1Z5YE

Crystal structure of the disulfide-linked complex between the n-terminal domain of the electron transfer catalyst dsbd and the cytochrome c biogenesis protein ccmg
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
136
structure length
136
Chain Sequence
RLESLDNPGQFYQADVLTQGKPVLLNVWATWCPTSRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYSKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/biosynthetic protein
molecule keywords Thiol:disulfide interchange protein dsbD
publication title Structural Basis and Kinetics of DsbD-Dependent Cytochrome c Maturation
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2005-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z5yE00
4KNDA 5IO0A 3ERFA 5JCWA 4BL7A 6GSWA 4TVEA 2GT6A 1I5GA 3IK9A 4ZL7A 1R5AA 2N5FA 4IQ1A 5HFKA 2X64A 4MJBA 3TJKA 1YEXA 2V6OA 2R2JA 1OKDA 3KCMA 4HI7A 3DEXA 1WOUA 3L4NA 1OC9A 5HR0A 1SJ6A 3EE2A 2VIMA 5IIZA 4FIWA 3D22A 2C3NA 4N11A 2Z9SA 1BG5A 3CSIA 2L6CA 5AISA 3KM6A 2H1AA 2KLXA 1ML6A 1TI3A 3F0IA 2LKUA 1M7TA 2OE3A 4I97A 3QOUA 3UL3A 3UVHA 3O76A 2IJYA 3UIWA 3LWAA 1A8YA 2VCQA 3M9KA 4IGJA 1UC7A 2CVDA 2R3XA 3TCOA 1YEPA 3H1NA 2I3YA 1VF4A 1M0UA 3GL5A 3CMIA 4O92A 3TKQA 3US3A 3ZRDA 5DQSA 2HT9A 1B8XA 4KGIA 4MZWA 1DUGA 4V2MA 3GX8A 7GSSA 2F9SA 2YJHA 3PINA 1N8JA 3D4MA 1G7EA 5F05A 3F63A 1JZRA 4IW9A 4K0NA 1TTZA 2LJAA 5ID2B 3C1RA 3TKSC 2H0IA 2IFQB 1SENA 3I69A 4MZCA 2H1BA 1TU7A 1XZOA 2MBSA 1GWCA 3BBYA 4JE1A 2PMTA 5CRDA 5GSTA 5KN2A 1QXHA 2NVLA 4J2FA 1GTBA 5DVBA 5IMDA 3LGCA 4EDYA 5JWQB 1B4PA 2FLSA 3SBCA 4F03A 3KEBA 4YQMA 3ZVJA 2JSZA 2CQ9A 1U88A 3HJMA 3E9JB 4YQVA 1PX7A 3IR4A 1HD2A 1UN2A 1FOVA 4AJ7A 5IQYA 6GSYA 1U6TA 2OADA 2CZ2A 5AIVA 2L59A 3NZNA 3M8NA 3FR6A 20GSA 4OMVA 1GLPA 2FUG2 3IPZA 4XS4A 1PQNA 4EKZA 4G19A 2RUFA 3L9SA 1G6WA 3ZFLA 3ZVJD 4JR6A 5DALA 1MDKA 3WYWA 2GT5A 8GSSA 4NV2A 1Z6NA 2A4VA 4BVYA 3LEFA 4TXVA 1U3IA 3CXGA 3ZYWA 1F3AA 3VI7A 3A5WA 2R5GA 3GUSA 3DIEA 5H5QA 2JADA 4AF2A 2GSSA 5JWOB 1B9YC 3ZIVA 4JBBA 1SKSB 2YWIA 2K9FA 1O85A 2CX4A 4GSSA 5KN0A 3VURA 3TJJA 1FAAA 1F3BA 3PR8A 2VAFA 5CRWA 3GKXA 4TR3A 2HNLA 2YWOA 1GLQA 1NW2A 1T7PB 2P5QA 3WGXA 3ZTLA 3UARA 1JZWA 1PD21 4I6XA 3W8SA 2LV3A 3O6TA 3QPMA 1N2AA 3I43A 2CX3A 3RHCA 1DBYA 2VLUA 1PSQA 1HNAA 4HOJA 3TKRA 1QK8A 4Q5QA 1SD8A 1QUWA 2DMLA 5GAPD 2HE3A 4JU5A 1XPVA 2KHPA 5GSSA 2C0FA 3QAWA 4BPYA 4EO3A 1QGVA 5G31A 3UBKA 4MH3A 1R4WA 3N5OA 1ILOA 2I9HA 2J23A 2WS2A 5ECNB 1ERTA 2C8UA 1J9BA 5JCUA 4TRXA 5CYYA 1WE0A 1GSFA 3UJ1A 4K9ZA 3F8UA 3ZMLA 4ACSA 1WPIA 1SJZA 2N5AA 1X0RA 1BJXA 3TRQA 1J08A 4POBA 2QKEA 3GH9A 1XBSA 4ZXGA 4TR1B 3HKRA 2LSTA 3GSTA 1AQXA 1JHBA 5J4UA 1V9WA 3LG6A 1HNBA 1QMVA 2CZ3A 4N0VA 2LJKA 1WRYA 1ACVA 1Z7PA 4TW5A 3ZITA 1JLWA 1X9WB 4IN0A 4ECJA 5D9TA 2FY6A 2LRNA 1ZGNA 2VCTA 4ECCA 2K8SA 4HQSA 3HHVA 1KNGA 1SKRB 2HRFA 2K8VA 5GZZB 4HU9A 3GKKA 5F06A 2O8VB 2OBKA 3TDGA 4K2DA 3ZZXA 4TKYA 1O81A 1TW9A 16GSA 3R2QA 3MNGA 1YDKA 2FWFA 2B1LA 4IVFA 1K3YA 3BCIA 3UVTA 3N9JA 2GLRA 1QFNA 4ZBDA 1IYHA 1W89A 3C7MA 3GX0A 4GSNA 4ZL9A 4X0XA 2LS5A 1K0CA 1OAZA 2F3MA 2F8AA 1WWJA 3F4RA 4MF5A 3WGEA 3TKPA 4OO5A 5CNWA 1TU8A 2F8FA 5ELGA 5IOXA 3FYGA 1XOAA 4V1Ap 4HZ4A 5G2ZA 3QFAC 3UMAA 4L8EA 1GSEA 2RIIA 18GSA 3HD5A 3FHKA 1M9BA 3NIVA 5CAXA 5CREA 3D21A 1YKAA 2HSHA 2V32A 5FWGA 1AW9A 10GSA 2CA8A 3HCZA 2L4QA 4KE3A 3BCKA 3TGZA 1OC3A 5HFGA 1X9MB 1VF2A 4K0GA 1SK2A 5HR3A 2KOKA 2H30A 3MDKA 1XVQA 2P0GA 1ERUA 2H72A 1PX6A 3KP9A 2H75A 3KTBA 3KH9A 4PXOA 4FYUA 1GSDA 6GSVA 2CV4A 3C1SA 1XIYA 2PN8A 3MWHA 4LMVA 4X43A 3M0FA 3M1GA 2D2ZA 4L0WA 1PMTA 5IOWA 4GRFA 1K0NA 3BOAA 1Z3EA 3GL3A 9GSSA 4OCEA 4EF0A 3BJ5A 1PL2A 3DVXA 4PUFC 3KH7A 1OC8A 1PKWA 2DJJA 4E8HA 2RLIA 4IS0A 4XS4B 3VPTA 5DQYA 2DJ2A 2YANA 2PERA 4V2NA 3H79A 1EOGA 2WJUA 2H74A 5DALB 1AQVA 4JRRA 3P90A 4XS1A 2XPEA 2XBQA 2F51A 1FB6A 3FZ5A 3F4TA 3L0HA 5HFIA 3ISOA 4GXZA 1K0BA 2XBIA 4LLRA 4PGTA 1KEBA 3AY8A 3GH6A 4LMWA 1K3OA 2GZYA 2YCDA 2B3SA 2C0DA 1YJ6A 2E2GA 2CT6A 1BAYA 1E2YA 4XRDA 5ECMB 3GKMA 1BQ7A 1PRXA 4TR1A 4EUYA 3GFKA 5A4WA 3GA4A 5INYA 1A2MA 3DYRA 2EIRA 2H0HA 2I4AA 1V40A 1O7UA 5G1KA 4ZB6A 1Z9HA 4HEA2 3D5JA 4I2UA 2H19A 1OYJA 3QDNA 1F2EA 2O85A 1NHYA 3RAZA 3MAKA 1FVJA 2E7PA 5IMAA 3A2WA 2G2QA 3DVWA 2EIOA 5D9WA 2EC4A 3HZ4A 1HNCA 2VL2C 5AGYA 2C0GA 2IIYA 3ZIJA 3RBTA 2OJLA 4DVCA 4E8EA 1ERVA 1YF0A 2K6VA 1S3DA 2QGVA 3HJOA 3HXSA 2VL3A 1GP1A 3CTFA 1GRXA 5CRGA 4EE0A 4CDOA 1THOA 2DJ1A 4LL4B 3ZLPA 1LJRA 5G1LA 1XWKA 4K8MA 1ZZYA 3CSJA 5CO3A 1QQ2A 4NAXA 17GSA 5GAND 4MJEA 2OACA 2VCZA 2REMA 3G9BA 3VWXA 4MZBA 5ECSA 2HYXA 1LBKA 1M2BA 3ERGA 2G0FA 2V6KA 2GSRA 1C72A 3I9V2 4WEYA 1T4YA 3MSZA 3LQ7A 4HJMA 2X8GA 4O5RA 3EMPA 4EL1A 2B5XA 3SWLA 2WDUA 4OWYA 2H0GA 2KUCA 1YQ1A 2AYTA 1GTUA 4G10A 4KDYA 4WF5A 1Q98A 1E6BA 2YV9A 2WB9A 2VO4A 3O3TA 3L78A 1F6MC 1XVWA 3KIJA 1AC1A 3P7XA 4JZQA 1EV4A 4NWYA 5H5RA 1V98A 4CW9A 3IA1A 2HFDA 1CQGA 2V1MA 1S3AA 1K0OA 1V57A 5AN1A 2K18A 3ED3A 3RPPA 1EGOA 3KP8A 4NV5A 1XWCA 3FEUA 2I1UA 5ECPB 2P5RA 4L5LA 1GH2A 2YZHA 3CYNA 2L5OA 4TR0A 3TUEA 1G6YA 3UAPA 2VOCA 4PQ1A 2H8LA 1Z6MA 3KTLA 3V1WA 4D73B 3NOFA 1TK0B 4ECBA 2OE1A 4WF4A 4GSTA 3QMXA 3TKSA 12GSA 4WBJA 1GNWA 5KEJA 2XC2A 4EXJA 4FO5A 2PU9C 2AB6A 3EINA 1A8LA 3D6IA 4EVMA 2ZUPA 3U6VA 1T8EB 3FRCA 4KSOA 5J5NA 3WT1A 4G2EA 3LYKA 3KMOA 1SD9A 4KX4A 4PQHA 2PVQA 3DRNA 4PQIA 2HZEB 1MDJA 2VCVA 3TJBA 5COHA 2JU5A 1PA3A 5ECIB 2VM1A 2IMKA 1TRUA 4BVXA 2IN3A 3HVVA 4DSSB 1OE7A 2C1YA 1R5PA 1GL8A 1ABAA 4TXOA 2H6ZA 2B7JA 1XOBA 3GV1A 5IPGA 5DAKA 4FYCA 22GSA 3WGDA 3FW2A 3VPQA 5C00A 2WGRA 3Q74A 4K7NA 2GSQA 2FWEA 3IHQA 4XRAA 4N30A 1X5EA 2VLTA 4QL9A 3KXOA 3F3RA 5LD0A 19GSA 2L4CA 2JZTA 2B5EA 2CAIA 1ZOFA 1J0FA 6GSTA 4POLA 3CBUA 5FHIA 4Q5RA 4WKWA 2VM2A 3ME7A 5IMFA 2FHEA 4KA0A 1WIKA 4ULXA 1XW6A 1K0MA 4O7HA 1V58A 1XFLA 1LU4A 3F6DA 2GQKA 2PVOC 3CRUA 1AXDA 2P31A 1GULA 4KDXA 2WULA 4NMUA 3D4TA 1YY7A 5EVOA 4PX1A 4L5OA 1PGTA 4ZBBA 13GSA 1JLVA 2DMMA 5AIXA 4IHUA 4HQZA 1BYEA 4EC0A 3A2XA 2RM6A 5ECQB 4XS6A 2HRNA 2KP1A 2LRCA 1X9SB 2FA8A 1R7HA 2PWJA 2R37A 3TJGA 4X1UA 2RM5A 5IPHA 2V2GA 1ST9A 4POKA 1A2JA 3DXBA 2HLSA 3RHBA 4KB3A 5G30A 2GQLA 1EOHA 4MA9A 3J7Yk 3IC4A 2WCIA 3EWLA 5EY6A 2MZCA 2YOIA 1MD4A 4NHZA 2B7KA 3TRPA 2AJQB 2MMOA 3DMLA 3DWVA 2M80A 2X99A 1GSUA 4ID0A 5DCGA 1OE8A 1XXUA 4HJ2A 2PGTA 1EWXA 1O8XA 3HVXA 5D73A 1TRSA 3C73A 3I6AA 5IM9A 1I9DA 5HR1A 3LYPA 4LL1B 1TJDA 1ZMAA 5CP1A 2L5LA 4D73A 4POMA 1Z7RA 1SL0B 4J56E 5EPFA 3QR6A 3HA9A 1TRVA 2C3QA 5DDLA 1AUCA 4MMMA 3CSHA 4H86A 2HXKA 4XHMA 4V1Ag 5H5SA 4XTSA 2MYGA 2GDRA 4KCAA 3DGQA 2DBCA 2LRTA 2WFCA 4MP4A 2ALBA 3FZ4A 2L57A 2IWTA 3GTUA 2M72A 2HZEA 2TRXA 3EC3A 2XPDA 5B8BA 1PKZA 3L9VA 4DSSA 5J41A 4MABA 2YZUA 5ABRA 3VK9A 3KJYA 5IO2A 4KCEA 2IMEA 1GNEA 1WMJA 5ECLB 3F4SA 3PH9A 3IE3A 4F0BA 2ZNMA 2H70A 3FY7A 3TOUA 3H93A 5HR2A 2H6XA 1T4ZA 2AAWA 4GCIA 1GUMA 2FNOA 3UBLA 5DJMA 2NTOA 5CRHA 3GKNA 2IPAA 4WBRD 1UVZA 4O32A 1M2AA 4FYBA 3IDVA 4ZB8A 3WD6A 2IMFA 1YZXA 3IXRA 2GS3A 1Y6EA 3HDCA 2C0EA 5DJLA 1B4QA 1G0TA 1PL1A 4OFTA 3FKFA 1FO5A 2NDOA 2R4VA 3PGTA 3TJFA 4YQUA 4YAVA 2FA4A 4LA1A 5IMVA 1XW9A 2C80A 3F3QA 1ZYQB 3LFLA 1S3CA 2DSAA 3GURA 1GUHA 1FVKA 4RI7A 1GSQA 5E4WA 2ON5A 3D0ZA 1A0RP 1SL2B 3VWUA 4YH2A 3WT2A 2MMZA 3A3TA 2YWMA 3APOA 2HSYA 2YPMA 2IL3A 4AJ6A 5J9CA 2DIZA 1DSBA 3EU4A 6GSSA 5B8AA 1THXA 4TXOB 4KDUA 2NPBA 2H66A 3VLNA 1EEMA 1TI1A 5DAKB 4IQAA 2LNTA 2TIRA 3P2AA 2MBTA 4MJCA 5IMZA 1AAZA 1Y25A 2C4JA 3IV4A 1VF3A 1M99A 2GVPA 4RUVA 4ECIA 3JCML 4RI6A 4MCUA 5A4VA 2PPTA 3QD9A 2YV7A 1TRWA 2GZPA 4XIHA 4ZBAA 5B6MA 1A2LA 1NSWA 4OFMA 1Z5YE 3LSZA 1BX9A 3HY2A 4F2IA 1EZKA 2LJRA 2BMXA 2AUVA 2L6DA 3IAM2 1TK5B 5KN3A 1GTIA 5G5FA 4OCFA 4TR4A 3EYTA 1HQOA 1ZCPA 2JL4A 1TOFA 3W8JA 3TOTA 4N0ZA 2NBSA 1M9AA 2E0QA 3KD0A 5D9XA 1X5DA 2H01A 3OR5A 3P8WA 1TDIA 4MJAA 1TKDB 2YWNA 1Q4JA 2YNXA 5B7CA 1HYUA 1SJIA 4I5QA 1EP8A 1U3AA 3FZAA 4TOPA 3GYKA 4OO4A 3TB2A 3VWVA 2YJ7A 5KN1A 4GF0A 2VL2A 4JEDA 3L9UA 4MF7A 1F9MA 4JR4A 4IBPA 2LNSA 3ZMKA 1XWGA 4OFNA 4KSMA 3APQA 4J57E 4HZ2A 2H73A 1GTAA 4N10A 3F9UA 3HJPA 2B5YA 5LNKe 3KZQA 2JACA 1G7OA 2OKAA 5A4UA 1ZYEA 3LXTA 2I81A 5B6NA 2GSTA 1SK0A 4NXIA 3ZREA 4PUAA 1EV9A 3DKSA 4IP6A 3EURA 3DD3A 4HDEA 1MDIA 1A0FA 5DBQA 3M3MA 4DSRA 1BEDA 4HUAA 2CVBA 2EIQA 3ZFBA 4IP1A 3CTGA 5D93A 2VD0A 3QAVA 3C8EA 2OA7A 2HZFA 4F9ZA 2FGXA 1JZOA 1FHEA 1GUKA 2VCWA 3FR3A 3GHAA 4MPFA 1ERWA 2O87A 1O8WA 2DJKA 3LXZA 2VCXA 1VRSD 4HS1A 2VLVA 2GZZA 4WETA 3GRXA 2AV4A 4NPBA 3KGKA 2QC7A 4MPGA 1NM3A 3CRTA 4KW6A 1F37A 3EMXA 4YAPA 3E3EA 1K3LA 4CHSA 5EL8A 2OE0A 1GSYA 2VL9A 1YKCA 4MF6A 3S9FA 3Q18A 1EGRA 3GTUB 2DC5A 4KUNA 4MK3A 2JSYA 4DSQA 4P3YB 1K0DA 1MTCA 2ON7A 3UOMA 1KBNA 1AIUA 2BTOT 2ES7A 4KAEA 3H4KA 3EVIA 1XWBA 4ZIJA 3IBHA 3G7JA 1MD3A 1OVNA 1SYRA 3GIXA 4WXTA 2GQMA 3RDWA 2MMAA 4K7OA 4ISDA 3VWWA 1VF1A 2J9HA 5JCGA 3J7Yb 1O6JA 2LTKA 4QQ7A 4BA7A 2H6YA 1IYIA 4I2TA 6GSXA 2FWGA 2LEGA 1EP7A 5F0GA 2V41A 1SL1B 1PN9A 2MMNA 3QFBC 4Q5FA 3GMFA 3TKSE 3IOSA 2A2SA 3HYPA 2A2RA 3UEMA 2VUPA 1WP0A 4WR5A 1TK8B 2QSIA 2H1DA 2WRTA 3E0UA 2C3TA 3APSA 2OBIA 4MH2A 3VFIA 4FH8A 5DCHA 4GQFA 1USBA 4NHWA 1JFUA 5LCZA 4WR4A 5ECHB 2RUEA 4KH7A 2TRCP 1B48A 5J3RA 2WZ9A 4ML6A 1RK4A 1NHOA 3HZ8A 2M46A 1VGLA 5ECOB 1RQMA 1T1VA 4ZB9A 4K7IA 2ZCTA 5JWRB 2CAQA 1UA5A 4TN8A 2FD3A 4AGSA 2FWHA 1FG4A 2B1KA 2IMDA 3Q6OA 1FB0A 2H76A 5ID2A 4OD7A 2R6KA 4HU7A 4DEJA 3VI5A 1FW1A 2IFQA 2JZSA 1XCCA 2GTUA 1OC9B 4L0UA 3FK8A 4IJIA 5ELAA 2LQOA 2DJ3A 2DIYA 5C04A 2YN1A 5A5KA 4RQXA 4V2LA 1SYXA 4ML1A 2VD1A 1YF1A 3A2VA 4EDZA 4PNFA 3QAGA 3ME8A 1RW1A 3ERWA 2FCHA 5IMCA 1OKTA 4MDCA 1U87A 2LQQA 3IAS2 4BWSA 3F6FA 4AJ8A 1W4VA 2N5BA 3W6GA 1XW5A 2LUSA 2DLXA 5D8IA 2X8HA 2PBJA 4F82A 4MLYA 1GSSA 4Z7XA 3M9JA 4GTUA 4RQRA 1EEJA 3LJRA 14GSA 4G9HA 5D9VA 5F8BA 2KP2A 1JZDA 5FT3A 1T3BA 4GWRA 2B6MA 1WJKA 3GNJA 1T00A 1X5CA 1SKWB 3FR9A 3ZL5A 2AHEA 4PNGA 2GGTA 3Q19A 3LORA 5G5EA 11GSA 1AQWA 3QCPA 4I8BA 1O73A 2O89A 1H75A 5L71A 2E2MA 4ILFA 1B9XC 1V2AA 2XHFA 3GSSA 1A24A 4Q5NA 3U5RE 1SK1A 2PUKC 4PURA 1KTEA 3G7IA 1K0AA 2IMIA 2BJXA 1H4OA 2JZRA 4GLTA 3EU3A 3K8NA 4GQCA 3C71A 4IKHA 1A23A 1TP9A 2O7KA 4ZILA 5HQPA 1DE2A 1URMA 5D96A 4IELA 2DJ0A 1TXXA 3RPNA 3H8QA 4BWQA 1CQHA 5J9BA 2HI7A 2X8CA 5E59A 1DE1A 3GN3A 5ECKB 1ZL9A 3IRAA 3TRXA 2YP6A 2H71A 4ZL8A 3BD2A 3KMNA 4IJ3A 5ENUA 4F0CA 6GSUA 4K1FA 5ECRB 3IK7A 4XCSA 1R26A 3HVSA 1SU9A 5F07A 2H1GA 3FZ9A 3G7YA 1XWAA 4QL7A 4K6XA 1M2DA 2CVKA 1MEKA 1ON4A
