A 1I5GA 4PX1A 5JCUA 20GSA 2JSZA 4K7NA 3KCMA 5ECMB 2B7KA 4IN0A 2K9FA 13GSA 1N2AA 1LBKA 2LJAA 4V2LA 1UC7A 2QC7A 1DE1A 5F8BA 1YY7A 4X1UA 1ACVA 4TXOA 2IPAA 5DALA 4EL1A 4MJBA 2DLXA 3BJ5A 4ECIA 4DEJA 2H6ZA 2GSQA 3U5RE 4ECCA 4CHSA 3IA1A 4G0KA 1FOVA 1GWCA 2QA2A 4BVYB 1SU9A 2K8VA 2P31A 3UBLA 2MBSA 1S3RA 3E9JB 1SJ6A 2VL3A 3HJMA 2L59A 1NHYA 6GSSA 2OADA 3UVHA 5IPGA 3C8EA 1PRXA 1WWJA 2LSTA 1M0UA 1FOHA 4IVFA 2KP1A 3ZMKA 3ERFA 4POBA 1BYEA 1M7TA 3MDKA 3I6AA 3BD2A 5J5NA 1MDIA 3RDWA 1DE2A 2GQMA 1JZRA 1USBA 1E2YA 4YQMA 3ZREA 2LRTA 4MPFA 3US3A 1EP7A 2FWEA 1A8LA 2GTUA 3RHCA 1GSEA 3BBYA 12GSA 3FW2A 3IBHA 3FY7A 1PN0A 2L4QA 2MYGA 4JR6A 1W89A 4MZWA 1THXA 4KDUA 1ERWA 4ID0A 4N10A 2HRAA 1OAZA 3EINA 4TRXA 2RM6A 2AAWA 3TB2A 4KCEA 4V1Ap 4I5QA 4TOPA 3WD6A 2KP2A 2JZSA 3UJ1A 2P5RA 2TIRA 2PERA 4G0IA 2YCDA 2EIRA 4J56E 4BL7A 4ZL9A 4MH2A 3G7JA 1AQWA 5FT3A 4MJCA 1ZYPA 1O7UA 1VF3A 4K2DA 3C73A 2BMXA 5DALB 1B9XC 3ZZXA 2GLRA 1SJIA 1ERVA 2GT6A 1SL0B 2B3SA 2IN3A 5G1KA 2DJJA 2HE3A 3GMFA 4EUYA 4FIWA 2HNLA 4TXVA 4OFNA 2GS3A 5G30A 3ZIVA 2A2PA 3VURA 5EY6A 4OFTA 3F4TA 2IJYA 4FYUA 2C0FA 2H76A 2CT6A 4ZB9A 4YKFA 3FRCA 1M2BA 3FR9A 5IMDA 1U87A 4ML1A 4O5UA 1TRVA 3M3MA 2MMAA 4RUVA 2Z9SA 3TGZA 1OC9A 3SWLA 2QSIA 2GZPA 1KTEA 1T8EB 5E59A 3UARA 4G19A 2OE1A 1Z6NA 2OE0A 1VF1A 5J3RA 2OKAA 5A5KA 3QDNA 4GCIA 4IHUA 2OBIA 3D0ZA 4BWQA 1MDKA 4HJMA 5DJMA 1AXDA 2IMKA 3GN3A 2H8LA 3D5JA 1YDKA 4RI7A 5ECLB 1XFLA 1ZGNA 1JZWA 4F82A 3ERGA 1TDIA 2F9SA 2CVBA 4ZILA 5ECPB 1EGOA 1SL1B 2DIYA 3OR5A 5C04A 3W6GA 4HOJA 5GAND 1X0RA 2F8AA 1W4VA 4USSA 3IAS2 2WGRA 2YV7A 5ELAA 2DIZA 3DXBA 4MDCA 2DKHA 1PSQA 3FZ9A 3UVTA 4BL7B 1V98A 1G7EA 3TRXA 4FYBA 4EIPA 3TJBA 17GSA 3RAZA 1Z6MA 5D93A 2PN8A 4ICYA 2FLSA 3MYDA 1PX6A 5IIZA 3RPNA 5IO2A 3A2XA 1WJKA 1WP0A 3F4RA 3DIEA 3EPTA 4EE0A 3E0UA 3LG6A 3EU4A 2I1UA 1X5CA 2HSHA 1O8XA 1QQ2A 4Z2UA 1WPIA 4BVXB 1JLVA 3VI5A 2C1YA 3QAGA 3M8NA 1GH2A 2VUPA 2RIIA 5HFIA 2NVLA 3HYPA 2GQKA 4PURA 2GQLA 4ZL8A 1OC9B 3LFLA 2WB9A 4CY6A 2LNTA 2CVKA 1B48A 1R26A 2YOIA 2O89A 4Q5QA 3FYGA 2H73A 5KEJA 3D4MA 5D9VA 2H71A 4F0CA 2JACA 3VK9A 3UAPA 3C71A 2F3MA 1THOA 5L71A 1ZMAA 1QUWA 2PU9C 3A5WA 2D2ZA 1YEXA 3HCZA 5ID2B 1TI1A 3S9FA 3CBUA 3DWVA 1FO5A 5DQYA 2MMNA 3C7MA 4MF6A 2P5QA 2H6XA 4K6XA 1PD21 2TRCP 2ALBA 5F05A 2H0IA 3M0FA 4QL9A 4PNGA 3WGXA 2R5GA 5DAKA 4V1Ag 2JADA 4LA1A 1OKDA 3GURA 1XOAA 3IC4A 1SL2B 3UL3A 5CRDA 11GSA 4KH7A 4ECJA 4EDZA 4KSOA 4JZQA 1ILOA 1X5EA 3I43A 4EF0A 2CQ9A 4O5QA 2VCQA 4BA7A 1HNBA 4KSMA 3EE2A 3VWXA 2H1GA 1VRSD 2V32A 4YAVA 4Z2TA 3W8SA 1A24A 4AJ8A 2XPDA 5CREA 1UA5A 2GVPA 1GLQA 4MCUA 3TRQA 1GSQA 4AJ6A 2DJ2A 3J7Yb
chains in the Genus database with same CATH topology
1QMVA 2X49A 4K5RA 2X4AA 4POMA 4WKWA 1TW9A 2FNOA 2ON7A 3U6VA 4F2IA 4CY8A 1X9WB 3GL5A 3ZFBA 1JLWA 1A0RP 1BG5A 5EPFA 5ABRA 4XS1A 1TRUA 1DBYA 3A5IA 1YQ1A 1YF0A 6GSTA 5CRHA 2HZFA 2WULA 1Z3EA 4CDOA 5FHIA 2H1DA 5AISA 1TKDB 3HY2A 4YH2A 5DJLA 2E2GA 3VWUA 2HZEA 1T3BA 1SJZA 3RHBA 2NPBA 3HZ8A 5DAKB 4HZ4A 1O8WA 1CQHA 4IELA 1PX7A 3PH9A 3DGQA 1QGVA 1R5AA 3ED3A 3LEFA 2RUFA 1UN2A 2YPMA 4RI6A 3Q6OA 3ZTLA 1O73A 5ECOB 2H70A 3GA4A 4IQ1A 22GSA 2BJXA 5JWRB 2VD1A 3GL3A 1XW5A 2C4JA 2V2GA 2ZNMA 1GTBA 1Z5YE 4FYCA 3J7Yk 5J41A 3LXTA 5AIXA 1A0FA 1AQVA 2X8CA 2X64A 5AN1A 4LLRA 1GTAA 3O76A 3ZMLA 3QPMA 4HS1A 4GXZA 1XXUA 3H4KA 2IMIA 1LJRA 1TP9A 1GNWA 2CA8A 3FR6A 4MK3A 3ZITA 4TR3A 3Q19A 2M46A 1BAYA 4WETA 2H0GA 2JL4A 1F9MA 1GNEA 1X9MB 3UOMA 4XRDA 1TI3A 3D22A 4A5PA 2IWTA 4MZCA 2MBTA 1V57A 3CYNA 2QKEA 1ZYNA 4EXJA 1TXXA 5G31A 3PINA 5A4VA 1MD4A 4NPBA 2HZEB 5IOWA 4HZ2A 2H74A 3EYTA 1RW1A 1A8YA 4EC0A 4KGIA 4NMUA 4GSTA 2H66A 4PGTA 1FB6A 4OWYA 3WGDA 2PGTA 3ZLPA 1AC1A 5F07A 3EU3A 3KMNA 2R0GA 3LSZA 3QCPA 1WRYA 2HXKA 1K3OA 4PXOA 4TN8A 2DSAA 4KA0A 2LQOA 3VI7A 6GSVA 2H1AA 2J9HA 3Q18A 3BOAA 4WR5A 3KGKA 2GDRA 3A2WA 4G0LA 2O8VB 4FH8A 3LYKA 5GSSA 2FWGA 4ZBDA 4ZXGA 4X4JA 4MMMA 3KMOA 4K9ZA 3MWHA 1EWXA 4BWSA 3L0HA 2L5LA 4KE3A 2XBIA 2B5YA 4ISDA 2GT5A 3FK8A 4IJ3A 2LRCA 2LQQA 3IOSA 4IS0A 5GZZB 2XBQA 1AAZA 4WR4A 4XS6A 4I6XA 2N5FA 2YJHA 3O3TA 5D9XA 1FHEA 1K0OA 3E3EA 3MIXA 2GGTA 5ENUA 4TR4A 5IQYA 3LW9A 2YWNA 1ZCPA 3IK7A 2ON5A 2H19A 4TXOB 4MH3A 3M9JA 3AY8A 3LJRA 4NXIA 5IM9A 2PPTA 1BX9A 3F4SA 3DRNA 4ML6A 4TR1A 3TKQA 2H30A 2X8HA 3CSIA 2UZ8A 4I8BA 2GZZA 1EOGA 3R3EA 4XCSA 3VPTA 4N30A 4PQ1A 4HJ2A 2MMOA 2I9HA 2VL9A 3CMIA 5G5EA 4Z2RA 5CO3A 4AGSA 1DUGA 2F51A 4ULXA 4YAPA 6GSWA 4IW9A 3I69A 2R6KA 5D9TA 2HT9A 2H01A 2J23A 4O7HA 3QFBC 2FWFA 2X8GA 2H0HA 4K7OA 3EMPA 3KXOA 2HFDA 4P3YB 1R5PA 3QMXA 1AIUA 3PPUA 4POLA 2YNXA 2VOCA 4H86A 4L8EA 1N8JA 3KH9A 2REMA 2YV9A 2GSTA 1KNGA 2N5BA 2EC4A 2L57A 3KJYA 5E4WA 1PA3A 1GUKA 1QFNA 1XBSA 1V2AA 2ES7A 5H5SA 1G6YA 4J57E 19GSA 2LTKA 1JZOA 4LL4B 5ECQB 5JWOB 3F0IA 4EIQA 2M72A 4JU5A 4XIHA 1ON4A 3TOUA 1NM3A 3LORA 1XVQA 4D73A 3GV1A 2TRXA 4YKGA 3QAVA 1AQXA 2AYTA 1G0TA 1Z9HA 3HKRA 1M2DA 2DJ3A 1SK0A 3TKSA 3TOTA 4NHWA 2IL3A 3NIVA 4MP4A 1TRWA 2EIQA 4TR1B 1HNAA 1A2MA 3DYRA 2A2RA 4DSRA 1FVKA 3GKKA 1VGLA 3G7IA 3DVWA 5D9WA 2VCWA 4MZBA 5ELGA 2FWHA 1GL8A 2GSSA 4OMVA 4PUFC 3TRPA 4X43A 2VLTA 6GSXA 4TKYA 4IGJA 3QD9A 5B7CA 1TK8B 3IPZA 3VLNA 2GZYA 2VM2A 2C8UA 3WGEA 3UMAA 2VL2A 1ERTA 1EV4A 2DC5A 3NOFA 3IDVA 2R0PA 3LWAA 1V9WA 2VO4A 1S3AA 2VCZA 5A4WA 4ZBAA 3FKFA 4WBRD 5G2ZA 1CQGA 3L9VA 1TU8A 4K8MA 2CZ3A 5D8IA 4ACSA 4KAEA 4GQCA 2PVQA 3NZNA 1MD3A 1EOHA 3KTBA 1TJDA 4F0BA 1NSWA 4ZB8A 6GSYA 2K18A 2L6CA 4O92A 1J08A 1K0NA 1EEMA 4YQVA 1K0BA 3WT1A 1K3LA 1EP8A 3HDCA 2FD3A 4D73B 4FO5A 4GLTA 5ECSA 4RQXA 2V1MA 2LJRA 3KD0A 2OA7A 5HFKA 3HA9A 3VWWA 2RM5A 4GSSA 5IOXA 3TDGA 2V41A 1M9AA 4E8EA 1TK5B 1MTCA 4RQRA 2FCHA 3F6DA 2E7PA 5CNWA 1QXHA 5B8AA 4WXTA 2B5EA 4V2MA 4N11A 4DSSA 3TKSC 4IP6A 3VPQA 4V2NA 4K0NA 3GH9A 4GRFA 4I2TA 3F8UA 4OCFA 2BTOT 2XPEA 5IMVA 1B4QA 3ZRDA 1S3CA 4XHMA 6GSUA 2WS2A 4OO5A 4PUAA 3IE3A 4PNFA 5IO0A 5KN2A 2VM1A 4AF2A 4HU9A 1G6WA 3LGCA 3CRTA 3GKXA 1GSDA 4MF5A 3FZAA 4MA9A 2L4CA 4MPGA 3ZFLA 5HR2A 2HLSA 5IMAA 3CRUA 1WMJA 3P8WA 3JCML 2FUG2 2IFQA 2PBJA 4Q5RA 2VL2C 4BPYA 3I9V2 4MJAA 4TR0A 4KX4A 18GSA 1U6TA 2I81A 1HNCA 3ZL5A 1SKRB 1MDJA 2CAQA 1F3AA 1SD8A 3CSJA 1SKSB 4E8HA 1PKZA 4HDEA 4TVEA 5HFGA 2PVOC 3APSA 1FVJA 2AB6A 3IV4A 4PQHA 3LYPA 1XWKA 1IYIA 3CTGA 2A4HA 2JSYA 2HRFA 3HJPA 1XOBA 4ECBA 1S3DA 4LMVA 4OFMA 4QL7A 1ML6A 3FEUA 5KN0A 4WF5A 4IBPA 3F9UA 5LCZA 5DBQA 4DSSB 4JR4A 4NHZA 2H72A 1T4ZA 1EEJA 1OC3A 2G0FA 5H5RA 4WBJA 5DCGA 4XRAA 1C72A 5D96A 1PL2A 3G7YA 2C0EA 3R2QA 4IJIA 2MMZA 3GIXA 3FHKA 1FW1A 4YQUA 3GX0A 1KBNA 2FA8A 3FZ4A 4FQUA 1GRXA 2YZUA 1OKTA 2X99A 1GULA 1OE8A 1TRSA 3PR8A 1WOUA 3KEBA 1X5DA 3HD5A 3BCIA 4K2XA 3IRAA 1K0MA 1ZYQB 2IFQB 5ECRB 7GSSA 2VIMA 3G9BA 3N5OA 2PWJA 4WF4A 3D21A 4HU7A 5GAPD 4NAXA 3IAM2 4MJEA 1H4OA 4WEYA 1G7OA 4OO4A 1O81A 3QR6A 2B7JA 4F03A 1BEDA 3Q74A 2VCVA 1FG4A 1U3IA 4HEA2 3KIJA 4ZB6A 3M1GA 2DJ1A 4LMWA 5IMZA 3APQA 1OVNA 2DBCA 1GSFA 2H6YA 1Y25A 4EDYA 3FMWA 3KP9A 2LNSA 1RQMA 3IK9A 3UBKA 3C1SA 3F6FA 5G1LA 3TJGA 1A2LA 2AUVA 5HR1A 1Z7PA 2WZ9A 2JU5A 3IXRA 3IHGA 3ZVJD 4L0UA 4JE1A 2C3TA 1M2AA 4TW5A 3SBCA 4GQFA 1M99A 2C3NA 1URMA 2LKUA 5JCGA 3VFIA 1HQOA 4L0WA 1V58A 1KEBA 3TJKA 1XW6A 4GF0A 1HD2A 1F6MC 4J2FA 5G5FA 