4TR3A

Mouse iodothyronine deiodinase 3 catalytic core, semet-labeled active site mutant secys->cys
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
188
structure length
188
Chain Sequence
GIDPFTGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTCPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Type III iodothyronine deiodinase
publication title Crystal structure of mammalian selenocysteine-dependent iodothyronine deiodinase suggests a peroxiredoxin-like catalytic mechanism.
pubmed doi rcsb
source organism Mus musculus
total genus 53
structure length 188
sequence length 188
ec nomenclature ec 1.21.99.3: Thyroxine 5-deiodinase.
pdb deposition date 2014-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4tr3A00
3CBUA 12GSA 3HA9A 4AF2A 4QL9A 4WR4A 19GSA 4AJ6A 1TOFA 2OACA 5J3RA 3KP8A 5DAKA 3BCKA 3ERGA 3CSIA 3P7XA 1GTBA 1EOHA 4HS1A 5LNKe 5F8BA 2XPEA 3L9SA 5DJMA 1TRVA 2V6KA 1ZYEA 4J56E 5C04A 3GH9A 2GVPA 4KSOA 5LCZA 3RDWA 4WBJA 2O85A 2HRFA 3RHBA 4IJ3A 1THXA 2XHFA 4IHUA 5IMCA 1GL8A 1DBYA 3GNJA 2OE3A 1JLWA 3QR6A 3VWUA 4DSQA 4PX1A 2PBJA 1HQOA 3ERFA 1K0DA 2OKAA 1B4PA 1KNGA 3GV1A 1T4ZA 4H86A 3W8JA 2WDUA 1ERVA 3GKMA 2XPDA 3J7Yk 3DEXA 2H74A 4NHWA 2DIYA 4MDCA 2MBTA 1AXDA 4MPGA 5INYA 1Z3EA 1PQNA 3GTUA 4KX4A 1A2LA 1TP9A 3TJFA 5H5QA 1OC3A 2GT6A 2DC5A 4V2MA 1WIKA 5ECNB 3A2XA 2HE3A 2YZUA 3KTBA 5CNWA 3TRPA 2VO4A 5IMAA 4JRRA 2YWNA 3IHQA 5D9TA 1T00A 2WZ9A 4I2UA 1THOA 1YJ6A 2TIRA 3ISOA 2L57A 2H0GA 3FY7A 1YKAA 1EEMA 3MAKA 3C1SA 5IOWA 5L71A 1TKDB 2AB6A 2HZFA 1VF1A 3ZFBA 4CDOA 4TR3A 4ZL9A 4KDYA 4OFMA 3BCIA 2CAQA 2C8UA 2CX3A 5IO2A 2B6MA 3HZ4A 5D96A 1FB0A 4X0XA 2H0IA 4OWYA 4WBRD 1SK0A 4BA7A 3F3QA 2FHEA 3IR4A 2YOIA 4POKA 5HR0A 1X0RA 3A5WA 5J41A 1OE8A 3TRQA 4X43A 2HZEA 4YH2A 1UA5A 3D22A 4KB3A 2RLIA 3D5JA 2ZUPA 1O85A 2NTOA 1R5PA 5ELAA 5G30A 1BJXA 1SU9A 4TR4A 1PX7A 5HR1A 3EYTA 4IGJA 6GSWA 1RQMA 3WYWA 2K8SA 4RUVA 1VGLA 4XS6A 5DDLA 1PN9A 2FWEA 2CAIA 1X9MB 1XZOA 2LRCA 3DGQA 4N10A 3I6AA 3ME7A 2IN3A 1O73A 1CQHA 1EV9A 3QDNA 5EVOA 1GTAA 2PUKC 2FGXA 2H75A 1TI1A 2YJHA 4MZBA 3EU4A 1XWKA 2K6VA 4JEDA 4PGTA 2EC4A 2KLXA 3KGKA 1ST9A 2L4QA 3TKPA 3K8NA 1FVJA 2LKUA 2VCVA 4K6XA 1MD4A 3TKRA 3EVIA 3APSA 5H5SA 2VCTA 2R6KA 2OBIA 4TRXA 4OO4A 1WPIA 3LWAA 1WMJA 3TOTA 2R37A 3QOUA 1DE1A 1G7EA 3R2QA 5A4UA 1NM3A 3CTGA 4K7NA 2ON5A 11GSA 2HYXA 1GSUA 3FYGA 4V1Ap 1HNAA 1TJDA 3TCOA 2N5BA 2VL2C 2AAWA 3A2WA 4GLTA 4BVXA 3VURA 1GSEA 3UMAA 1SK1A 2OE0A 2RM6A 3KM6A 1NSWA 2CVDA 3FR6A 3F0IA 3VFIA 2V41A 2FWFA 4ECBA 22GSA 5IQYA 3LYPA 2FNOA 1WE0A 1ERTA 3QAVA 5D9WA 1UN2A 2AYTA 2JADA 4NV2A 3C73A 3F63A 2L59A 2IFQA 1AQXA 1XBSA 2VM1A 4L0UA 3EC3A 3AY8A 2B1LA 5ECOB 4BVYA 1IYHA 2IMFA 2IIYA 2LQOA 4NV5A 3HYPA 2HT9A 1XWCA 1XOAA 4JR6A 4ML1A 3DVXA 2VL9A 4FH8A 1ZOFA 5JCUA 1K0OA 2CA8A 1OC8A 4MJBA 4KGIA 2L4CA 3TRXA 4KA0A 6GSVA 4IP6A 2AUVA 2X8HA 3QD9A 2DMLA 4ZBDA 1Z6NA 2HXKA 3D6IA 4OMVA 1GUHA 2GDRA 2QGVA 1CQGA 1GRXA 4WEYA 3FKFA 3ZL5A 4N0ZA 2JZTA 2YPMA 2VCXA 4KNDA 2H73A 2WJUA 3M9KA 1USBA 3GHAA 1UVZA 5ECIB 1BAYA 1O8XA 2K18A 3M3MA 3TJBA 4EDYA 4EDZA 3UJ1A 3O6TA 1O8WA 1YKCA 1MDKA 1GH2A 2GQLA 5CP1A 3KP9A 4IP1A 3GKKA 4K9ZA 2MYGA 1T3BA 3HHVA 1FVKA 8GSSA 3LGCA 2DIZA 1QQ2A 2B5YA 3CMIA 3KIJA 3ZLPA 3KMNA 3RPPA 1AW9A 1S3DA 2F51A 1F3BA 5AISA 3E9JB 4ZL8A 2DLXA 2C0EA 5D9XA 1Q98A 4QQ7A 5HR3A 2G0FA 1WOUA 3V1WA 4WETA 1ZMAA 3KMOA 4IVFA 1EP8A 1A24A 3ZITA 2ON7A 1TW9A 4GTUA 2K9FA 5IMFA 1YDKA 2OBKA 2GSSA 4TXOB 1YQ1A 2O8VB 1U6TA 4KCEA 1ACVA 3IC4A 4MH2A 2FA8A 1Z6MA 2YCDA 3F4SA 4HUAA 4ULXA 4EKZA 1FHEA 2CV4A 3F4TA 2MZCA 6GSUA 1X9SB 1M9AA 2GS3A 4L8EA 5GZZB 5DQYA 4AJ7A 2B7KA 4YAVA 1TRUA 3UAPA 1GP1A 4G19A 4MJEA 5G1KA 3H8QA 3KH9A 4O32A 1ZGNA 2DJ3A 2IMEA 3HD5A 3CRUA 1G7OA 3H79A 1EGRA 10GSA 5JWRB 5C00A 2LSTA 5E59A 1Z7RA 4KUNA 3DVWA 1O7UA 4HJMA 2VL3A 1FG4A 1NW2A 3GURA 1EOGA 2YWOA 3A2VA 1M0UA 2RM5A 2H1AA 3Q6OA 5A5KA 3F6DA 2C1YA 4NPBA 2KP2A 3F4RA 4HZ2A 4OCFA 4G9HA 3WT1A 4YQUA 2F8FA 4ZILA 4KDXA 3LXTA 2O87A 1ML6A 1A8YA 4IS0A 2LUSA 3GX8A 4NXIA 1ZZYA 3TKSE 1IYIA 5IMDA 2DJ0A 2ALBA 1AQWA 2WRTA 1V58A 3MSZA 1C72A 3PH9A 1XW6A 3HJOA 1FOVA 18GSA 2C0FA 2N5FA 3I9V2 1KBNA 4GQCA 4F9ZA 1UC7A 3EMXA 3HZ8A 1XPVA 2I3YA 1K0NA 4PUAA 1A0FA 3KJYA 1PMTA 4I8BA 2HSHA 1ERUA 3H1NA 1SYXA 1BYEA 2PERA 2MMOA 3VK9A 1B4QA 1GTUA 3DYRA 3UVTA 2XBQA 4MK3A 4ZBBA 2P31A 4NWYA 6GSYA 1AC1A 1BQ7A 3Q18A 1HD2A 3VWVA 3UARA 3WD6A 3VI5A 4TR1A 2JL4A 5ECQB 2AV4A 