chains in the Genus database with same CATH superfamily
4KNDA 4KF9A 5IO0A 3ERFA 5JCWA 4BL7A 6GSWA 4TVEA 2GT6A 1I5GA 3A5IA 3IK9A 4ZL7A 1R5AA 2N5FA 4IQ1A 5HFKA 2X64A 4MJBA 3TJKA 1YEXA 2V6OA 2R2JA 1OKDA 3KCMA 4HI7A 3DEXA 1WOUA 3L4NA 1OC9A 5HR0A 1SJ6A 3EE2A 2VIMA 5IIZA 4FIWA 3D22A 2C3NA 4N11A 2Z9SA 1BG5A 3CSIA 2L6CA 5AISA 3KM6A 2H1AA 2KLXA 1ML6A 1TI3A 3F0IA 2LKUA 1M7TA 2OE3A 4I97A 3QOUA 3UL3A 3UVHA 4ICYA 3O76A 2IJYA 3UIWA 3LWAA 1A8YA 2VCQA 3M9KA 4IGJA 1UC7A 2CVDA 2R3XA 3TCOA 1YEPA 3H1NA 2I3YA 1VF4A 1M0UA 3GL5A 3CMIA 4O92A 3TKQA 3US3A 3ZRDA 5DQSA 2HT9A 1B8XA 4KGIA 4MZWA 1DUGA 4V2MA 3GX8A 7GSSA 2F9SA 2YJHA 3PINA 1N8JA 3D4MA 1G7EA 5F05A 3F63A 1JZRA 4IW9A 4K0NA 1TTZA 2LJAA 5ID2B 3C1RA 3TKSC 2H0IA 2IFQB 1SENA 3I69A 4MZCA 2H1BA 1TU7A 3MIXA 1XZOA 2MBSA 1GWCA 3BBYA 4JE1A 2PMTA 5CRDA 5GSTA 5KN2A 1QXHA 2NVLA 4J2FA 1GTBA 5DVBA 5IMDA 3LGCA 4EDYA 5JWQB 1B4PA 2FLSA 3R3EA 3SBCA 4F03A 3KEBA 4YQMA 3ZVJA 2JSZA 2CQ9A 1U88A 3HJMA 3E9JB 4YQVA 1PX7A 3IR4A 1HD2A 1UN2A 1FOVA 4AJ7A 5IQYA 6GSYA 1U6TA 2OADA 2CZ2A 5AIVA 2L59A 3NZNA 3M8NA 3FR6A 20GSA 4OMVA 1GLPA 2FUG2 3IPZA 4XS4A 1PQNA 4EKZA 3PPUA 4G19A 2RUFA 3L9SA 1G6WA 3ZFLA 3ZVJD 4JR6A 5DALA 1MDKA 3WYWA 2GT5A 8GSSA 4NV2A 1Z6NA 2A4VA 4BVYA 3LEFA 4TXVA 1U3IA 3CXGA 3ZYWA 1F3AA 3VI7A 3A5WA 2R5GA 3GUSA 3DIEA 5H5QA 2JADA 4AF2A 2GSSA 5JWOB 1B9YC 3ZIVA 4JBBA 1SKSB 2YWIA 2K9FA 1O85A 2CX4A 4GSSA 5KN0A 3VURA 3TJJA 1FAAA 1F3BA 3PR8A 2VAFA 5CRWA 3GKXA 4TR3A 2HNLA 2YWOA 1GLQA 2DKIA 1NW2A 1T7PB 2P5QA 3WGXA 3ZTLA 3UARA 1JZWA 1PD21 4I6XA 3W8SA 2LV3A 3O6TA 3QPMA 1N2AA 3I43A 2CX3A 3RHCA 1DBYA 2VLUA 1PSQA 1HNAA 4HOJA 3TKRA 1QK8A 4Q5QA 1SD8A 1QUWA 2DMLA 5GAPD 2HE3A 4JU5A 1XPVA 2KHPA 5GSSA 2C0FA 3QAWA 4BPYA 2X4AA 4EO3A 1QGVA 5G31A 3UBKA 4MH3A 1R4WA 4K5RA 3N5OA 1ILOA 2I9HA 2J23A 2WS2A 5ECNB 1ERTA 2C8UA 1J9BA 5JCUA 4TRXA 5CYYA 1WE0A 1GSFA 3UJ1A 4K9ZA 3F8UA 3ZMLA 4ACSA 1WPIA 1SJZA 5BMUA 2N5AA 1X0RA 1BJXA 3TRQA 1J08A 4POBA 2QKEA 3GH9A 1XBSA 4ZXGA 4TR1B 3HKRA 2LSTA 3GSTA 1AQXA 4BL7B 1JHBA 5J4UA 1V9WA 3LG6A 1HNBA 1QMVA 2CZ3A 4N0VA 2LJKA 1WRYA 1ACVA 1Z7PA 4TW5A 3ZITA 1JLWA 1X9WB 4IN0A 4ECJA 5D9TA 2FY6A 2LRNA 1ZGNA 2VCTA 4ECCA 2K8SA 4HQSA 3HHVA 1KNGA 1SKRB 2HRFA 2K8VA 5GZZB 4HU9A 3GKKA 5F06A 2O8VB 2OBKA 3TDGA 4K2DA 3ZZXA 4TKYA 1O81A 1TW9A 16GSA 4K2XA 3R2QA 3MNGA 1YDKA 2FWFA 2B1LA 4IVFA 1K3YA 3BCIA 3UVTA 3N9JA 2GLRA 1QFNA 4ZBDA 1IYHA 1W89A 3C7MA 3GX0A 4GSNA 4ZL9A 4X0XA 2LS5A 1K0CA 1OAZA 2F3MA 2F8AA 4O5QA 1WWJA 3F4RA 4MF5A 3WGEA 3TKPA 4OO5A 3HVNA 5CNWA 1TU8A 2F8FA 5ELGA 5IOXA 3FYGA 1XOAA 4V1Ap 4HZ4A 5G2ZA 3QFAC 3UMAA 4L8EA 1GSEA 2RIIA 18GSA 3HD5A 3FHKA 1M9BA 3NIVA 5CAXA 5CREA 3D21A 1YKAA 2HSHA 2V32A 5FWGA 1AW9A 10GSA 2CA8A 3HCZA 2L4QA 4KE3A 3BCKA 3TGZA 1OC3A 5HFGA 1X9MB 1VF2A 1M3IA 4K0GA 1SK2A 5HR3A 2KOKA 2H30A 3MDKA 1XVQA 2P0GA 1ERUA 2H72A 1PX6A 3KP9A 2H75A 3KTBA 3KH9A 4PXOA 4FYUA 1GSDA 1PFOA 6GSVA 2CV4A 3C1SA 1XIYA 2PN8A 3MWHA 4LMVA 4X43A 3M0FA 3M1GA 2D2ZA 4L0WA 1PMTA 5IOWA 4GRFA 4K5SA 1K0NA 3BOAA 1Z3EA 3GL3A 9GSSA 4OCEA 4EF0A 3BJ5A 1PL2A 3DVXA 4Z2UA 4PUFC 3KH7A 1OC8A 1PKWA 2DJJA 4E8HA 2RLIA 4IS0A 4XS4B 3VPTA 5DQYA 2DJ2A 2YANA 2PERA 4V2NA 3H79A 1EOGA 2WJUA 2H74A 5DALB 1AQVA 4JRRA 3P90A 4XS1A 2XPEA 2XBQA 2F51A 1FB6A 3FZ5A 3F4TA 3L0HA 5HFIA 3ISOA 4GXZA 1K0BA 2XBIA 4LLRA 4PGTA 1KEBA 3AY8A 3GH6A 4LMWA 1K3OA 2GZYA 2YCDA 2B3SA 2C0DA 1YJ6A 2E2GA 2CT6A 1BAYA 1E2YA 4XRDA 5ECMB 3GKMA 1BQ7A 1PRXA 4TR1A 4EUYA 3GFKA 5A4WA 3GA4A 5INYA 1A2MA 3DYRA 2EIRA 2H0HA 2I4AA 4BVXB 1V40A 1O7UA 5G1KA 4ZB6A 1Z9HA 4HEA2 3D5JA 4I2UA 2H19A 1OYJA 3QDNA 1F2EA 2O85A 1NHYA 3RAZA 3MAKA 1FVJA 2E7PA 5IMAA 3A2WA 2G2QA 3DVWA 2EIOA 5D9WA 2EC4A 3HZ4A 1HNCA 2VL2C 5AGYA 2C0GA 2IIYA 3ZIJA 3RBTA 2OJLA 4DVCA 4E8EA 1ERVA 1YF0A 2K6VA 1S3DA 2QGVA 3HJOA 3HXSA 2VL3A 1GP1A 3CTFA 1GRXA 5CRGA 4EE0A 4CDOA 1THOA 2DJ1A 4LL4B 3ZLPA 1LJRA 5G1LA 1XWKA 2HRAA 4K8MA 1ZZYA 3CSJA 5CO3A 1QQ2A 4EIQA 4NAXA 17GSA 5GAND 4MJEA 2OACA 2VCZA 2REMA 3G9BA 3VWXA 4MZBA 2HYXA 5ECSA 1LBKA 1M2BA 3ERGA 1ZYPA 2G0FA 4YKGA 2V6KA 2GSRA 1C72A 3I9V2 4WEYA 1T4YA 3MSZA 3LQ7A 4HJMA 2X8GA 4O5RA 3EMPA 4EL1A 2B5XA 3SWLA 2WDUA 4OWYA 2H0GA 2KUCA 1YQ1A 2AYTA 1GTUA 4G10A 4KDYA 4WF5A 1Q98A 1E6BA 2YV9A 2WB9A 2VO4A 3O3TA 3L78A 1F6MC 1XVWA 3KIJA 1AC1A 3P7XA 4JZQA 1EV4A 4NWYA 5H5RA 1V98A 4CW9A 3IA1A 2HFDA 1CQGA 2V1MA 1S3AA 1K0OA 1V57A 5AN1A 2K18A 3ED3A 3RPPA 1EGOA 3KP8A 4NV5A 1XWCA 3FEUA 2I1UA 5ECPB 2P5RA 4L5LA 4CY8A 1GH2A 1M3JA 2YZHA 3CYNA 2L5OA 4TR0A 3TUEA 1G6YA 3UAPA 2VOCA 4PQ1A 2H8LA 1Z6MA 3KTLA 3V1WA 4D73B 3NOFA 1TK0B 4ECBA 2OE1A 4WF4A 4GSTA 3QMXA 3TKSA 12GSA 4WBJA 1GNWA 5KEJA 1S3RA 2XC2A 4EXJA 4FO5A 2PU9C 2AB6A 4MNNA 3EINA 1A8LA 3D6IA 3FMWA 4EVMA 2ZUPA 3U6VA 1T8EB 3FRCA 4KSOA 5J5NA 3WT1A 4G2EA 3LYKA 3KMOA 1SD9A 4KX4A 4PQHA 2PVQA 3DRNA 4PQIA 2HZEB 1MDJA 2VCVA 3TJBA 5COHA 2JU5A 1PA3A 5ECIB 2VM1A 2IMKA 1TRUA 4BVXA 2IN3A 3HVVA 4DSSB 1OE7A 2R0GA 2C1YA 1R5PA 1GL8A 1ABAA 4TXOA 2H6ZA 2B7JA 1XOBA 3GV1A 5IPGA 5DAKA 4FYCA 22GSA 3WGDA 3FW2A 3VPQA 5C00A 2WGRA 3Q74A 4K7NA 2GSQA 2FWEA 3IHQA 4XRAA 4N30A 1X5EA 2VLTA 4QL9A 3KXOA 3F3RA 5LD0A 19GSA 2L4CA 2JZTA 2B5EA 2CAIA 1ZOFA 1J0FA 6GSTA 4POLA 3CBUA 5FHIA 4Q5RA 4WKWA 2VM2A 3ME7A 5IMFA 2FHEA 4KA0A 1WIKA 4ULXA 1XW6A 1K0MA 4O7HA 1V58A 1XFLA 1LU4A 3F6DA 2GQKA 2PVOC 3CRUA 1AXDA 2P31A 1GULA 4KDXA 2WULA 4NMUA 3D4TA 1YY7A 2X49A 5EVOA 4PX1A 4L5OA 1PGTA 4ZBBA 13GSA 1JLVA 2DMMA 5AIXA 4IHUA 4HQZA 1BYEA 4EC0A 3A2XA 2RM6A 5ECQB 4XS6A 2HRNA 2KP1A 2LRCA 1X9SB 2FA8A 1R7HA 2PWJA 2R37A 3TJGA 4X1UA 2RM5A 5IPHA 2V2GA 1ST9A 4POKA 1A2JA 3DXBA 2A2PA 2HLSA 3RHBA 4KB3A 5G30A 2GQLA 1EOHA 4MA9A 3J7Yk 3IC4A 2WCIA 3EWLA 5EY6A 2MZCA 2YOIA 1MD4A 4NHZA 2B7KA 3TRPA 2AJQB 2MMOA 3DMLA 3DWVA 2M80A 2X99A 1GSUA 4ID0A 5DCGA 1OE8A 1XXUA 4HJ2A 2PGTA 1EWXA 1O8XA 3HVXA 5D73A 4G0KA 1TRSA 3C73A 3I6AA 5IM9A 1I9DA 5HR1A 2R0PA 3LYPA 4LL1B 1TJDA 1ZMAA 5CP1A 2L5LA 4D73A 4POMA 1Z7RA 1SL0B 4J56E 5EPFA 3QR6A 3HA9A 1TRVA 2C3QA 4X4JA 5DDLA 1AUCA 4MMMA 3CSHA 4H86A 2HXKA 5BRTA 4XHMA 3IC8A 4V1Ag 5H5SA 4XTSA 2MYGA 2GDRA 4KCAA 3DGQA 2DBCA 2LRTA 2WFCA 4MP4A 2ALBA 3FZ4A 2L57A 2IWTA 3GTUA 2HSMA 2M72A 2HZEA 2TRXA 3EC3A 2XPDA 5B8BA 1PKZA 3L9VA 4DSSA 5J41A 4MABA 2YZUA 5ABRA 3VK9A 2QA1A 3KJYA 5IO2A 4KCEA 2IMEA 1GNEA 1WMJA 4Z2TA 5ECLB 3F4SA 3PH9A 3IE3A 4F0BA 2ZNMA 2H70A 3FY7A 3TOUA 3H93A 5HR2A 2H6XA 1T4ZA 2AAWA 4GCIA 1GUMA 2FNOA 3UBLA 2A4HA 5DJMA 2NTOA 5CRHA 3GKNA 2IPAA 4WBRD 1UVZA 4FYBA 4O32A 1M2AA 3IDVA 4CY6A 4ZB8A 3WD6A 2IMFA 1YZXA 3IXRA 2GS3A 1Y6EA 3HDCA 2C0EA 5DJLA 1B4QA 1G0TA 1PL1A 4OFTA 4FQUA 3FKFA 1FO5A 2NDOA 2R4VA 3PGTA 3TJFA 4YQUA 4YAVA 2FA4A 4LA1A 4O5UA 5IMVA 1XW9A 2C80A 3F3QA 1ZYQB 3LFLA 1S3CA 2DSAA 3GURA 1GUHA 1FVKA 4RI7A 1GSQA 5E4WA 2ON5A 3D0ZA 1A0RP 1SL2B 3VWUA 4YH2A 3WT2A 2MMZA 3A3TA 2YWMA 3APOA 2HSYA 2YPMA 2IL3A 4AJ6A 5J9CA 2DIZA 1DSBA 3EU4A 6GSSA 5B8AA 4G0IA 1THXA 4TXOB 4KDUA 2NPBA 2H66A 3VLNA 1EEMA 1TI1A 5DAKB 4IQAA 2LNTA 2TIRA 3P2AA 3IHGA 2MBTA 4MJCA 5IMZA 1AAZA 1Y25A 2C4JA 3IV4A 1VF3A 1M99A 2GVPA 4RUVA 4ECIA 3JCML 4RI6A 4MCUA 5A4VA 2PPTA 3MYDA 3QD9A 2YV7A 1TRWA 2GZPA 4XIHA 4ZBAA 5B6MA 1A2LA 1NSWA 4OFMA 1Z5YE 3LSZA 1BX9A 3HY2A 4F2IA 1EZKA 2LJRA 2BMXA 2AUVA 2L6DA 3IAM2 4YKFA 2R0CA 1TK5B 5KN3A 1GTIA 5G5FA 4OCFA 4TR4A 3EYTA 1HQOA 1ZCPA 2JL4A 1TOFA 3W8JA 3TOTA 4N0ZA 2NBSA 1M9AA 4BIKA 2E0QA 3KD0A 5D9XA 1X5DA 2H01A 3OR5A 3P8WA 1TDIA 4MJAA 1TKDB 2YWNA 1Q4JA 2YNXA 5B7CA 1HYUA 1SJIA 4I5QA 1EP8A 1U3AA 3FZAA 4TOPA 3GYKA 4OO4A 3TB2A 3VWVA 2YJ7A 5KN1A 4GF0A 2VL2A 4JEDA 3L9UA 4MF7A 1F9MA 4JR4A 4IBPA 2LNSA 3ZMKA 5KOXA 1XWGA 4OFNA 4KSMA 3APQA 4J57E 4HZ2A 2H73A 1GTAA 4N10A 3F9UA 3HJPA 2B5YA 5LNKe 3KZQA 2JACA 1G7OA 2OKAA 5A4UA 1ZYEA 3LXTA 2I81A 5B6NA 2GSTA 1SK0A 4NXIA 3ZREA 4PUAA 1EV9A 3DKSA 4IP6A 3EURA 3DD3A 4HDEA 1MDIA 5KOWA 1A0FA 5DBQA 3M3MA 4DSRA 1BEDA 4HUAA 2CVBA 2EIQA 3ZFBA 4IP1A 1PN0A 2QA2A 3CTGA 5D93A 2VD0A 3QAVA 3C8EA 2OA7A 2HZFA 3EPTA 2FGXA 4F9ZA 1JZOA 1FHEA 1GUKA 2VCWA 3FR3A 3GHAA 4MPFA 1ERWA 2O87A 1O8WA 2DJKA 3LXZA 2VCXA 1VRSD 4HS1A 2UZ8A 2VLVA 2GZZA 4WETA 3GRXA 2AV4A 4NPBA 3KGKA 2QC7A 4MPGA 1NM3A 3CRTA 4KW6A 1F37A 3EMXA 4YAPA 3E3EA 1K3LA 1ZYNA 4CHSA 5EL8A 2OE0A 1GSYA 2VL9A 1YKCA 4MF6A 3S9FA 3Q18A 1EGRA 3GTUB 2DC5A 4KUNA 4MK3A 2JSYA 4DSQA 4P3YB 1K0DA 1MTCA 2ON7A 3UOMA 1KBNA 1AIUA 2BTOT 2ES7A 4KAEA 3H4KA 3EVIA 1XWBA 2HRKA 4ZIJA 3IBHA 3G7JA 1MD3A 1OVNA 1SYRA 4WXTA 3GIXA 2GQMA 3RDWA 1XG8A 2MMAA 4K7OA 4ISDA 3VWWA 1VF1A 2J9HA 5JCGA 3J7Yb 1O6JA 