1SK2A 1RK4A 3TKSE 2C3QA 5KN1A 2LJKA 2FGXA 3GTUA 1UVZA 4MABA 4KUNA 4I2UA 4EVMA 1PMTA 5A4UA 3C1RA 2ZUPA 3DKSA 5BMUA 1HYUA 5INYA 4NV2A 3TJJA 1LU4A 2B1KA 5ECHB 1V40A 5B6MA 4ZBBA 1ZZYA 3GKMA 2YZHA 4KF9A 3GHAA 9GSSA 2CX4A 1TOFA 3HHVA 1O85A 3ISOA 1F3BA 4JRRA 5ECKB 1Y6EA 2E0QA 3K8NA 4HUAA 1K3YA 2OACA 1XIYA 4CW9A 1EZKA 2PUKC 1XVWA 4KB3A 8GSSA 3GRXA 3CSHA 1GUHA 3H1NA 4K1FA 4PTSA 2A4VA 4XS4A 1F2EA 3HVXA 3FR3A 5DDLA 3ZYWA 1M9BA 1J0FA 3EWLA 5HR0A 3LQ7A 3HJOA 2FY6A 1YF1A 3ERWA 2VAFA 5IPHA 2L5OA 2WJUA 2YWMA 1GSUA 1A23A 2YWOA 4GTUA 4G10A 1SK1A 2VLUA 2OE3A 2R2JA 5COHA 4Q5FA 1PQNA 3A2VA 1XW9A 2L6DA 4EKZA 4KCAA 5J9BA 1ZYEA 3H93A 3H79A 3TKPA 1PL1A 4KDYA 5CAXA 4OD7A 2NBSA 3TCOA 5HQPA 3RBTA 3GTUB 3LXZA 2FA4A 2B6MA 1T4YA 3KZQA 1XWCA 2HI7A 4ILFA 4NWYA 3BCKA 4BVXA 2AHEA 4HI7A 2FHEA 1VF2A 3DMLA 5D73A 2HSMA 3D4TA 4IP1A 4L5OA 2G2QA 3FZ5A 3ME7A 1DSBA 2QA1A 1Q98A 3HZ4A 5EL8A 2WRTA 3DVXA 3HVVA 5IMCA 5B8BA 3EC3A 2VLVA 5F0GA 5KOWA 2K6VA 2IMDA 1GSYA 1K0CA 5EVOA 3W8JA 4O5RA 3A3TA 10GSA 2HRKA 3O6TA 1XPVA 2ZCTA 3QOUA 2H1BA 2C80A 2CX3A 2KHPA 2QGVA 4XS4B 16GSA 1H75A 2VCTA 3TKRA 5ID2A 2V6KA 3H8QA 3HVSA 3MAKA 3KH7A 2KUCA 3QAWA 3DEXA 2IMFA 1TU7A 4F9ZA 2LEGA 4Z7XA 5KOXA 3APOA 4QQ7A 5IMFA 2JZRA 3CTFA 2K8SA 3V1WA 4KDXA 3L9UA 1OYJA 3F63A 3KP8A 3L9SA 1PN9A 3EMXA 1NW2A 5DQSA 3GKNA 1YJ6A 2O85A 3IC8A 1ST9A 2WFCA 1XWBA 2AV4A 2MZCA 2LRNA 2VD0A 5CRWA 2A2SA 5H5QA 2DJ0A 3TJFA 4MF7A 4JBBA 2LV3A 2E2MA 1J9BA 3WYWA 3KM6A 1XCCA 3F3QA 3ZIJA 3IR4A 5JWQB 1T1VA 5B6NA 2RUEA 5CYYA 1SKWB 2AJQB 4MLYA 2NDOA 3RPPA 5DVBA 2H75A 2O87A 4G2EA 1QK8A 4PQIA 1K0DA 5HR3A 1SD9A 5AGYA 3L4NA 5FWGA 2YWIA 1TK0B 1WE0A 3UEMA 2KOKA 3N9JA 3MSZA 3CXGA 5ECNB 1ERUA 2HRNA 1Z7RA 1A2JA 4DSQA 1T00A 4N0VA 1JHBA 1EV9A 3ME8A 2WDUA 5CP1A 2P0GA 2R0CA 5CRGA 3QFAC 4K0GA 1SYXA 4POKA 5AIVA 1ZL9A 3GH6A 1YZXA 1XZOA 4LL1B 3GYKA 2IMEA 3P2AA 4NV5A 1O6JA 4K5SA 2M80A 2R3XA 1JZDA 4XTSA 1FAAA 1I9DA 1GTUA 3EURA 2LUSA 1GTIA 3ZVJA 5J9CA 1YKAA 2HSYA 4KNDA 2I3YA 2CVDA 4MNNA 1R7HA 4ZL7A 4AJ7A 2LS5A 1GLPA 2R37A 4K7IA 2DKIA 2C0DA 3HXSA 4ZIJA 1ABAA 1BJXA 1YEPA 4HQZA 3DD3A 2RLIA 1ZOFA 2R4VA 2N5AA 2DMLA 2B1LA 1F37A 5GSTA 2EIOA 2YP6A 3GX8A 4X0XA 3L78A 1NHOA 2B5XA 1JFUA 1GP1A 2CAIA 4GWRA 4KW6A 1VF4A 3GNJA 2IIYA 1R4WA 1YKCA 5DCHA 1U3AA 2NTOA 1Q4JA 3TUEA 1B8XA 3UIWA 1XWGA 1PKWA 2XHFA 1GSSA 1U88A 2O7KA 5C00A 3KTLA 1BQ7A 3M9KA 5BRTA 2I4AA 5JCWA 1MEKA 3GFKA 4O32A 3F3RA 4OCEA 3IHQA 1GUMA 4L5LA 2YN1A 2KLXA 2OJLA 2YANA 5LD0A 5J4UA 4EO3A 4BVYA 5ECIB 1SENA 3MNGA 4IQAA 4HQSA 1E6BA 4G9HA 3GSTA 2YJ7A 3P7XA 4I97A 2GSRA 5LNKe 4IKHA 3D6IA 2F8FA 2OBKA 1EGRA 1B9YC 1XWAA 1OE7A 1X9SB 3P90A 5F06A 4JEDA 2WCIA 3EVIA 4Q5NA 1AW9A 2HYXA 1AUCA 4N0ZA 2CV4A 2VCXA 1SYRA 3GUSA 4GSNA 1PGTA 1FB0A 1TTZA 2PMTA 2JZTA 2V6OA 3PGTA 1T7PB 2C0GA 2DJKA 1K0AA 2CZ2A 1OC8A 3WT2A 1B4PA 1WIKA 3VWVA 2DMMA 3GSSA 2XC2A 14GSA 4DVCA 1IYHA 5KN3A 1I5GA 4PX1A 5JCUA 20GSA 2JSZA 4K7NA 3KCMA 5ECMB 2B7KA 4IN0A 2K9FA 13GSA 1N2AA 1LBKA 2LJAA 4V2LA 1UC7A 2QC7A 1DE1A 5F8BA 1YY7A 4X1UA 1ACVA 4TXOA 2IPAA 5DALA 4EL1A 4MJBA 2DLXA 3BJ5A 4ECIA 4DEJA 2H6ZA 2GSQA 3U5RE 4ECCA 4CHSA 3IA1A 4G0KA 1FOVA 1GWCA 2QA2A 4BVYB 1SU9A 2K8VA 2P31A 3UBLA 2MBSA 3E9JB 1SJ6A 2VL3A 3HJMA 2L59A 1NHYA 6GSSA 2OADA 3UVHA 5IPGA 3C8EA 1PRXA 1WWJA 2LSTA 1M0UA 1FOHA 4IVFA 2KP1A 3ZMKA 3ERFA 4POBA 1BYEA 1M7TA 3MDKA 3I6AA 3BD2A 5J5NA 1MDIA 3RDWA 1DE2A 2GQMA 1JZRA 1USBA 1E2YA 4YQMA 3ZREA 2LRTA 4MPFA 3US3A 1EP7A 2FWEA 1A8LA 2GTUA 3RHCA 1GSEA 3BBYA 12GSA 3FW2A 3IBHA 3FY7A 1PN0A 2L4QA 2MYGA 4JR6A 1W89A 4MZWA 1THXA 4KDUA 1ERWA 4ID0A 4N10A 2HRAA 1OAZA 3EINA 4TRXA 2RM6A 2AAWA 3TB2A 4KCEA 4V1Ap 4I5QA 4TOPA 3WD6A 2KP2A 2JZSA 3UJ1A 2P5RA 2TIRA 2PERA 4G0IA 2YCDA 2EIRA 4J56E 4BL7A 4ZL9A 4MH2A 3G7JA 1AQWA 5FT3A 4MJCA 1ZYPA 1O7UA 1VF3A 4K2DA 3C73A 2BMXA 5DALB 1B9XC 3ZZXA 2GLRA 1SJIA 1ERVA 2GT6A 1SL0B 2B3SA 2IN3A 5G1KA 2DJJA 2HE3A 3GMFA 4EUYA 4FIWA 2HNLA 4TXVA 4OFNA 2GS3A 5G30A 3ZIVA 2A2PA 3VURA 5EY6A 4OFTA 3F4TA 2IJYA 4FYUA 2C0FA 2H76A 2CT6A 4ZB9A 4YKFA 3FRCA 1M2BA 3FR9A 5IMDA 1U87A 4ML1A 4O5UA 1TRVA 3M3MA 2MMAA 4RUVA 2Z9SA 3TGZA 1OC9A 3SWLA 2QSIA 2GZPA 1KTEA 1T8EB 5E59A 3UARA 4G19A 2OE1A 1Z6NA 2OE0A 1VF1A 5J3RA 2OKAA 5A5KA 3QDNA 4GCIA 4IHUA 2OBIA 3D0ZA 4BWQA 1MDKA 4HJMA 5DJMA 1AXDA 2IMKA 3GN3A 2H8LA 3D5JA 1YDKA 4RI7A 5ECLB 1XFLA 1ZGNA 1JZWA 4F82A 3ERGA 1TDIA 2F9SA 2CVBA 4ZILA 5ECPB 1EGOA 1SL1B 2DIYA 3OR5A 5C04A 3W6GA 4HOJA 5GAND 1X0RA 2F8AA 1W4VA 4USSA 3IAS2 2WGRA 2YV7A 5ELAA 2DIZA 3DXBA 4MDCA 2DKHA 1PSQA 3FZ9A 3UVTA 4BL7B 1V98A 1G7EA 3TRXA 4FYBA 4EIPA 3TJBA 17GSA 3RAZA 1Z6MA 5D93A 2PN8A 4ICYA 2FLSA 3MYDA 1PX6A 5IIZA 3RPNA 5IO2A 3A2XA 1WJKA 1WP0A 3F4RA 3DIEA 3EPTA 4EE0A 3E0UA 3LG6A 3EU4A 2I1UA 1X5CA 2HSHA 1O8XA 1QQ2A 4Z2UA 1WPIA 4BVXB 1JLVA 3VI5A 2C1YA 3QAGA 3M8NA 1GH2A 2VUPA 2RIIA 5HFIA 2NVLA 3HYPA 2GQKA 4PURA 2GQLA 4ZL8A 1OC9B 3LFLA 2WB9A 4CY6A 2LNTA 2CVKA 1B48A 1R26A 2YOIA 2O89A 4Q5QA 3FYGA 2H73A 5KEJA 3D4MA 5D9VA 2H71A 4F0CA 2JACA 3VK9A 3UAPA 3C71A 2F3MA 1THOA 5L71A 1ZMAA 1QUWA 2PU9C 3A5WA 2D2ZA 1YEXA 3HCZA 5ID2B 1TI1A 3S9FA 3CBUA 3DWVA 1FO5A 5DQYA 2MMNA 3C7MA 4MF6A 2P5QA 2H6XA 4K6XA 1PD21 2TRCP 2ALBA 5F05A 2H0IA 3M0FA 4QL9A 4PNGA 3WGXA 2R5GA 5DAKA 4V1Ag 2JADA 4LA1A 1OKDA 3GURA 1XOAA 3IC4A 1SL2B 3UL3A 5CRDA 11GSA 4KH7A 4ECJA 4EDZA 4KSOA 4JZQA 1ILOA 1X5EA 3I43A 4EF0A 2CQ9A 4O5QA 2VCQA 4BA7A 1HNBA 4KSMA 3EE2A 3VWXA 2H1GA 1VRSD 2V32A 4YAVA 4Z2TA 3W8SA 1A24A 4AJ8A 2XPDA 5CREA 1UA5A 2GVPA 1GLQA 4MCUA 3TRQA 1GSQA 4AJ6A 2DJ2A 3J7Yb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QMV A;  4POM A;  4WKW A;  1TW9 A;  2FNO A;  2ON7 A;  3U6V A;  4F2I A;  1X9W B;  3GL5 A;  3ZFB A;  1JLW A;  1A0R P;  1BG5 A;  5EPF A;  5ABR A;  4XS1 A;  1TRU A;  1DBY A;  1YQ1 A;  1YF0 A;  6GST A;  5CRH A;  2HZF A;  2WUL A;  1Z3E A;  4CDO A;  5FHI A;  2H1D A;  5AIS A;  1TKD B;  3HY2 A;  4YH2 A;  5DJL A;  2E2G A;  3VWU A;  2HZE A;  1T3B A;  1SJZ A;  3RHB A;  2NPB A;  3HZ8 A;  5DAK B;  4HZ4 A;  1O8W A;  1CQH A;  4IEL A;  1PX7 A;  3PH9 A;  3DGQ A;  1QGV A;  1R5A A;  3ED3 A;  3LEF A;  2RUF A;  1UN2 A;  2YPM A;  4RI6 A;  3Q6O A;  3ZTL A;  1O73 A;  5ECO B;  2H70 A;  3GA4 A;  4IQ1 A;  22GS A;  2BJX A;  5JWR B;  2VD1 A;  3GL3 A;  1XW5 A;  2C4J A;  2V2G A;  2ZNM A;  1GTB A;  1Z5Y E;  4FYC A;  3J7Y k;  5J41 A;  3LXT A;  5AIX A;  1A0F A;  1AQV A;  2X8C A;  2X64 A;  5AN1 A;  4LLR A;  1GTA A;  3O76 A;  3ZML A;  3QPM A;  4HS1 A;  4GXZ A;  1XXU A;  3H4K A;  2IMI A;  1LJR A;  1TP9 A;  1GNW A;  2CA8 A;  3FR6 A;  4MK3 A;  3ZIT A;  4TR3 A;  3Q19 A;  2M46 A;  1BAY A;  4WET A;  2H0G A;  2JL4 A;  1F9M A;  1GNE A;  1X9M B;  3UOM A;  4XRD A;  1TI3 A;  3D22 A;  2IWT A;  4MZC A;  2MBT A;  1V57 A;  3CYN A;  2QKE A;  4EXJ A;  1TXX A;  5G31 A;  3PIN A;  5A4V A;  1MD4 A;  4NPB A;  2HZE B;  5IOW A;  4HZ2 A;  2H74 A;  3EYT A;  1RW1 A;  1A8Y A;  4EC0 A;  4KGI A;  4NMU A;  4GST A;  2H66 A;  4PGT A;  1FB6 A;  4OWY A;  3WGD A;  2PGT A;  3ZLP A;  1AC1 A;  5F07 A;  3EU3 A;  3KMN A;  3LSZ A;  3QCP A;  1WRY A;  2HXK A;  1K3O A;  4PXO A;  4TN8 A;  2DSA A;  4KA0 A;  2LQO A;  3VI7 A;  6GSV A;  2H1A A;  2J9H A;  3Q18 A;  3BOA A;  4WR5 