4Z7XA 6GSSA 1OE7A 2WGRA 2C3TA 1ABAA 1T7PB 1SKWB 3VI7A 4F2IA 3QMXA 4NHZA 1R5AA 4XS4B 3C71A 4ML6A 5KN0A 2MMZA 3KTLA 3VPTA 3TKSC 1B48A 4HI7A 4XRDA 4MF6A 3LSZA 4FYCA 3HKRA 5IOXA 2F9SA 4AJ8A 2OADA 1OC9A 5DALA 1DSBA 1EGOA 2GLRA 3IAM2 1JZWA 1HNCA 4IN0A 4HU7A 1ZL9A 2NVLA 2B7JA 1A23A 2X8CA 2NDOA 3WGXA 2LS5A 1XWAA 4MPFA 5DJLA 4CHSA 3CSJA 5H5RA 2N5AA 4J57E 3QAWA 2BMXA 3VWXA 1GUKA 4D73A 2AHEA 4PQHA 3GFKA 1QUWA 2XBIA 3FW2A 1JLVA 3F8UA 1TRSA 4OD7A 3MWHA 1O6JA 2GZPA 2GSRA 4N0VA 3PR8A 3E3EA 3RPNA 1FAAA 4L5OA 5G5FA 4ACSA 2DMMA 7GSSA 4G10A 3WGEA 1QK8A 1Y6EA 4LA1A 2A2RA 3L0HA 4TN8A 3RAZA 1BX9A 2FWHA 2B5XA 1SJIA 3GL5A 2VCQA 4I97A 1GTIA 2PVQA 1AIUA 2H72A 4FYBA 3QPMA 4JBBA 3FR3A 5EL8A 1SD9A 3RBTA 3IXRA 1V9WA 1U88A 3FEUA 2VL2A 4BL7A 1EWXA 2H01A 4LL1B 1N8JA 2H0HA 2K8VA 2MMAA 5B6MA 4HU9A 1T4YA 3OR5A 4HZ4A 4ZL7A 2I9HA 2R4VA 3FZ5A 1N2AA 4Q5FA 3ZMLA 3BJ5A 4YAPA 1B8XA 5HFGA 4KW6A 2WULA 1O81A 2V1MA 2R5GA 2JSYA 4ZIJA 1K3LA 4JZQA 5EPFA 1VF2A 3CRTA 5AGYA 5AN1A 3M1GA 3O3TA 1GWCA 3Q19A 3UBKA 2KOKA 3BOAA 2HRNA 1TK5B 5CRWA 4DSSB 1PKWA 4V2NA 4PQ1A 2NPBA 4OO5A 4ZB9A 14GSA 4HQZA 5ECMB 1PKZA 1ZCPA 1M2DA 3TUEA 3VWWA 2IMIA 1HYUA 1Y25A 1Z9HA 4XHMA 4Q5RA 2OA7A 3KXOA 3H4KA 1G0TA 1K0AA 2V2GA 4ECCA 3W6GA 2IWTA 1WWJA 5FHIA 5KN3A 2VD0A 4XS1A 1M2BA 1PGTA 2LRTA 1SKRB 4RQRA 4ZXGA 2EIOA 2RIIA 3FR9A 3GUSA 1TU7A 1XXUA 5ID2A 1J9BA 1JZRA 5CRHA 3U5RE 3TDGA 4CW9A 20GSA 2GT5A 4K1FA 3PGTA 1MDJA 3VPQA 2J23A 5CRGA 2M80A 3FHKA 1AAZA 2C4JA 4ZB8A 3ZFLA 2LJRA 5F07A 2YZHA 2E2GA 2H70A 2DJ1A 4L0WA 3E0UA 1U3IA 1OKDA 3ED3A 2WS2A 4TR0A 1EZKA 2LRNA 3GN3A 4XCSA 1R4WA 2FD3A 4K2DA 1XIYA 1XOBA 3C7MA 1K0CA 4HDEA 3FRCA 16GSA 4KH7A 2YNXA 4ZBAA 1A0RP 2CVKA 2IPAA 2RUEA 1YY7A 1G6YA 1T1VA 2JZSA 1GULA 3IA1A 4O7HA 2H6ZA 4PUFC 4POLA 4POBA 2WCIA 1PRXA 3MNGA 5GSTA 4YQVA 1U3AA 2CT6A 4IBPA 1M9BA 2P0GA 2YV9A 3KCMA 3ZRDA 2JSZA 1SL2B 1QFNA 1VF3A 4EE0A 1MTCA 2M72A 5CRDA 4XIHA 2H1DA 1AUCA 1Z5YE 2YV7A 2VOCA 3GIXA 4MP4A 4MZCA 2O89A 3D21A 4MCUA 5AIVA 3IOSA 13GSA 2CZ3A 2XC2A 3A3TA 1F2EA 4EF0A 3CXGA 2LNTA 4MJAA 2YN1A 2F8AA 2EIRA 4L5LA 1H4OA 5DAKB 4LL4B 4IW9A 4QL7A 3QAGA 4V1Ag 4IQAA 3O76A 2LQQA 4PXOA 4N11A 3TKQA 1R26A 3CTFA 2GQMA 5J9CA 3ZIJA 2E0QA 3ZVJA 4OFTA 2GGTA 3ME8A 2DBCA 1J08A 3KEBA 4K7IA 1GNWA 5CYYA 2JZRA 2FWGA 4EVMA 1F6MC 4K8MA 1H75A 1SJZA 4P3YB 4BWQA 4I6XA 2B5EA 5G1LA 3KH7A 1K3OA 1X9WB 4ZB6A 1YZXA 1ZYQB 2MBSA 1FB6A 3D0ZA 4IELA 1TRWA 1S3AA 4EO3A 5B8AA 2PWJA 5ECLB 3GTUB 4F03A 3G7IA 2NBSA 5IMVA 1TK8B 2PN8A 1T8EB 2IMKA 1KTEA 3TB2A 3GKXA 5F05A 2R2JA 3LXZA 5A4VA 4I2TA 2AJQB 3F6FA 3FK8A 3EE2A 1XCCA 3GYKA 1URMA 2ES7A 2V32A 2GZYA 5KN2A 4NMUA 3UIWA 2C80A 2CX4A 4G2EA 3EU3A 1FW1A 2VD1A 1NHOA 5FT3A 3LQ7A 2PPTA 2PU9C 2LNSA 1GSFA 3IPZA 4PNGA 1R7HA 1DE2A 4O92A 1RW1A 5A4WA 3I69A 2IMDA 3EMPA 4GSNA 4GQFA 3G7YA 3ERWA 2DSAA 2LV3A 4MLYA 3HY2A 2I81A 3TKSA 3D4MA 4JE1A 9GSSA 4MABA 1F9MA 3BD2A 3J7Yb 2VLUA 1W4VA 5D73A 3EURA 3M9JA 4MH3A 1V2AA 5FWGA 2O7KA 2TRXA 5DCHA 2HZEB 4ECJA 5B6NA 2H6YA 2H1BA 1E2YA 4XTSA 4AGSA 3GH6A 4TW5A 4XRAA 1MEKA 4MF5A 2CZ2A 2FA4A 1M99A 4GCIA 4OFNA 1RK4A 2G2QA 4POMA 4DEJA 3GSTA 3GA4A 17GSA 4TXOA 5LD0A 3GKNA 3HJPA 3SWLA 4BWSA 3IDVA 2YJ7A 3GSSA 1PA3A 4BPYA 1OKTA 2F3MA 5IPHA 3GX0A 2KUCA 5AIXA 2BTOT 3PINA 4KDUA 2H19A 1PSQA 2YANA 3UEMA 3L4NA 1JFUA 4GSTA 4ILFA 2VCZA 1TK0B 3M8NA 2VAFA 2DJKA 4DVCA 1SENA 4HOJA 4EL1A 1SKSB 1BG5A 3KZQA 1X5CA 2H1GA 3QFAC 2VLTA 2KP1A 4F0BA 4MMMA 2GZZA 1SYRA 4PNFA 4OCEA 1M2AA 1WJKA 1Z7PA 1FO5A 3HXSA 3TJGA 2A4VA 2YWMA 1V57A 3G9BA 5JWOB 1V40A 1VF4A 2ZCTA 4KAEA 5GSSA 1MD3A 2BJXA 5CAXA 3HDCA 3IK9A 4ECIA 5D93A 1YEXA 4KSMA 5IM9A 5ID2B 2WFCA 1B9YC 2B3SA 2LTKA 1QGVA 2CQ9A 5CREA 4E8HA 3VLNA 1GLQA 1PL1A 4GXZA 3P90A 3QCPA 3QFBC 4TXVA 4O5RA 2GSQA 5GAPD 2FCHA 5EY6A 1K0BA 1XWGA 5ENUA 4I5QA 1GSDA 2GSTA 2ZNMA 1S3CA 3ZVJD 1GNEA 1LBKA 3C1RA 2LEGA 3DIEA 3LFLA 2IFQB 1A2MA 4F0CA 4LMVA 5DQSA 1XVQA 1ERWA 3GL3A 3ZZXA 1I9DA 2H71A 2X8GA 3N5OA 4EUYA 3IAS2 1F3AA 2HNLA 2E7PA 5JCGA 4ISDA 4ID0A 4KCAA 2V6OA 4N30A 3Q74A 1J0FA 4GWRA 1I5GA 3L9UA 6GSTA 1KEBA 1PX6A 4EC0A 2LJAA 1YF0A 1TI3A 3DKSA 5G31A 1G6WA 3DWVA 3F9UA 1GSQA 5D8IA 1EV4A 4WKWA 4JR4A 4XS4A 2OJLA 4TVEA 1K0MA 3S9FA 4IJIA 6GSXA 2H8LA 4RI6A 3FZAA 1Q4JA 4E8EA 2IL3A 3TJJA 1JZOA 1V98A 3IBHA 2P5QA 4FIWA 2WB9A 3UBLA 1QMVA 3NIVA 3TOUA 3RHCA 3NOFA 2H30A 5HFKA 4LLRA 4WF5A 1XW9A 2QC7A 3KD0A 2REMA 1NHYA 2DJJA 4GRFA 5J5NA 1OYJA 1XFLA 2HLSA 2QSIA 3GMFA 1SJ6A 1YF1A 