1FOHA 2LTKA 4QQ7A 4BA7A 2H6YA 1IYIA 4I2TA 6GSXA 2FWGA 2LEGA 1EP7A 5F0GA 2V41A 1SL1B 1PN9A 2MMNA 3QFBC 4Q5FA 3GMFA 3TKSE 3IOSA 2A2SA 3HYPA 2A2RA 3UEMA 2VUPA 1WP0A 4WR5A 1TK8B 2QSIA 2H1DA 2WRTA 3E0UA 2C3TA 3APSA 2OBIA 4MH2A 3VFIA 4FH8A 5DCHA 4GQFA 1USBA 4NHWA 1JFUA 5LCZA 4WR4A 5ECHB 2RUEA 4HSCX 4KH7A 2TRCP 1B48A 5J3RA 2WZ9A 4ML6A 1RK4A 1NHOA 3HZ8A 2M46A 1VGLA 5ECOB 1RQMA 1T1VA 4ZB9A 4K7IA 2ZCTA 5JWRB 3LW9A 2CAQA 1UA5A 4TN8A 2FD3A 4AGSA 2FWHA 1FG4A 2B1KA 2IMDA 3Q6OA 1FB0A 2H76A 3CQFA 5ID2A 4OD7A 2R6KA 4HU7A 4DEJA 3VI5A 1FW1A 2IFQA 2JZSA 1XCCA 2GTUA 1OC9B 4L0UA 3FK8A 4IJIA 5ELAA 2LQOA 2DJ3A 2DIYA 5C04A 2YN1A 5A5KA 4RQXA 4V2LA 1SYXA 4ML1A 2VD1A 1YF1A 3A2VA 4EDZA 4A5PA 4PNFA 3QAGA 3ME8A 1RW1A 3ERWA 2FCHA 5IMCA 1OKTA 4MDCA 1U87A 2DKHA 2LQQA 3IAS2 4BWSA 3F6FA 4AJ8A 1W4VA 2N5BA 3W6GA 1XW5A 2LUSA 2DLXA 5D8IA 2X8HA 2PBJA 4F82A 4MLYA 1GSSA 4Z7XA 3M9JA 4GTUA 4RQRA 1EEJA 3LJRA 14GSA 4G9HA 5D9VA 5F8BA 2KP2A 1JZDA 5FT3A 1T3BA 4GWRA 2B6MA 1WJKA 3GNJA 1T00A 1X5CA 1SKWB 3FR9A 3ZL5A 2AHEA 4PNGA 2GGTA 3Q19A 3LORA 5G5EA 11GSA 1AQWA 3QCPA 4I8BA 1O73A 2O89A 1H75A 4USSA 5L71A 2E2MA 4ILFA 1B9XC 1V2AA 2XHFA 3GSSA 1A24A 4Q5NA 3U5RE 1SK1A 2PUKC 4PURA 4G0LA 1KTEA 3G7IA 1K0AA 2IMIA 2BJXA 1H4OA 2JZRA 4GLTA 3EU3A 3K8NA 4GQCA 3C71A 4IKHA 1A23A 1TP9A 2O7KA 4ZILA 5HQPA 1DE2A 1URMA 5D96A 4IELA 2DJ0A 1TXXA 3RPNA 3H8QA 4BWQA 1CQHA 5J9BA 2HI7A 2X8CA 5E59A 1DE1A 3GN3A 5ECKB 1ZL9A 3IRAA 3TRXA 2YP6A 2H71A 4ZL8A 3BD2A 4EIPA 3KMNA 4Z2RA 4IJ3A 5ENUA 4F0CA 4BVYB 6GSUA 4K1FA 5ECRB 3IK7A 4XCSA 1R26A 3HVSA 1SU9A 5F07A 2H1GA 3FZ9A 3G7YA 1XWAA 4QL7A 4K6XA 1M2DA 4PTSA 2CVKA 1MEKA 1ON4A
chains in the Genus database with same CATH topology
4KNDA 4KF9A 5IO0A 3ERFA 5JCWA 4BL7A 6GSWA 4TVEA 2GT6A 1I5GA 3A5IA 3IK9A 4ZL7A 1R5AA 2N5FA 4IQ1A 5HFKA 2X64A 4MJBA 3TJKA 1YEXA 2V6OA 2R2JA 1OKDA 3KCMA 4HI7A 3DEXA 1WOUA 3L4NA 1OC9A 5HR0A 1SJ6A 3EE2A 2VIMA 5IIZA 4FIWA 3D22A 2C3NA 4N11A 2Z9SA 1BG5A 3CSIA 2L6CA 5AISA 3KM6A 2H1AA 2KLXA 1ML6A 1TI3A 3F0IA 2LKUA 1M7TA 2OE3A 4I97A 3QOUA 3UL3A 3UVHA 4ICYA 3O76A 2IJYA 3UIWA 3LWAA 1A8YA 2VCQA 3M9KA 4IGJA 1UC7A 2CVDA 2R3XA 3TCOA 1YEPA 3H1NA 2I3YA 1VF4A 1M0UA 3GL5A 3CMIA 4O92A 3TKQA 3US3A 3ZRDA 5DQSA 2HT9A 1B8XA 4KGIA 4MZWA 1DUGA 4V2MA 3GX8A 7GSSA 2F9SA 2YJHA 3PINA 1N8JA 3D4MA 1G7EA 5F05A 3F63A 1JZRA 4IW9A 4K0NA 1TTZA 2LJAA 5ID2B 3C1RA 3TKSC 2H0IA 2IFQB 1SENA 3I69A 4MZCA 2H1BA 1TU7A 3MIXA 1XZOA 2MBSA 1GWCA 3BBYA 4JE1A 2PMTA 5CRDA 5GSTA 5KN2A 1QXHA 2NVLA 4J2FA 1GTBA 5DVBA 5IMDA 3LGCA 4EDYA 5JWQB 1B4PA 2FLSA 3R3EA 3SBCA 4F03A 3KEBA 4YQMA 3ZVJA 2JSZA 2CQ9A 1U88A 3HJMA 3E9JB 4YQVA 1PX7A 3IR4A 1HD2A 1UN2A 1FOVA 4AJ7A 5IQYA 6GSYA 1U6TA 2OADA 2CZ2A 5AIVA 2L59A 3NZNA 3M8NA 3FR6A 20GSA 4OMVA 1GLPA 2FUG2 3IPZA 4XS4A 1PQNA 4EKZA 3PPUA 4G19A 2RUFA 3L9SA 1G6WA 3ZFLA 3ZVJD 4JR6A 5DALA 1MDKA 3WYWA 2GT5A 8GSSA 4NV2A 1Z6NA 2A4VA 4BVYA 3LEFA 4TXVA 1U3IA 3CXGA 3ZYWA 1F3AA 3VI7A 3A5WA 2R5GA 3GUSA 3DIEA 5H5QA 2JADA 4AF2A 2GSSA 5JWOB 1B9YC 3ZIVA 4JBBA 1SKSB 2YWIA 2K9FA 1O85A 2CX4A 4GSSA 5KN0A 3VURA 3TJJA 1FAAA 1F3BA 3PR8A 2VAFA 5CRWA 3GKXA 4TR3A 2HNLA 2YWOA 1GLQA 2DKIA 1NW2A 1T7PB 2P5QA 3WGXA 3ZTLA 3UARA 1JZWA 1PD21 4I6XA 3W8SA 2LV3A 3O6TA 3QPMA 1N2AA 3I43A 2CX3A 3RHCA 1DBYA 2VLUA 1PSQA 1HNAA 4HOJA 3TKRA 1QK8A 4Q5QA 1SD8A 1QUWA 2DMLA 5GAPD 2HE3A 4JU5A 1XPVA 2KHPA 5GSSA 2C0FA 3QAWA 4BPYA 2X4AA 4EO3A 1QGVA 5G31A 3UBKA 4MH3A 1R4WA 4K5RA 3N5OA 1ILOA 2I9HA 2J23A 2WS2A 5ECNB 1ERTA 2C8UA 1J9BA 5JCUA 4TRXA 5CYYA 1WE0A 1GSFA 3UJ1A 4K9ZA 3F8UA 3ZMLA 4ACSA 1WPIA 1SJZA 5BMUA 2N5AA 1X0RA 1BJXA 3TRQA 1J08A 4POBA 2QKEA 3GH9A 1XBSA 4ZXGA 4TR1B 3HKRA 2LSTA 3GSTA 1AQXA 4BL7B 1JHBA 5J4UA 1V9WA 3LG6A 1HNBA 1QMVA 2CZ3A 4N0VA 2LJKA 1WRYA 1ACVA 1Z7PA 4TW5A 3ZITA 1JLWA 1X9WB 4IN0A 4ECJA 5D9TA 2FY6A 2LRNA 1ZGNA 2VCTA 4ECCA 2K8SA 4HQSA 3HHVA 1KNGA 1SKRB 2HRFA 2K8VA 5GZZB 4HU9A 3GKKA 5F06A 2O8VB 2OBKA 3TDGA 4K2DA 3ZZXA 4TKYA 1O81A 1TW9A 16GSA 4K2XA 3R2QA 3MNGA 1YDKA 2FWFA 2B1LA 4IVFA 1K3YA 3BCIA 3UVTA 3N9JA 2GLRA 1QFNA 4ZBDA 1IYHA 1W89A 3C7MA 3GX0A 4GSNA 4ZL9A 4X0XA 2LS5A 1K0CA 1OAZA 2F3MA 2F8AA 4O5QA 1WWJA 3F4RA 4MF5A 3WGEA 3TKPA 4OO5A 5CNWA 1TU8A 2F8FA 5ELGA 5IOXA 3FYGA 1XOAA 4V1Ap 4HZ4A 5G2ZA 3QFAC 3UMAA 4L8EA 1GSEA 2RIIA 18GSA 3HD5A 3FHKA 1M9BA 3NIVA 5CAXA 5CREA 3D21A 1YKAA 2HSHA 2V32A 5FWGA 1AW9A 10GSA 2CA8A 3HCZA 2L4QA 4KE3A 3BCKA 3TGZA 1OC3A 5HFGA 1X9MB 1VF2A 4K0GA 1SK2A 5HR3A 2KOKA 2H30A 3MDKA 1XVQA 2P0GA 1ERUA 2H72A 1PX6A 3KP9A 2H75A 3KTBA 3KH9A 4PXOA 4FYUA 1GSDA 6GSVA 2CV4A 3C1SA 1XIYA 2PN8A 3MWHA 4LMVA 4X43A 3M0FA 3M1GA 2D2ZA 4L0WA 1PMTA 5IOWA 4GRFA 4K5SA 1K0NA 3BOAA 1Z3EA 3GL3A 9GSSA 4OCEA 4EF0A 3BJ5A 1PL2A 3DVXA 4Z2UA 4PUFC 3KH7A 1OC8A 1PKWA 2DJJA 4E8HA 2RLIA 4IS0A 4XS4B 3VPTA 5DQYA 2DJ2A 2YANA 2PERA 4V2NA 3H79A 1EOGA 2WJUA 2H74A 5DALB 1AQVA 4JRRA 3P90A 4XS1A 2XPEA 2XBQA 2F51A 1FB6A 3FZ5A 3F4TA 3L0HA 5HFIA 3ISOA 4GXZA 1K0BA 2XBIA 4LLRA 4PGTA 1KEBA 3AY8A 3GH6A 4LMWA 1K3OA 2GZYA 2YCDA 2B3SA 2C0DA 1YJ6A 2E2GA 2CT6A 1BAYA 1E2YA 4XRDA 5ECMB 3GKMA 1BQ7A 1PRXA 4TR1A 4EUYA 3GFKA 5A4WA 3GA4A 5INYA 1A2MA 3DYRA 2EIRA 2H0HA 2I4AA 4BVXB 1V40A 1O7UA 5G1KA 4ZB6A 1Z9HA 4HEA2 3D5JA 4I2UA 2H19A 1OYJA 3QDNA 1F2EA 2O85A 1NHYA 3RAZA 3MAKA 1FVJA 2E7PA 5IMAA 3A2WA 2G2QA 3DVWA 2EIOA 5D9WA 2EC4A 3HZ4A 1HNCA 2VL2C 5AGYA 2C0GA 2IIYA 3ZIJA 3RBTA 2OJLA 4DVCA 4E8EA 1ERVA 1YF0A 2K6VA 1S3DA 2QGVA 3HJOA 3HXSA 2VL3A 1GP1A 3CTFA 1GRXA 5CRGA 4EE0A 4CDOA 1THOA 2DJ1A 4LL4B 3ZLPA 1LJRA 5G1LA 1XWKA 2HRAA 4K8MA 1ZZYA 3CSJA 5CO3A 1QQ2A 4EIQA 4NAXA 17GSA 5GAND 4MJEA 2OACA 2VCZA 2REMA 3G9BA 3VWXA 4MZBA 2HYXA 5ECSA 1LBKA 1M2BA 3ERGA 1ZYPA 2G0FA 4YKGA 2V6KA 2GSRA 1C72A 3I9V2 4WEYA 1T4YA 3MSZA 3LQ7A 4HJMA 2X8GA 4O5RA 3EMPA 4EL1A 2B5XA 3SWLA 2WDUA 4OWYA 2H0GA 2KUCA 1YQ1A 2AYTA 1GTUA 4G10A 4KDYA 4WF5A 1Q98A 1E6BA 2YV9A 2WB9A 2VO4A 3O3TA 3L78A 1F6MC 1XVWA 3KIJA 1AC1A 3P7XA 4JZQA 1EV4A 4NWYA 5H5RA 1V98A 4CW9A 3IA1A 2HFDA 1CQGA 2V1MA 1S3AA 1K0OA 1V57A 5AN1A 2K18A 3ED3A 3RPPA 1EGOA 3KP8A 4NV5A 1XWCA 3FEUA 2I1UA 5ECPB 2P5RA 4L5LA 4CY8A 1GH2A 2YZHA 3CYNA 2L5OA 4TR0A 3TUEA 1G6YA 3UAPA 2VOCA 4PQ1A 2H8LA 1Z6MA 3KTLA 3V1WA 4D73B 3NOFA 1TK0B 4ECBA 2OE1A 4WF4A 4GSTA 3QMXA 3TKSA 12GSA 4WBJA 1GNWA 5KEJA 2XC2A 4EXJA 4FO5A 2PU9C 2AB6A 4MNNA 3EINA 1A8LA 3D6IA 3FMWA 4EVMA 2ZUPA 3U6VA 1T8EB 3FRCA 4KSOA 5J5NA 3WT1A 4G2EA 3LYKA 3KMOA 1SD9A 4KX4A 4PQHA 2PVQA 3DRNA 4PQIA 2HZEB 1MDJA 2VCVA 3TJBA 5COHA 2JU5A 1PA3A 5ECIB 2VM1A 2IMKA 1TRUA 4BVXA 2IN3A 3HVVA 4DSSB 1OE7A 2R0GA 2C1YA 1R5PA 1GL8A 1ABAA 4TXOA 2H6ZA 2B7JA 1XOBA 3GV1A 5IPGA 5DAKA 4FYCA 22GSA 3WGDA 3FW2A 3VPQA 5C00A 2WGRA 3Q74A 4K7NA 2GSQA 2FWEA 3IHQA 4XRAA 4N30A 1X5EA 2VLTA 4QL9A 3KXOA 3F3RA 5LD0A 19GSA 2L4CA 2JZTA 2B5EA 2CAIA 1ZOFA 1J0FA 6GSTA 4POLA 3CBUA 5FHIA 4Q5RA 4WKWA 2VM2A 3ME7A 5IMFA 2FHEA 4KA0A 1WIKA 4ULXA 1XW6A 1K0MA 4O7HA 1V58A 1XFLA 1LU4A 3F6DA 2GQKA 2PVOC 3CRUA 1AXDA 2P31A 1GULA 4KDXA 2WULA 4NMUA 3D4TA 1YY7A 2X49A 5EVOA 4PX1A 4L5OA 1PGTA 4ZBBA 13GSA 1JLVA 2DMMA 5AIXA 4IHUA 4HQZA 1BYEA 4EC0A 3A2XA 2RM6A 5ECQB 4XS6A 2HRNA 2KP1A 2LRCA 1X9SB 2FA8A 1R7HA 2PWJA 2R37A 3TJGA 4X1UA 2RM5A 5IPHA 2V2GA 1ST9A 4POKA 1A2JA 3DXBA 2A2PA 2HLSA 3RHBA 4KB3A 5G30A 2GQLA 1EOHA 4MA9A 3J7Yk 3IC4A 2WCIA 3EWLA 5EY6A 2MZCA 2YOIA 1MD4A 4NHZA 2B7KA 3TRPA 2AJQB 2MMOA 3DMLA 3DWVA 2M80A 2X99A 1GSUA 4ID0A 5DCGA 1OE8A 1XXUA 4HJ2A 2PGTA 1EWXA 1O8XA 3HVXA 5D73A 4G0KA 1TRSA 3C73A 3I6AA 5IM9A 1I9DA 5HR1A 2R0PA 3LYPA 4LL1B 1TJDA 1ZMAA 5CP1A 2L5LA 4D73A 4POMA 1Z7RA 1SL0B 4J56E 5EPFA 3QR6A 3HA9A 1TRVA 2C3QA 4X4JA 5DDLA 1AUCA 4MMMA 3CSHA 4H86A 2HXKA 5BRTA 4XHMA 3IC8A 4V1Ag 5H5SA 4XTSA 2MYGA 2GDRA 4KCAA 3DGQA 2DBCA 2LRTA 2WFCA 4MP4A 2ALBA 3FZ4A 2L57A 2IWTA 3GTUA 2HSMA 2M72A 2HZEA 2TRXA 3EC3A 2XPDA 5B8BA 1PKZA 3L9VA 4DSSA 5J41A 4MABA 2YZUA 5ABRA 3VK9A 2QA1A 3KJYA 5IO2A 4KCEA 2IMEA 1GNEA 1WMJA 4Z2TA 5ECLB 3F4SA 3PH9A 3IE3A 4F0BA 2ZNMA 2H70A 3FY7A 3TOUA 3H93A 5HR2A 2H6XA 1T4ZA 2AAWA 4GCIA 1GUMA 2FNOA 3UBLA 2A4HA 5DJMA 2NTOA 5CRHA 3GKNA 2IPAA 4WBRD 1UVZA 4FYBA 4O32A 1M2AA 3IDVA 4CY6A 4ZB8A 3WD6A 2IMFA 1YZXA 3IXRA 2GS3A 1Y6EA 3HDCA 2C0EA 5DJLA 1B4QA 1G0TA 1PL1A 4OFTA 4FQUA 3FKFA 1FO5A 2NDOA 2R4VA 3PGTA 3TJFA 4YQUA 4YAVA 2FA4A 4LA1A 4O5UA 5IMVA 1XW9A 2C80A 3F3QA 1ZYQB 3LFLA 1S3CA 2DSAA 3GURA 1GUHA 1FVKA 4RI7A 1GSQA 5E4WA 2ON5A 3D0ZA 1A0RP 1SL2B 3VWUA 4YH2A 3WT2A 2MMZA 3A3TA 2YWMA 3APOA 2HSYA 2YPMA 2IL3A 4AJ6A 5J9CA 2DIZA 1DSBA 3EU4A 6GSSA 5B8AA 4G0IA 1THXA 4TXOB 4KDUA 2NPBA 2H66A 3VLNA 1EEMA 1TI1A 5DAKB 4IQAA 2LNTA 2TIRA 3P2AA 3IHGA 2MBTA 4MJCA 5IMZA 1AAZA 1Y25A 2C4JA 3IV4A 1VF3A 1M99A 2GVPA 4RUVA 4ECIA 3JCML 4RI6A 4MCUA 5A4VA 2PPTA 3MYDA 3QD9A 2YV7A 1TRWA 2GZPA 4XIHA 4ZBAA 5B6MA 1A2LA 1NSWA 4OFMA 1Z5YE 3LSZA 1BX9A 3HY2A 4F2IA 1EZKA 2LJRA 2BMXA 2AUVA 2L6DA 3IAM2 4YKFA 2R0CA 1TK5B 5KN3A 1GTIA 5G5FA 4OCFA 4TR4A 3EYTA 1HQOA 1ZCPA 2JL4A 1TOFA 3W8JA 3TOTA 4N0ZA 2NBSA 1M9AA 2E0QA 3KD0A 5D9XA 1X5DA 2H01A 3OR5A 3P8WA 1TDIA 4MJAA 1TKDB 2YWNA 1Q4JA 2YNXA 5B7CA 1HYUA 1SJIA 4I5QA 1EP8A 1U3AA 3FZAA 4TOPA 3GYKA 4OO4A 3TB2A 3VWVA 2YJ7A 5KN1A 4GF0A 2VL2A 4JEDA 3L9UA 4MF7A 1F9MA 4JR4A 4IBPA 2LNSA 3ZMKA 5KOXA 1XWGA 4OFNA 4KSMA 3APQA 4J57E 4HZ2A 2H73A 1GTAA 4N10A 3F9UA 3HJPA 2B5YA 5LNKe 3KZQA 2JACA 1G7OA 2OKAA 5A4UA 1ZYEA 3LXTA 2I81A 5B6NA 2GSTA 1SK0A 4NXIA 3ZREA 4PUAA 1EV9A 3DKSA 4IP6A 3EURA 3DD3A 4HDEA 1MDIA 5KOWA 1A0FA 