A;  3KGK A;  2GDR A;  3A2W A;  2O8V B;  4FH8 A;  3LYK A;  5GSS A;  2FWG A;  4ZBD A;  4ZXG A;  4MMM A;  3KMO A;  4K9Z A;  3MWH A;  1EWX A;  4BWS A;  3L0H A;  2L5L A;  4KE3 A;  2XBI A;  2B5Y A;  4ISD A;  2GT5 A;  3FK8 A;  4IJ3 A;  2LRC A;  2LQQ A;  3IOS A;  4IS0 A;  5GZZ B;  2XBQ A;  1AAZ A;  4WR4 A;  4XS6 A;  4I6X A;  2N5F A;  2YJH A;  3O3T A;  5D9X A;  1FHE A;  1K0O A;  3E3E A;  2GGT A;  5ENU A;  4TR4 A;  5IQY A;  2YWN A;  1ZCP A;  3IK7 A;  2ON5 A;  2H19 A;  4TXO B;  4MH3 A;  3M9J A;  3AY8 A;  3LJR A;  4NXI A;  5IM9 A;  2PPT A;  1BX9 A;  3F4S A;  3DRN A;  4ML6 A;  4TR1 A;  3TKQ A;  2H30 A;  2X8H A;  3CSI A;  4I8B A;  2GZZ A;  1EOG A;  4XCS A;  3VPT A;  4N30 A;  4PQ1 A;  4HJ2 A;  2MMO A;  2I9H A;  2VL9 A;  3CMI A;  5G5E A;  5CO3 A;  4AGS A;  1DUG A;  2F51 A;  4ULX A;  4YAP A;  6GSW A;  4IW9 A;  3I69 A;  2R6K A;  5D9T A;  2HT9 A;  2H01 A;  2J23 A;  4O7H A;  3QFB C;  2FWF A;  2X8G A;  2H0H A;  4K7O A;  3EMP A;  3KXO A;  2HFD A;  4P3Y B;  1R5P A;  3QMX A;  1AIU A;  4POL A;  2YNX A;  2VOC A;  4H86 A;  4L8E A;  1N8J A;  3KH9 A;  2REM A;  2YV9 A;  2GST A;  1KNG A;  2N5B A;  2EC4 A;  2L57 A;  3KJY A;  5E4W A;  1PA3 A;  1GUK A;  1QFN A;  1XBS A;  1V2A A;  2ES7 A;  5H5S A;  1G6Y A;  4J57 E;  19GS A;  2LTK A;  1JZO A;  4LL4 B;  5ECQ B;  5JWO B;  3F0I A;  2M72 A;  4JU5 A;  4XIH A;  1ON4 A;  3TOU A;  1NM3 A;  3LOR A;  1XVQ A;  4D73 A;  3GV1 A;  2TRX A;  3QAV A;  1AQX A;  2AYT A;  1G0T A;  1Z9H A;  3HKR A;  1M2D A;  2DJ3 A;  1SK0 A;  3TKS A;  3TOT A;  4NHW A;  2IL3 A;  3NIV A;  4MP4 A;  1TRW A;  2EIQ A;  4TR1 B;  1HNA A;  1A2M A;  3DYR A;  2A2R A;  4DSR A;  1FVK A;  3GKK A;  1VGL A;  3G7I A;  3DVW A;  5D9W A;  2VCW A;  4MZB A;  5ELG A;  2FWH A;  1GL8 A;  2GSS A;  4OMV A;  4PUF C;  3TRP A;  4X43 A;  2VLT A;  6GSX A;  4TKY A;  4IGJ A;  3QD9 A;  5B7C A;  1TK8 B;  3IPZ A;  3VLN A;  2GZY A;  2VM2 A;  2C8U A;  3WGE A;  3UMA A;  2VL2 A;  1ERT A;  1EV4 A;  2DC5 A;  3NOF A;  3IDV A;  3LWA A;  1V9W A;  2VO4 A;  1S3A A;  2VCZ A;  5A4W A;  4ZBA A;  3FKF A;  4WBR D;  5G2Z A;  1CQG A;  3L9V A;  1TU8 A;  4K8M A;  2CZ3 A;  5D8I A;  4ACS A;  4KAE A;  4GQC A;  2PVQ A;  3NZN A;  1MD3 A;  1EOH A;  3KTB A;  1TJD A;  4F0B A;  1NSW A;  4ZB8 A;  6GSY A;  2K18 A;  2L6C A;  4O92 A;  1J08 A;  1K0N A;  1EEM A;  4YQV A;  1K0B A;  3WT1 A;  1K3L A;  1EP8 A;  3HDC A;  2FD3 A;  4D73 B;  4FO5 A;  4GLT A;  5ECS A;  4RQX A;  2V1M A;  2LJR A;  3KD0 A;  2OA7 A;  5HFK A;  3HA9 A;  3VWW A;  2RM5 A;  4GSS A;  5IOX A;  3TDG A;  2V41 A;  1M9A A;  4E8E A;  1TK5 B;  1MTC A;  4RQR A;  2FCH A;  3F6D A;  2E7P A;  5CNW A;  1QXH A;  5B8A A;  4WXT A;  2B5E A;  4V2M A;  4N11 A;  4DSS A;  3TKS C;  4IP6 A;  3VPQ A;  4V2N A;  4K0N A;  3GH9 A;  4GRF A;  4I2T A;  3F8U A;  4OCF A;  2BTO T;  2XPE A;  5IMV A;  1B4Q A;  3ZRD A;  1S3C A;  4XHM A;  6GSU A;  2WS2 A;  4OO5 A;  4PUA A;  3IE3 A;  4PNF A;  5IO0 A;  5KN2 A;  2VM1 A;  4AF2 A;  4HU9 A;  1G6W A;  3LGC A;  3CRT A;  3GKX A;  1GSD A;  4MF5 A;  3FZA A;  4MA9 A;  2L4C A;  4MPG A;  3ZFL A;  5HR2 A;  2HLS A;  5IMA A;  3CRU A;  1WMJ A;  3P8W A;  3JCM L;  2FUG 2;  2IFQ A;  2PBJ A;  4Q5R A;  2VL2 C;  4BPY A;  3I9V 2;  4MJA A;  4TR0 A;  4KX4 A;  18GS A;  1U6T A;  2I81 A;  1HNC A;  3ZL5 A;  1SKR B;  1MDJ A;  2CAQ A;  1F3A A;  1SD8 A;  3CSJ A;  1SKS B;  4E8H A;  1PKZ A;  4HDE A;  4TVE A;  5HFG A;  2PVO C;  3APS A;  1FVJ A;  2AB6 A;  3IV4 A;  4PQH A;  3LYP A;  1XWK A;  1IYI A;  3CTG A;  2JSY A;  2HRF A;  3HJP A;  1XOB A;  4ECB A;  1S3D A;  4LMV A;  4OFM A;  4QL7 A;  1ML6 A;  3FEU A;  5KN0 A;  4WF5 A;  4IBP A;  3F9U A;  5LCZ A;  5DBQ A;  4DSS B;  4JR4 A;  4NHZ A;  2H72 A;  1T4Z A;  1EEJ A;  1OC3 A;  2G0F A;  5H5R A;  4WBJ A;  5DCG A;  4XRA A;  1C72 A;  5D96 A;  1PL2 A;  3G7Y A;  2C0E A;  3R2Q A;  4IJI A;  2MMZ A;  3GIX A;  3FHK A;  1FW1 A;  4YQU A;  3GX0 A;  1KBN A;  2FA8 A;  3FZ4 A;  1GRX A;  2YZU A;  1OKT A;  2X99 A;  1GUL A;  1OE8 A;  1TRS A;  3PR8 A;  1WOU A;  3KEB A;  1X5D A;  3HD5 A;  3BCI A;  3IRA A;  1K0M A;  1ZYQ B;  2IFQ B;  5ECR B;  7GSS A;  2VIM A;  3G9B A;  3N5O A;  2PWJ A;  4WF4 A;  3D21 A;  4HU7 A;  5GAP D;  3IAM 2;  4MJE A;  4NAX A;  1H4O A;  4WEY A;  1G7O A;  4OO4 A;  1O81 A;  3QR6 A;  2B7J A;  4F03 A;  1BED A;  3Q74 A;  2VCV A;  1FG4 A;  1U3I A;  4HEA 2;  3KIJ A;  4ZB6 A;  3M1G A;  2DJ1 A;  4LMW A;  5IMZ A;  3APQ A;  1OVN A;  2DBC A;  1GSF A;  2H6Y A;  1Y25 A;  4EDY A;  3KP9 A;  2LNS A;  1RQM A;  3IK9 A;  3UBK A;  3C1S A;  3F6F A;  5G1L A;  3TJG A;  1A2L A;  2AUV A;  5HR1 A;  1Z7P A;  2WZ9 A;  2JU5 A;  3IXR A;  3ZVJ D;  4L0U A;  4JE1 A;  2C3T A;  1M2A A;  4TW5 A;  3SBC A;  4GQF A;  1M99 A;  2C3N A;  1URM A;  2LKU A;  5JCG A;  3VFI A;  1HQO A;  4L0W A;  1V58 A;  1KEB A;  3TJK A;  1XW6 A;  4GF0 A;  1HD2 A;  1F6M C;  4J2F A;  5G5F A;  1SK2 A;  1RK4 A;  3TKS E;  2C3Q A;  5KN1 A;  2LJK A;  2FGX A;  3GTU A;  1UVZ A;  4MAB A;  4KUN A;  4I2U A;  4EVM A;  1PMT A;  5A4U A;  3C1R A;  2ZUP A;  3DKS A;  1HYU A;  5INY A;  4NV2 A;  3TJJ A;  1LU4 A;  2B1K A;  5ECH B;  1V40 A;  5B6M A;  4ZBB A;  1ZZY A;  3GKM A;  2YZH A;  3GHA A;  9GSS A;  2CX4 A;  1TOF A;  3HHV A;  1O85 A;  3ISO A;  1F3B A;  4JRR A;  5ECK B;  1Y6E A;  2E0Q A;  3K8N A;  4HUA A;  1K3Y A;  2OAC A;  1XIY A;  4CW9 A;  1EZK A;  2PUK C;  1XVW A;  4KB3 A;  8GSS A;  3GRX A;  3CSH A;  1GUH A;  3H1N A;  4K1F A;  2A4V A;  4XS4 A;  1F2E A;  3HVX A;  3FR3 A;  5DDL A;  3ZYW A;  1M9B A;  1J0F A;  3EWL A;  5HR0 A;  3LQ7 A;  3HJO A;  2FY6 A;  1YF1 A;  3ERW A;  2VAF A;  5IPH A;  2L5O A;  2WJU A;  2YWM A;  1GSU A;  1A23 A;  2YWO A;  4GTU A;  4G10 A;  1SK1 A;  2VLU A;  2OE3 A;  2R2J A;  5COH A;  4Q5F A;  1PQN A;  3A2V A;  1XW9 A;  2L6D A;  4EKZ A;  4KCA A;  5J9B A;  1ZYE A;  3H93 A;  3H79 A;  3TKP A;  1PL1 A;  4KDY A;  5CAX A;  4OD7 A;  2NBS A;  3TCO A;  5HQP A;  3RBT A;  3GTU B;  3LXZ A;  2FA4 A;  2B6M A;  1T4Y A;  3KZQ A;  1XWC A;  2HI7 A;  4ILF A;  4NWY A;  3BCK A;  4BVX A;  2AHE A;  4HI7 A;  2FHE A;  1VF2 A;  3DML A;  5D73 A;  3D4T A;  4IP1 A;  4L5O A;  2G2Q A;  3FZ5 A;  3ME7 A;  1DSB A;  1Q98 A;  3HZ4 A;  5EL8 A;  2WRT A;  3DVX A;  3HVV A;  5IMC A;  5B8B A;  3EC3 A;  2VLV A;  5F0G A;  2K6V A;  2IMD A;  1GSY A;  1K0C A;  5EVO A;  3W8J A;  4O5R A;  3A3T A;  10GS A;  3O6T A;  1XPV A;  2ZCT A;  3QOU A;  2H1B A;  2C80 A;  2CX3 A;  2KHP A;  2QGV A;  4XS4 B;  16GS A;  1H75 A;  2VCT A;  3TKR A;  5ID2 A;  2V6K A;  3H8Q A;  3HVS A;  3MAK A;  3KH7 A;  2KUC A;  3QAW A;  3DEX A;  2IMF A;  1TU7 A;  4F9Z A;  2LEG A;  4Z7X A;  3APO A;  4QQ7 A;  5IMF A;  2JZR A;  3CTF A;  2K8S A;  3V1W A;  4KDX A;  3L9U A;  1OYJ A;  3F63 A;  3KP8 A;  3L9S A;  1PN9 A;  3EMX A;  1NW2 A;  5DQS A;  3GKN A;  1YJ6 A;  2O85 A;  1ST9 A;  2WFC A;  1XWB A;  2AV4 A;  2MZC A;  2LRN A;  2VD0 A;  5CRW A;  2A2S A;  5H5Q A;  2DJ0 A;  3TJF A;  4MF7 A;  4JBB A;  2LV3 A;  2E2M A;  1J9B A;  3WYW A;  3KM6 A;  1XCC A;  3F3Q A;  3ZIJ A;  3IR4 A;  5JWQ B;  1T1V A;  5B6N A;  2RUE A;  5CYY A;  1SKW B;  2AJQ B;  4MLY A;  2NDO A;  3RPP A;  5DVB A;  2H75 A;  2O87 A;  