2J9HA 3D4TA 5DVBA 1JZDA 3BBYA 1GSYA 4RQXA 3HCZA 5J9BA 1B9XC 2L5LA 4IKHA 4YQMA 2FY6A 2LJKA 1BEDA 1EP7A 2VUPA 2CVBA 3IV4A 5IPGA 1PD21 4TKYA 5JCWA 3FZ4A 3C8EA 1LJRA 1HNBA 3G7JA 3IK7A 4FO5A 3L9VA 3I43A 3U6VA 5ECKB 4HQSA 3CYNA 2P5RA 3L78A 3EWLA 3IRAA 4F82A 5JWQB 5KN1A 1DUGA 2PMTA 2GTUA 2M46A 1WRYA 3LJRA 4X1UA 4IQ1A 5KEJA 2YWIA 5IMZA 5E4WA 2HI7A 4JU5A 2H76A 4J2FA 2H6XA 1X5EA 4HEA2 5GAND 1EEJA 1E6BA 1OVNA 2HSYA 4EXJA 2C0DA 3LYKA 3UVHA 1SL1B 5G2ZA 2GQKA 2X99A 5G5EA 3DRNA 1MDIA 4LMWA 2OE1A 1SL0B 4V2LA 2VCWA 3APOA 3UOMA 4Q5QA 5DBQA 2PVOC 3IE3A 1JHBA 1WP0A 2VLVA 1XW5A 1U87A 4MF7A 4KE3A 4DSSA 5ECSA 1TXXA 2JACA 3HVVA 2B1KA 5HQPA 3N9JA 4GF0A 3FZ9A 3GRXA 3ZIVA 5DCGA 1ILOA 1YEPA 3LORA 2FUG2 2E2MA 3NZNA 2L6CA 5ECHB 1TU8A 3ZREA 5IIZA 5ECRB 5D9VA 5J4UA 2L6DA 1PL2A 1GLPA 2JU5A 2VIMA 1W89A 3P2AA 5COHA 2H66A 2KHPA 4K0NA 1XVWA 3DMLA 3EINA 1A8LA 3HVSA 3APQA 3UL3A 1GSSA 3LEFA 1SD8A 4PQIA 4Q5NA 4WXTA 4TR1B 5ECPB 2I1UA 3US3A 3HJMA 3MDKA 2FLSA 4HJ2A 4RI7A 4GSSA 3M0FA 1X5DA 5ABRA 3H93A 1VRSD 3DD3A 1AQVA 1F37A 4FYUA 4MZWA 3CSHA 2MMNA 5HFIA 2I4AA 2EIQA 2VM2A 3P8WA 5B7CA 1LU4A 3SBCA 3TJKA 1M7TA 2HFDA 5HR2A 1SK2A 2D2ZA 3LG6A 5F06A 3WT2A 2PGTA 2QKEA 3DXBA 1OC9B 5DALB 3F3RA 4WF4A 3TGZA 4TOPA 2YP6A 2DJ2A 4K0GA 3ZMKA 1XWBA 2R3XA 4MJCA 1OAZA 2A2SA 4PURA 4MA9A 2C3QA 3W8SA 3JCML 1A2JA 5ELGA 1TTZA 2RUFA 4DSRA 5B8BA 4D73B 2C3NA 1QXHA 5CO3A 2IJYA 3ZYWA 5F0GA 2L5OA 1K3YA 2Z9SA 5IO0A 1TDIA 4NAXA 2X64A 1GUMA 2C0GA 4WR5A 3ZTLA 3WGDA 1ON4A 2TRCP 4K7OA 3HVXA
chains in the Genus database with same CATH superfamily
3CBUA 12GSA 3HA9A 4AF2A 4QL9A 4WR4A 19GSA 4AJ6A 1TOFA 2OACA 5J3RA 1ZYNA 3KP8A 5DAKA 3BCKA 3ERGA 3CSIA 3P7XA 1GTBA 3CQFA 1EOHA 4HS1A 5LNKe 5F8BA 2XPEA 3L9SA 5DJMA 1TRVA 2V6KA 1ZYEA 4J56E 5C04A 3GH9A 2GVPA 4KSOA 5LCZA 3RDWA 4WBJA 2O85A 2HRFA 3RHBA 4BL7B 4IJ3A 1THXA 2XHFA 4EIQA 4IHUA 5IMCA 1GL8A 1DBYA 3GNJA 2OE3A 1JLWA 3QR6A 3VWUA 4DSQA 4PX1A 2PBJA 1HQOA 1PN0A 3ERFA 1K0DA 2OKAA 1B4PA 1KNGA 3GV1A 1T4ZA 4H86A 3W8JA 2WDUA 1ERVA 3GKMA 2XPDA 3J7Yk 3DEXA 2H74A 4NHWA 2DIYA 4MDCA 2HRAA 2MBTA 1AXDA 4MPGA 5INYA 1Z3EA 1PQNA 3GTUA 4KX4A 1A2LA 1TP9A 3TJFA 5BRTA 5H5QA 1OC3A 2GT6A 2DC5A 4V2MA 1WIKA 5ECNB 3A2XA 2HE3A 2YZUA 3KTBA 5CNWA 3TRPA 2VO4A 4G0IA 5IMAA 4JRRA 2YWNA 3IHQA 5D9TA 1T00A 2WZ9A 4I2UA 1THOA 1YJ6A 2TIRA 3ISOA 2L57A 2H0GA 3FY7A 1YKAA 1EEMA 3MAKA 3FMWA 3C1SA 5IOWA 5L71A 1TKDB 2AB6A 2HZFA 1VF1A 3ZFBA 4CDOA 4TR3A 4ZL9A 4Z2TA 4KDYA 4OFMA 3BCIA 2CAQA 2C8UA 2CX3A 5IO2A 2B6MA 3HZ4A 5D96A 1FB0A 4X0XA 2H0IA 4OWYA 4WBRD 1SK0A 4BA7A 3F3QA 2FHEA 3IR4A 2YOIA 4POKA 5HR0A 1X0RA 3A5WA 5J41A 1OE8A 3TRQA 4X43A 2HZEA 4YH2A 1UA5A 3D22A 4KB3A 2RLIA 3D5JA 2ZUPA 1O85A 2NTOA 1R5PA 5ELAA 5G30A 1BJXA 1SU9A 4YKFA 4TR4A 1PX7A 5HR1A 3EYTA 4IGJA 4YKGA 6GSWA 1RQMA 3WYWA 2K8SA 4RUVA 1VGLA 4XS6A 5DDLA 1PN9A 2FWEA 2CAIA 1X9MB 1XZOA 2LRCA 3DGQA 4N10A 3I6AA 3ME7A 2IN3A 1O73A 1CQHA 1EV9A 3QDNA 5EVOA 1GTAA 2PUKC 2FGXA 2H75A 1TI1A 2YJHA 4K5SA 4MZBA 3EU4A 1XWKA 2K6VA 4JEDA 4PGTA 2EC4A 2KLXA 3KGKA 1ST9A 2L4QA 3TKPA 3K8NA 1FVJA 2LKUA 4EIPA 2VCVA 4K6XA 1MD4A 3TKRA 3EVIA 3APSA 5H5SA 2VCTA 2R6KA 2OBIA 4TRXA 4OO4A 1WPIA 3LWAA 1WMJA 3TOTA 2R37A 3QOUA 1DE1A 1G7EA 3R2QA 5A4UA 1NM3A 3CTGA 4K7NA 2ON5A 2DKIA 11GSA 2HYXA 1GSUA 3FYGA 4V1Ap 1HNAA 1TJDA 3TCOA 2N5BA 2VL2C 2AAWA 3A2WA 4GLTA 4BVXA 3VURA 1GSEA 3UMAA 1XG8A 1SK1A 2OE0A 2RM6A 3KM6A 1NSWA 2CVDA 3FR6A 3F0IA 3VFIA 2V41A 4G0LA 2FWFA 4ECBA 22GSA 5IQYA 3LYPA 2FNOA 1WE0A 1ERTA 3QAVA 5D9WA 1UN2A 2AYTA 2JADA 4NV2A 3C73A 3F63A 2L59A 2IFQA 1AQXA 1XBSA 2VM1A 4L0UA 3EC3A 3AY8A 2X49A 2B1LA 5ECOB 4BVYA 1IYHA 2IMFA 2IIYA 2LQOA 4NV5A 3HYPA 2HT9A 1XWCA 1XOAA 4JR6A 4ML1A 4K5RA 3DVXA 2VL9A 4FH8A 1ZOFA 5JCUA 1K0OA 2CA8A 1OC8A 4MJBA 4KGIA 2L4CA 3TRXA 4KA0A 6GSVA 2R0CA 4IP6A 2AUVA 2X8HA 3QD9A 2DMLA 4ZBDA 1Z6NA 2HXKA 3D6IA 4OMVA 1GUHA 2GDRA 2QGVA 1CQGA 1GRXA 4WEYA 3FKFA 3ZL5A 4N0ZA 2JZTA 2YPMA 2VCXA 4KNDA 2X4AA 2H73A 2WJUA 3M9KA 1USBA 3GHAA 1UVZA 5ECIB 1BAYA 1O8XA 2K18A 3M3MA 3TJBA 4EDYA 4EDZA 3UJ1A 1ZYPA 3O6TA 1O8WA 1YKCA 1MDKA 1GH2A 2GQLA 5CP1A 3KP9A 4IP1A 3GKKA 4K9ZA 2MYGA 1T3BA 3HHVA 1FVKA 8GSSA 3LGCA 2DIZA 1QQ2A 2B5YA 3CMIA 3KIJA 3ZLPA 3KMNA 3RPPA 1AW9A 1S3DA 2F51A 1F3BA 5AISA 3E9JB 4ZL8A 2DLXA 5KOWA 2C0EA 5D9XA 1Q98A 4QQ7A 5HR3A 2G0FA 1WOUA 3V1WA 4WETA 1ZMAA 3KMOA 4IVFA 1EP8A 1A24A 3ZITA 2ON7A 1TW9A 4GTUA 2K9FA 5IMFA 1YDKA 2OBKA 2GSSA 1M3JA 4TXOB 1YQ1A 2O8VB 