5DBQA 3M3MA 4DSRA 1BEDA 4HUAA 2CVBA 2EIQA 3ZFBA 4IP1A 1PN0A 2QA2A 3CTGA 5D93A 2VD0A 3QAVA 3C8EA 2OA7A 2HZFA 3EPTA 2FGXA 4F9ZA 1JZOA 1FHEA 1GUKA 2VCWA 3FR3A 3GHAA 4MPFA 1ERWA 2O87A 1O8WA 2DJKA 3LXZA 2VCXA 1VRSD 4HS1A 2UZ8A 2VLVA 2GZZA 4WETA 3GRXA 2AV4A 4NPBA 3KGKA 2QC7A 4MPGA 1NM3A 3CRTA 4KW6A 1F37A 3EMXA 4YAPA 3E3EA 1K3LA 1ZYNA 4CHSA 5EL8A 2OE0A 1GSYA 2VL9A 1YKCA 4MF6A 3S9FA 3Q18A 1EGRA 3GTUB 2DC5A 4KUNA 4MK3A 2JSYA 4DSQA 4P3YB 1K0DA 1MTCA 2ON7A 3UOMA 1KBNA 1AIUA 2BTOT 2ES7A 4KAEA 3H4KA 3EVIA 1XWBA 2HRKA 4ZIJA 3IBHA 3G7JA 1MD3A 1OVNA 1SYRA 3GIXA 4WXTA 2GQMA 3RDWA 2MMAA 4K7OA 4ISDA 3VWWA 1VF1A 2J9HA 5JCGA 3J7Yb 1O6JA 1FOHA 2LTKA 4QQ7A 4BA7A 2H6YA 1IYIA 4I2TA 6GSXA 2FWGA 2LEGA 1EP7A 5F0GA 2V41A 1SL1B 1PN9A 2MMNA 3QFBC 4Q5FA 3GMFA 3TKSE 3IOSA 2A2SA 3HYPA 2A2RA 3UEMA 2VUPA 1WP0A 4WR5A 1TK8B 2QSIA 2H1DA 2WRTA 3E0UA 2C3TA 3APSA 2OBIA 4MH2A 3VFIA 4FH8A 5DCHA 4GQFA 1USBA 4NHWA 1JFUA 5LCZA 4WR4A 5ECHB 2RUEA 4KH7A 2TRCP 1B48A 5J3RA 2WZ9A 4ML6A 1RK4A 1NHOA 3HZ8A 2M46A 1VGLA 5ECOB 1RQMA 1T1VA 4ZB9A 4K7IA 2ZCTA 5JWRB 3LW9A 2CAQA 1UA5A 4TN8A 2FD3A 4AGSA 2FWHA 1FG4A 2B1KA 2IMDA 3Q6OA 1FB0A 2H76A 5ID2A 4OD7A 2R6KA 4HU7A 4DEJA 3VI5A 1FW1A 2IFQA 2JZSA 1XCCA 2GTUA 1OC9B 4L0UA 3FK8A 4IJIA 5ELAA 2LQOA 2DJ3A 2DIYA 5C04A 2YN1A 5A5KA 4RQXA 4V2LA 1SYXA 4ML1A 2VD1A 1YF1A 3A2VA 4EDZA 4A5PA 4PNFA 3QAGA 3ME8A 1RW1A 3ERWA 2FCHA 5IMCA 1OKTA 4MDCA 1U87A 2DKHA 2LQQA 3IAS2 4BWSA 3F6FA 4AJ8A 1W4VA 2N5BA 3W6GA 1XW5A 2LUSA 2DLXA 5D8IA 2X8HA 2PBJA 4F82A 4MLYA 1GSSA 4Z7XA 3M9JA 4GTUA 4RQRA 1EEJA 3LJRA 14GSA 4G9HA 5D9VA 5F8BA 2KP2A 1JZDA 5FT3A 1T3BA 4GWRA 2B6MA 1WJKA 3GNJA 1T00A 1X5CA 1SKWB 3FR9A 3ZL5A 2AHEA 4PNGA 2GGTA 3Q19A 3LORA 5G5EA 11GSA 1AQWA 3QCPA 4I8BA 1O73A 2O89A 1H75A 4USSA 5L71A 2E2MA 4ILFA 1B9XC 1V2AA 2XHFA 3GSSA 1A24A 4Q5NA 3U5RE 1SK1A 2PUKC 4PURA 4G0LA 1KTEA 3G7IA 1K0AA 2IMIA 2BJXA 1H4OA 2JZRA 4GLTA 3EU3A 3K8NA 4GQCA 3C71A 4IKHA 1A23A 1TP9A 2O7KA 4ZILA 5HQPA 1DE2A 1URMA 5D96A 4IELA 2DJ0A 1TXXA 3RPNA 3H8QA 4BWQA 1CQHA 5J9BA 2HI7A 2X8CA 5E59A 1DE1A 3GN3A 5ECKB 1ZL9A 3IRAA 3TRXA 2YP6A 2H71A 4ZL8A 3BD2A 4EIPA 3KMNA 4Z2RA 4IJ3A 5ENUA 4F0CA 4BVYB 6GSUA 4K1FA 5ECRB 3IK7A 4XCSA 1R26A 3HVSA 1SU9A 5F07A 2H1GA 3FZ9A 3G7YA 1XWAA 4QL7A 4K6XA 1M2DA 4PTSA 2CVKA 1MEKA 1ON4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KND A;  5IO0 A;  3ERF A;  5JCW A;  4BL7 A;  6GSW A;  4TVE A;  2GT6 A;  1I5G A;  3IK9 A;  4ZL7 A;  1R5A A;  2N5F A;  4IQ1 A;  5HFK A;  2X64 A;  4MJB A;  3TJK A;  1YEX A;  2V6O A;  2R2J A;  1OKD A;  3KCM A;  4HI7 A;  3DEX A;  1WOU A;  3L4N A;  1OC9 A;  5HR0 A;  1SJ6 A;  3EE2 A;  2VIM A;  5IIZ A;  4FIW A;  3D22 A;  2C3N A;  4N11 A;  2Z9S A;  1BG5 A;  3CSI A;  2L6C A;  5AIS A;  3KM6 A;  2H1A A;  2KLX A;  1ML6 A;  1TI3 A;  3F0I A;  2LKU A;  1M7T A;  2OE3 A;  4I97 A;  3QOU A;  3UL3 A;  3UVH A;  3O76 A;  2IJY A;  3UIW A;  3LWA A;  1A8Y A;  2VCQ A;  3M9K A;  4IGJ A;  1UC7 A;  2CVD A;  2R3X A;  3TCO A;  1YEP A;  3H1N A;  2I3Y A;  1VF4 A;  1M0U A;  3GL5 A;  3CMI A;  4O92 A;  3TKQ A;  3US3 A;  3ZRD A;  5DQS A;  2HT9 A;  1B8X A;  4KGI A;  4MZW A;  1DUG A;  4V2M A;  3GX8 A;  7GSS A;  2F9S A;  2YJH A;  3PIN A;  1N8J A;  3D4M A;  1G7E A;  5F05 A;  3F63 A;  1JZR A;  4IW9 A;  4K0N A;  1TTZ A;  2LJA A;  5ID2 B;  3C1R A;  3TKS C;  2H0I A;  2IFQ B;  1SEN A;  3I69 A;  4MZC A;  2H1B A;  1TU7 A;  1XZO A;  2MBS A;  1GWC A;  3BBY A;  4JE1 A;  2PMT A;  5CRD A;  5GST A;  5KN2 A;  1QXH A;  2NVL A;  4J2F A;  1GTB A;  5DVB A;  5IMD A;  3LGC A;  4EDY A;  5JWQ B;  1B4P A;  2FLS A;  3SBC A;  4F03 A;  3KEB A;  4YQM A;  3ZVJ A;  2JSZ A;  2CQ9 A;  1U88 A;  3HJM A;  3E9J B;  4YQV A;  1PX7 A;  3IR4 A;  1HD2 A;  1UN2 A;  1FOV A;  4AJ7 A;  5IQY A;  6GSY A;  1U6T A;  2OAD A;  2CZ2 A;  5AIV A;  2L59 A;  3NZN A;  3M8N A;  3FR6 A;  20GS A;  4OMV A;  1GLP A;  2FUG 2;  3IPZ A;  4XS4 A;  1PQN A;  4EKZ A;  4G19 A;  2RUF A;  3L9S A;  1G6W A;  3ZFL A;  3ZVJ D;  4JR6 A;  5DAL A;  1MDK A;  3WYW A;  2GT5 A;  8GSS A;  4NV2 A;  1Z6N A;  2A4V A;  4BVY A;  3LEF A;  4TXV A;  1U3I A;  3CXG A;  3ZYW A;  1F3A A;  3VI7 A;  3A5W A;  2R5G A;  3GUS A;  3DIE A;  5H5Q A;  2JAD A;  4AF2 A;  2GSS A;  5JWO B;  1B9Y C;  3ZIV A;  4JBB A;  1SKS B;  2YWI A;  2K9F A;  1O85 A;  2CX4 A;  4GSS A;  5KN0 A;  3VUR A;  3TJJ A;  1FAA A;  1F3B A;  3PR8 A;  2VAF A;  5CRW A;  3GKX A;  4TR3 A;  2HNL A;  2YWO A;  1GLQ A;  1NW2 A;  1T7P B;  2P5Q A;  3WGX A;  3ZTL A;  3UAR A;  1JZW A;  1PD2 1;  4I6X A;  3W8S A;  2LV3 A;  3O6T A;  3QPM A;  1N2A A;  3I43 A;  2CX3 A;  3RHC A;  1DBY A;  2VLU A;  1PSQ A;  1HNA A;  4HOJ A;  3TKR A;  1QK8 A;  4Q5Q A;  1SD8 A;  1QUW A;  2DML A;  5GAP D;  2HE3 A;  4JU5 A;  1XPV A;  2KHP A;  5GSS A;  2C0F A;  3QAW A;  4BPY A;  4EO3 A;  1QGV A;  5G31 A;  3UBK A;  4MH3 A;  1R4W A;  3N5O A;  1ILO A;  2I9H A;  2J23 A;  2WS2 A;  5ECN B;  1ERT A;  2C8U A;  1J9B A;  5JCU A;  4TRX A;  5CYY A;  1WE0 A;  1GSF A;  3UJ1 A;  4K9Z A;  3F8U A;  3ZML A;  4ACS A;  1WPI A;  1SJZ A;  2N5A A;  1X0R A;  1BJX A;  3TRQ A;  1J08 A;  4POB A;  2QKE A;  3GH9 A;  1XBS A;  4ZXG A;  4TR1 B;  3HKR A;  2LST A;  3GST A;  1AQX A;  1JHB A;  5J4U A;  1V9W A;  3LG6 A;  1HNB A;  1QMV A;  2CZ3 A;  4N0V A;  2LJK A;  1WRY A;  1ACV A;  1Z7P A;  4TW5 A;  3ZIT A;  1JLW A;  1X9W B;  4IN0 A;  4ECJ A;  5D9T A;  2FY6 A;  2LRN A;  1ZGN A;  2VCT A;  4ECC A;  2K8S A;  4HQS A;  3HHV A;  1KNG A;  1SKR B;  2HRF A;  2K8V A;  5GZZ B;  4HU9 A;  3GKK A;  5F06 A;  2O8V B;  2OBK A;  3TDG A;  4K2D A;  3ZZX A;  4TKY A;  1O81 A;  1TW9 A;  16GS A;  3R2Q A;  3MNG A;  1YDK A;  2FWF A;  2B1L A;  4IVF A;  1K3Y A;  3BCI A;  3UVT A;  3N9J A;  2GLR A;  1QFN A;  4ZBD A;  1IYH A;  1W89 A;  3C7M A;  3GX0 A;  4GSN A;  4ZL9 A;  4X0X A;  2LS5 A;  1K0C A;  1OAZ A;  2F3M A;  2F8A A;  1WWJ A;  3F4R A;  4MF5 A;  3WGE A;  3TKP A;  4OO5 A;  5CNW A;  1TU8 A;  2F8F A;  5ELG A;  5IOX A;  3FYG A;  1XOA A;  4V1A p;  4HZ4 A;  5G2Z A;  3QFA C;  3UMA A;  4L8E A;  1GSE A;  2RII A;  18GS A;  3HD5 A;  3FHK A;  1M9B A;  3NIV A;  5CAX A;  5CRE A;  3D21 A;  1YKA A;  2HSH A;  2V32 A;  5FWG A;  1AW9 A;  10GS A;  2CA8 A;  3HCZ A;  2L4Q A;  4KE3 A;  3BCK A;  3TGZ A;  1OC3 A;  5HFG A;  1X9M B;  1VF2 A;  4K0G A;  1SK2 A;  5HR3 A;  2KOK A;  2H30 A;  3MDK A;  1XVQ A;  2P0G A;  1ERU A;  2H72 A;  1PX6 A;  3KP9 A;  2H75 A;  3KTB A;  3KH9 A;  4PXO A;  4FYU A;  1GSD A;  6GSV A;  2CV4 A;  3C1S A;  1XIY A;  2PN8 A;  3MWH A;  4LMV A;  4X43 A;  3M0F A;  3M1G A;  2D2Z A;  4L0W A;  1PMT A;  5IOW A;  4GRF A;  1K0N A;  3BOA A;  1Z3E A;  3GL3 A;  9GSS A;  4OCE A;  4EF0 A;  3BJ5 A;  1PL2 A;  3DVX A;  4PUF C;  3KH7 A;  1OC8 A;  1PKW A;  2DJJ A;  4E8H A;  2RLI A;  4IS0 A;  4XS4 B;  3VPT A;  5DQY A;  2DJ2 A;  2YAN A;  2PER A;  4V2N A;  3H79 A;  1EOG A;  2WJU A;  2H74 A;  5DAL B;  1AQV A;  4JRR A;  3P90 A;  4XS1 A;  2XPE A;  2XBQ A;  2F51 A;  1FB6 A;  3FZ5 A;  3F4T A;  3L0H A;  5HFI A;  3ISO A;  4GXZ A;  1K0B A;  2XBI A;  4LLR A;  4PGT A;  1KEB A;  3AY8 A;  3GH6 A;  4LMW A;  1K3O A;  2GZY A;  2YCD A;  2B3S A;  2C0D A;  1YJ6 A;  2E2G A;  2CT6 A;  1BAY A;  1E2Y A;  4XRD A;  5ECM B;  3GKM A;  1BQ7 A;  1PRX A;  4TR1 A;  4EUY A;  3GFK A;  5A4W A;  3GA4 A;  5INY A;  1A2M A;  3DYR A;  2EIR A;  2H0H A;  2I4A A;  1V40 A;  1O7U A;  5G1K A;  4ZB6 A;  1Z9H A;  4HEA 2;  3D5J A;  4I2U A;  2H19 A;  1OYJ A;  3QDN A;  1F2E A;  2O85 A;  1NHY A;  3RAZ A;  3MAK A;  1FVJ A;  2E7P A;  5IMA A;  3A2W A;  2G2Q A;  3DVW A;  2EIO A;  5D9W A;  2EC4 A;  3HZ4 A;  1HNC A;  2VL2 C;  5AGY A;  2C0G A;  2IIY A;  3ZIJ A;  3RBT A;  2OJL A;  4DVC A;  4E8E A;  1ERV A;  1YF0 A;  2K6V A;  1S3D A;  2QGV A;  3HJO A;  3HXS A;  2VL3 A;  1GP1 A;  3CTF A;  1GRX A;  5CRG A;  4EE0 A;  4CDO A;  1THO A;  2DJ1 A;  4LL4 B;  3ZLP A;  1LJR A;  5G1L A;  1XWK A;  4K8M A;  1ZZY A;  3CSJ A;  5CO3 A;  1QQ2 A;  4NAX A;  17GS A;  5GAN D;  4MJE A;  2OAC A;  2VCZ A;  2REM A;  3G9B A;  3VWX A;  4MZB A;  5ECS A;  2HYX A;  1LBK A;  1M2B A;  3ERG A;  2G0F A;  2V6K A;  2GSR A;  1C72 A;  3I9V 2;  4WEY A;  1T4Y A;  3MSZ A;  3LQ7 A;  4HJM A;  2X8G A;  4O5R A;  3EMP A;  4EL1 A;  2B5X A;  3SWL A;  2WDU A;  4OWY A;  2H0G A;  2KUC A;  1YQ1 A;  2AYT A;  1GTU A;  4G10 A;  4KDY A;  4WF5 A;  1Q98 A;  1E6B A;  2YV9 A;  2WB9 A;  2VO4 A;  3O3T A;  3L78 A;  1F6M C;  1XVW A;  3KIJ A;  1AC1 A;  3P7X A;  4JZQ A;  1EV4 A;  4NWY A;  5H5R A;  1V98 A;  4CW9 A;  3IA1 A;  2HFD A;  1CQG A;  2V1M A;  1S3A A;  1K0O A;  1V57 A;  5AN1 A;  2K18 A;  3ED3 A;  3RPP A;  1EGO A;  3KP8 A;  4NV5 A;  1XWC A;  3FEU A;  2I1U A;  5ECP B;  2P5R A;  4L5L A;  1GH2 A;  2YZH A;  3CYN A;  2L5O A;  4TR0 A;  3TUE A;  1G6Y A;  3UAP A;  2VOC A;  4PQ1 A;  2H8L A;  1Z6M A;  3KTL A;  3V1W A;  4D73 B;  3NOF A;  1TK0 B;  4ECB A;  2OE1 A;  4WF4 A;  4GST A;  3QMX A;  3TKS A;  12GS A;  4WBJ A;  1GNW A;  5KEJ A;  2XC2 A;  4EXJ A;  4FO5 A;  2PU9 C;  2AB6 A;  3EIN A;  1A8L A;  3D6I A;  4EVM A;  2ZUP A;  3U6V A;  1T8E B;  3FRC A;  4KSO A;  5J5N A;  3WT1 A;  4G2E A;  3LYK A;  3KMO A;  1SD9 A;  4KX4 A;  4PQH A;  2PVQ A;  3DRN A;  4PQI A;  2HZE B;  1MDJ A;  2VCV A;  3TJB A;  5COH A;  2JU5 A;  1PA3 A;  5ECI B;  2VM1 A;  2IMK A;  1TRU A;  4BVX A;  2IN3 A;  3HVV A;  4DSS B;  1OE7 A;  2C1Y A;  1R5P A;  1GL8 A;  1ABA A;  4TXO A;  