4G2E A;  1QK8 A;  4PQI A;  1K0D A;  5HR3 A;  1SD9 A;  5AGY A;  3L4N A;  5FWG A;  2YWI A;  1TK0 B;  1WE0 A;  3UEM A;  2KOK A;  3N9J A;  3MSZ A;  3CXG A;  5ECN B;  1ERU A;  2HRN A;  1Z7R A;  1A2J A;  4DSQ A;  1T00 A;  4N0V A;  1JHB A;  1EV9 A;  3ME8 A;  2WDU A;  5CP1 A;  2P0G A;  5CRG A;  3QFA C;  4K0G A;  1SYX A;  4POK A;  5AIV A;  1ZL9 A;  3GH6 A;  1YZX A;  1XZO A;  4LL1 B;  3GYK A;  2IME A;  3P2A A;  4NV5 A;  1O6J A;  2M80 A;  2R3X A;  1JZD A;  4XTS A;  1FAA A;  1I9D A;  1GTU A;  3EUR A;  2LUS A;  1GTI A;  3ZVJ A;  5J9C A;  1YKA A;  2HSY A;  4KND A;  2I3Y A;  2CVD A;  1R7H A;  4ZL7 A;  4AJ7 A;  2LS5 A;  1GLP A;  2R37 A;  4K7I A;  2C0D A;  3HXS A;  4ZIJ A;  1ABA A;  1BJX A;  1YEP A;  4HQZ A;  3DD3 A;  2RLI A;  1ZOF A;  2R4V A;  2N5A A;  2DML A;  2B1L A;  1F37 A;  5GST A;  2EIO A;  2YP6 A;  3GX8 A;  4X0X A;  3L78 A;  1NHO A;  2B5X A;  1JFU A;  1GP1 A;  2CAI A;  4GWR A;  4KW6 A;  1VF4 A;  3GNJ A;  2IIY A;  1R4W A;  1YKC A;  5DCH A;  1U3A A;  2NTO A;  1Q4J A;  3TUE A;  1B8X A;  3UIW A;  1XWG A;  1PKW A;  2XHF A;  1GSS A;  1U88 A;  2O7K A;  5C00 A;  3KTL A;  1BQ7 A;  3M9K A;  2I4A A;  5JCW A;  1MEK A;  3GFK A;  4O32 A;  3F3R A;  4OCE A;  3IHQ A;  1GUM A;  4L5L A;  2YN1 A;  2KLX A;  2OJL A;  2YAN A;  5LD0 A;  5J4U A;  4EO3 A;  4BVY A;  5ECI B;  1SEN A;  3MNG A;  4IQA A;  4HQS A;  1E6B A;  4G9H A;  3GST A;  2YJ7 A;  3P7X A;  4I97 A;  2GSR A;  5LNK e;  4IKH A;  3D6I A;  2F8F A;  2OBK A;  1EGR A;  1B9Y C;  1XWA A;  1OE7 A;  1X9S B;  3P90 A;  5F06 A;  4JED A;  2WCI A;  3EVI A;  4Q5N A;  1AW9 A;  2HYX A;  1AUC A;  4N0Z A;  2CV4 A;  2VCX A;  1SYR A;  3GUS A;  4GSN A;  1PGT A;  1FB0 A;  1TTZ A;  2PMT A;  2JZT A;  2V6O A;  3PGT A;  1T7P B;  2C0G A;  2DJK A;  1K0A A;  2CZ2 A;  1OC8 A;  3WT2 A;  1B4P A;  1WIK A;  3VWV A;  2DMM A;  3GSS A;  2XC2 A;  14GS A;  4DVC A;  1IYH A;  5KN3 A;  1I5G A;  4PX1 A;  5JCU A;  20GS A;  2JSZ A;  4K7N A;  3KCM A;  5ECM B;  2B7K A;  4IN0 A;  2K9F A;  13GS A;  1N2A A;  1LBK A;  2LJA A;  4V2L A;  1UC7 A;  2QC7 A;  1DE1 A;  5F8B A;  1YY7 A;  4X1U A;  1ACV A;  4TXO A;  2IPA A;  5DAL A;  4EL1 A;  4MJB A;  2DLX A;  3BJ5 A;  4ECI A;  4DEJ A;  2H6Z A;  2GSQ A;  3U5R E;  4ECC A;  4CHS A;  3IA1 A;  1FOV A;  1GWC A;  1SU9 A;  2K8V A;  2P31 A;  3UBL A;  2MBS A;  3E9J B;  1SJ6 A;  2VL3 A;  3HJM A;  2L59 A;  1NHY A;  6GSS A;  2OAD A;  3UVH A;  5IPG A;  3C8E A;  1PRX A;  1WWJ A;  2LST A;  1M0U A;  4IVF A;  2KP1 A;  3ZMK A;  3ERF A;  4POB A;  1BYE A;  1M7T A;  3MDK A;  3I6A A;  3BD2 A;  5J5N A;  1MDI A;  3RDW A;  1DE2 A;  2GQM A;  1JZR A;  1USB A;  1E2Y A;  4YQM A;  3ZRE A;  2LRT A;  4MPF A;  3US3 A;  1EP7 A;  2FWE A;  1A8L A;  2GTU A;  3RHC A;  1GSE A;  3BBY A;  12GS A;  3FW2 A;  3IBH A;  3FY7 A;  2L4Q A;  2MYG A;  4JR6 A;  1W89 A;  4MZW A;  1THX A;  4KDU A;  1ERW A;  4ID0 A;  4N10 A;  1OAZ A;  3EIN A;  4TRX A;  2RM6 A;  2AAW A;  3TB2 A;  4KCE A;  4V1A p;  4I5Q A;  4TOP A;  3WD6 A;  2KP2 A;  2JZS A;  3UJ1 A;  2P5R A;  2TIR A;  2PER A;  2YCD A;  2EIR A;  4J56 E;  4BL7 A;  4ZL9 A;  4MH2 A;  3G7J A;  1AQW A;  5FT3 A;  4MJC A;  1O7U A;  1VF3 A;  4K2D A;  3C73 A;  2BMX A;  5DAL B;  1B9X C;  3ZZX A;  2GLR A;  1SJI A;  1ERV A;  2GT6 A;  1SL0 B;  2B3S A;  2IN3 A;  5G1K A;  2DJJ A;  2HE3 A;  3GMF A;  4EUY A;  4FIW A;  2HNL A;  4TXV A;  4OFN A;  2GS3 A;  5G30 A;  3ZIV A;  3VUR A;  5EY6 A;  4OFT A;  3F4T A;  2IJY A;  4FYU A;  2C0F A;  2H76 A;  2CT6 A;  4ZB9 A;  3FRC A;  1M2B A;  3FR9 A;  5IMD A;  1U87 A;  4ML1 A;  1TRV A;  3M3M A;  2MMA A;  4RUV A;  2Z9S A;  3TGZ A;  1OC9 A;  3SWL A;  2QSI A;  2GZP A;  1KTE A;  1T8E B;  5E59 A;  3UAR A;  4G19 A;  2OE1 A;  1Z6N A;  2OE0 A;  1VF1 A;  5J3R A;  2OKA A;  5A5K A;  3QDN A;  4GCI A;  4IHU A;  2OBI A;  3D0Z A;  4BWQ A;  1MDK A;  4HJM A;  5DJM A;  1AXD A;  2IMK A;  3GN3 A;  2H8L A;  3D5J A;  1YDK A;  4RI7 A;  5ECL B;  1XFL A;  1ZGN A;  1JZW A;  4F82 A;  3ERG A;  1TDI A;  2F9S A;  2CVB A;  4ZIL A;  5ECP B;  1EGO A;  1SL1 B;  2DIY A;  3OR5 A;  5C04 A;  3W6G A;  4HOJ A;  5GAN D;  1X0R A;  2F8A A;  1W4V A;  3IAS 2;  2WGR A;  2YV7 A;  5ELA A;  2DIZ A;  3DXB A;  4MDC A;  1PSQ A;  3FZ9 A;  3UVT A;  1V98 A;  1G7E A;  3TRX A;  4FYB A;  3TJB A;  17GS A;  3RAZ A;  1Z6M A;  5D93 A;  2PN8 A;  2FLS A;  1PX6 A;  5IIZ A;  3RPN A;  5IO2 A;  3A2X A;  1WJK A;  1WP0 A;  3F4R A;  3DIE A;  4EE0 A;  3E0U A;  3LG6 A;  3EU4 A;  2I1U A;  1X5C A;  2HSH A;  1O8X A;  1QQ2 A;  1WPI A;  1JLV A;  3VI5 A;  2C1Y A;  3QAG A;  3M8N A;  1GH2 A;  2VUP A;  2RII A;  5HFI A;  2NVL A;  3HYP A;  2GQK A;  4PUR A;  2GQL A;  4ZL8 A;  1OC9 B;  3LFL A;  2WB9 A;  2LNT A;  2CVK A;  1B48 A;  1R26 A;  2YOI A;  2O89 A;  4Q5Q A;  3FYG A;  2H73 A;  5KEJ A;  3D4M A;  5D9V A;  2H71 A;  4F0C A;  2JAC A;  3VK9 A;  3UAP A;  3C71 A;  2F3M A;  1THO A;  5L71 A;  1ZMA A;  1QUW A;  2PU9 C;  3A5W A;  2D2Z A;  1YEX A;  3HCZ A;  5ID2 B;  1TI1 A;  3S9F A;  3CBU A;  3DWV A;  1FO5 A;  5DQY A;  2MMN A;  3C7M A;  4MF6 A;  2P5Q A;  2H6X A;  4K6X A;  1PD2 1;  2TRC P;  2ALB A;  5F05 A;  2H0I A;  3M0F A;  4QL9 A;  4PNG A;  3WGX A;  2R5G A;  5DAK A;  4V1A g;  2JAD A;  4LA1 A;  1OKD A;  3GUR A;  1XOA A;  3IC4 A;  1SL2 B;  3UL3 A;  5CRD A;  11GS A;  4KH7 A;  4ECJ A;  4EDZ A;  4KSO A;  4JZQ A;  1ILO A;  1X5E A;  3I43 A;  4EF0 A;  2CQ9 A;  2VCQ A;  4BA7 A;  1HNB A;  4KSM A;  3EE2 A;  3VWX A;  2H1G A;  1VRS D;  2V32 A;  4YAV A;  3W8S A;  1A24 A;  4AJ8 A;  2XPD A;  5CRE A;  1UA5 A;  2GVP A;  1GLQ A;  4MCU A;  3TRQ A;  1GSQ A;  4AJ6 A;  2DJ2 A;  3J7Y b; 
#chains in the Genus database with same CATH topology
 1QMV A;  2X49 A;  4K5R A;  2X4A A;  4POM A;  4WKW A;  1TW9 A;  2FNO A;  2ON7 A;  3U6V A;  4F2I A;  4CY8 A;  1X9W B;  3GL5 A;  3ZFB A;  1JLW A;  1A0R P;  1BG5 A;  5EPF A;  5ABR A;  4XS1 A;  1TRU A;  4HSC X;  1DBY A;  3A5I A;  1YQ1 A;  1YF0 A;  6GST A;  5CRH A;  2HZF A;  2WUL A;  1Z3E A;  4CDO A;  5FHI A;  2H1D A;  5AIS A;  1TKD B;  3HY2 A;  4YH2 A;  5DJL A;  2E2G A;  3VWU A;  2HZE A;  1T3B A;  1SJZ A;  3RHB A;  2NPB A;  3HZ8 A;  5DAK B;  4HZ4 A;  1O8W A;  1CQH A;  4IEL A;  1PX7 A;  3PH9 A;  3DGQ A;  1QGV A;  1R5A A;  3ED3 A;  3LEF A;  2RUF A;  1UN2 A;  2YPM A;  4RI6 A;  3Q6O A;  3ZTL A;  1O73 A;  5ECO B;  2H70 A;  3GA4 A;  4IQ1 A;  22GS A;  2BJX A;  5JWR B;  2VD1 A;  3GL3 A;  1XW5 A;  2C4J A;  2V2G A;  2ZNM A;  1GTB A;  1Z5Y E;  4FYC A;  3J7Y k;  5J41 A;  3LXT A;  5AIX A;  1A0F A;  1AQV A;  2X8C A;  2X64 A;  5AN1 A;  4LLR A;  1GTA A;  3O76 A;  3ZML A;  3QPM A;  4HS1 A;  4GXZ A;  1XXU A;  3H4K A;  2IMI A;  1LJR A;  1TP9 A;  1GNW A;  2CA8 A;  3FR6 A;  4MK3 A;  3ZIT A;  4TR3 A;  3Q19 A;  2M46 A;  1BAY A;  4WET A;  2H0G A;  2JL4 A;  1F9M A;  1GNE A;  1X9M B;  3UOM A;  4XRD A;  1TI3 A;  3D22 A;  4A5P A;  2IWT A;  4MZC A;  2MBT A;  1V57 A;  3CYN A;  2QKE A;  1ZYN A;  4EXJ A;  1TXX A;  5G31 A;  3PIN A;  5A4V A;  1MD4 A;  4NPB A;  2HZE B;  5IOW A;  1M3J A;  4HZ2 A;  2H74 A;  3EYT A;  1RW1 A;  1A8Y A;  4EC0 A;  4KGI A;  4NMU A;  4GST A;  2H66 A;  4PGT A;  1FB6 A;  4OWY A;  3WGD A;  2PGT A;  