1U6TA 4KCEA 1ACVA 3IC4A 4MH2A 2FA8A 1Z6MA 2YCDA 3F4SA 4HUAA 4ULXA 4EKZA 1FHEA 2CV4A 3F4TA 2MZCA 6GSUA 1X9SB 1M9AA 2GS3A 4L8EA 5GZZB 5DQYA 4AJ7A 2B7KA 4YAVA 1TRUA 3UAPA 1GP1A 4G19A 4MJEA 5G1KA 3H8QA 3KH9A 4O32A 1ZGNA 2DJ3A 2IMEA 3HD5A 3CRUA 1G7OA 3H79A 1EGRA 10GSA 5JWRB 5C00A 2LSTA 5E59A 1Z7RA 4KUNA 3DVWA 1O7UA 4HJMA 3HVNA 2VL3A 1FG4A 1NW2A 3GURA 1EOGA 2YWOA 3A2VA 1M0UA 2RM5A 2H1AA 3Q6OA 5A5KA 2A4HA 2C1YA 3F6DA 4NPBA 2KP2A 3F4RA 4HZ2A 4OCFA 4G9HA 3WT1A 4YQUA 2F8FA 4ZILA 4KDXA 3LXTA 3EPTA 2O87A 1ML6A 1A8YA 4IS0A 2LUSA 3GX8A 4NXIA 1ZZYA 3TKSE 1IYIA 5IMDA 2DJ0A 2ALBA 1AQWA 2WRTA 1PFOA 1V58A 3MSZA 1C72A 3PH9A 1XW6A 3HJOA 1FOVA 18GSA 2C0FA 2N5FA 3I9V2 1KBNA 4GQCA 4F9ZA 1UC7A 3EMXA 3HZ8A 1XPVA 2I3YA 1K0NA 4PUAA 1A0FA 3KJYA 1PMTA 4I8BA 2QA1A 2HSHA 1ERUA 3H1NA 1SYXA 1BYEA 2PERA 2MMOA 3VK9A 1B4QA 1GTUA 3DYRA 3UVTA 2XBQA 4MK3A 4ZBBA 3IHGA 2P31A 4NWYA 6GSYA 1AC1A 1BQ7A 3Q18A 1HD2A 3VWVA 3UARA 3WD6A 3VI5A 4TR1A 2JL4A 4Z2RA 5ECQB 2AV4A 4Z7XA 6GSSA 1OE7A 2WGRA 2C3TA 1ABAA 1T7PB 1SKWB 3VI7A 4F2IA 3QMXA 4NHZA 1R5AA 4XS4B 3C71A 4ML6A 5KN0A 2MMZA 3KTLA 3VPTA 3TKSC 1B48A 4HI7A 4XRDA 4MF6A 3LSZA 4FYCA 3HKRA 5IOXA 2F9SA 4AJ8A 2OADA 1OC9A 5DALA 1DSBA 1EGOA 2GLRA 3IAM2 1JZWA 1HNCA 4IN0A 4HU7A 1ZL9A 2NVLA 2B7JA 1A23A 2X8CA 2NDOA 3WGXA 2LS5A 1XWAA 4MPFA 5DJLA 4CHSA 3CSJA 5H5RA 2N5AA 4J57E 3QAWA 2BMXA 3VWXA 1GUKA 4D73A 3MYDA 2AHEA 4PQHA 3GFKA 1QUWA 2XBIA 3FW2A 4BVXB 1JLVA 3F8UA 1TRSA 4OD7A 3MWHA 1O6JA 2GZPA 2GSRA 4N0VA 3PR8A 3E3EA 3RPNA 1FAAA 4L5OA 5G5FA 4ACSA 2DMMA 7GSSA 4G10A 3WGEA 1QK8A 1Y6EA 4LA1A 2A2RA 3L0HA 4TN8A 3RAZA 1BX9A 2FWHA 2B5XA 1SJIA 3GL5A 2VCQA 3PPUA 4I97A 1GTIA 2PVQA 1AIUA 2H72A 4FYBA 3QPMA 4JBBA 3FR3A 5EL8A 1SD9A 3RBTA 3IXRA 1V9WA 1U88A 3FEUA 2VL2A 4BL7A 1EWXA 2H01A 4LL1B 1N8JA 2H0HA 2K8VA 2MMAA 5B6MA 4HU9A 1T4YA 3OR5A 4HZ4A 4ZL7A 2I9HA 2R4VA 3FZ5A 1N2AA 4Q5FA 3ZMLA 4CY6A 3BJ5A 4YAPA 1B8XA 5HFGA 4KW6A 2WULA 1O81A 2V1MA 2R5GA 2JSYA 4O5QA 1K3LA 4JZQA 5EPFA 4ZIJA 1S3RA 1VF2A 3CRTA 5AGYA 5AN1A 3M1GA 3O3TA 4USSA 1GWCA 3Q19A 3UBKA 2KOKA 3BOAA 2HRNA 1TK5B 5CRWA 4DSSB 1PKWA 4V2NA 4PQ1A 2NPBA 4OO5A 4ZB9A 14GSA 4HQZA 5ECMB 1PKZA 1ZCPA 1M2DA 3TUEA 3VWWA 2IMIA 1HYUA 2HRKA 1Y25A 1Z9HA 4XHMA 4Q5RA 2OA7A 3IC8A 3H4KA 3KXOA 1G0TA 1K0AA 2V2GA 4ECCA 3W6GA 2IWTA 1WWJA 5FHIA 5KN3A 2VD0A 4XS1A 1M2BA 1PGTA 2LRTA 1SKRB 4RQRA 4ZXGA 2EIOA 2RIIA 3FR9A 3GUSA 1TU7A 1XXUA 5ID2A 1J9BA 1JZRA 5CRHA 3U5RE 3TDGA 4CW9A 20GSA 2GT5A 4K1FA 3PGTA 1MDJA 3VPQA 2J23A 5CRGA 2M80A 3FHKA 1AAZA 2C4JA 4ZB8A 3ZFLA 2LJRA 5F07A 2YZHA 2E2GA 2H70A 2DJ1A 4L0WA 3E0UA 1U3IA 1OKDA 3ED3A 2WS2A 4TR0A 1EZKA 2LRNA 3GN3A 4XCSA 1R4WA 2FD3A 4K2DA 1XIYA 1XOBA 3C7MA 1K0CA 4HDEA 3FRCA 16GSA 4KH7A 2YNXA 4ZBAA 2HSMA 1A0RP 2CVKA 2IPAA 2RUEA 1YY7A 1G6YA 1T1VA 2JZSA 4PTSA 1GULA 3IA1A 4O7HA 2H6ZA 4PUFC 4POLA 4POBA 2WCIA 1PRXA 3MNGA 5GSTA 4YQVA 1U3AA 2CT6A 4IBPA 1M9BA 2P0GA 2YV9A 3KCMA 3ZRDA 2JSZA 1SL2B 1QFNA 1VF3A 4EE0A 1MTCA 2M72A 5CRDA 4XIHA 2H1DA 1AUCA 1Z5YE 3MIXA 2YV7A 2VOCA 3GIXA 4MP4A 4MZCA 2O89A 3D21A 4MCUA 5AIVA 3IOSA 5BMUA 13GSA 2CZ3A 2XC2A 3A3TA 1F2EA 4EF0A 3CXGA 4G0KA 2LNTA 4MJAA 2YN1A 2F8AA 2EIRA 4L5LA 1H4OA 5DAKB 4LL4B 4IW9A 4QL7A 3QAGA 4V1Ag 4IQAA 3O76A 2LQQA 4PXOA 4N11A 3TKQA 1R26A 3CTFA 2GQMA 5J9CA 3ZIJA 2E0QA 3ZVJA 4OFTA 2GGTA 3ME8A 2DBCA 1J08A 3KEBA 4K7IA 1GNWA 5CYYA 2JZRA 2FWGA 4EVMA 1F6MC 4K8MA 1H75A 1SJZA 4P3YB 4BWQA 4I6XA 2B5EA 5G1LA 3KH7A 4A5PA 1K3OA 1X9WB 4ZB6A 1YZXA 1ZYQB 2MBSA 1FB6A 3D0ZA 4IELA 1TRWA 1S3AA 4EO3A 5B8AA 2PWJA 5ECLB 3GTUB 4F03A 4FQUA 3G7IA 2NBSA 5IMVA 1TK8B 2PN8A 1T8EB 2IMKA 1KTEA 3TB2A 3GKXA 5F05A 3A5IA 2R2JA 3LXZA 5A4VA 4I2TA 2AJQB 2QA2A 3F6FA 3FK8A 3EE2A 1XCCA 3GYKA 1URMA 2ES7A 2V32A 2GZYA 5KN2A 4NMUA 3UIWA 2C80A 2CX4A 2R0GA 4G2EA 3EU3A 1FW1A 2VD1A 1NHOA 5FT3A 3LQ7A 2PPTA 2PU9C 2LNSA 1GSFA 3IPZA 4PNGA 1R7HA 1DE2A 4O92A 1RW1A 5A4WA 3I69A 2IMDA 3EMPA 4GSNA 4GQFA 3G7YA 3ERWA 2DSAA 2LV3A 4MLYA 3HY2A 2I81A 3TKSA 4ICYA 3D4MA 4JE1A 9GSSA 4MABA 1F9MA 3BD2A 3J7Yb 2VLUA 1W4VA 5D73A 3EURA 3M9JA 4MH3A 1V2AA 5FWGA 2O7KA 2TRXA 5DCHA 2HZEB 4ECJA 5B6NA 2H6YA 2H1BA 1E2YA 4XTSA 4AGSA 3GH6A 4TW5A 4XRAA 1MEKA 4MF5A 2CZ2A 2FA4A 1M99A 4GCIA 2R0PA 4OFNA 1RK4A 2G2QA 4POMA 4DEJA 3GSTA 3GA4A 17GSA 4TXOA 5LD0A 3GKNA 3HJPA 3SWLA 4BWSA 4HSCX 3IDVA 2YJ7A 3GSSA 1PA3A 4BPYA 1OKTA 2F3MA 5IPHA 3GX0A 2KUCA 5AIXA 2BTOT 3PINA 4KDUA 2H19A 4CY8A 1PSQA 1FOHA 2YANA 3UEMA 3L4NA 