2H6Z A;  2B7J A;  1XOB A;  3GV1 A;  5IPG A;  5DAK A;  4FYC A;  22GS A;  3WGD A;  3FW2 A;  3VPQ A;  5C00 A;  2WGR A;  3Q74 A;  4K7N A;  2GSQ A;  2FWE A;  3IHQ A;  4XRA A;  4N30 A;  1X5E A;  2VLT A;  4QL9 A;  3KXO A;  3F3R A;  5LD0 A;  19GS A;  2L4C A;  2JZT A;  2B5E A;  2CAI A;  1ZOF A;  1J0F A;  6GST A;  4POL A;  3CBU A;  5FHI A;  4Q5R A;  4WKW A;  2VM2 A;  3ME7 A;  5IMF A;  2FHE A;  4KA0 A;  1WIK A;  4ULX A;  1XW6 A;  1K0M A;  4O7H A;  1V58 A;  1XFL A;  1LU4 A;  3F6D A;  2GQK A;  2PVO C;  3CRU A;  1AXD A;  2P31 A;  1GUL A;  4KDX A;  2WUL A;  4NMU A;  3D4T A;  1YY7 A;  5EVO A;  4PX1 A;  4L5O A;  1PGT A;  4ZBB A;  13GS A;  1JLV A;  2DMM A;  5AIX A;  4IHU A;  4HQZ A;  1BYE A;  4EC0 A;  3A2X A;  2RM6 A;  5ECQ B;  4XS6 A;  2HRN A;  2KP1 A;  2LRC A;  1X9S B;  2FA8 A;  1R7H A;  2PWJ A;  2R37 A;  3TJG A;  4X1U A;  2RM5 A;  5IPH A;  2V2G A;  1ST9 A;  4POK A;  1A2J A;  3DXB A;  2HLS A;  3RHB A;  4KB3 A;  5G30 A;  2GQL A;  1EOH A;  4MA9 A;  3J7Y k;  3IC4 A;  2WCI A;  3EWL A;  5EY6 A;  2MZC A;  2YOI A;  1MD4 A;  4NHZ A;  2B7K A;  3TRP A;  2AJQ B;  2MMO A;  3DML A;  3DWV A;  2M80 A;  2X99 A;  1GSU A;  4ID0 A;  5DCG A;  1OE8 A;  1XXU A;  4HJ2 A;  2PGT A;  1EWX A;  1O8X A;  3HVX A;  5D73 A;  1TRS A;  3C73 A;  3I6A A;  5IM9 A;  1I9D A;  5HR1 A;  3LYP A;  4LL1 B;  1TJD A;  1ZMA A;  5CP1 A;  2L5L A;  4D73 A;  4POM A;  1Z7R A;  1SL0 B;  4J56 E;  5EPF A;  3QR6 A;  3HA9 A;  1TRV A;  2C3Q A;  5DDL A;  1AUC A;  4MMM A;  3CSH A;  4H86 A;  2HXK A;  4XHM A;  4V1A g;  5H5S A;  4XTS A;  2MYG A;  2GDR A;  4KCA A;  3DGQ A;  2DBC A;  2LRT A;  2WFC A;  4MP4 A;  2ALB A;  3FZ4 A;  2L57 A;  2IWT A;  3GTU A;  2M72 A;  2HZE A;  2TRX A;  3EC3 A;  2XPD A;  5B8B A;  1PKZ A;  3L9V A;  4DSS A;  5J41 A;  4MAB A;  2YZU A;  5ABR A;  3VK9 A;  3KJY A;  5IO2 A;  4KCE A;  2IME A;  1GNE A;  1WMJ A;  5ECL B;  3F4S A;  3PH9 A;  3IE3 A;  4F0B A;  2ZNM A;  2H70 A;  3FY7 A;  3TOU A;  3H93 A;  5HR2 A;  2H6X A;  1T4Z A;  2AAW A;  4GCI A;  1GUM A;  2FNO A;  3UBL A;  5DJM A;  2NTO A;  5CRH A;  3GKN A;  2IPA A;  4WBR D;  1UVZ A;  4O32 A;  1M2A A;  4FYB A;  3IDV A;  4ZB8 A;  3WD6 A;  2IMF A;  1YZX A;  3IXR A;  2GS3 A;  1Y6E A;  3HDC A;  2C0E A;  5DJL A;  1B4Q A;  1G0T A;  1PL1 A;  4OFT A;  3FKF A;  1FO5 A;  2NDO A;  2R4V A;  3PGT A;  3TJF A;  4YQU A;  4YAV A;  2FA4 A;  4LA1 A;  5IMV A;  1XW9 A;  2C80 A;  3F3Q A;  1ZYQ B;  3LFL A;  1S3C A;  2DSA A;  3GUR A;  1GUH A;  1FVK A;  4RI7 A;  1GSQ A;  5E4W A;  2ON5 A;  3D0Z A;  1A0R P;  1SL2 B;  3VWU A;  4YH2 A;  3WT2 A;  2MMZ A;  3A3T A;  2YWM A;  3APO A;  2HSY A;  2YPM A;  2IL3 A;  4AJ6 A;  5J9C A;  2DIZ A;  1DSB A;  3EU4 A;  6GSS A;  5B8A A;  1THX A;  4TXO B;  4KDU A;  2NPB A;  2H66 A;  3VLN A;  1EEM A;  1TI1 A;  5DAK B;  4IQA A;  2LNT A;  2TIR A;  3P2A A;  2MBT A;  4MJC A;  5IMZ A;  1AAZ A;  1Y25 A;  2C4J A;  3IV4 A;  1VF3 A;  1M99 A;  2GVP A;  4RUV A;  4ECI A;  3JCM L;  4RI6 A;  4MCU A;  5A4V A;  2PPT A;  3QD9 A;  2YV7 A;  1TRW A;  2GZP A;  4XIH A;  4ZBA A;  5B6M A;  1A2L A;  1NSW A;  4OFM A;  1Z5Y E;  3LSZ A;  1BX9 A;  3HY2 A;  4F2I A;  1EZK A;  2LJR A;  2BMX A;  2AUV A;  2L6D A;  3IAM 2;  1TK5 B;  5KN3 A;  1GTI A;  5G5F A;  4OCF A;  4TR4 A;  3EYT A;  1HQO A;  1ZCP A;  2JL4 A;  1TOF A;  3W8J A;  3TOT A;  4N0Z A;  2NBS A;  1M9A A;  2E0Q A;  3KD0 A;  5D9X A;  1X5D A;  2H01 A;  3OR5 A;  3P8W A;  1TDI A;  4MJA A;  1TKD B;  2YWN A;  1Q4J A;  2YNX A;  5B7C A;  1HYU A;  1SJI A;  4I5Q A;  1EP8 A;  1U3A A;  3FZA A;  4TOP A;  3GYK A;  4OO4 A;  3TB2 A;  3VWV A;  2YJ7 A;  5KN1 A;  4GF0 A;  2VL2 A;  4JED A;  3L9U A;  4MF7 A;  1F9M A;  4JR4 A;  4IBP A;  2LNS A;  3ZMK A;  1XWG A;  4OFN A;  4KSM A;  3APQ A;  4J57 E;  4HZ2 A;  2H73 A;  1GTA A;  4N10 A;  3F9U A;  3HJP A;  2B5Y A;  5LNK e;  3KZQ A;  2JAC A;  1G7O A;  2OKA A;  5A4U A;  1ZYE A;  3LXT A;  2I81 A;  5B6N A;  2GST A;  1SK0 A;  4NXI A;  3ZRE A;  4PUA A;  1EV9 A;  3DKS A;  4IP6 A;  3EUR A;  3DD3 A;  4HDE A;  1MDI A;  1A0F A;  5DBQ A;  3M3M A;  4DSR A;  1BED A;  4HUA A;  2CVB A;  2EIQ A;  3ZFB A;  4IP1 A;  3CTG A;  5D93 A;  2VD0 A;  3QAV A;  3C8E A;  2OA7 A;  2HZF A;  4F9Z A;  2FGX A;  1JZO A;  1FHE A;  1GUK A;  2VCW A;  3FR3 A;  3GHA A;  4MPF A;  1ERW A;  2O87 A;  1O8W A;  2DJK A;  3LXZ A;  2VCX A;  1VRS D;  4HS1 A;  2VLV A;  2GZZ A;  4WET A;  3GRX A;  2AV4 A;  4NPB A;  3KGK A;  2QC7 A;  4MPG A;  1NM3 A;  3CRT A;  4KW6 A;  1F37 A;  3EMX A;  4YAP A;  3E3E A;  1K3L A;  4CHS A;  5EL8 A;  2OE0 A;  1GSY A;  2VL9 A;  1YKC A;  4MF6 A;  3S9F A;  3Q18 A;  1EGR A;  3GTU B;  2DC5 A;  4KUN A;  4MK3 A;  2JSY A;  4DSQ A;  4P3Y B;  1K0D A;  1MTC A;  2ON7 A;  3UOM A;  1KBN A;  1AIU A;  2BTO T;  2ES7 A;  4KAE A;  3H4K A;  3EVI A;  1XWB A;  4ZIJ A;  3IBH A;  3G7J A;  1MD3 A;  1OVN A;  1SYR A;  3GIX A;  4WXT A;  2GQM A;  3RDW A;  2MMA A;  4K7O A;  4ISD A;  3VWW A;  1VF1 A;  2J9H A;  5JCG A;  3J7Y b;  1O6J A;  2LTK A;  4QQ7 A;  4BA7 A;  2H6Y A;  1IYI A;  4I2T A;  6GSX A;  2FWG A;  2LEG A;  1EP7 A;  5F0G A;  2V41 A;  1SL1 B;  1PN9 A;  2MMN A;  3QFB C;  4Q5F A;  3GMF A;  3TKS E;  3IOS A;  2A2S A;  3HYP A;  2A2R A;  3UEM A;  2VUP A;  1WP0 A;  4WR5 A;  1TK8 B;  2QSI A;  2H1D A;  2WRT A;  3E0U A;  2C3T A;  3APS A;  2OBI A;  4MH2 A;  3VFI A;  4FH8 A;  5DCH A;  4GQF A;  1USB A;  4NHW A;  1JFU A;  5LCZ A;  4WR4 A;  5ECH B;  2RUE A;  4KH7 A;  2TRC P;  1B48 A;  5J3R A;  2WZ9 A;  4ML6 A;  1RK4 A;  1NHO A;  3HZ8 A;  2M46 A;  1VGL A;  5ECO B;  1RQM A;  1T1V A;  4ZB9 A;  4K7I A;  2ZCT A;  5JWR B;  2CAQ A;  1UA5 A;  4TN8 A;  2FD3 A;  4AGS A;  2FWH A;  1FG4 A;  2B1K A;  2IMD A;  3Q6O A;  1FB0 A;  2H76 A;  5ID2 A;  4OD7 A;  2R6K A;  4HU7 A;  4DEJ A;  3VI5 A;  1FW1 A;  2IFQ A;  2JZS A;  1XCC A;  2GTU A;  1OC9 B;  4L0U A;  3FK8 A;  4IJI A;  5ELA A;  2LQO A;  2DJ3 A;  2DIY A;  5C04 A;  2YN1 A;  5A5K A;  4RQX A;  4V2L A;  1SYX A;  4ML1 A;  2VD1 A;  1YF1 A;  3A2V A;  4EDZ A;  4PNF A;  3QAG A;  3ME8 A;  1RW1 A;  3ERW A;  2FCH A;  5IMC A;  1OKT A;  4MDC A;  1U87 A;  2LQQ A;  3IAS 2;  4BWS A;  3F6F A;  4AJ8 A;  1W4V A;  2N5B A;  3W6G A;  1XW5 A;  2LUS A;  2DLX A;  5D8I A;  2X8H A;  2PBJ A;  4F82 A;  4MLY A;  1GSS A;  4Z7X A;  3M9J A;  4GTU A;  4RQR A;  1EEJ A;  3LJR A;  14GS A;  4G9H A;  5D9V A;  5F8B A;  2KP2 A;  1JZD A;  5FT3 A;  1T3B A;  4GWR A;  2B6M A;  1WJK A;  3GNJ A;  1T00 A;  1X5C A;  1SKW B;  3FR9 A;  3ZL5 A;  2AHE A;  4PNG A;  2GGT A;  3Q19 A;  3LOR A;  5G5E A;  11GS A;  1AQW A;  3QCP A;  4I8B A;  1O73 A;  2O89 A;  1H75 A;  5L71 A;  2E2M A;  4ILF A;  1B9X C;  1V2A A;  2XHF A;  3GSS A;  1A24 A;  4Q5N A;  3U5R E;  1SK1 A;  2PUK C;  4PUR A;  1KTE A;  3G7I A;  1K0A A;  2IMI A;  2BJX A;  1H4O A;  2JZR A;  4GLT A;  3EU3 A;  3K8N A;  4GQC A;  3C71 A;  4IKH A;  1A23 A;  1TP9 A;  2O7K A;  4ZIL A;  5HQP A;  1DE2 A;  1URM A;  5D96 A;  4IEL A;  2DJ0 A;  1TXX A;  3RPN A;  3H8Q A;  4BWQ A;  1CQH A;  5J9B A;  2HI7 A;  2X8C A;  5E59 A;  1DE1 A;  3GN3 A;  5ECK B;  1ZL9 A;  3IRA A;  3TRX A;  2YP6 A;  2H71 A;  4ZL8 A;  3BD2 A;  3KMN A;  4IJ3 A;  5ENU A;  4F0C A;  6GSU A;  4K1F A;  5ECR B;  3IK7 A;  4XCS A;  1R26 A;  3HVS A;  1SU9 A;  5F07 A;  2H1G A;  3FZ9 A;  3G7Y A;  1XWA A;  4QL7 A;  4K6X A;  1M2D A;  2CVK A;  1MEK A;  1ON4 A; 
#chains in the Genus database with same CATH topology
 4KND A;  4KF9 A;  5IO0 A;  3ERF A;  5JCW A;  4BL7 A;  6GSW A;  4TVE A;  2GT6 A;  1I5G A;  3A5I A;  3IK9 A;  4ZL7 A;  1R5A A;  2N5F A;  4IQ1 A;  5HFK A;  2X64 A;  4MJB A;  3TJK A;  1YEX A;  2V6O A;  2R2J A;  1OKD A;  3KCM A;  4HI7 A;  3DEX A;  1WOU A;  3L4N A;  1OC9 A;  5HR0 A;  1SJ6 A;  3EE2 A;  2VIM A;  5IIZ A;  4FIW A;  3D22 A;  2C3N A;  4N11 A;  2Z9S A;  1BG5 A;  3CSI A;  2L6C A;  5AIS A;  3KM6 A;  2H1A A;  2KLX A;  1ML6 A;  1TI3 A;  3F0I A;  2LKU A;  1M7T A;  2OE3 A;  4I97 A;  3QOU A;  3UL3 A;  3UVH A;  4ICY A;  3O76 A;  2IJY A;  3UIW A;  3LWA A;  1A8Y A;  2VCQ A;  3M9K A;  4IGJ A;  1UC7 A;  2CVD A;  2R3X A;  3TCO A;  1YEP A;  3H1N A;  2I3Y A;  1VF4 A;  1M0U A;  3GL5 A;  3CMI A;  4O92 A;  3TKQ A;  3US3 A;  3ZRD A;  5DQS A;  2HT9 A;  1B8X A;  4KGI A;  4MZW A;  1DUG A;  4V2M A;  3GX8 A;  7GSS A;  2F9S A;  2YJH A;  3PIN A;  1N8J A;  3D4M A;  1G7E A;  5F05 A;  3F63 A;  1JZR A;  4IW9 A;  4K0N A;  1TTZ A;  2LJA A;  5ID2 B;  3C1R A;  3TKS C;  2H0I A;  2IFQ B;  1SEN A;  3I69 A;  4MZC A;  2H1B A;  1TU7 A;  3MIX A;  1XZO A;  2MBS A;  1GWC A;  3BBY A;  4JE1 A;  2PMT A;  5CRD A;  5GST A;  5KN2 A;  1QXH A;  2NVL A;  4J2F A;  1GTB A;  5DVB A;  5IMD A;  3LGC A;  4EDY A;  5JWQ B;  1B4P A;  2FLS A;  3R3E A;  3SBC A;  4F03 A;  3KEB A;  4YQM A;  3ZVJ A;  2JSZ A;  2CQ9 A;  1U88 A;  3HJM A;  3E9J B;  4YQV A;  1PX7 A;  3IR4 A;  1HD2 A;  1UN2 A;  1FOV A;  4AJ7 A;  5IQY A;  6GSY A;  1U6T A;  2OAD A;  2CZ2 A;  5AIV A;  2L59 A;  3NZN A;  3M8N A;  3FR6 A;  20GS A;  4OMV A;  1GLP A;  2FUG 2;  3IPZ A;  4XS4 A;  1PQN A;  4EKZ A;  3PPU A;  4G19 A;  2RUF A;  3L9S A;  1G6W A;  3ZFL A;  3ZVJ D;  4JR6 A;  5DAL A;  1MDK A;  3WYW A;  2GT5 A;  8GSS A;  4NV2 A;  1Z6N A;  2A4V A;  4BVY A;  3LEF A;  4TXV A;  1U3I A;  3CXG A;  3ZYW A;  1F3A A;  3VI7 A;  3A5W A;  2R5G A;  3GUS A;  3DIE A;  5H5Q A;  2JAD A;  4AF2 A;  2GSS A;  5JWO B;  1B9Y C;  3ZIV A;  4JBB A;  1SKS B;  