3ZLP A;  1AC1 A;  5F07 A;  3EU3 A;  3KMN A;  2R0G A;  3LSZ A;  3QCP A;  1WRY A;  2HXK A;  1K3O A;  4PXO A;  4TN8 A;  2DSA A;  4KA0 A;  2LQO A;  3VI7 A;  6GSV A;  2H1A A;  2J9H A;  3Q18 A;  3BOA A;  4WR5 A;  3KGK A;  2GDR A;  3A2W A;  4G0L A;  2O8V B;  4FH8 A;  3LYK A;  5GSS A;  2FWG A;  4ZBD A;  4ZXG A;  4X4J A;  4MMM A;  3KMO A;  4K9Z A;  3MWH A;  1EWX A;  4BWS A;  3L0H A;  2L5L A;  4KE3 A;  2XBI A;  2B5Y A;  4ISD A;  2GT5 A;  3FK8 A;  4IJ3 A;  2LRC A;  2LQQ A;  3IOS A;  4IS0 A;  5GZZ B;  2XBQ A;  1AAZ A;  4WR4 A;  4XS6 A;  4I6X A;  2N5F A;  2YJH A;  3O3T A;  5D9X A;  1FHE A;  1K0O A;  3E3E A;  3MIX A;  2GGT A;  5ENU A;  4TR4 A;  5IQY A;  3LW9 A;  2YWN A;  1ZCP A;  3IK7 A;  2ON5 A;  2H19 A;  4TXO B;  4MH3 A;  3M9J A;  3AY8 A;  3LJR A;  4NXI A;  5IM9 A;  2PPT A;  1BX9 A;  3F4S A;  3DRN A;  4ML6 A;  4TR1 A;  3TKQ A;  2H30 A;  2X8H A;  3CSI A;  1PFO A;  2UZ8 A;  4I8B A;  2GZZ A;  1EOG A;  3R3E A;  4XCS A;  3VPT A;  4N30 A;  4PQ1 A;  4HJ2 A;  2MMO A;  2I9H A;  2VL9 A;  3CMI A;  5G5E A;  4Z2R A;  5CO3 A;  4AGS A;  1DUG A;  2F51 A;  4ULX A;  4YAP A;  6GSW A;  4IW9 A;  3I69 A;  2R6K A;  5D9T A;  2HT9 A;  2H01 A;  2J23 A;  4O7H A;  3QFB C;  2FWF A;  2X8G A;  2H0H A;  4K7O A;  3EMP A;  3KXO A;  2HFD A;  4P3Y B;  1R5P A;  3QMX A;  1AIU A;  3PPU A;  4POL A;  2YNX A;  2VOC A;  4H86 A;  4L8E A;  1N8J A;  3KH9 A;  2REM A;  2YV9 A;  2GST A;  1KNG A;  2N5B A;  2EC4 A;  2L57 A;  3KJY A;  5E4W A;  1PA3 A;  1GUK A;  1QFN A;  1XBS A;  1V2A A;  2ES7 A;  5H5S A;  1G6Y A;  4J57 E;  19GS A;  2LTK A;  1JZO A;  4LL4 B;  5ECQ B;  5JWO B;  3F0I A;  4EIQ A;  2M72 A;  4JU5 A;  4XIH A;  1ON4 A;  3TOU A;  1NM3 A;  3LOR A;  1XVQ A;  4D73 A;  3GV1 A;  2TRX A;  4YKG A;  3QAV A;  1AQX A;  2AYT A;  1G0T A;  1Z9H A;  3HKR A;  1M2D A;  2DJ3 A;  1SK0 A;  3TKS A;  3TOT A;  4NHW A;  2IL3 A;  3NIV A;  4MP4 A;  1TRW A;  2EIQ A;  4TR1 B;  1HNA A;  1A2M A;  3DYR A;  2A2R A;  4DSR A;  1FVK A;  3GKK A;  1VGL A;  3G7I A;  3DVW A;  5D9W A;  2VCW A;  4MZB A;  5ELG A;  2FWH A;  1GL8 A;  2GSS A;  4OMV A;  4PUF C;  3TRP A;  4X43 A;  2VLT A;  6GSX A;  4TKY A;  4IGJ A;  3QD9 A;  5B7C A;  1TK8 B;  3IPZ A;  3VLN A;  2GZY A;  2VM2 A;  2C8U A;  3WGE A;  3UMA A;  2VL2 A;  1ERT A;  1EV4 A;  2DC5 A;  3NOF A;  3IDV A;  2R0P A;  3LWA A;  1V9W A;  2VO4 A;  1S3A A;  2VCZ A;  5A4W A;  4ZBA A;  3FKF A;  4WBR D;  5G2Z A;  1CQG A;  3L9V A;  1TU8 A;  4K8M A;  2CZ3 A;  5D8I A;  4ACS A;  4KAE A;  4GQC A;  2PVQ A;  3NZN A;  1MD3 A;  1EOH A;  3KTB A;  1TJD A;  4F0B A;  1NSW A;  4ZB8 A;  6GSY A;  2K18 A;  2L6C A;  4O92 A;  1J08 A;  1K0N A;  1EEM A;  4YQV A;  1K0B A;  3WT1 A;  1K3L A;  1EP8 A;  3HDC A;  2FD3 A;  4D73 B;  4FO5 A;  4GLT A;  5ECS A;  4RQX A;  2V1M A;  2LJR A;  3KD0 A;  2OA7 A;  5HFK A;  3HA9 A;  3VWW A;  2RM5 A;  4GSS A;  5IOX A;  3TDG A;  2V41 A;  1M9A A;  4E8E A;  1TK5 B;  1MTC A;  4RQR A;  2FCH A;  3F6D A;  2E7P A;  5CNW A;  1QXH A;  5B8A A;  4WXT A;  2B5E A;  4V2M A;  4N11 A;  4DSS A;  3TKS C;  4IP6 A;  3VPQ A;  4V2N A;  4K0N A;  3GH9 A;  4GRF A;  4I2T A;  3F8U A;  4OCF A;  2BTO T;  2XPE A;  5IMV A;  1B4Q A;  3ZRD A;  1S3C A;  4XHM A;  6GSU A;  2WS2 A;  4OO5 A;  4PUA A;  3IE3 A;  4PNF A;  5IO0 A;  5KN2 A;  2VM1 A;  4AF2 A;  4HU9 A;  1G6W A;  3LGC A;  3CRT A;  3GKX A;  1GSD A;  4MF5 A;  3FZA A;  4MA9 A;  2L4C A;  4MPG A;  3ZFL A;  5HR2 A;  2HLS A;  5IMA A;  3CRU A;  1WMJ A;  3P8W A;  3JCM L;  2FUG 2;  2IFQ A;  2PBJ A;  4Q5R A;  2VL2 C;  4BPY A;  3I9V 2;  4MJA A;  4TR0 A;  4KX4 A;  18GS A;  1U6T A;  2I81 A;  1HNC A;  3ZL5 A;  1SKR B;  1MDJ A;  2CAQ A;  1F3A A;  1SD8 A;  3CSJ A;  1SKS B;  4E8H A;  1PKZ A;  4HDE A;  4TVE A;  5HFG A;  2PVO C;  3APS A;  1FVJ A;  2AB6 A;  3IV4 A;  4PQH A;  3LYP A;  1XWK A;  1IYI A;  3CTG A;  2A4H A;  2JSY A;  2HRF A;  3HJP A;  1XOB A;  4ECB A;  1S3D A;  4LMV A;  4OFM A;  4QL7 A;  1ML6 A;  3FEU A;  5KN0 A;  4WF5 A;  4IBP A;  3F9U A;  5LCZ A;  5DBQ A;  4DSS B;  4JR4 A;  4NHZ A;  2H72 A;  1T4Z A;  1EEJ A;  1OC3 A;  2G0F A;  5H5R A;  4WBJ A;  5DCG A;  4XRA A;  1C72 A;  5D96 A;  1PL2 A;  3G7Y A;  2C0E A;  3R2Q A;  4IJI A;  2MMZ A;  3GIX A;  3FHK A;  1FW1 A;  4YQU A;  3GX0 A;  1KBN A;  2FA8 A;  3FZ4 A;  4FQU A;  1GRX A;  2YZU A;  1OKT A;  2X99 A;  1GUL A;  1OE8 A;  1TRS A;  3PR8 A;  1WOU A;  3KEB A;  1X5D A;  3HD5 A;  3BCI A;  4K2X A;  3IRA A;  1K0M A;  1ZYQ B;  2IFQ B;  5ECR B;  7GSS A;  2VIM A;  3G9B A;  3N5O A;  2PWJ A;  4WF4 A;  3D21 A;  4HU7 A;  5GAP D;  4NAX A;  3IAM 2;  4MJE A;  1H4O A;  4WEY A;  1G7O A;  4OO4 A;  1O81 A;  3QR6 A;  2B7J A;  4F03 A;  1BED A;  3Q74 A;  2VCV A;  1FG4 A;  1U3I A;  4HEA 2;  3KIJ A;  4ZB6 A;  3M1G A;  2DJ1 A;  4LMW A;  5IMZ A;  3APQ A;  1OVN A;  2DBC A;  1GSF A;  2H6Y A;  1Y25 A;  4EDY A;  3FMW A;  3KP9 A;  2LNS A;  1RQM A;  3IK9 A;  3UBK A;  3C1S A;  3F6F A;  5G1L A;  3TJG A;  1A2L A;  2AUV A;  5HR1 A;  1Z7P A;  2WZ9 A;  2JU5 A;  3IXR A;  3IHG A;  3ZVJ D;  4L0U A;  4JE1 A;  2C3T A;  1M2A A;  4TW5 A;  3SBC A;  4GQF A;  1M99 A;  2C3N A;  1URM A;  2LKU A;  5JCG A;  3VFI A;  1HQO A;  4L0W A;  1V58 A;  1KEB A;  3TJK A;  1XW6 A;  4GF0 A;  1HD2 A;  1F6M C;  4J2F A;  5G5F A;  1SK2 A;  1RK4 A;  3TKS E;  2C3Q A;  5KN1 A;  2LJK A;  2FGX A;  3GTU A;  1UVZ A;  4MAB A;  4KUN A;  4I2U A;  4EVM A;  1PMT A;  5A4U A;  3C1R A;  2ZUP A;  3DKS A;  5BMU A;  1HYU A;  5INY A;  4NV2 A;  3TJJ A;  1LU4 A;  2B1K A;  5ECH B;  1V40 A;  5B6M A;  4BIK A;  4ZBB A;  1ZZY A;  3GKM A;  2YZH A;  4KF9 A;  3GHA A;  9GSS A;  2CX4 A;  1TOF A;  3HHV A;  1O85 A;  3ISO A;  1F3B A;  4JRR A;  5ECK B;  1Y6E A;  2E0Q A;  3K8N A;  4HUA A;  1K3Y A;  2OAC A;  1XIY A;  4CW9 A;  1EZK A;  2PUK C;  1XVW A;  4KB3 A;  8GSS A;  3GRX A;  3CSH A;  1GUH A;  3H1N A;  4K1F A;  4PTS A;  2A4V A;  4XS4 A;  1F2E A;  3HVX A;  3FR3 A;  5DDL A;  3ZYW A;  1M9B A;  1J0F A;  3EWL A;  5HR0 A;  3LQ7 A;  3HJO A;  2FY6 A;  1YF1 A;  3ERW A;  2VAF A;  5IPH A;  2L5O A;  2WJU A;  2YWM A;  1GSU A;  1A23 A;  2YWO A;  4GTU A;  4G10 A;  1SK1 A;  2VLU A;  2OE3 A;  2R2J A;  5COH A;  4Q5F A;  1PQN A;  3A2V A;  1XW9 A;  2L6D A;  4EKZ A;  4KCA A;  5J9B A;  1ZYE A;  3H93 A;  3H79 A;  3TKP A;  1PL1 A;  4KDY A;  5CAX A;  4OD7 A;  2NBS A;  3TCO A;  5HQP A;  3RBT A;  3GTU B;  3LXZ A;  2FA4 A;  2B6M A;  1T4Y A;  3KZQ A;  1XWC A;  2HI7 A;  4ILF A;  4NWY A;  3BCK A;  4BVX A;  2AHE A;  4HI7 A;  2FHE A;  1VF2 A;  3DML A;  5D73 A;  2HSM A;  3D4T A;  4IP1 A;  4L5O A;  2G2Q A;  3FZ5 A;  3ME7 A;  1DSB A;  2QA1 A;  1Q98 A;  3HZ4 A;  5EL8 A;  2WRT A;  3DVX A;  3HVV A;  5IMC A;  5B8B A;  3EC3 A;  2VLV A;  5F0G A;  5KOW A;  2K6V A;  2IMD A;  1GSY A;  1K0C A;  5EVO A;  3W8J A;  4O5R A;  3A3T A;  10GS A;  2HRK A;  3O6T A;  1XPV A;  2ZCT A;  3QOU A;  2H1B A;  2C80 A;  2CX3 A;  2KHP A;  2QGV A;  4XS4 B;  16GS A;  1H75 A;  2VCT A;  3TKR A;  5ID2 A;  2V6K A;  3H8Q A;  3HVS A;  3MAK A;  3KH7 A;  2KUC A;  3QAW A;  3DEX A;  2IMF A;  1TU7 A;  4F9Z A;  2LEG A;  4Z7X A;  5KOX A;  3APO A;  4QQ7 A;  5IMF A;  2JZR A;  3CTF A;  2K8S A;  3V1W A;  4KDX