1JFUA 4GSTA 4ILFA 2VCZA 1TK0B 3M8NA 2VAFA 2DJKA 4DVCA 1SENA 4HOJA 4EL1A 1SKSB 1BG5A 3KZQA 1X5CA 2H1GA 3QFAC 2VLTA 2KP1A 4F0BA 4MMMA 2GZZA 1SYRA 4PNFA 4OCEA 1M2AA 1WJKA 1Z7PA 1FO5A 3HXSA 3TJGA 2A4VA 2YWMA 1V57A 3G9BA 5JWOB 1V40A 1VF4A 2ZCTA 4KF9A 4KAEA 5GSSA 1MD3A 2BJXA 5CAXA 3HDCA 3IK9A 4ECIA 5D93A 1YEXA 4KSMA 5IM9A 5ID2B 2WFCA 1B9YC 2B3SA 2LTKA 1QGVA 2CQ9A 5CREA 4E8HA 3VLNA 1GLQA 1PL1A 4GXZA 3P90A 3QCPA 3QFBC 4TXVA 4O5RA 4BIKA 2GSQA 5GAPD 2FCHA 5EY6A 1K0BA 1XWGA 5ENUA 4I5QA 1GSDA 2GSTA 2ZNMA 1S3CA 3ZVJD 1GNEA 1LBKA 3C1RA 2LEGA 3DIEA 3LFLA 2IFQB 1A2MA 4F0CA 4LMVA 5DQSA 1XVQA 1ERWA 3GL3A 3ZZXA 1I9DA 2H71A 1M3IA 2X8GA 3N5OA 3IAS2 4EUYA 4BVYB 1F3AA 2HNLA 2E7PA 5JCGA 4ISDA 4ID0A 4KCAA 2V6OA 4N30A 3Q74A 1J0FA 4GWRA 1I5GA 3L9UA 6GSTA 1KEBA 1PX6A 4EC0A 2LJAA 1YF0A 1TI3A 3DKSA 5G31A 1G6WA 3DWVA 3F9UA 1GSQA 5D8IA 1EV4A 4WKWA 2UZ8A 4JR4A 4XS4A 2OJLA 4TVEA 1K0MA 3S9FA 4IJIA 6GSXA 2H8LA 4RI6A 3FZAA 1Q4JA 4E8EA 2IL3A 3TJJA 1JZOA 1V98A 2A2PA 3IBHA 2P5QA 4FIWA 2WB9A 3UBLA 1QMVA 3NIVA 3TOUA 3RHCA 3NOFA 2H30A 5HFKA 4LLRA 4WF5A 1XW9A 2QC7A 3KD0A 2REMA 1NHYA 2DJJA 4GRFA 4X4JA 5J5NA 1OYJA 1XFLA 2HLSA 2QSIA 3GMFA 1SJ6A 1YF1A 2J9HA 3D4TA 5DVBA 1JZDA 3BBYA 3R3EA 1GSYA 4RQXA 3HCZA 5J9BA 1B9XC 2L5LA 4IKHA 4YQMA 2FY6A 2LJKA 1BEDA 1EP7A 2VUPA 2CVBA 3IV4A 5IPGA 1PD21 4TKYA 5JCWA 3FZ4A 3C8EA 1LJRA 1HNBA 3G7JA 3IK7A 4K2XA 4FO5A 3L9VA 3I43A 3U6VA 5ECKB 4HQSA 3CYNA 2P5RA 3L78A 3EWLA 3IRAA 4F82A 5JWQB 5KN1A 1DUGA 2PMTA 2GTUA 2M46A 4Z2UA 1WRYA 3LJRA 4X1UA 4IQ1A 5KEJA 2YWIA 5IMZA 5E4WA 2HI7A 4O5UA 4JU5A 2H76A 5KOXA 4J2FA 2H6XA 1X5EA 4HEA2 5GAND 1EEJA 1E6BA 1OVNA 2HSYA 4EXJA 2C0DA 3LYKA 3UVHA 1SL1B 5G2ZA 2GQKA 2X99A 5G5EA 3DRNA 1MDIA 4LMWA 2OE1A 1SL0B 4V2LA 2VCWA 3APOA 3UOMA 4Q5QA 5DBQA 2PVOC 3IE3A 1JHBA 1WP0A 2VLVA 1XW5A 1U87A 4MF7A 4KE3A 4DSSA 5ECSA 1TXXA 2JACA 3HVVA 2B1KA 5HQPA 3N9JA 4GF0A 3FZ9A 3GRXA 3ZIVA 5DCGA 1ILOA 1YEPA 3LORA 2FUG2 2E2MA 3NZNA 2L6CA 5ECHB 1TU8A 3ZREA 5IIZA 5ECRB 5D9VA 5J4UA 2L6DA 1PL2A 1GLPA 2JU5A 2VIMA 1W89A 3P2AA 5COHA 2H66A 2KHPA 4K0NA 1XVWA 3DMLA 3EINA 1A8LA 3HVSA 3APQA 3UL3A 1GSSA 3LEFA 1SD8A 4PQIA 4Q5NA 4WXTA 4TR1B 5ECPB 2I1UA 3US3A 3LW9A 3HJMA 3MDKA 2FLSA 4HJ2A 4RI7A 4GSSA 3M0FA 1X5DA 5ABRA 3H93A 1VRSD 3DD3A 1AQVA 1F37A 4FYUA 4MZWA 3CSHA 2MMNA 5HFIA 2I4AA 2EIQA 2VM2A 3P8WA 5B7CA 1LU4A 2DKHA 3SBCA 3TJKA 1M7TA 2HFDA 5HR2A 1SK2A 4MNNA 2D2ZA 3LG6A 5F06A 3WT2A 2PGTA 2QKEA 3DXBA 1OC9B 5DALB 3F3RA 4WF4A 3TGZA 4TOPA 2YP6A 2DJ2A 4K0GA 3ZMKA 1XWBA 2R3XA 4MJCA 1OAZA 2A2SA 4PURA 4MA9A 2C3QA 3W8SA 3JCML 1A2JA 5ELGA 1TTZA 2RUFA 4DSRA 5B8BA 4D73B 2C3NA 1QXHA 5CO3A 2IJYA 3ZYWA 5F0GA 2L5OA 1K3YA 2Z9SA 5IO0A 1TDIA 4NAXA 2X64A 1GUMA 2C0GA 4WR5A 3ZTLA 3WGDA 1ON4A 2TRCP 4K7OA 3HVXA
chains in the Genus database with same CATH topology
3CBUA 12GSA 3HA9A 4AF2A 4QL9A 4WR4A 19GSA 4AJ6A 1TOFA 2OACA 5J3RA 1ZYNA 3KP8A 5DAKA 3BCKA 3ERGA 3CSIA 3P7XA 1GTBA 1EOHA 4HS1A 5LNKe 5F8BA 2XPEA 3L9SA 5DJMA 1TRVA 2V6KA 1ZYEA 4J56E 5C04A 3GH9A 2GVPA 4KSOA 5LCZA 3RDWA 4WBJA 2O85A 2HRFA 3RHBA 4BL7B 4IJ3A 1THXA 2XHFA 4EIQA 4IHUA 5IMCA 1GL8A 1DBYA 3GNJA 2OE3A 1JLWA 3QR6A 3VWUA 4DSQA 4PX1A 2PBJA 1HQOA 1PN0A 3ERFA 1K0DA 2OKAA 1B4PA 1KNGA 3GV1A 1T4ZA 4H86A 3W8JA 2WDUA 1ERVA 3GKMA 2XPDA 3J7Yk 3DEXA 2H74A 4NHWA 2DIYA 4MDCA 2HRAA 2MBTA 1AXDA 4MPGA 5INYA 1Z3EA 1PQNA 3GTUA 4KX4A 1A2LA 1TP9A 3TJFA 5BRTA 5H5QA 1OC3A 2GT6A 2DC5A 4V2MA 1WIKA 5ECNB 3A2XA 2HE3A 2YZUA 3KTBA 5CNWA 3TRPA 2VO4A 4G0IA 5IMAA 4JRRA 2YWNA 3IHQA 5D9TA 1T00A 2WZ9A 4I2UA 1THOA 1YJ6A 2TIRA 3ISOA 2L57A 2H0GA 3FY7A 1YKAA 1EEMA 3MAKA 3FMWA 3C1SA 5IOWA 5L71A 1TKDB 2AB6A 2HZFA 1VF1A 3ZFBA 4CDOA 4TR3A 4ZL9A 4Z2TA 4KDYA 4OFMA 3BCIA 2CAQA 2C8UA 2CX3A 5IO2A 2B6MA 3HZ4A 5D96A 1FB0A 4X0XA 2H0IA 4OWYA 4WBRD 1SK0A 4BA7A 3F3QA 2FHEA 3IR4A 2YOIA 4POKA 5HR0A 1X0RA 3A5WA 5J41A 1OE8A 3TRQA 4X43A 2HZEA 4YH2A 1UA5A 3D22A 4KB3A 2RLIA 3D5JA 2ZUPA 1O85A 2NTOA 1R5PA 5ELAA 5G30A 1BJXA 1SU9A 4YKFA 4TR4A 1PX7A 5HR1A 3EYTA 4IGJA 4YKGA 6GSWA 1RQMA 3WYWA 2K8SA 4RUVA 1VGLA 4XS6A 5DDLA 1PN9A 2FWEA 2CAIA 1X9MB 1XZOA 2LRCA 3DGQA 4N10A 3I6AA 3ME7A 2IN3A 1O73A 1CQHA 1EV9A 3QDNA 5EVOA 1GTAA 2PUKC 2FGXA 2H75A 1TI1A 2YJHA 4K5SA 4MZBA 3EU4A 1XWKA 2K6VA 4JEDA 4PGTA 2EC4A 2KLXA 3KGKA 1ST9A 2L4QA 3TKPA 3K8NA 1FVJA 2LKUA 4EIPA 2VCVA 4K6XA 1MD4A 3TKRA 3EVIA 3APSA 5H5SA 2VCTA 2R6KA 2OBIA 4TRXA 4OO4A 1WPIA 3LWAA 1WMJA 3TOTA 2R37A 3QOUA 