2YWI A;  2K9F A;  1O85 A;  2CX4 A;  4GSS A;  5KN0 A;  3VUR A;  3TJJ A;  1FAA A;  1F3B A;  3PR8 A;  2VAF A;  5CRW A;  3GKX A;  4TR3 A;  2HNL A;  2YWO A;  1GLQ A;  2DKI A;  1NW2 A;  1T7P B;  2P5Q A;  3WGX A;  3ZTL A;  3UAR A;  1JZW A;  1PD2 1;  4I6X A;  3W8S A;  2LV3 A;  3O6T A;  3QPM A;  1N2A A;  3I43 A;  2CX3 A;  3RHC A;  1DBY A;  2VLU A;  1PSQ A;  1HNA A;  4HOJ A;  3TKR A;  1QK8 A;  4Q5Q A;  1SD8 A;  1QUW A;  2DML A;  5GAP D;  2HE3 A;  4JU5 A;  1XPV A;  2KHP A;  5GSS A;  2C0F A;  3QAW A;  4BPY A;  2X4A A;  4EO3 A;  1QGV A;  5G31 A;  3UBK A;  4MH3 A;  1R4W A;  4K5R A;  3N5O A;  1ILO A;  2I9H A;  2J23 A;  2WS2 A;  5ECN B;  1ERT A;  2C8U A;  1J9B A;  5JCU A;  4TRX A;  5CYY A;  1WE0 A;  1GSF A;  3UJ1 A;  4K9Z A;  3F8U A;  3ZML A;  4ACS A;  1WPI A;  1SJZ A;  5BMU A;  2N5A A;  1X0R A;  1BJX A;  3TRQ A;  1J08 A;  4POB A;  2QKE A;  3GH9 A;  1XBS A;  4ZXG A;  4TR1 B;  3HKR A;  2LST A;  3GST A;  1AQX A;  4BL7 B;  1JHB A;  5J4U A;  1V9W A;  3LG6 A;  1HNB A;  1QMV A;  2CZ3 A;  4N0V A;  2LJK A;  1WRY A;  1ACV A;  1Z7P A;  4TW5 A;  3ZIT A;  1JLW A;  1X9W B;  4IN0 A;  4ECJ A;  5D9T A;  2FY6 A;  2LRN A;  1ZGN A;  2VCT A;  4ECC A;  2K8S A;  4HQS A;  3HHV A;  1KNG A;  1SKR B;  2HRF A;  2K8V A;  5GZZ B;  4HU9 A;  3GKK A;  5F06 A;  2O8V B;  2OBK A;  3TDG A;  4K2D A;  3ZZX A;  4TKY A;  1O81 A;  1TW9 A;  16GS A;  4K2X A;  3R2Q A;  3MNG A;  1YDK A;  2FWF A;  2B1L A;  4IVF A;  1K3Y A;  3BCI A;  3UVT A;  3N9J A;  2GLR A;  1QFN A;  4ZBD A;  1IYH A;  1W89 A;  3C7M A;  3GX0 A;  4GSN A;  4ZL9 A;  4X0X A;  2LS5 A;  1K0C A;  1OAZ A;  2F3M A;  2F8A A;  4O5Q A;  1WWJ A;  3F4R A;  4MF5 A;  3WGE A;  3TKP A;  4OO5 A;  3HVN A;  5CNW A;  1TU8 A;  2F8F A;  5ELG A;  5IOX A;  3FYG A;  1XOA A;  4V1A p;  4HZ4 A;  5G2Z A;  3QFA C;  3UMA A;  4L8E A;  1GSE A;  2RII A;  18GS A;  3HD5 A;  3FHK A;  1M9B A;  3NIV A;  5CAX A;  5CRE A;  3D21 A;  1YKA A;  2HSH A;  2V32 A;  5FWG A;  1AW9 A;  10GS A;  2CA8 A;  3HCZ A;  2L4Q A;  4KE3 A;  3BCK A;  3TGZ A;  1OC3 A;  5HFG A;  1X9M B;  1VF2 A;  1M3I A;  4K0G A;  1SK2 A;  5HR3 A;  2KOK A;  2H30 A;  3MDK A;  1XVQ A;  2P0G A;  1ERU A;  2H72 A;  1PX6 A;  3KP9 A;  2H75 A;  3KTB A;  3KH9 A;  4PXO A;  4FYU A;  1GSD A;  1PFO A;  6GSV A;  2CV4 A;  3C1S A;  1XIY A;  2PN8 A;  3MWH A;  4LMV A;  4X43 A;  3M0F A;  3M1G A;  2D2Z A;  4L0W A;  1PMT A;  5IOW A;  4GRF A;  4K5S A;  1K0N A;  3BOA A;  1Z3E A;  3GL3 A;  9GSS A;  4OCE A;  4EF0 A;  3BJ5 A;  1PL2 A;  3DVX A;  4Z2U A;  4PUF C;  3KH7 A;  1OC8 A;  1PKW A;  2DJJ A;  4E8H A;  2RLI A;  4IS0 A;  4XS4 B;  3VPT A;  5DQY A;  2DJ2 A;  2YAN A;  2PER A;  4V2N A;  3H79 A;  1EOG A;  2WJU A;  2H74 A;  5DAL B;  1AQV A;  4JRR A;  3P90 A;  4XS1 A;  2XPE A;  2XBQ A;  2F51 A;  1FB6 A;  3FZ5 A;  3F4T A;  3L0H A;  5HFI A;  3ISO A;  4GXZ A;  1K0B A;  2XBI A;  4LLR A;  4PGT A;  1KEB A;  3AY8 A;  3GH6 A;  4LMW A;  1K3O A;  2GZY A;  2YCD A;  2B3S A;  2C0D A;  1YJ6 A;  2E2G A;  2CT6 A;  1BAY A;  1E2Y A;  4XRD A;  5ECM B;  3GKM A;  1BQ7 A;  1PRX A;  4TR1 A;  4EUY A;  3GFK A;  5A4W A;  3GA4 A;  5INY A;  1A2M A;  3DYR A;  2EIR A;  2H0H A;  2I4A A;  4BVX B;  1V40 A;  1O7U A;  5G1K A;  4ZB6 A;  1Z9H A;  4HEA 2;  3D5J A;  4I2U A;  2H19 A;  1OYJ A;  3QDN A;  1F2E A;  2O85 A;  1NHY A;  3RAZ A;  3MAK A;  1FVJ A;  2E7P A;  5IMA A;  3A2W A;  2G2Q A;  3DVW A;  2EIO A;  5D9W A;  2EC4 A;  3HZ4 A;  1HNC A;  2VL2 C;  5AGY A;  2C0G A;  2IIY A;  3ZIJ A;  3RBT A;  2OJL A;  4DVC A;  4E8E A;  1ERV A;  1YF0 A;  2K6V A;  1S3D A;  2QGV A;  3HJO A;  3HXS A;  2VL3 A;  1GP1 A;  3CTF A;  1GRX A;  5CRG A;  4EE0 A;  4CDO A;  1THO A;  2DJ1 A;  4LL4 B;  3ZLP A;  1LJR A;  5G1L A;  1XWK A;  2HRA A;  4K8M A;  1ZZY A;  3CSJ A;  5CO3 A;  1QQ2 A;  4EIQ A;  4NAX A;  17GS A;  5GAN D;  4MJE A;  2OAC A;  2VCZ A;  2REM A;  3G9B A;  3VWX A;  4MZB A;  2HYX A;  5ECS A;  1LBK A;  1M2B A;  3ERG A;  1ZYP A;  2G0F A;  4YKG A;  2V6K A;  2GSR A;  1C72 A;  3I9V 2;  4WEY A;  1T4Y A;  3MSZ A;  3LQ7 A;  4HJM A;  2X8G A;  4O5R A;  3EMP A;  4EL1 A;  2B5X A;  3SWL A;  2WDU A;  4OWY A;  2H0G A;  2KUC A;  1YQ1 A;  2AYT A;  1GTU A;  4G10 A;  4KDY A;  4WF5 A;  1Q98 A;  1E6B A;  2YV9 A;  2WB9 A;  2VO4 A;  3O3T A;  3L78 A;  1F6M C;  1XVW A;  3KIJ A;  1AC1 A;  3P7X A;  4JZQ A;  1EV4 A;  4NWY A;  5H5R A;  1V98 A;  4CW9 A;  3IA1 A;  2HFD A;  1CQG A;  2V1M A;  1S3A A;  1K0O A;  1V57 A;  5AN1 A;  2K18 A;  3ED3 A;  3RPP A;  1EGO A;  3KP8 A;  4NV5 A;  1XWC A;  3FEU A;  2I1U A;  5ECP B;  2P5R A;  4L5L A;  4CY8 A;  1GH2 A;  1M3J A;  2YZH A;  3CYN A;  2L5O A;  4TR0 A;  3TUE A;  1G6Y A;  3UAP A;  2VOC A;  4PQ1 A;  2H8L A;  1Z6M A;  3KTL A;  3V1W A;  4D73 B;  3NOF A;  1TK0 B;  4ECB A;  2OE1 A;  4WF4 A;  4GST A;  3QMX A;  3TKS A;  12GS A;  4WBJ A;  1GNW A;  5KEJ A;  1S3R A;  2XC2 A;  4EXJ A;  4FO5 A;  2PU9 C;  2AB6 A;  4MNN A;  3EIN A;  1A8L A;  3D6I A;  3FMW A;  4EVM A;  2ZUP A;  3U6V A;  1T8E B;  3FRC A;  4KSO A;  5J5N A;  3WT1 A;  4G2E A;  3LYK A;  3KMO A;  1SD9 A;  4KX4 A;  4PQH A;  2PVQ A;  3DRN A;  4PQI A;  2HZE B;  1MDJ A;  2VCV A;  3TJB A;  5COH A;  2JU5 A;  1PA3 A;  5ECI B;  2VM1 A;  2IMK A;  1TRU A;  4BVX A;  2IN3 A;  3HVV A;  4DSS B;  1OE7 A;  2R0G A;  2C1Y A;  1R5P A;  1GL8 A;  1ABA A;  4TXO A;  2H6Z A;  2B7J A;  1XOB A;  3GV1 A;  5IPG A;  5DAK A;  4FYC A;  22GS A;  3WGD A;  3FW2 A;  3VPQ A;  5C00 A;  2WGR A;  3Q74 A;  4K7N A;  2GSQ A;  2FWE A;  3IHQ A;  4XRA A;  4N30 A;  1X5E A;  2VLT A;  4QL9 A;  3KXO A;  3F3R A;  5LD0 A;  19GS A;  2L4C A;  2JZT A;  2B5E A;  2CAI A;  1ZOF A;  1J0F A;  6GST A;  4POL A;  3CBU A;  5FHI A;  4Q5R A;  4WKW A;  2VM2 A;  3ME7 A;  5IMF A;  2FHE A;  4KA0 A;  1WIK A;  4ULX A;  1XW6 A;  1K0M A;  4O7H A;  1V58 A;  1XFL A;  1LU4 A;  3F6D A;  2GQK A;  2PVO C;  3CRU A;  1AXD A;  2P31 A;  1GUL A;  4KDX A;  2WUL A;  4NMU A;  3D4T A;  1YY7 A;  2X49 A;  5EVO A;  4PX1 A;  4L5O A;  1PGT A;  4ZBB A;  13GS A;  1JLV A;  2DMM A;  5AIX A;  4IHU A;  4HQZ A;  1BYE A;  4EC0 A;  3A2X A;  2RM6 A;  5ECQ B;  4XS6 A;  2HRN A;  2KP1 A;  2LRC A;  1X9S B;  2FA8 A;  1R7H A;  2PWJ A;  2R37 A;  3TJG A;  4X1U A;  2RM5 A;  5IPH A;  2V2G A;  1ST9 A;  4POK A;  1A2J A;  3DXB A;  2A2P A;  2HLS A;  3RHB A;  4KB3 A;  5G30 A;  2GQL A;  1EOH A;  4MA9 A;  3J7Y k;  3IC4 A;  2WCI A;  3EWL A;  5EY6 A;  2MZC A;  2YOI A;  1MD4 A;  4NHZ A;  2B7K A;  3TRP A;  2AJQ B;  2MMO A;  3DML A;  3DWV A;  2M80 A;  2X99 A;  1GSU A;  4ID0 A;  5DCG A;  1OE8 A;  1XXU A;  4HJ2 A;  2PGT A;  1EWX A;  1O8X A;  3HVX A;  5D73 A;  4G0K A;  1TRS A;  3C73 A;  3I6A A;  5IM9 A;  1I9D A;  5HR1 A;  2R0P A;  3LYP A;  4LL1 B;  1TJD A;  1ZMA A;  5CP1 A;  2L5L A;  4D73 A;  4POM A;  1Z7R A;  1SL0 B;  4J56 E;  5EPF A;  3QR6 A;  3HA9 A;  1TRV A;  2C3Q A;  4X4J A;  5DDL A;  1AUC A;  4MMM A;  3CSH A;  4H86 A;  2HXK A;  5BRT A;  4XHM A;  3IC8 A;  4V1A g;  5H5S A;  4XTS A;  2MYG A;  2GDR A;  4KCA A;  3DGQ A;  2DBC A;  2LRT A;  2WFC A;  4MP4 A;  2ALB A;  3FZ4 A;  2L57 A;  2IWT A;  3GTU A;  2HSM A;  2M72 A;  2HZE A;  2TRX A;  3EC3 A;  2XPD A;  5B8B A;  1PKZ A;  3L9V A;  4DSS A;  5J41 A;  4MAB A;  2YZU A;  5ABR A;  3VK9 A;  2QA1 A;  3KJY A;  5IO2 A;  4KCE A;  2IME A;  1GNE A;  1WMJ A;  4Z2T A;  5ECL B;  3F4S A;  3PH9 A;  3IE3 A;  4F0B A;  2ZNM A;  2H70 A;  3FY7 A;  3TOU A;  3H93 A;  5HR2 A;  2H6X A;  1T4Z A;  2AAW A;  4GCI A;  1GUM A;  2FNO A;  3UBL A;  2A4H A;  5DJM A;  2NTO A;  5CRH A;  3GKN A;  2IPA A;  4WBR D;  1UVZ A;  4FYB A;  4O32 A;  1M2A A;  3IDV A;  4CY6 A;  4ZB8 A;  3WD6 A;  2IMF A;  1YZX A;  3IXR A;  2GS3 A;  1Y6E A;  3HDC A;  2C0E A;  5DJL A;  1B4Q A;  1G0T A;  1PL1 A;  4OFT A;  4FQU A;  3FKF A;  1FO5 A;  2NDO A;  2R4V A;  3PGT A;  3TJF A;  4YQU A;  4YAV A;  2FA4 A;  4LA1 A;  4O5U A;  5IMV A;  1XW9 A;  2C80 A;  3F3Q A;  1ZYQ B;  3LFL A;  1S3C A;  2DSA A;  3GUR A;  1GUH A;  1FVK A;  4RI7 A;  1GSQ A;  5E4W A;  2ON5 A;  3D0Z A;  1A0R P;  1SL2 B;  3VWU A;  4YH2 A;  3WT2 A;  2MMZ A;  3A3T A;  2YWM A;  3APO A;  2HSY A;  2YPM A;  2IL3 A;  4AJ6 A;  5J9C A;  2DIZ A;  1DSB A;  3EU4 A;  6GSS A;  5B8A A;  4G0I A;  1THX A;  4TXO B;  4KDU A;  2NPB A;  2H66 A;  3VLN A;  1EEM A;  1TI1 A;  5DAK B;  4IQA A;  2LNT A;  2TIR A;  3P2A A;  3IHG A;  2MBT A;  4MJC A;  5IMZ A;  1AAZ A;  1Y25 A;  2C4J A;  3IV4 A;  1VF3 A;  1M99 A;  2GVP A;  4RUV A;  4ECI A;  3JCM L;  4RI6 A;  4MCU A;  5A4V A;  2PPT A;  3MYD A;  3QD9 A;  2YV7 A;  1TRW A;  2GZP A;  4XIH A;  4ZBA A;  5B6M A;  1A2L A;  1NSW A;  4OFM A;  1Z5Y E;  3LSZ A;  1BX9 A;  3HY2 A;  4F2I A;  1EZK A;  2LJR A;  2BMX A;  2AUV A;  2L6D A;  3IAM 2;  4YKF A;  2R0C A;  1TK5 B;  5KN3 A;  1GTI A;  5G5F A;  4OCF A;  4TR4 A;  3EYT A;  1HQO A;  1ZCP A;  2JL4 A;  1TOF A;  3W8J A;  3TOT A;  4N0Z A;  2NBS A;  1M9A A;  4BIK A;  2E0Q A;  3KD0 A;  5D9X A;  1X5D A;  2H01 A;  3OR5 A;  3P8W A;  1TDI A;  4MJA A;  1TKD B;  2YWN A;  1Q4J A;  2YNX A;  5B7C A;  1HYU A;  1SJI A;  4I5Q A;  1EP8 A;  1U3A A;  3FZA A;  4TOP A;  3GYK A;  4OO4 A;  3TB2 A;  3VWV A;  2YJ7 A;  5KN1 A;  4GF0 A;  2VL2 A;  4JED A;  3L9U A;  4MF7 A;  1F9M A;  4JR4 A;  4IBP A;  2LNS A;  3ZMK A;  5KOX A;  1XWG A;  4OFN A;  4KSM A;  3APQ A;  4J57 E;  4HZ2 A;  2H73 A;  1GTA A;  4N10 A;  3F9U A;  3HJP A;  2B5Y A;  5LNK e;  3KZQ A;  