A;  3L9U A;  1OYJ A;  3F63 A;  3KP8 A;  3L9S A;  1PN9 A;  3EMX A;  1NW2 A;  5DQS A;  3GKN A;  1YJ6 A;  2O85 A;  3IC8 A;  1ST9 A;  2WFC A;  1XWB A;  2AV4 A;  2MZC A;  2LRN A;  2VD0 A;  5CRW A;  2A2S A;  5H5Q A;  2DJ0 A;  3TJF A;  4MF7 A;  4JBB A;  2LV3 A;  2E2M A;  1J9B A;  3WYW A;  3KM6 A;  1XCC A;  3F3Q A;  3ZIJ A;  3IR4 A;  5JWQ B;  1T1V A;  5B6N A;  2RUE A;  5CYY A;  1SKW B;  2AJQ B;  4MLY A;  2NDO A;  3RPP A;  5DVB A;  2H75 A;  2O87 A;  4G2E A;  1QK8 A;  4PQI A;  1K0D A;  5HR3 A;  1SD9 A;  5AGY A;  3L4N A;  5FWG A;  2YWI A;  1TK0 B;  1WE0 A;  3UEM A;  2KOK A;  3N9J A;  3MSZ A;  3CXG A;  5ECN B;  1ERU A;  2HRN A;  1Z7R A;  1A2J A;  4DSQ A;  1T00 A;  4N0V A;  1JHB A;  1EV9 A;  3ME8 A;  2WDU A;  5CP1 A;  2P0G A;  2R0C A;  5CRG A;  3QFA C;  4K0G A;  1SYX A;  4POK A;  5AIV A;  1ZL9 A;  3GH6 A;  1YZX A;  1XZO A;  4LL1 B;  3GYK A;  2IME A;  3P2A A;  4NV5 A;  1O6J A;  4K5S A;  2M80 A;  2R3X A;  1JZD A;  4XTS A;  1FAA A;  1I9D A;  1GTU A;  3EUR A;  2LUS A;  1GTI A;  3ZVJ A;  5J9C A;  1YKA A;  2HSY A;  4KND A;  3CQF A;  2I3Y A;  2CVD A;  4MNN A;  1R7H A;  4ZL7 A;  4AJ7 A;  2LS5 A;  1GLP A;  2R37 A;  4K7I A;  2DKI A;  2C0D A;  3HXS A;  4ZIJ A;  1ABA A;  1BJX A;  1YEP A;  4HQZ A;  3DD3 A;  2RLI A;  1ZOF A;  2R4V A;  2N5A A;  2DML A;  2B1L A;  1F37 A;  5GST A;  2EIO A;  2YP6 A;  3GX8 A;  4X0X A;  3L78 A;  1NHO A;  2B5X A;  1JFU A;  1GP1 A;  2CAI A;  4GWR A;  4KW6 A;  1VF4 A;  3GNJ A;  2IIY A;  1R4W A;  1YKC A;  5DCH A;  1U3A A;  2NTO A;  1Q4J A;  3TUE A;  1B8X A;  3UIW A;  1XWG A;  1PKW A;  2XHF A;  1GSS A;  1U88 A;  2O7K A;  5C00 A;  3KTL A;  1BQ7 A;  3M9K A;  5BRT A;  2I4A A;  5JCW A;  1MEK A;  3GFK A;  4O32 A;  3F3R A;  4OCE A;  3IHQ A;  1GUM A;  4L5L A;  2YN1 A;  2KLX A;  2OJL A;  2YAN A;  5LD0 A;  5J4U A;  4EO3 A;  4BVY A;  5ECI B;  1SEN A;  3MNG A;  4IQA A;  4HQS A;  1E6B A;  4G9H A;  3GST A;  2YJ7 A;  3P7X A;  4I97 A;  2GSR A;  5LNK e;  4IKH A;  3D6I A;  2F8F A;  2OBK A;  1EGR A;  1B9Y C;  1XWA A;  1OE7 A;  3HVN A;  1X9S B;  3P90 A;  5F06 A;  1XG8 A;  4JED A;  2WCI A;  3EVI A;  4Q5N A;  1AW9 A;  2HYX A;  1AUC A;  4N0Z A;  2CV4 A;  2VCX A;  1SYR A;  3GUS A;  4GSN A;  1PGT A;  1FB0 A;  1TTZ A;  2PMT A;  2JZT A;  2V6O A;  3PGT A;  1T7P B;  2C0G A;  2DJK A;  1K0A A;  2CZ2 A;  1OC8 A;  3WT2 A;  1B4P A;  1WIK A;  1M3I A;  3VWV A;  2DMM A;  3GSS A;  2XC2 A;  14GS A;  4DVC A;  1IYH A;  5KN3 A;  1I5G A;  4PX1 A;  5JCU A;  20GS A;  2JSZ A;  4K7N A;  3KCM A;  5ECM B;  2B7K A;  4IN0 A;  2K9F A;  13GS A;  1N2A A;  1LBK A;  2LJA A;  4V2L A;  1UC7 A;  2QC7 A;  1DE1 A;  5F8B A;  1YY7 A;  4X1U A;  1ACV A;  4TXO A;  2IPA A;  5DAL A;  4EL1 A;  4MJB A;  2DLX A;  3BJ5 A;  4ECI A;  4DEJ A;  2H6Z A;  2GSQ A;  3U5R E;  4ECC A;  4CHS A;  3IA1 A;  4G0K A;  1FOV A;  1GWC A;  2QA2 A;  4BVY B;  1SU9 A;  2K8V A;  2P31 A;  3UBL A;  2MBS A;  1S3R A;  3E9J B;  1SJ6 A;  2VL3 A;  3HJM A;  2L59 A;  1NHY A;  6GSS A;  2OAD A;  3UVH A;  5IPG A;  3C8E A;  1PRX A;  1WWJ A;  2LST A;  1M0U A;  1FOH A;  4IVF A;  2KP1 A;  3ZMK A;  3ERF A;  4POB A;  1BYE A;  1M7T A;  3MDK A;  3I6A A;  3BD2 A;  5J5N A;  1MDI A;  3RDW A;  1DE2 A;  2GQM A;  1JZR A;  1USB A;  1E2Y A;  4YQM A;  3ZRE A;  2LRT A;  4MPF A;  3US3 A;  1EP7 A;  2FWE A;  1A8L A;  2GTU A;  3RHC A;  1GSE A;  3BBY A;  12GS A;  3FW2 A;  3IBH A;  3FY7 A;  1PN0 A;  2L4Q A;  2MYG A;  4JR6 A;  1W89 A;  4MZW A;  1THX A;  4KDU A;  1ERW A;  4ID0 A;  4N10 A;  2HRA A;  1OAZ A;  3EIN A;  4TRX A;  2RM6 A;  2AAW A;  3TB2 A;  4KCE A;  4V1A p;  4I5Q A;  4TOP A;  3WD6 A;  2KP2 A;  2JZS A;  3UJ1 A;  2P5R A;  2TIR A;  2PER A;  4G0I A;  2YCD A;  2EIR A;  4J56 E;  4BL7 A;  4ZL9 A;  4MH2 A;  3G7J A;  1AQW A;  5FT3 A;  4MJC A;  1ZYP A;  1O7U A;  1VF3 A;  4K2D A;  3C73 A;  2BMX A;  5DAL B;  1B9X C;  3ZZX A;  2GLR A;  1SJI A;  1ERV A;  2GT6 A;  1SL0 B;  2B3S A;  2IN3 A;  5G1K A;  2DJJ A;  2HE3 A;  3GMF A;  4EUY A;  4FIW A;  2HNL A;  4TXV A;  4OFN A;  2GS3 A;  5G30 A;  3ZIV A;  2A2P A;  3VUR A;  5EY6 A;  4OFT A;  3F4T A;  2IJY A;  4FYU A;  2C0F A;  2H76 A;  2CT6 A;  4ZB9 A;  4YKF A;  3FRC A;  1M2B A;  3FR9 A;  5IMD A;  1U87 A;  4ML1 A;  4O5U A;  1TRV A;  3M3M A;  2MMA A;  4RUV A;  2Z9S A;  3TGZ A;  1OC9 A;  3SWL A;  2QSI A;  2GZP A;  1KTE A;  1T8E B;  5E59 A;  3UAR A;  4G19 A;  2OE1 A;  1Z6N A;  2OE0 A;  1VF1 A;  5J3R A;  2OKA A;  5A5K A;  3QDN A;  4GCI A;  4IHU A;  2OBI A;  3D0Z A;  4BWQ A;  1MDK A;  4HJM A;  5DJM A;  1AXD A;  2IMK A;  3GN3 A;  2H8L A;  3D5J A;  1YDK A;  4RI7 A;  5ECL B;  1XFL A;  1ZGN A;  1JZW A;  4F82 A;  3ERG A;  1TDI A;  2F9S A;  2CVB A;  4ZIL A;  5ECP B;  1EGO A;  1SL1 B;  2DIY A;  3OR5 A;  5C04 A;  3W6G A;  4HOJ A;  5GAN D;  1X0R A;  2F8A A;  1W4V A;  4USS A;  3IAS 2;  2WGR A;  2YV7 A;  5ELA A;  2DIZ A;  3DXB A;  4MDC A;  2DKH A;  1PSQ A;  3FZ9 A;  3UVT A;  4BL7 B;  1V98 A;  1G7E A;  3TRX A;  4FYB A;  4EIP A;  3TJB A;  17GS A;  3RAZ A;  1Z6M A;  5D93 A;  2PN8 A;  4ICY A;  2FLS A;  3MYD A;  1PX6 A;  5IIZ A;  3RPN A;  5IO2 A;  3A2X A;  1WJK A;  1WP0 A;  3F4R A;  3DIE A;  3EPT A;  4EE0 A;  3E0U A;  3LG6 A;  3EU4 A;  2I1U A;  1X5C A;  2HSH A;  1O8X A;  1QQ2 A;  4Z2U A;  1WPI A;  4BVX B;  1JLV A;  3VI5 A;  2C1Y A;  3QAG A;  3M8N A;  1GH2 A;  2VUP A;  2RII A;  5HFI A;  2NVL A;  3HYP A;  2GQK A;  4PUR A;  2GQL A;  4ZL8 A;  1OC9 B;  3LFL A;  2WB9 A;  4CY6 A;  2LNT A;  2CVK A;  1B48 A;  1R26 A;  2YOI A;  2O89 A;  4Q5Q A;  3FYG A;  2H73 A;  5KEJ A;  3D4M A;  5D9V A;  2H71 A;  4F0C A;  2JAC A;  3VK9 A;  3UAP A;  3C71 A;  2F3M A;  1THO A;  5L71 A;  1ZMA A;  1QUW A;  2PU9 C;  3A5W A;  2D2Z A;  1YEX A;  3HCZ A;  5ID2 B;  1TI1 A;  3S9F A;  3CBU A;  3DWV A;  1FO5 A;  5DQY A;  2MMN A;  3C7M A;  4MF6 A;  2P5Q A;  2H6X A;  4K6X A;  1PD2 1;  2TRC P;  2ALB A;  5F05 A;  2H0I A;  3M0F A;  4QL9 A;  4PNG A;  3WGX A;  2R5G A;  5DAK A;  4V1A g;  2JAD A;  4LA1 A;  1OKD A;  3GUR A;  1XOA A;  3IC4 A;  1SL2 B;  3UL3 A;  5CRD A;  11GS A;  4KH7 A;  4ECJ A;  4EDZ A;  4KSO A;  4JZQ A;  1ILO A;  1X5E A;  3I43 A;  4EF0 A;  2CQ9 A;  4O5Q A;  2VCQ A;  4BA7 A;  1HNB A;  4KSM A;  3EE2 A;  3VWX A;  2H1G A;  1VRS D;  2V32 A;  4YAV A;  4Z2T A;  3W8S A;  1A24 A;  4AJ8 A;  2XPD A;  5CRE A;  1UA5 A;  2GVP A;  1GLQ A;  4MCU A;  3TRQ A;  1GSQ A;  4AJ6 A;  2DJ2 A;  3J7Y b; 
#chains in the Genus database with same CATH homology