1DE1A 1G7EA 3R2QA 5A4UA 1NM3A 3CTGA 4K7NA 2ON5A 2DKIA 11GSA 2HYXA 1GSUA 3FYGA 4V1Ap 1HNAA 1TJDA 3TCOA 2N5BA 2VL2C 2AAWA 3A2WA 4GLTA 4BVXA 3VURA 1GSEA 3UMAA 1SK1A 2OE0A 2RM6A 3KM6A 1NSWA 2CVDA 3FR6A 3F0IA 3VFIA 2V41A 4G0LA 2FWFA 4ECBA 22GSA 5IQYA 3LYPA 2FNOA 1WE0A 1ERTA 3QAVA 5D9WA 1UN2A 2AYTA 2JADA 4NV2A 3C73A 3F63A 2L59A 2IFQA 1AQXA 1XBSA 2VM1A 4L0UA 3EC3A 3AY8A 2X49A 2B1LA 5ECOB 4BVYA 1IYHA 2IMFA 2IIYA 2LQOA 4NV5A 3HYPA 2HT9A 1XWCA 1XOAA 4JR6A 4ML1A 4K5RA 3DVXA 2VL9A 4FH8A 1ZOFA 5JCUA 1K0OA 2CA8A 1OC8A 4MJBA 4KGIA 2L4CA 3TRXA 4KA0A 6GSVA 2R0CA 4IP6A 2AUVA 2X8HA 3QD9A 2DMLA 4ZBDA 1Z6NA 2HXKA 3D6IA 4OMVA 1GUHA 2GDRA 2QGVA 1CQGA 1GRXA 4WEYA 3FKFA 3ZL5A 4N0ZA 2JZTA 2YPMA 2VCXA 4KNDA 2X4AA 2H73A 2WJUA 3M9KA 1USBA 3GHAA 1UVZA 5ECIB 1BAYA 1O8XA 2K18A 3M3MA 3TJBA 4EDYA 4EDZA 3UJ1A 1ZYPA 3O6TA 1O8WA 1YKCA 1MDKA 1GH2A 2GQLA 5CP1A 3KP9A 4IP1A 3GKKA 4K9ZA 2MYGA 1T3BA 3HHVA 1FVKA 8GSSA 3LGCA 2DIZA 1QQ2A 2B5YA 3CMIA 3KIJA 3ZLPA 3KMNA 3RPPA 1AW9A 1S3DA 2F51A 1F3BA 5AISA 3E9JB 4ZL8A 2DLXA 5KOWA 2C0EA 5D9XA 1Q98A 4QQ7A 5HR3A 2G0FA 1WOUA 3V1WA 4WETA 1ZMAA 3KMOA 4IVFA 1EP8A 1A24A 3ZITA 2ON7A 1TW9A 4GTUA 2K9FA 5IMFA 1YDKA 2OBKA 2GSSA 4TXOB 1YQ1A 2O8VB 1U6TA 4KCEA 1ACVA 3IC4A 4MH2A 2FA8A 1Z6MA 2YCDA 3F4SA 4HUAA 4ULXA 4EKZA 1FHEA 2CV4A 3F4TA 2MZCA 6GSUA 1X9SB 1M9AA 2GS3A 4L8EA 5GZZB 5DQYA 4AJ7A 2B7KA 4YAVA 1TRUA 3UAPA 1GP1A 4G19A 4MJEA 5G1KA 3H8QA 3KH9A 4O32A 1ZGNA 2DJ3A 2IMEA 3HD5A 3CRUA 1G7OA 3H79A 1EGRA 10GSA 5JWRB 5C00A 2LSTA 5E59A 1Z7RA 4KUNA 3DVWA 1O7UA 4HJMA 2VL3A 1FG4A 1NW2A 3GURA 1EOGA 2YWOA 3A2VA 1M0UA 2RM5A 2H1AA 3Q6OA 5A5KA 2A4HA 2C1YA 3F6DA 4NPBA 2KP2A 3F4RA 4HZ2A 4OCFA 4G9HA 3WT1A 4YQUA 2F8FA 4ZILA 4KDXA 3LXTA 3EPTA 2O87A 1ML6A 1A8YA 4IS0A 2LUSA 3GX8A 4NXIA 1ZZYA 3TKSE 1IYIA 5IMDA 2DJ0A 2ALBA 1AQWA 2WRTA 1V58A 3MSZA 1C72A 3PH9A 1XW6A 3HJOA 1FOVA 18GSA 2C0FA 2N5FA 3I9V2 1KBNA 4GQCA 4F9ZA 1UC7A 3EMXA 3HZ8A 1XPVA 2I3YA 1K0NA 4PUAA 1A0FA 3KJYA 1PMTA 4I8BA 2QA1A 2HSHA 1ERUA 3H1NA 1SYXA 1BYEA 2PERA 2MMOA 3VK9A 1B4QA 1GTUA 3DYRA 3UVTA 2XBQA 4MK3A 4ZBBA 3IHGA 2P31A 4NWYA 6GSYA 1AC1A 1BQ7A 3Q18A 1HD2A 3VWVA 3UARA 3WD6A 3VI5A 4TR1A 2JL4A 4Z2RA 5ECQB 2AV4A 4Z7XA 6GSSA 1OE7A 2WGRA 2C3TA 1ABAA 1T7PB 1SKWB 3VI7A 4F2IA 3QMXA 4NHZA 1R5AA 4XS4B 3C71A 4ML6A 5KN0A 2MMZA 3KTLA 3VPTA 3TKSC 1B48A 4HI7A 4XRDA 4MF6A 3LSZA 4FYCA 3HKRA 5IOXA 2F9SA 4AJ8A 2OADA 1OC9A 5DALA 1DSBA 1EGOA 2GLRA 3IAM2 1JZWA 1HNCA 4IN0A 4HU7A 1ZL9A 2NVLA 2B7JA 1A23A 2X8CA 2NDOA 3WGXA 2LS5A 1XWAA 4MPFA 5DJLA 4CHSA 3CSJA 5H5RA 2N5AA 4J57E 3QAWA 2BMXA 3VWXA 1GUKA 4D73A 3MYDA 2AHEA 4PQHA 3GFKA 1QUWA 2XBIA 3FW2A 4BVXB 1JLVA 3F8UA 1TRSA 4OD7A 3MWHA 1O6JA 2GZPA 2GSRA 4N0VA 3PR8A 3E3EA 3RPNA 1FAAA 4L5OA 5G5FA 4ACSA 2DMMA 7GSSA 4G10A 3WGEA 1QK8A 1Y6EA 4LA1A 2A2RA 3L0HA 4TN8A 3RAZA 1BX9A 2FWHA 2B5XA 1SJIA 3GL5A 2VCQA 3PPUA 4I97A 1GTIA 2PVQA 1AIUA 2H72A 4FYBA 3QPMA 4JBBA 3FR3A 5EL8A 1SD9A 3RBTA 3IXRA 1V9WA 1U88A 3FEUA 2VL2A 4BL7A 1EWXA 2H01A 4LL1B 1N8JA 2H0HA 2K8VA 2MMAA 5B6MA 4HU9A 1T4YA 3OR5A 4HZ4A 4ZL7A 2I9HA 2R4VA 3FZ5A 1N2AA 4Q5FA 3ZMLA 4CY6A 3BJ5A 4YAPA 1B8XA 5HFGA 4KW6A 2WULA 1O81A 2V1MA 2R5GA 2JSYA 4O5QA 1K3LA 4JZQA 5EPFA 4ZIJA 1VF2A 3CRTA 5AGYA 5AN1A 3M1GA 3O3TA 4USSA 1GWCA 3Q19A 3UBKA 2KOKA 3BOAA 2HRNA 1TK5B 5CRWA 4DSSB 1PKWA 4V2NA 4PQ1A 2NPBA 4OO5A 4ZB9A 14GSA 4HQZA 5ECMB 1PKZA 1ZCPA 1M2DA 3TUEA 3VWWA 2IMIA 1HYUA 2HRKA 1Y25A 1Z9HA 4XHMA 4Q5RA 2OA7A 3IC8A 3H4KA 3KXOA 1G0TA 1K0AA 2V2GA 4ECCA 3W6GA 2IWTA 1WWJA 5FHIA 5KN3A 2VD0A 4XS1A 1M2BA 1PGTA 2LRTA 1SKRB 4RQRA 4ZXGA 2EIOA 2RIIA 3FR9A 3GUSA 1TU7A 1XXUA 5ID2A 1J9BA 1JZRA 5CRHA 3U5RE 3TDGA 4CW9A 20GSA 2GT5A 4K1FA 3PGTA 1MDJA 3VPQA 2J23A 5CRGA 2M80A 3FHKA 1AAZA 2C4JA 4ZB8A 3ZFLA 2LJRA 5F07A 2YZHA 2E2GA 2H70A 2DJ1A 4L0WA 3E0UA 1U3IA 1OKDA 3ED3A 2WS2A 4TR0A 1EZKA 2LRNA 3GN3A 4XCSA 1R4WA 2FD3A 4K2DA 1XIYA 1XOBA 3C7MA 1K0CA 4HDEA 3FRCA 16GSA 4KH7A 2YNXA 4ZBAA 2HSMA 1A0RP 2CVKA 2IPAA 2RUEA 1YY7A 1G6YA 1T1VA 2JZSA 4PTSA 1GULA 3IA1A 4O7HA 2H6ZA 4PUFC 4POLA 4POBA 2WCIA 1PRXA 3MNGA 5GSTA 4YQVA 1U3AA 2CT6A 4IBPA 1M9BA 2P0GA 2YV9A 3KCMA 3ZRDA 2JSZA 1SL2B 1QFNA 1VF3A 4EE0A 1MTCA 2M72A 5CRDA 4XIHA 2H1DA 1AUCA 1Z5YE 3MIXA 2YV7A 2VOCA 3GIXA 4MP4A 4MZCA 2O89A 3D21A 4MCUA 5AIVA 3IOSA 5BMUA 13GSA 2CZ3A 2XC2A 3A3TA 1F2EA 4EF0A 3CXGA 4G0KA 2LNTA 4MJAA 2YN1A 2F8AA 2EIRA 4L5LA 1H4OA 5DAKB 4LL4B 4IW9A 4QL7A 3QAGA 4V1Ag 4IQAA 3O76A 