2JAC A;  1G7O A;  2OKA A;  5A4U A;  1ZYE A;  3LXT A;  2I81 A;  5B6N A;  2GST A;  1SK0 A;  4NXI A;  3ZRE A;  4PUA A;  1EV9 A;  3DKS A;  4IP6 A;  3EUR A;  3DD3 A;  4HDE A;  1MDI A;  5KOW A;  1A0F A;  5DBQ A;  3M3M A;  4DSR A;  1BED A;  4HUA A;  2CVB A;  2EIQ A;  3ZFB A;  4IP1 A;  1PN0 A;  2QA2 A;  3CTG A;  5D93 A;  2VD0 A;  3QAV A;  3C8E A;  2OA7 A;  2HZF A;  3EPT A;  2FGX A;  4F9Z A;  1JZO A;  1FHE A;  1GUK A;  2VCW A;  3FR3 A;  3GHA A;  4MPF A;  1ERW A;  2O87 A;  1O8W A;  2DJK A;  3LXZ A;  2VCX A;  1VRS D;  4HS1 A;  2UZ8 A;  2VLV A;  2GZZ A;  4WET A;  3GRX A;  2AV4 A;  4NPB A;  3KGK A;  2QC7 A;  4MPG A;  1NM3 A;  3CRT A;  4KW6 A;  1F37 A;  3EMX A;  4YAP A;  3E3E A;  1K3L A;  1ZYN A;  4CHS A;  5EL8 A;  2OE0 A;  1GSY A;  2VL9 A;  1YKC A;  4MF6 A;  3S9F A;  3Q18 A;  1EGR A;  3GTU B;  2DC5 A;  4KUN A;  4MK3 A;  2JSY A;  4DSQ A;  4P3Y B;  1K0D A;  1MTC A;  2ON7 A;  3UOM A;  1KBN A;  1AIU A;  2BTO T;  2ES7 A;  4KAE A;  3H4K A;  3EVI A;  1XWB A;  2HRK A;  4ZIJ A;  3IBH A;  3G7J A;  1MD3 A;  1OVN A;  1SYR A;  4WXT A;  3GIX A;  2GQM A;  3RDW A;  1XG8 A;  2MMA A;  4K7O A;  4ISD A;  3VWW A;  1VF1 A;  2J9H A;  5JCG A;  3J7Y b;  1O6J A;  1FOH A;  2LTK A;  4QQ7 A;  4BA7 A;  2H6Y A;  1IYI A;  4I2T A;  6GSX A;  2FWG A;  2LEG A;  1EP7 A;  5F0G A;  2V41 A;  1SL1 B;  1PN9 A;  2MMN A;  3QFB C;  4Q5F A;  3GMF A;  3TKS E;  3IOS A;  2A2S A;  3HYP A;  2A2R A;  3UEM A;  2VUP A;  1WP0 A;  4WR5 A;  1TK8 B;  2QSI A;  2H1D A;  2WRT A;  3E0U A;  2C3T A;  3APS A;  2OBI A;  4MH2 A;  3VFI A;  4FH8 A;  5DCH A;  4GQF A;  1USB A;  4NHW A;  1JFU A;  5LCZ A;  4WR4 A;  5ECH B;  2RUE A;  4HSC X;  4KH7 A;  2TRC P;  1B48 A;  5J3R A;  2WZ9 A;  4ML6 A;  1RK4 A;  1NHO A;  3HZ8 A;  2M46 A;  1VGL A;  5ECO B;  1RQM A;  1T1V A;  4ZB9 A;  4K7I A;  2ZCT A;  5JWR B;  3LW9 A;  2CAQ A;  1UA5 A;  4TN8 A;  2FD3 A;  4AGS A;  2FWH A;  1FG4 A;  2B1K A;  2IMD A;  3Q6O A;  1FB0 A;  2H76 A;  3CQF A;  5ID2 A;  4OD7 A;  2R6K A;  4HU7 A;  4DEJ A;  3VI5 A;  1FW1 A;  2IFQ A;  2JZS A;  1XCC A;  2GTU A;  1OC9 B;  4L0U A;  3FK8 A;  4IJI A;  5ELA A;  2LQO A;  2DJ3 A;  2DIY A;  5C04 A;  2YN1 A;  5A5K A;  4RQX A;  4V2L A;  1SYX A;  4ML1 A;  2VD1 A;  1YF1 A;  3A2V A;  4EDZ A;  4A5P A;  4PNF A;  3QAG A;  3ME8 A;  1RW1 A;  3ERW A;  2FCH A;  5IMC A;  1OKT A;  4MDC A;  1U87 A;  2DKH A;  2LQQ A;  3IAS 2;  4BWS A;  3F6F A;  4AJ8 A;  1W4V A;  2N5B A;  3W6G A;  1XW5 A;  2LUS A;  2DLX A;  5D8I A;  2X8H A;  2PBJ A;  4F82 A;  4MLY A;  1GSS A;  4Z7X A;  3M9J A;  4GTU A;  4RQR A;  1EEJ A;  3LJR A;  14GS A;  4G9H A;  5D9V A;  5F8B A;  2KP2 A;  1JZD A;  5FT3 A;  1T3B A;  4GWR A;  2B6M A;  1WJK A;  3GNJ A;  1T00 A;  1X5C A;  1SKW B;  3FR9 A;  3ZL5 A;  2AHE A;  4PNG A;  2GGT A;  3Q19 A;  3LOR A;  5G5E A;  11GS A;  1AQW A;  3QCP A;  4I8B A;  1O73 A;  2O89 A;  1H75 A;  4USS A;  5L71 A;  2E2M A;  4ILF A;  1B9X C;  1V2A A;  2XHF A;  3GSS A;  1A24 A;  4Q5N A;  3U5R E;  1SK1 A;  2PUK C;  4PUR A;  4G0L A;  1KTE A;  3G7I A;  1K0A A;  2IMI A;  2BJX A;  1H4O A;  2JZR A;  4GLT A;  3EU3 A;  3K8N A;  4GQC A;  3C71 A;  4IKH A;  1A23 A;  1TP9 A;  2O7K A;  4ZIL A;  5HQP A;  1DE2 A;  1URM A;  5D96 A;  4IEL A;  2DJ0 A;  1TXX A;  3RPN A;  3H8Q A;  4BWQ A;  1CQH A;  5J9B A;  2HI7 A;  2X8C A;  5E59 A;  1DE1 A;  3GN3 A;  5ECK B;  1ZL9 A;  3IRA A;  3TRX A;  2YP6 A;  2H71 A;  4ZL8 A;  3BD2 A;  4EIP A;  3KMN A;  4Z2R A;  4IJ3 A;  5ENU A;  4F0C A;  4BVY B;  6GSU A;  4K1F A;  5ECR B;  3IK7 A;  4XCS A;  1R26 A;  3HVS A;  1SU9 A;  5F07 A;  2H1G A;  3FZ9 A;  3G7Y A;  1XWA A;  4QL7 A;  4K6X A;  1M2D A;  4PTS A;  2CVK A;  1MEK A;  1ON4 A; 
#chains in the Genus database with same CATH homology
 4KND A;  4KF9 A;  5IO0 A;  3ERF A;  5JCW A;  4BL7 A;  6GSW A;  4TVE A;  2GT6 A;  1I5G A;  3A5I A;  3IK9 A;  4ZL7 A;  1R5A A;  2N5F A;  4IQ1 A;  5HFK A;  2X64 A;  4MJB A;  3TJK A;  1YEX A;  2V6O A;  2R2J A;  1OKD A;  3KCM A;  4HI7 A;  3DEX A;  1WOU A;  3L4N A;  1OC9 A;  5HR0 A;  1SJ6 A;  3EE2 A;  2VIM A;  5IIZ A;  4FIW A;  3D22 A;  2C3N A;  4N11 A;  2Z9S A;  1BG5 A;  3CSI A;  2L6C A;  5AIS A;  3KM6 A;  2H1A A;  2KLX A;  1ML6 A;  1TI3 A;  3F0I A;  2LKU A;  1M7T A;  2OE3 A;  4I97 A;  3QOU A;  3UL3 A;  3UVH A;  4ICY A;  3O76 A;  2IJY A;  3UIW A;  3LWA A;  1A8Y A;  2VCQ A;  3M9K A;  4IGJ A;  1UC7 A;  2CVD A;  2R3X A;  3TCO A;  1YEP A;  3H1N A;  2I3Y A;  1VF4 A;  1M0U A;  3GL5 A;  3CMI A;  4O92 A;  3TKQ A;  3US3 A;  3ZRD A;  5DQS A;  2HT9 A;  1B8X A;  4KGI A;  4MZW A;  1DUG A;  4V2M A;  3GX8 A;  7GSS A;  2F9S A;  2YJH A;  3PIN A;  1N8J A;  3D4M A;  1G7E A;  5F05 A;  3F63 A;  1JZR A;  4IW9 A;  4K0N A;  1TTZ A;  2LJA A;  5ID2 B;  3C1R A;  3TKS C;  2H0I A;  2IFQ B;  1SEN A;  3I69 A;  4MZC A;  2H1B A;  1TU7 A;  3MIX A;  1XZO A;  2MBS A;  1GWC A;  3BBY A;  4JE1 A;  2PMT A;  5CRD A;  5GST A;  5KN2 A;  1QXH A;  2NVL A;  4J2F A;  1GTB A;  5DVB A;  5IMD A;  3LGC A;  4EDY A;  5JWQ B;  1B4P A;  2FLS A;  3R3E A;  3SBC A;  4F03 A;  3KEB A;  4YQM A;  3ZVJ A;  2JSZ A;  2CQ9 A;  1U88 A;  3HJM A;  3E9J B;  4YQV A;  1PX7 A;  3IR4 A;  1HD2 A;  1UN2 A;  1FOV A;  4AJ7 A;  5IQY A;  6GSY A;  1U6T A;  2OAD A;  2CZ2 A;  5AIV A;  2L59 A;  3NZN A;  3M8N A;  3FR6 A;  20GS A;  4OMV A;  1GLP A;  2FUG 2;  3IPZ A;  4XS4 A;  1PQN A;  4EKZ A;  3PPU A;  4G19 A;  2RUF A;  3L9S A;  1G6W A;  3ZFL A;  3ZVJ D;  4JR6 A;  5DAL A;  1MDK A;  3WYW A;  2GT5 A;  8GSS A;  4NV2 A;  1Z6N A;  2A4V A;  4BVY A;  3LEF A;  4TXV A;  1U3I A;  3CXG A;  3ZYW A;  1F3A A;  3VI7 A;  3A5W A;  2R5G A;  3GUS A;  3DIE A;  5H5Q A;  2JAD A;  4AF2 A;  2GSS A;  5JWO B;  1B9Y C;  3ZIV A;  4JBB A;  1SKS B;  2YWI A;  2K9F A;  1O85 A;  2CX4 A;  4GSS A;  5KN0 A;  3VUR A;  3TJJ A;  1FAA A;  1F3B A;  3PR8 A;  2VAF A;  5CRW A;  3GKX A;  4TR3 A;  2HNL A;  2YWO A;  1GLQ A;  2DKI A;  1NW2 A;  1T7P B;  2P5Q A;  3WGX A;  3ZTL A;  3UAR A;  1JZW A;  1PD2 1;  4I6X A;  3W8S A;  2LV3 A;  3O6T A;  3QPM A;  1N2A A;  3I43 A;  2CX3 A;  3RHC A;  1DBY A;  2VLU A;  1PSQ A;  1HNA A;  4HOJ A;  3TKR A;  1QK8 A;  4Q5Q A;  1SD8 A;  1QUW A;  2DML A;  5GAP D;  2HE3 A;  4JU5 A;  1XPV A;  2KHP A;  5GSS A;  2C0F A;  3QAW A;  4BPY A;  2X4A A;  4EO3 A;  1QGV A;  5G31 A;  3UBK A;  4MH3 A;  1R4W A;  4K5R A;  3N5O A;  1ILO A;  2I9H A;  2J23 A;  2WS2 A;  5ECN B;  1ERT A;  2C8U A;  1J9B A;  5JCU A;  4TRX A;  5CYY A;  1WE0 A;  1GSF A;  3UJ1 A;  4K9Z A;  3F8U A;  3ZML A;  4ACS A;  1WPI A;  1SJZ A;  5BMU A;  2N5A A;  1X0R A;  1BJX A;  3TRQ A;  1J08 A;  4POB A;  2QKE A;  3GH9 A;  1XBS A;  4ZXG A;  4TR1 B;  3HKR A;  2LST A;  3GST A;  1AQX A;  4BL7 B;  1JHB A;  5J4U A;  1V9W A;  3LG6 A;  1HNB A;  1QMV A;  2CZ3 A;  4N0V A;  2LJK A;  1WRY A;  1ACV A;  1Z7P A;  4TW5 A;  3ZIT A;  1JLW A;  1X9W B;  4IN0 A;  4ECJ A;  5D9T A;  2FY6 A;  2LRN A;  1ZGN A;  2VCT A;  4ECC A;  2K8S A;  4HQS A;  3HHV A;  1KNG A;  1SKR B;  2HRF A;  2K8V A;  5GZZ B;  4HU9 A;  3GKK A;  5F06 A;  2O8V B;  2OBK A;  3TDG A;  4K2D A;  3ZZX A;  4TKY A;  1O81 A;  1TW9 A;  16GS A;  4K2X A;  3R2Q A;  3MNG A;  1YDK A;  2FWF A;  2B1L A;  4IVF A;  1K3Y A;  3BCI A;  3UVT A;  3N9J A;  2GLR A;  1QFN A;  4ZBD A;  1IYH A;  1W89 A;  3C7M A;  3GX0 A;  4GSN A;  4ZL9 A;  4X0X A;  2LS5 A;  1K0C A;  1OAZ A;  2F3M A;  2F8A A;  4O5Q A;  1WWJ A;  3F4R A;  4MF5 A;  3WGE A;  3TKP A;  4OO5 A;  5CNW A;  1TU8 A;  2F8F A;  5ELG A;  5IOX A;  3FYG A;  1XOA A;  4V1A p;  4HZ4 A;  5G2Z A;  3QFA C;  3UMA A;  4L8E A;  1GSE A;  2RII A;  18GS A;  3HD5 A;  3FHK A;  1M9B A;  3NIV A;  5CAX A;  5CRE A;  3D21 A;  1YKA A;  2HSH A;  2V32 A;  5FWG A;  1AW9 A;  10GS A;  2CA8 A;  3HCZ A;  2L4Q A;  4KE3 A;  3BCK A;  3TGZ A;  1OC3 A;  5HFG A;  1X9M B;  1VF2 A;  4K0G A;  1SK2 A;  5HR3 A;  2KOK A;  2H30 A;  3MDK A;  1XVQ A;  2P0G A;  1ERU A;  2H72 A;  1PX6 A;  3KP9 A;  2H75 A;  3KTB A;  3KH9 A;  4PXO A;  4FYU A;  1GSD A;  6GSV A;  2CV4 A;  3C1S A;  1XIY A;  2PN8 A;  3MWH A;  4LMV A;  4X43 A;  3M0F A;  3M1G A;  2D2Z A;  4L0W A;  1PMT A;  5IOW A;  4GRF A;  4K5S A;  1K0N A;  3BOA A;  1Z3E A;  3GL3 A;  9GSS A;  4OCE A;  4EF0 A;  3BJ5 A;  1PL2 A;  3DVX A;  4Z2U A;  4PUF C;  3KH7 A;  1OC8 A;  1PKW A;  2DJJ A;  4E8H A;  2RLI A;  4IS0 A;  4XS4 B;  3VPT A;  5DQY A;  2DJ2 A;  2YAN A;  2PER A;  4V2N A;  3H79 A;  1EOG A;  2WJU A;  2H74 A;  5DAL B;  1AQV A;  4JRR A;  3P90 A;  4XS1 A;  2XPE A;  2XBQ A;  2F51 A;  1FB6 A;  3FZ5 A;  3F4T A;  3L0H A;  5HFI A;  3ISO A;  4GXZ A;  1K0B A;  2XBI A;  4LLR A;  4PGT A;  1KEB A;  3AY8 A;  3GH6 A;  4LMW A;  1K3O A;  2GZY A;  2YCD A;  2B3S A;  2C0D A;  1YJ6 A;  2E2G A;  2CT6 A;  1BAY A;  1E2Y A;  4XRD A;  5ECM B;  3GKM A;  1BQ7 A;  1PRX A;  4TR1 A;  4EUY A;  3GFK A;  5A4W A;  3GA4 A;  5INY A;  1A2M A;  3DYR A;  2EIR A;  2H0H A;  2I4A A;  4BVX B;  1V40 A;  1O7U A;  5G1K A;  4ZB6 A;  1Z9H A;  4HEA 2;  3D5J A;  4I2U A;  2H19 A;  1OYJ A;  3QDN A;  1F2E A;  2O85 A;  1NHY A;  3RAZ A;  3MAK A;  1FVJ A;  2E7P A;  5IMA A;  3A2W A;  2G2Q A;  3DVW A;  2EIO A;  5D9W A;  2EC4 A;  3HZ4 A;  1HNC A;  2VL2 C;  5AGY A;  2C0G A;  2IIY A;  3ZIJ A;  3RBT A;  2OJL A;  4DVC A;  4E8E A;  1ERV A;  1YF0 A;  2K6V A;  1S3D A;  2QGV A;  3HJO A;  3HXS A;  2VL3 A;  1GP1 A;  3CTF A;  1GRX A;  5CRG A;  4EE0 A;  4CDO A;  1THO A;  2DJ1 