 1QMV A;  2X49 A;  4K5R A;  2X4A A;  4POM A;  4WKW A;  1TW9 A;  2FNO A;  2ON7 A;  3U6V A;  4F2I A;  4CY8 A;  1X9W B;  3GL5 A;  3ZFB A;  1JLW A;  1A0R P;  1BG5 A;  5EPF A;  5ABR A;  4XS1 A;  1TRU A;  1DBY A;  3A5I A;  1YQ1 A;  1YF0 A;  6GST A;  5CRH A;  2HZF A;  2WUL A;  1Z3E A;  4CDO A;  5FHI A;  2H1D A;  5AIS A;  1TKD B;  3HY2 A;  4YH2 A;  5DJL A;  2E2G A;  3VWU A;  2HZE A;  1T3B A;  1SJZ A;  3RHB A;  2NPB A;  3HZ8 A;  5DAK B;  4HZ4 A;  1O8W A;  1CQH A;  4IEL A;  1PX7 A;  3PH9 A;  3DGQ A;  1QGV A;  1R5A A;  3ED3 A;  3LEF A;  2RUF A;  1UN2 A;  2YPM A;  4RI6 A;  3Q6O A;  3ZTL A;  1O73 A;  5ECO B;  2H70 A;  3GA4 A;  4IQ1 A;  22GS A;  2BJX A;  5JWR B;  2VD1 A;  3GL3 A;  1XW5 A;  2C4J A;  2V2G A;  2ZNM A;  1GTB A;  1Z5Y E;  4FYC A;  3J7Y k;  5J41 A;  3LXT A;  5AIX A;  1A0F A;  1AQV A;  2X8C A;  2X64 A;  5AN1 A;  4LLR A;  1GTA A;  3O76 A;  3ZML A;  3QPM A;  4HS1 A;  4GXZ A;  1XXU A;  3H4K A;  2IMI A;  1LJR A;  1TP9 A;  1GNW A;  2CA8 A;  3FR6 A;  4MK3 A;  3ZIT A;  4TR3 A;  3Q19 A;  2M46 A;  1BAY A;  4WET A;  2H0G A;  2JL4 A;  1F9M A;  1GNE A;  1X9M B;  3UOM A;  4XRD A;  1TI3 A;  3D22 A;  4A5P A;  2IWT A;  4MZC A;  2MBT A;  1V57 A;  3CYN A;  2QKE A;  1ZYN A;  4EXJ A;  1TXX A;  5G31 A;  3PIN A;  5A4V A;  1MD4 A;  4NPB A;  2HZE B;  5IOW A;  4HZ2 A;  2H74 A;  3EYT A;  1RW1 A;  1A8Y A;  4EC0 A;  4KGI A;  4NMU A;  4GST A;  2H66 A;  4PGT A;  1FB6 A;  4OWY A;  3WGD A;  2PGT A;  3ZLP A;  1AC1 A;  5F07 A;  3EU3 A;  3KMN A;  2R0G A;  3LSZ A;  3QCP A;  1WRY A;  2HXK A;  1K3O A;  4PXO A;  4TN8 A;  2DSA A;  4KA0 A;  2LQO A;  3VI7 A;  6GSV A;  2H1A A;  2J9H A;  3Q18 A;  3BOA A;  4WR5 A;  3KGK A;  2GDR A;  3A2W A;  4G0L A;  2O8V B;  4FH8 A;  3LYK A;  5GSS A;  2FWG A;  4ZBD A;  4ZXG A;  4X4J A;  4MMM A;  3KMO A;  4K9Z A;  3MWH A;  1EWX A;  4BWS A;  3L0H A;  2L5L A;  4KE3 A;  2XBI A;  2B5Y A;  4ISD A;  2GT5 A;  3FK8 A;  4IJ3 A;  2LRC A;  2LQQ A;  3IOS A;  4IS0 A;  5GZZ B;  2XBQ A;  1AAZ A;  4WR4 A;  4XS6 A;  4I6X A;  2N5F A;  2YJH A;  3O3T A;  5D9X A;  1FHE A;  1K0O A;  3E3E A;  3MIX A;  2GGT A;  5ENU A;  4TR4 A;  5IQY A;  3LW9 A;  2YWN A;  1ZCP A;  3IK7 A;  2ON5 A;  2H19 A;  4TXO B;  4MH3 A;  3M9J A;  3AY8 A;  3LJR A;  4NXI A;  5IM9 A;  2PPT A;  1BX9 A;  3F4S A;  3DRN A;  4ML6 A;  4TR1 A;  3TKQ A;  2H30 A;  2X8H A;  3CSI A;  2UZ8 A;  4I8B A;  2GZZ A;  1EOG A;  3R3E A;  4XCS A;  3VPT A;  4N30 A;  4PQ1 A;  4HJ2 A;  2MMO A;  2I9H A;  2VL9 A;  3CMI A;  5G5E A;  4Z2R A;  5CO3 A;  4AGS A;  1DUG A;  2F51 A;  4ULX A;  4YAP A;  6GSW A;  4IW9 A;  3I69 A;  2R6K A;  5D9T A;  2HT9 A;  2H01 A;  2J23 A;  4O7H A;  3QFB C;  2FWF A;  2X8G A;  2H0H A;  4K7O A;  3EMP A;  3KXO A;  2HFD A;  4P3Y B;  1R5P A;  3QMX A;  1AIU A;  3PPU A;  4POL A;  2YNX A;  2VOC A;  4H86 A;  4L8E A;  1N8J A;  3KH9 A;  2REM A;  2YV9 A;  2GST A;  1KNG A;  2N5B A;  2EC4 A;  2L57 A;  3KJY A;  5E4W A;  1PA3 A;  1GUK A;  1QFN A;  1XBS A;  1V2A A;  2ES7 A;  5H5S A;  1G6Y A;  4J57 E;  19GS A;  2LTK A;  1JZO A;  4LL4 B;  5ECQ B;  5JWO B;  3F0I A;  4EIQ A;  2M72 A;  4JU5 A;  4XIH A;  1ON4 A;  3TOU A;  1NM3 A;  3LOR A;  1XVQ A;  4D73 A;  3GV1 A;  2TRX A;  4YKG A;  3QAV A;  1AQX A;  2AYT A;  1G0T A;  1Z9H A;  3HKR A;  1M2D A;  2DJ3 A;  1SK0 A;  3TKS A;  3TOT A;  4NHW A;  2IL3 A;  3NIV A;  4MP4 A;  1TRW A;  2EIQ A;  4TR1 B;  1HNA A;  1A2M A;  3DYR A;  2A2R A;  4DSR A;  1FVK A;  3GKK A;  1VGL A;  3G7I A;  3DVW A;  5D9W A;  2VCW A;  4MZB A;  5ELG A;  2FWH A;  1GL8 A;  2GSS A;  4OMV A;  4PUF C;  3TRP A;  4X43 A;  2VLT A;  6GSX A;  4TKY A;  4IGJ A;  3QD9 A;  5B7C A;  1TK8 B;  3IPZ A;  3VLN A;  2GZY A;  2VM2 A;  2C8U A;  3WGE A;  3UMA A;  2VL2 A;  1ERT A;  1EV4 A;  2DC5 A;  3NOF A;  3IDV A;  2R0P A;  3LWA A;  1V9W A;  2VO4 A;  1S3A A;  2VCZ A;  5A4W A;  4ZBA A;  3FKF A;  4WBR D;  5G2Z A;  1CQG A;  3L9V A;  1TU8 A;  4K8M A;  2CZ3 A;  5D8I A;  4ACS A;  4KAE A;  4GQC A;  2PVQ A;  3NZN A;  1MD3 A;  1EOH A;  3KTB A;  1TJD A;  4F0B A;  1NSW A;  4ZB8 A;  6GSY A;  2K18 A;  2L6C A;  4O92 A;  1J08 A;  1K0N A;  1EEM A;  4YQV A;  1K0B A;  3WT1 A;  1K3L A;  1EP8 A;  3HDC A;  2FD3 A;  4D73 B;  4FO5 A;  4GLT A;  5ECS A;  4RQX A;  2V1M A;  2LJR A;  3KD0 A;  2OA7 A;  5HFK A;  3HA9 A;  3VWW A;  2RM5 A;  4GSS A;  5IOX A;  3TDG A;  2V41 A;  1M9A A;  4E8E A;  1TK5 B;  1MTC A;  4RQR A;  2FCH A;  3F6D A;  2E7P A;  5CNW A;  1QXH A;  5B8A A;  4WXT A;  2B5E A;  4V2M A;  4N11 A;  4DSS A;  3TKS C;  4IP6 A;  3VPQ A;  4V2N A;  4K0N A;  3GH9 A;  4GRF A;  4I2T A;  3F8U A;  4OCF A;  2BTO T;  2XPE A;  5IMV A;  1B4Q A;  3ZRD A;  1S3C A;  4XHM A;  6GSU A;  2WS2 A;  4OO5 A;  4PUA A;  3IE3 A;  4PNF A;  5IO0 A;  5KN2 A;  2VM1 A;  4AF2 A;  4HU9 A;  1G6W A;  3LGC A;  3CRT A;  3GKX A;  1GSD A;  4MF5 A;  3FZA A;  4MA9 A;  2L4C A;  4MPG A;  3ZFL A;  5HR2 A;  2HLS A;  5IMA A;  3CRU A;  1WMJ A;  3P8W A;  3JCM L;  2FUG 2;  2IFQ A;  2PBJ A;  4Q5R A;  2VL2 C;  4BPY A;  3I9V 2;  4MJA A;  4TR0 A;  4KX4 A;  18GS A;  1U6T A;  2I81 A;  1HNC A;  3ZL5 A;  1SKR B;  1MDJ A;  2CAQ A;  1F3A A;  1SD8 A;  3CSJ A;  1SKS B;  4E8H A;  1PKZ A;  4HDE A;  4TVE A;  5HFG A;  2PVO C;  3APS A;  1FVJ A;  2AB6 A;  3IV4 A;  4PQH A;  3LYP A;  1XWK A;  1IYI A;  3CTG A;  2A4H A;  2JSY A;  2HRF A;  3HJP A;  1XOB A;  4ECB A;  1S3D A;  4LMV A;  4OFM A;  4QL7 A;  1ML6 A;  3FEU A;  5KN0 A;  4WF5 A;  4IBP A;  3F9U A;  5LCZ A;  5DBQ A;  4DSS B;  4JR4 A;  4NHZ A;  2H72 A;  1T4Z A;  1EEJ A;  1OC3 A;  2G0F A;  5H5R A;  4WBJ A;  5DCG A;  4XRA A;  1C72 A;  5D96 A;  1PL2 A;  3G7Y A;  2C0E A;  3R2Q A;  4IJI A;  2MMZ A;  3GIX A;  3FHK A;  1FW1 A;  4YQU A;  3GX0 A;  1KBN A;  2FA8 A;  3FZ4 A;  4FQU A;  1GRX A;  2YZU A;  1OKT A;  2X99 A;  1GUL A;  1OE8 A;  1TRS A;  3PR8 A;  1WOU A;  3KEB A;  1X5D A;  3HD5 A;  3BCI A;  4K2X A;  3IRA A;  1K0M A;  1ZYQ B;  2IFQ B;  5ECR B;  7GSS A;  2VIM A;  3G9B A;  3N5O A;  2PWJ A;  4WF4 A;  3D21 A;  4HU7 A;  5GAP D;  4NAX A;  3IAM 2;  4MJE A;  1H4O A;  4WEY A;  1G7O A;  4OO4 A;  1O81 A;  3QR6 A;  2B7J A;  4F03 A;  1BED A;  3Q74 A;  2VCV A;  1FG4 A;  1U3I A;  4HEA 2;  3KIJ A;  4ZB6 A;  3M1G A;  2DJ1 A;  4LMW A;  5IMZ A;  3APQ A;  1OVN A;  2DBC A;  1GSF A;  2H6Y A;  1Y25 A;  4EDY A;  3FMW A;  3KP9 A;  2LNS A;  1RQM A;  3IK9 A;  3UBK A;  3C1S A;  3F6F A;  5G1L A;  3TJG A;  1A2L A;  2AUV A;  5HR1 A;  1Z7P A;  2WZ9 A;  2JU5 A;  3IXR A;  3IHG A;  3ZVJ D;  4L0U A;  4JE1 A;  2C3T A;  1M2A A;  4TW5 A;  3SBC A;  4GQF A;  1M99 A;  2C3N A;  1URM A;  2LKU A;  5JCG A;  3VFI A;  1HQO A;  4L0W A;  1V58 A;  1KEB A;  3TJK A;  1XW6 A;  4GF0 A;  1HD2 A;  1F6M C;  4J2F A;  5G5F A;  1SK2 A;  1RK4 A;  3TKS E;  2C3Q A;  5KN1 A;  2LJK A;  2FGX A;  3GTU A;  1UVZ A;  4MAB A;  4KUN A;  4I2U A;  4EVM A;  1PMT A;  5A4U A;  3C1R A;  2ZUP A;  3DKS A;  5BMU A;  1HYU A;  5INY A;  4NV2 A;  3TJJ A;  1LU4 A;  2B1K A;  5ECH B;  1V40 A;  5B6M A;  4ZBB A;  1ZZY A;  3GKM A;  2YZH A;  4KF9 A;  3GHA A;  9GSS A;  2CX4 A;  1TOF A;  3HHV A;  1O85 A;  3ISO A;  1F3B A;  4JRR A;  5ECK B;  1Y6E A;  2E0Q A;  3K8N A;  4HUA A;  1K3Y A;  2OAC A;  1XIY A;  4CW9 A;  1EZK A;  2PUK C;  1XVW A;  4KB3 A;  8GSS A;  3GRX A;  3CSH A;  1GUH A;  3H1N A;  4K1F A;  4PTS A;  2A4V A;  4XS4 A;  1F2E A;  3HVX A;  3FR3 A;  5DDL A;  3ZYW A;  1M9B A;  1J0F A;  3EWL A;  5HR0 A;  3LQ7 A;  3HJO A;  2FY6 A;  1YF1 A;  3ERW A;  2VAF A;  5IPH A;  2L5O A;  2WJU A;  2YWM A;  1GSU A;  1A23 A;  2YWO A;  4GTU A;  4G10 A;  1SK1 A;  2VLU A;  2OE3 A;  2R2J A;  5COH A;  4Q5F A;  1PQN A;  3A2V A;  1XW9 A;  2L6D A;  4EKZ A;  4KCA A;  5J9B A;  1ZYE A;  3H93 A;  3H79 A;  3TKP A;  1PL1 A;  4KDY A;  5CAX A;  4OD7 A;  2NBS A;  3TCO A;  5HQP A;  3RBT A;  3GTU B;  3LXZ A;  2FA4 A;  2B6M A;  1T4Y A;  3KZQ A;  1XWC A;  