2LQQA 4PXOA 4N11A 3TKQA 1R26A 3CTFA 2GQMA 5J9CA 3ZIJA 2E0QA 3ZVJA 4OFTA 2GGTA 3ME8A 2DBCA 1J08A 3KEBA 4K7IA 1GNWA 5CYYA 2JZRA 2FWGA 4EVMA 1F6MC 4K8MA 1H75A 1SJZA 4P3YB 4BWQA 4I6XA 2B5EA 5G1LA 3KH7A 4A5PA 1K3OA 1X9WB 4ZB6A 1YZXA 1ZYQB 2MBSA 1FB6A 3D0ZA 4IELA 1TRWA 1S3AA 4EO3A 5B8AA 2PWJA 5ECLB 3GTUB 4F03A 4FQUA 3G7IA 2NBSA 5IMVA 1TK8B 2PN8A 1T8EB 2IMKA 1KTEA 3TB2A 3GKXA 5F05A 3A5IA 2R2JA 3LXZA 5A4VA 4I2TA 2AJQB 2QA2A 3F6FA 3FK8A 3EE2A 1XCCA 3GYKA 1URMA 2ES7A 2V32A 2GZYA 5KN2A 4NMUA 3UIWA 2C80A 2CX4A 2R0GA 4G2EA 3EU3A 1FW1A 2VD1A 1NHOA 5FT3A 3LQ7A 2PPTA 2PU9C 2LNSA 1GSFA 3IPZA 4PNGA 1R7HA 1DE2A 4O92A 1RW1A 5A4WA 3I69A 2IMDA 3EMPA 4GSNA 4GQFA 3G7YA 3ERWA 2DSAA 2LV3A 4MLYA 3HY2A 2I81A 3TKSA 4ICYA 3D4MA 4JE1A 9GSSA 4MABA 1F9MA 3BD2A 3J7Yb 2VLUA 1W4VA 5D73A 3EURA 3M9JA 4MH3A 1V2AA 5FWGA 2O7KA 2TRXA 5DCHA 2HZEB 4ECJA 5B6NA 2H6YA 2H1BA 1E2YA 4XTSA 4AGSA 3GH6A 4TW5A 4XRAA 1MEKA 4MF5A 2CZ2A 2FA4A 1M99A 4GCIA 2R0PA 4OFNA 1RK4A 2G2QA 4POMA 4DEJA 3GSTA 3GA4A 17GSA 4TXOA 5LD0A 3GKNA 3HJPA 3SWLA 4BWSA 3IDVA 2YJ7A 3GSSA 1PA3A 4BPYA 1OKTA 2F3MA 5IPHA 3GX0A 2KUCA 5AIXA 2BTOT 3PINA 4KDUA 2H19A 4CY8A 1PSQA 1FOHA 2YANA 3UEMA 3L4NA 1JFUA 4GSTA 4ILFA 2VCZA 1TK0B 3M8NA 2VAFA 2DJKA 4DVCA 1SENA 4HOJA 4EL1A 1SKSB 1BG5A 3KZQA 1X5CA 2H1GA 3QFAC 2VLTA 2KP1A 4F0BA 4MMMA 2GZZA 1SYRA 4PNFA 4OCEA 1M2AA 1WJKA 1Z7PA 1FO5A 3HXSA 3TJGA 2A4VA 2YWMA 1V57A 3G9BA 5JWOB 1V40A 1VF4A 2ZCTA 4KF9A 4KAEA 5GSSA 1MD3A 2BJXA 5CAXA 3HDCA 3IK9A 4ECIA 5D93A 1YEXA 4KSMA 5IM9A 5ID2B 2WFCA 1B9YC 2B3SA 2LTKA 1QGVA 2CQ9A 5CREA 4E8HA 3VLNA 1GLQA 1PL1A 4GXZA 3P90A 3QCPA 3QFBC 4TXVA 4O5RA 2GSQA 5GAPD 2FCHA 5EY6A 1K0BA 1XWGA 5ENUA 4I5QA 1GSDA 2GSTA 2ZNMA 1S3CA 3ZVJD 1GNEA 1LBKA 3C1RA 2LEGA 3DIEA 3LFLA 2IFQB 1A2MA 4F0CA 4LMVA 5DQSA 1XVQA 1ERWA 3GL3A 3ZZXA 1I9DA 2H71A 2X8GA 3N5OA 4EUYA 3IAS2 4BVYB 1F3AA 2HNLA 2E7PA 5JCGA 4ISDA 4ID0A 4KCAA 2V6OA 4N30A 3Q74A 1J0FA 4GWRA 1I5GA 3L9UA 6GSTA 1KEBA 1PX6A 4EC0A 2LJAA 1YF0A 1TI3A 3DKSA 5G31A 1G6WA 3DWVA 3F9UA 1GSQA 5D8IA 1EV4A 4WKWA 2UZ8A 4JR4A 4XS4A 2OJLA 4TVEA 1K0MA 3S9FA 4IJIA 6GSXA 2H8LA 4RI6A 3FZAA 1Q4JA 4E8EA 2IL3A 3TJJA 1JZOA 1V98A 2A2PA 3IBHA 2P5QA 4FIWA 2WB9A 3UBLA 1QMVA 3NIVA 3TOUA 3RHCA 3NOFA 2H30A 5HFKA 4LLRA 4WF5A 1XW9A 2QC7A 3KD0A 2REMA 1NHYA 2DJJA 4GRFA 4X4JA 5J5NA 1OYJA 1XFLA 2HLSA 2QSIA 3GMFA 1SJ6A 1YF1A 2J9HA 3D4TA 5DVBA 1JZDA 3BBYA 3R3EA 1GSYA 4RQXA 3HCZA 5J9BA 1B9XC 2L5LA 4IKHA 4YQMA 2FY6A 2LJKA 1BEDA 1EP7A 2VUPA 2CVBA 3IV4A 5IPGA 1PD21 4TKYA 5JCWA 3FZ4A 3C8EA 1LJRA 1HNBA 3G7JA 3IK7A 4K2XA 4FO5A 3L9VA 3I43A 3U6VA 5ECKB 4HQSA 3CYNA 2P5RA 3L78A 3EWLA 3IRAA 4F82A 5JWQB 5KN1A 1DUGA 2PMTA 2GTUA 2M46A 4Z2UA 1WRYA 3LJRA 4X1UA 4IQ1A 5KEJA 2YWIA 5IMZA 5E4WA 2HI7A 4O5UA 4JU5A 2H76A 5KOXA 4J2FA 2H6XA 1X5EA 4HEA2 5GAND 1EEJA 1E6BA 1OVNA 2HSYA 4EXJA 2C0DA 3LYKA 3UVHA 1SL1B 5G2ZA 2GQKA 2X99A 5G5EA 3DRNA 1MDIA 4LMWA 2OE1A 1SL0B 4V2LA 2VCWA 3APOA 3UOMA 4Q5QA 5DBQA 2PVOC 3IE3A 1JHBA 1WP0A 2VLVA 1XW5A 1U87A 4MF7A 4KE3A 4DSSA 5ECSA 1TXXA 2JACA 3HVVA 2B1KA 5HQPA 3N9JA 4GF0A 3FZ9A 3GRXA 3ZIVA 5DCGA 1ILOA 1YEPA 3LORA 2FUG2 2E2MA 3NZNA 2L6CA 5ECHB 1TU8A 3ZREA 5IIZA 5ECRB 5D9VA 5J4UA 2L6DA 1PL2A 1GLPA 2JU5A 2VIMA 1W89A 3P2AA 5COHA 2H66A 2KHPA 4K0NA 1XVWA 3DMLA 3EINA 1A8LA 3HVSA 3APQA 3UL3A 1GSSA 3LEFA 1SD8A 4PQIA 4Q5NA 4WXTA 4TR1B 5ECPB 2I1UA 3US3A 3LW9A 3HJMA 3MDKA 2FLSA 4HJ2A 4RI7A 4GSSA 3M0FA 1X5DA 5ABRA 3H93A 1VRSD 3DD3A 1AQVA 1F37A 4FYUA 4MZWA 3CSHA 2MMNA 5HFIA 2I4AA 2EIQA 2VM2A 3P8WA 5B7CA 1LU4A 2DKHA 3SBCA 3TJKA 1M7TA 2HFDA 5HR2A 1SK2A 4MNNA 2D2ZA 3LG6A 5F06A 3WT2A 2PGTA 2QKEA 3DXBA 1OC9B 5DALB 3F3RA 4WF4A 3TGZA 4TOPA 2YP6A 2DJ2A 4K0GA 3ZMKA 1XWBA 2R3XA 4MJCA 1OAZA 2A2SA 4PURA 4MA9A 2C3QA 3W8SA 3JCML 1A2JA 5ELGA 1TTZA 2RUFA 4DSRA 5B8BA 4D73B 2C3NA 1QXHA 5CO3A 2IJYA 3ZYWA 5F0GA 2L5OA 1K3YA 2Z9SA 5IO0A 1TDIA 4NAXA 2X64A 1GUMA 2C0GA 4WR5A 3ZTLA 3WGDA 1ON4A 2TRCP 4K7OA 3HVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBU A;  12GS A;  3HA9 A;  4AF2 A;  4QL9 A;  4WR4 A;  19GS A;  4AJ6 A;  1TOF A;  2OAC A;  5J3R A;  3KP8 A;  5DAK A;  3BCK A;  3ERG A;  3CSI A;  3P7X A;  1GTB A;  1EOH A;  4HS1 A;  5LNK e;  5F8B A;  2XPE A;  3L9S A;  5DJM A;  1TRV A;  2V6K A;  1ZYE A;  4J56 E;  5C04 A;  3GH9 A;  2GVP A;  4KSO A;  5LCZ A;  3RDW A;  4WBJ A;  2O85 A;  2HRF A;  3RHB A;  4IJ3 A;  1THX A;  2XHF A;  4IHU A;  5IMC A;  1GL8 A;  