A;  4LL4 B;  3ZLP A;  1LJR A;  5G1L A;  1XWK A;  2HRA A;  4K8M A;  1ZZY A;  3CSJ A;  5CO3 A;  1QQ2 A;  4EIQ A;  4NAX A;  17GS A;  5GAN D;  4MJE A;  2OAC A;  2VCZ A;  2REM A;  3G9B A;  3VWX A;  4MZB A;  2HYX A;  5ECS A;  1LBK A;  1M2B A;  3ERG A;  1ZYP A;  2G0F A;  4YKG A;  2V6K A;  2GSR A;  1C72 A;  3I9V 2;  4WEY A;  1T4Y A;  3MSZ A;  3LQ7 A;  4HJM A;  2X8G A;  4O5R A;  3EMP A;  4EL1 A;  2B5X A;  3SWL A;  2WDU A;  4OWY A;  2H0G A;  2KUC A;  1YQ1 A;  2AYT A;  1GTU A;  4G10 A;  4KDY A;  4WF5 A;  1Q98 A;  1E6B A;  2YV9 A;  2WB9 A;  2VO4 A;  3O3T A;  3L78 A;  1F6M C;  1XVW A;  3KIJ A;  1AC1 A;  3P7X A;  4JZQ A;  1EV4 A;  4NWY A;  5H5R A;  1V98 A;  4CW9 A;  3IA1 A;  2HFD A;  1CQG A;  2V1M A;  1S3A A;  1K0O A;  1V57 A;  5AN1 A;  2K18 A;  3ED3 A;  3RPP A;  1EGO A;  3KP8 A;  4NV5 A;  1XWC A;  3FEU A;  2I1U A;  5ECP B;  2P5R A;  4L5L A;  4CY8 A;  1GH2 A;  2YZH A;  3CYN A;  2L5O A;  4TR0 A;  3TUE A;  1G6Y A;  3UAP A;  2VOC A;  4PQ1 A;  2H8L A;  1Z6M A;  3KTL A;  3V1W A;  4D73 B;  3NOF A;  1TK0 B;  4ECB A;  2OE1 A;  4WF4 A;  4GST A;  3QMX A;  3TKS A;  12GS A;  4WBJ A;  1GNW A;  5KEJ A;  2XC2 A;  4EXJ A;  4FO5 A;  2PU9 C;  2AB6 A;  4MNN A;  3EIN A;  1A8L A;  3D6I A;  3FMW A;  4EVM A;  2ZUP A;  3U6V A;  1T8E B;  3FRC A;  4KSO A;  5J5N A;  3WT1 A;  4G2E A;  3LYK A;  3KMO A;  1SD9 A;  4KX4 A;  4PQH A;  2PVQ A;  3DRN A;  4PQI A;  2HZE B;  1MDJ A;  2VCV A;  3TJB A;  5COH A;  2JU5 A;  1PA3 A;  5ECI B;  2VM1 A;  2IMK A;  1TRU A;  4BVX A;  2IN3 A;  3HVV A;  4DSS B;  1OE7 A;  2R0G A;  2C1Y A;  1R5P A;  1GL8 A;  1ABA A;  4TXO A;  2H6Z A;  2B7J A;  1XOB A;  3GV1 A;  5IPG A;  5DAK A;  4FYC A;  22GS A;  3WGD A;  3FW2 A;  3VPQ A;  5C00 A;  2WGR A;  3Q74 A;  4K7N A;  2GSQ A;  2FWE A;  3IHQ A;  4XRA A;  4N30 A;  1X5E A;  2VLT A;  4QL9 A;  3KXO A;  3F3R A;  5LD0 A;  19GS A;  2L4C A;  2JZT A;  2B5E A;  2CAI A;  1ZOF A;  1J0F A;  6GST A;  4POL A;  3CBU A;  5FHI A;  4Q5R A;  4WKW A;  2VM2 A;  3ME7 A;  5IMF A;  2FHE A;  4KA0 A;  1WIK A;  4ULX A;  1XW6 A;  1K0M A;  4O7H A;  1V58 A;  1XFL A;  1LU4 A;  3F6D A;  2GQK A;  2PVO C;  3CRU A;  1AXD A;  2P31 A;  1GUL A;  4KDX A;  2WUL A;  4NMU A;  3D4T A;  1YY7 A;  2X49 A;  5EVO A;  4PX1 A;  4L5O A;  1PGT A;  4ZBB A;  13GS A;  1JLV A;  2DMM A;  5AIX A;  4IHU A;  4HQZ A;  1BYE A;  4EC0 A;  3A2X A;  2RM6 A;  5ECQ B;  4XS6 A;  2HRN A;  2KP1 A;  2LRC A;  1X9S B;  2FA8 A;  1R7H A;  2PWJ A;  2R37 A;  3TJG A;  4X1U A;  2RM5 A;  5IPH A;  2V2G A;  1ST9 A;  4POK A;  1A2J A;  3DXB A;  2A2P A;  2HLS A;  3RHB A;  4KB3 A;  5G30 A;  2GQL A;  1EOH A;  4MA9 A;  3J7Y k;  3IC4 A;  2WCI A;  3EWL A;  5EY6 A;  2MZC A;  2YOI A;  1MD4 A;  4NHZ A;  2B7K A;  3TRP A;  2AJQ B;  2MMO A;  3DML A;  3DWV A;  2M80 A;  2X99 A;  1GSU A;  4ID0 A;  5DCG A;  1OE8 A;  1XXU A;  4HJ2 A;  2PGT A;  1EWX A;  1O8X A;  3HVX A;  5D73 A;  4G0K A;  1TRS A;  3C73 A;  3I6A A;  5IM9 A;  1I9D A;  5HR1 A;  2R0P A;  3LYP A;  4LL1 B;  1TJD A;  1ZMA A;  5CP1 A;  2L5L A;  4D73 A;  4POM A;  1Z7R A;  1SL0 B;  4J56 E;  5EPF A;  3QR6 A;  3HA9 A;  1TRV A;  2C3Q A;  4X4J A;  5DDL A;  1AUC A;  4MMM A;  3CSH A;  4H86 A;  2HXK A;  5BRT A;  4XHM A;  3IC8 A;  4V1A g;  5H5S A;  4XTS A;  2MYG A;  2GDR A;  4KCA A;  3DGQ A;  2DBC A;  2LRT A;  2WFC A;  4MP4 A;  2ALB A;  3FZ4 A;  2L57 A;  2IWT A;  3GTU A;  2HSM A;  2M72 A;  2HZE A;  2TRX A;  3EC3 A;  2XPD A;  5B8B A;  1PKZ A;  3L9V A;  4DSS A;  5J41 A;  4MAB A;  2YZU A;  5ABR A;  3VK9 A;  2QA1 A;  3KJY A;  5IO2 A;  4KCE A;  2IME A;  1GNE A;  1WMJ A;  4Z2T A;  5ECL B;  3F4S A;  3PH9 A;  3IE3 A;  4F0B A;  2ZNM A;  2H70 A;  3FY7 A;  3TOU A;  3H93 A;  5HR2 A;  2H6X A;  1T4Z A;  2AAW A;  4GCI A;  1GUM A;  2FNO A;  3UBL A;  2A4H A;  5DJM A;  2NTO A;  5CRH A;  3GKN A;  2IPA A;  4WBR D;  1UVZ A;  4FYB A;  4O32 A;  1M2A A;  3IDV A;  4CY6 A;  4ZB8 A;  3WD6 A;  2IMF A;  1YZX A;  3IXR A;  2GS3 A;  1Y6E A;  3HDC A;  2C0E A;  5DJL A;  1B4Q A;  1G0T A;  1PL1 A;  4OFT A;  4FQU A;  3FKF A;  1FO5 A;  2NDO A;  2R4V A;  3PGT A;  3TJF A;  4YQU A;  4YAV A;  2FA4 A;  4LA1 A;  4O5U A;  5IMV A;  1XW9 A;  2C80 A;  3F3Q A;  1ZYQ B;  3LFL A;  1S3C A;  2DSA A;  3GUR A;  1GUH A;  1FVK A;  4RI7 A;  1GSQ A;  5E4W A;  2ON5 A;  3D0Z A;  1A0R P;  1SL2 B;  3VWU A;  4YH2 A;  3WT2 A;  2MMZ A;  3A3T A;  2YWM A;  3APO A;  2HSY A;  2YPM A;  2IL3 A;  4AJ6 A;  5J9C A;  2DIZ A;  1DSB A;  3EU4 A;  6GSS A;  5B8A A;  4G0I A;  1THX A;  4TXO B;  4KDU A;  2NPB A;  2H66 A;  3VLN A;  1EEM A;  1TI1 A;  5DAK B;  4IQA A;  2LNT A;  2TIR A;  3P2A A;  3IHG A;  2MBT A;  4MJC A;  5IMZ A;  1AAZ A;  1Y25 A;  2C4J A;  3IV4 A;  1VF3 A;  1M99 A;  2GVP A;  4RUV A;  4ECI A;  3JCM L;  4RI6 A;  4MCU A;  5A4V A;  2PPT A;  3MYD A;  3QD9 A;  2YV7 A;  1TRW A;  2GZP A;  4XIH A;  4ZBA A;  5B6M A;  1A2L A;  1NSW A;  4OFM A;  1Z5Y E;  3LSZ A;  1BX9 A;  3HY2 A;  4F2I A;  1EZK A;  2LJR A;  2BMX A;  2AUV A;  2L6D A;  3IAM 2;  4YKF A;  2R0C A;  1TK5 B;  5KN3 A;  1GTI A;  5G5F A;  4OCF A;  4TR4 A;  3EYT A;  1HQO A;  1ZCP A;  2JL4 A;  1TOF A;  3W8J A;  3TOT A;  4N0Z A;  2NBS A;  1M9A A;  2E0Q A;  3KD0 A;  5D9X A;  1X5D A;  2H01 A;  3OR5 A;  3P8W A;  1TDI A;  4MJA A;  1TKD B;  2YWN A;  1Q4J A;  2YNX A;  5B7C A;  1HYU A;  1SJI A;  4I5Q A;  1EP8 A;  1U3A A;  3FZA A;  4TOP A;  3GYK A;  4OO4 A;  3TB2 A;  3VWV A;  2YJ7 A;  5KN1 A;  4GF0 A;  2VL2 A;  4JED A;  3L9U A;  4MF7 A;  1F9M A;  4JR4 A;  4IBP A;  2LNS A;  3ZMK A;  5KOX A;  1XWG A;  4OFN A;  4KSM A;  3APQ A;  4J57 E;  4HZ2 A;  2H73 A;  1GTA A;  4N10 A;  3F9U A;  3HJP A;  2B5Y A;  5LNK e;  3KZQ A;  2JAC A;  1G7O A;  2OKA A;  5A4U A;  1ZYE A;  3LXT A;  2I81 A;  5B6N A;  2GST A;  1SK0 A;  4NXI A;  3ZRE A;  4PUA A;  1EV9 A;  3DKS A;  4IP6 A;  3EUR A;  3DD3 A;  4HDE A;  1MDI A;  5KOW A;  1A0F A;  5DBQ A;  3M3M A;  4DSR A;  1BED A;  4HUA A;  2CVB A;  2EIQ A;  3ZFB A;  4IP1 A;  1PN0 A;  2QA2 A;  3CTG A;  5D93 A;  2VD0 A;  3QAV A;  3C8E A;  2OA7 A;  2HZF A;  3EPT A;  2FGX A;  4F9Z A;  1JZO A;  1FHE A;  1GUK A;  2VCW A;  3FR3 A;  3GHA A;  4MPF A;  1ERW A;  2O87 A;  1O8W A;  2DJK A;  3LXZ A;  2VCX A;  1VRS D;  4HS1 A;  2UZ8 A;  2VLV A;  2GZZ A;  4WET A;  3GRX A;  2AV4 A;  4NPB A;  3KGK A;  2QC7 A;  4MPG A;  1NM3 A;  3CRT A;  4KW6 A;  1F37 A;  3EMX A;  4YAP A;  3E3E A;  1K3L A;  1ZYN A;  4CHS A;  5EL8 A;  2OE0 A;  1GSY A;  2VL9 A;  1YKC A;  4MF6 A;  3S9F A;  3Q18 A;  1EGR A;  3GTU B;  2DC5 A;  4KUN A;  4MK3 A;  2JSY A;  4DSQ A;  4P3Y B;  1K0D A;  1MTC A;  2ON7 A;  3UOM A;  1KBN A;  1AIU A;  2BTO T;  2ES7 A;  4KAE A;  3H4K A;  3EVI A;  1XWB A;  2HRK A;  4ZIJ A;  3IBH A;  3G7J A;  1MD3 A;  1OVN A;  1SYR A;  3GIX A;  4WXT A;  2GQM A;  3RDW A;  2MMA A;  4K7O A;  4ISD A;  3VWW A;  1VF1 A;  2J9H A;  5JCG A;  3J7Y b;  1O6J A;  1FOH A;  2LTK A;  4QQ7 A;  4BA7 A;  2H6Y A;  1IYI A;  4I2T A;  6GSX A;  2FWG A;  2LEG A;  1EP7 A;  5F0G A;  2V41 A;  1SL1 B;  1PN9 A;  2MMN A;  3QFB C;  4Q5F A;  3GMF A;  3TKS E;  3IOS A;  2A2S A;  3HYP A;  2A2R A;  3UEM A;  2VUP A;  1WP0 A;  4WR5 A;  1TK8 B;  2QSI A;  2H1D A;  2WRT A;  3E0U A;  2C3T A;  3APS A;  2OBI A;  4MH2 A;  3VFI A;  4FH8 A;  5DCH A;  4GQF A;  1USB A;  4NHW A;  1JFU A;  5LCZ A;  4WR4 A;  5ECH B;  2RUE A;  4KH7 A;  2TRC P;  1B48 A;  5J3R A;  2WZ9 A;  4ML6 A;  1RK4 A;  1NHO A;  3HZ8 A;  2M46 A;  1VGL A;  5ECO B;  1RQM A;  1T1V A;  4ZB9 A;  4K7I A;  2ZCT A;  5JWR B;  3LW9 A;  2CAQ A;  1UA5 A;  4TN8 A;  2FD3 A;  4AGS A;  2FWH A;  1FG4 A;  2B1K A;  2IMD A;  3Q6O A;  1FB0 A;  2H76 A;  5ID2 A;  4OD7 A;  2R6K A;  4HU7 A;  4DEJ A;  3VI5 A;  1FW1 A;  2IFQ A;  2JZS A;  1XCC A;  2GTU A;  1OC9 B;  4L0U A;  3FK8 A;  4IJI A;  5ELA A;  2LQO A;  2DJ3 A;  2DIY A;  5C04 A;  2YN1 A;  5A5K A;  4RQX A;  4V2L A;  1SYX A;  4ML1 A;  2VD1 A;  1YF1 A;  3A2V A;  4EDZ A;  4A5P A;  4PNF A;  3QAG A;  3ME8 A;  1RW1 A;  3ERW A;  2FCH A;  5IMC A;  1OKT A;  4MDC A;  1U87 A;  2DKH A;  2LQQ A;  3IAS 2;  4BWS A;  3F6F A;  4AJ8 A;  1W4V A;  2N5B A;  3W6G A;  1XW5 A;  2LUS A;  2DLX A;  5D8I A;  2X8H A;  2PBJ A;  4F82 A;  4MLY A;  1GSS A;  4Z7X A;  3M9J A;  4GTU A;  4RQR A;  1EEJ A;  3LJR A;  14GS A;  4G9H A;  5D9V A;  5F8B A;  2KP2 A;  1JZD A;  5FT3 A;  1T3B A;  4GWR A;  2B6M A;  1WJK A;  3GNJ A;  1T00 A;  1X5C A;  1SKW B;  3FR9 A;  3ZL5 A;  2AHE A;  4PNG A;  2GGT A;  3Q19 A;  3LOR A;  5G5E A;  11GS A;  1AQW A;  3QCP A;  4I8B A;  1O73 A;  2O89 A;  1H75 A;  4USS A;  5L71 A;  2E2M A;  4ILF A;  1B9X C;  1V2A A;  2XHF A;  3GSS A;  1A24 A;  4Q5N A;  3U5R E;  1SK1 A;  2PUK C;  4PUR A;  4G0L A;  1KTE A;  3G7I A;  1K0A A;  2IMI A;  2BJX A;  1H4O A;  2JZR A;  4GLT A;  3EU3 A;  3K8N A;  4GQC A;  3C71 A;  4IKH A;  1A23 A;  1TP9 A;  2O7K A;  4ZIL A;  5HQP A;  1DE2 A;  1URM A;  5D96 A;  4IEL A;  2DJ0 A;  1TXX A;  3RPN A;  3H8Q A;  4BWQ A;  1CQH A;  5J9B A;  2HI7 A;  2X8C A;  5E59 A;  1DE1 A;  3GN3 A;  5ECK B;  1ZL9 A;  3IRA A;  3TRX A;  2YP6 A;  2H71 A;  4ZL8 A;  3BD2 A;  4EIP A;  3KMN A;  4Z2R A;  4IJ3 A;  5ENU A;  4F0C A;  4BVY B;  6GSU A;  4K1F A;  5ECR B;  3IK7 A;  4XCS A;  1R26 A;  3HVS A;  1SU9 A;  5F07 A;  2H1G A;  3FZ9 A;  3G7Y A;  1XWA A;  4QL7 A;  4K6X A;  1M2D A;  4PTS A;  2CVK A;  1MEK A;  1ON4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...