2HI7 A;  4ILF A;  4NWY A;  3BCK A;  4BVX A;  2AHE A;  4HI7 A;  2FHE A;  1VF2 A;  3DML A;  5D73 A;  2HSM A;  3D4T A;  4IP1 A;  4L5O A;  2G2Q A;  3FZ5 A;  3ME7 A;  1DSB A;  2QA1 A;  1Q98 A;  3HZ4 A;  5EL8 A;  2WRT A;  3DVX A;  3HVV A;  5IMC A;  5B8B A;  3EC3 A;  2VLV A;  5F0G A;  5KOW A;  2K6V A;  2IMD A;  1GSY A;  1K0C A;  5EVO A;  3W8J A;  4O5R A;  3A3T A;  10GS A;  2HRK A;  3O6T A;  1XPV A;  2ZCT A;  3QOU A;  2H1B A;  2C80 A;  2CX3 A;  2KHP A;  2QGV A;  4XS4 B;  16GS A;  1H75 A;  2VCT A;  3TKR A;  5ID2 A;  2V6K A;  3H8Q A;  3HVS A;  3MAK A;  3KH7 A;  2KUC A;  3QAW A;  3DEX A;  2IMF A;  1TU7 A;  4F9Z A;  2LEG A;  4Z7X A;  5KOX A;  3APO A;  4QQ7 A;  5IMF A;  2JZR A;  3CTF A;  2K8S A;  3V1W A;  4KDX A;  3L9U A;  1OYJ A;  3F63 A;  3KP8 A;  3L9S A;  1PN9 A;  3EMX A;  1NW2 A;  5DQS A;  3GKN A;  1YJ6 A;  2O85 A;  3IC8 A;  1ST9 A;  2WFC A;  1XWB A;  2AV4 A;  2MZC A;  2LRN A;  2VD0 A;  5CRW A;  2A2S A;  5H5Q A;  2DJ0 A;  3TJF A;  4MF7 A;  4JBB A;  2LV3 A;  2E2M A;  1J9B A;  3WYW A;  3KM6 A;  1XCC A;  3F3Q A;  3ZIJ A;  3IR4 A;  5JWQ B;  1T1V A;  5B6N A;  2RUE A;  5CYY A;  1SKW B;  2AJQ B;  4MLY A;  2NDO A;  3RPP A;  5DVB A;  2H75 A;  2O87 A;  4G2E A;  1QK8 A;  4PQI A;  1K0D A;  5HR3 A;  1SD9 A;  5AGY A;  3L4N A;  5FWG A;  2YWI A;  1TK0 B;  1WE0 A;  3UEM A;  2KOK A;  3N9J A;  3MSZ A;  3CXG A;  5ECN B;  1ERU A;  2HRN A;  1Z7R A;  1A2J A;  4DSQ A;  1T00 A;  4N0V A;  1JHB A;  1EV9 A;  3ME8 A;  2WDU A;  5CP1 A;  2P0G A;  2R0C A;  5CRG A;  3QFA C;  4K0G A;  1SYX A;  4POK A;  5AIV A;  1ZL9 A;  3GH6 A;  1YZX A;  1XZO A;  4LL1 B;  3GYK A;  2IME A;  3P2A A;  4NV5 A;  1O6J A;  4K5S A;  2M80 A;  2R3X A;  1JZD A;  4XTS A;  1FAA A;  1I9D A;  1GTU A;  3EUR A;  2LUS A;  1GTI A;  3ZVJ A;  5J9C A;  1YKA A;  2HSY A;  4KND A;  2I3Y A;  2CVD A;  4MNN A;  1R7H A;  4ZL7 A;  4AJ7 A;  2LS5 A;  1GLP A;  2R37 A;  4K7I A;  2DKI A;  2C0D A;  3HXS A;  4ZIJ A;  1ABA A;  1BJX A;  1YEP A;  4HQZ A;  3DD3 A;  2RLI A;  1ZOF A;  2R4V A;  2N5A A;  2DML A;  2B1L A;  1F37 A;  5GST A;  2EIO A;  2YP6 A;  3GX8 A;  4X0X A;  3L78 A;  1NHO A;  2B5X A;  1JFU A;  1GP1 A;  2CAI A;  4GWR A;  4KW6 A;  1VF4 A;  3GNJ A;  2IIY A;  1R4W A;  1YKC A;  5DCH A;  1U3A A;  2NTO A;  1Q4J A;  3TUE A;  1B8X A;  3UIW A;  1XWG A;  1PKW A;  2XHF A;  1GSS A;  1U88 A;  2O7K A;  5C00 A;  3KTL A;  1BQ7 A;  3M9K A;  5BRT A;  2I4A A;  5JCW A;  1MEK A;  3GFK A;  4O32 A;  3F3R A;  4OCE A;  3IHQ A;  1GUM A;  4L5L A;  2YN1 A;  2KLX A;  2OJL A;  2YAN A;  5LD0 A;  5J4U A;  4EO3 A;  4BVY A;  5ECI B;  1SEN A;  3MNG A;  4IQA A;  4HQS A;  1E6B A;  4G9H A;  3GST A;  2YJ7 A;  3P7X A;  4I97 A;  2GSR A;  5LNK e;  4IKH A;  3D6I A;  2F8F A;  2OBK A;  1EGR A;  1B9Y C;  1XWA A;  1OE7 A;  1X9S B;  3P90 A;  5F06 A;  4JED A;  2WCI A;  3EVI A;  4Q5N A;  1AW9 A;  2HYX A;  1AUC A;  4N0Z A;  2CV4 A;  2VCX A;  1SYR A;  3GUS A;  4GSN A;  1PGT A;  1FB0 A;  1TTZ A;  2PMT A;  2JZT A;  2V6O A;  3PGT A;  1T7P B;  2C0G A;  2DJK A;  1K0A A;  2CZ2 A;  1OC8 A;  3WT2 A;  1B4P A;  1WIK A;  3VWV A;  2DMM A;  3GSS A;  2XC2 A;  14GS A;  4DVC A;  1IYH A;  5KN3 A;  1I5G A;  4PX1 A;  5JCU A;  20GS A;  2JSZ A;  4K7N A;  3KCM A;  5ECM B;  2B7K A;  4IN0 A;  2K9F A;  13GS A;  1N2A A;  1LBK A;  2LJA A;  4V2L A;  1UC7 A;  2QC7 A;  1DE1 A;  5F8B A;  1YY7 A;  4X1U A;  1ACV A;  4TXO A;  2IPA A;  5DAL A;  4EL1 A;  4MJB A;  2DLX A;  3BJ5 A;  4ECI A;  4DEJ A;  2H6Z A;  2GSQ A;  3U5R E;  4ECC A;  4CHS A;  3IA1 A;  4G0K A;  1FOV A;  1GWC A;  2QA2 A;  4BVY B;  1SU9 A;  2K8V A;  2P31 A;  3UBL A;  2MBS A;  3E9J B;  1SJ6 A;  2VL3 A;  3HJM A;  2L59 A;  1NHY A;  6GSS A;  2OAD A;  3UVH A;  5IPG A;  3C8E A;  1PRX A;  1WWJ A;  2LST A;  1M0U A;  1FOH A;  4IVF A;  2KP1 A;  3ZMK A;  3ERF A;  4POB A;  1BYE A;  1M7T A;  3MDK A;  3I6A A;  3BD2 A;  5J5N A;  1MDI A;  3RDW A;  1DE2 A;  2GQM A;  1JZR A;  1USB A;  1E2Y A;  4YQM A;  3ZRE A;  2LRT A;  4MPF A;  3US3 A;  1EP7 A;  2FWE A;  1A8L A;  2GTU A;  3RHC A;  1GSE A;  3BBY A;  12GS A;  3FW2 A;  3IBH A;  3FY7 A;  1PN0 A;  2L4Q A;  2MYG A;  4JR6 A;  1W89 A;  4MZW A;  1THX A;  4KDU A;  1ERW A;  4ID0 A;  4N10 A;  2HRA A;  1OAZ A;  3EIN A;  4TRX A;  2RM6 A;  2AAW A;  3TB2 A;  4KCE A;  4V1A p;  4I5Q A;  4TOP A;  3WD6 A;  2KP2 A;  2JZS A;  3UJ1 A;  2P5R A;  2TIR A;  2PER A;  4G0I A;  2YCD A;  2EIR A;  4J56 E;  4BL7 A;  4ZL9 A;  4MH2 A;  3G7J A;  1AQW A;  5FT3 A;  4MJC A;  1ZYP A;  1O7U A;  1VF3 A;  4K2D A;  3C73 A;  2BMX A;  5DAL B;  1B9X C;  3ZZX A;  2GLR A;  1SJI A;  1ERV A;  2GT6 A;  1SL0 B;  2B3S A;  2IN3 A;  5G1K A;  2DJJ A;  2HE3 A;  3GMF A;  4EUY A;  4FIW A;  2HNL A;  4TXV A;  4OFN A;  2GS3 A;  5G30 A;  3ZIV A;  2A2P A;  3VUR A;  5EY6 A;  4OFT A;  3F4T A;  2IJY A;  4FYU A;  2C0F A;  2H76 A;  2CT6 A;  4ZB9 A;  4YKF A;  3FRC A;  1M2B A;  3FR9 A;  5IMD A;  1U87 A;  4ML1 A;  4O5U A;  1TRV A;  3M3M A;  2MMA A;  4RUV A;  2Z9S A;  3TGZ A;  1OC9 A;  3SWL A;  2QSI A;  2GZP A;  1KTE A;  1T8E B;  5E59 A;  3UAR A;  4G19 A;  2OE1 A;  1Z6N A;  2OE0 A;  1VF1 A;  5J3R A;  2OKA A;  5A5K A;  3QDN A;  4GCI A;  4IHU A;  2OBI A;  3D0Z A;  4BWQ A;  1MDK A;  4HJM A;  5DJM A;  1AXD A;  2IMK A;  3GN3 A;  2H8L A;  3D5J A;  1YDK A;  4RI7 A;  5ECL B;  1XFL A;  1ZGN A;  1JZW A;  4F82 A;  3ERG A;  1TDI A;  2F9S A;  2CVB A;  4ZIL A;  5ECP B;  1EGO A;  1SL1 B;  2DIY A;  3OR5 A;  5C04 A;  3W6G A;  4HOJ A;  5GAN D;  1X0R A;  2F8A A;  1W4V A;  4USS A;  3IAS 2;  2WGR A;  2YV7 A;  5ELA A;  2DIZ A;  3DXB A;  4MDC A;  2DKH A;  1PSQ A;  3FZ9 A;  3UVT A;  4BL7 B;  1V98 A;  1G7E A;  3TRX A;  4FYB A;  4EIP A;  3TJB A;  17GS A;  3RAZ A;  1Z6M A;  5D93 A;  2PN8 A;  4ICY A;  2FLS A;  3MYD A;  1PX6 A;  5IIZ A;  3RPN A;  5IO2 A;  3A2X A;  1WJK A;  1WP0 A;  3F4R A;  3DIE A;  3EPT A;  4EE0 A;  3E0U A;  3LG6 A;  3EU4 A;  2I1U A;  1X5C A;  2HSH A;  1O8X A;  1QQ2 A;  4Z2U A;  1WPI A;  4BVX B;  1JLV A;  3VI5 A;  2C1Y A;  3QAG A;  3M8N A;  1GH2 A;  2VUP A;  2RII A;  5HFI A;  2NVL A;  3HYP A;  2GQK A;  4PUR A;  2GQL A;  4ZL8 A;  1OC9 B;  3LFL A;  2WB9 A;  4CY6 A;  2LNT A;  2CVK A;  1B48 A;  1R26 A;  2YOI A;  2O89 A;  4Q5Q A;  3FYG A;  2H73 A;  5KEJ A;  3D4M A;  5D9V A;  2H71 A;  4F0C A;  2JAC A;  3VK9 A;  3UAP A;  3C71 A;  2F3M A;  1THO A;  5L71 A;  1ZMA A;  1QUW A;  2PU9 C;  3A5W A;  2D2Z A;  1YEX A;  3HCZ A;  5ID2 B;  1TI1 A;  3S9F A;  3CBU A;  3DWV A;  1FO5 A;  5DQY A;  2MMN A;  3C7M A;  4MF6 A;  2P5Q A;  2H6X A;  4K6X A;  1PD2 1;  2TRC P;  2ALB A;  5F05 A;  2H0I A;  3M0F A;  4QL9 A;  4PNG A;  3WGX A;  2R5G A;  5DAK A;  4V1A g;  2JAD A;  4LA1 A;  1OKD A;  3GUR A;  1XOA A;  3IC4 A;  1SL2 B;  3UL3 A;  5CRD A;  11GS A;  4KH7 A;  4ECJ A;  4EDZ A;  4KSO A;  4JZQ A;  1ILO A;  1X5E A;  3I43 A;  4EF0 A;  2CQ9 A;  4O5Q A;  2VCQ A;  4BA7 A;  1HNB A;  4KSM A;  3EE2 A;  3VWX A;  2H1G A;  1VRS D;  2V32 A;  4YAV A;  4Z2T A;  3W8S A;  1A24 A;  4AJ8 A;  2XPD A;  5CRE A;  1UA5 A;  2GVP A;  1GLQ A;  4MCU A;  3TRQ A;  1GSQ A;  4AJ6 A;  2DJ2 A;  3J7Y b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...