1DBY A;  3GNJ A;  2OE3 A;  1JLW A;  3QR6 A;  3VWU A;  4DSQ A;  4PX1 A;  2PBJ A;  1HQO A;  3ERF A;  1K0D A;  2OKA A;  1B4P A;  1KNG A;  3GV1 A;  1T4Z A;  4H86 A;  3W8J A;  2WDU A;  1ERV A;  3GKM A;  2XPD A;  3J7Y k;  3DEX A;  2H74 A;  4NHW A;  2DIY A;  4MDC A;  2MBT A;  1AXD A;  4MPG A;  5INY A;  1Z3E A;  1PQN A;  3GTU A;  4KX4 A;  1A2L A;  1TP9 A;  3TJF A;  5H5Q A;  1OC3 A;  2GT6 A;  2DC5 A;  4V2M A;  1WIK A;  5ECN B;  3A2X A;  2HE3 A;  2YZU A;  3KTB A;  5CNW A;  3TRP A;  2VO4 A;  5IMA A;  4JRR A;  2YWN A;  3IHQ A;  5D9T A;  1T00 A;  2WZ9 A;  4I2U A;  1THO A;  1YJ6 A;  2TIR A;  3ISO A;  2L57 A;  2H0G A;  3FY7 A;  1YKA A;  1EEM A;  3MAK A;  3C1S A;  5IOW A;  5L71 A;  1TKD B;  2AB6 A;  2HZF A;  1VF1 A;  3ZFB A;  4CDO A;  4TR3 A;  4ZL9 A;  4KDY A;  4OFM A;  3BCI A;  2CAQ A;  2C8U A;  2CX3 A;  5IO2 A;  2B6M A;  3HZ4 A;  5D96 A;  1FB0 A;  4X0X A;  2H0I A;  4OWY A;  4WBR D;  1SK0 A;  4BA7 A;  3F3Q A;  2FHE A;  3IR4 A;  2YOI A;  4POK A;  5HR0 A;  1X0R A;  3A5W A;  5J41 A;  1OE8 A;  3TRQ A;  4X43 A;  2HZE A;  4YH2 A;  1UA5 A;  3D22 A;  4KB3 A;  2RLI A;  3D5J A;  2ZUP A;  1O85 A;  2NTO A;  1R5P A;  5ELA A;  5G30 A;  1BJX A;  1SU9 A;  4TR4 A;  1PX7 A;  5HR1 A;  3EYT A;  4IGJ A;  6GSW A;  1RQM A;  3WYW A;  2K8S A;  4RUV A;  1VGL A;  4XS6 A;  5DDL A;  1PN9 A;  2FWE A;  2CAI A;  1X9M B;  1XZO A;  2LRC A;  3DGQ A;  4N10 A;  3I6A A;  3ME7 A;  2IN3 A;  1O73 A;  1CQH A;  1EV9 A;  3QDN A;  5EVO A;  1GTA A;  2PUK C;  2FGX A;  2H75 A;  1TI1 A;  2YJH A;  4MZB A;  3EU4 A;  1XWK A;  2K6V A;  4JED A;  4PGT A;  2EC4 A;  2KLX A;  3KGK A;  1ST9 A;  2L4Q A;  3TKP A;  3K8N A;  1FVJ A;  2LKU A;  2VCV A;  4K6X A;  1MD4 A;  3TKR A;  3EVI A;  3APS A;  5H5S A;  2VCT A;  2R6K A;  2OBI A;  4TRX A;  4OO4 A;  1WPI A;  3LWA A;  1WMJ A;  3TOT A;  2R37 A;  3QOU A;  1DE1 A;  1G7E A;  3R2Q A;  5A4U A;  1NM3 A;  3CTG A;  4K7N A;  2ON5 A;  11GS A;  2HYX A;  1GSU A;  3FYG A;  4V1A p;  1HNA A;  1TJD A;  3TCO A;  2N5B A;  2VL2 C;  2AAW A;  3A2W A;  4GLT A;  4BVX A;  3VUR A;  1GSE A;  3UMA A;  1SK1 A;  2OE0 A;  2RM6 A;  3KM6 A;  1NSW A;  2CVD A;  3FR6 A;  3F0I A;  3VFI A;  2V41 A;  2FWF A;  4ECB A;  22GS A;  5IQY A;  3LYP A;  2FNO A;  1WE0 A;  1ERT A;  3QAV A;  5D9W A;  1UN2 A;  2AYT A;  2JAD A;  4NV2 A;  3C73 A;  3F63 A;  2L59 A;  2IFQ A;  1AQX A;  1XBS A;  2VM1 A;  4L0U A;  3EC3 A;  3AY8 A;  2B1L A;  5ECO B;  4BVY A;  1IYH A;  2IMF A;  2IIY A;  2LQO A;  4NV5 A;  3HYP A;  2HT9 A;  1XWC A;  1XOA A;  4JR6 A;  4ML1 A;  3DVX A;  2VL9 A;  4FH8 A;  1ZOF A;  5JCU A;  1K0O A;  2CA8 A;  1OC8 A;  4MJB A;  4KGI A;  2L4C A;  3TRX A;  4KA0 A;  6GSV A;  4IP6 A;  2AUV A;  2X8H A;  3QD9 A;  2DML A;  4ZBD A;  1Z6N A;  2HXK A;  3D6I A;  4OMV A;  1GUH A;  2GDR A;  2QGV A;  1CQG A;  1GRX A;  4WEY A;  3FKF A;  3ZL5 A;  4N0Z A;  2JZT A;  2YPM A;  2VCX A;  4KND A;  2H73 A;  2WJU A;  3M9K A;  1USB A;  3GHA A;  1UVZ A;  5ECI B;  1BAY A;  1O8X A;  2K18 A;  3M3M A;  3TJB A;  4EDY A;  4EDZ A;  3UJ1 A;  3O6T A;  1O8W A;  1YKC A;  1MDK A;  1GH2 A;  2GQL A;  5CP1 A;  3KP9 A;  4IP1 A;  3GKK A;  4K9Z A;  2MYG A;  1T3B A;  3HHV A;  1FVK A;  8GSS A;  3LGC A;  2DIZ A;  1QQ2 A;  2B5Y A;  3CMI A;  3KIJ A;  3ZLP A;  3KMN A;  3RPP A;  1AW9 A;  1S3D A;  2F51 A;  1F3B A;  5AIS A;  3E9J B;  4ZL8 A;  2DLX A;  2C0E A;  5D9X A;  1Q98 A;  4QQ7 A;  5HR3 A;  2G0F A;  1WOU A;  3V1W A;  4WET A;  1ZMA A;  3KMO A;  4IVF A;  1EP8 A;  1A24 A;  3ZIT A;  2ON7 A;  1TW9 A;  4GTU A;  2K9F A;  5IMF A;  1YDK A;  2OBK A;  2GSS A;  4TXO B;  1YQ1 A;  2O8V B;  1U6T A;  4KCE A;  1ACV A;  3IC4 A;  4MH2 A;  2FA8 A;  1Z6M A;  2YCD A;  3F4S A;  4HUA A;  4ULX A;  4EKZ A;  1FHE A;  2CV4 A;  3F4T A;  2MZC A;  6GSU A;  1X9S B;  1M9A A;  2GS3 A;  4L8E A;  5GZZ B;  5DQY A;  4AJ7 A;  2B7K A;  4YAV A;  1TRU A;  3UAP A;  1GP1 A;  4G19 A;  4MJE A;  5G1K A;  3H8Q A;  3KH9 A;  4O32 A;  1ZGN A;  2DJ3 A;  2IME A;  3HD5 A;  3CRU A;  1G7O A;  3H79 A;  1EGR A;  10GS A;  5JWR B;  5C00 A;  2LST A;  5E59 A;  1Z7R A;  4KUN A;  3DVW A;  1O7U A;  4HJM A;  2VL3 A;  1FG4 A;  1NW2 A;  3GUR A;  1EOG A;  2YWO A;  3A2V A;  1M0U A;  2RM5 A;  2H1A A;  3Q6O A;  5A5K A;  3F6D A;  2C1Y A;  4NPB A;  2KP2 A;  3F4R A;  4HZ2 A;  4OCF A;  4G9H A;  3WT1 A;  4YQU A;  2F8F A;  4ZIL A;  4KDX A;  3LXT A;  2O87 A;  1ML6 A;  1A8Y A;  4IS0 A;  2LUS A;  3GX8 A;  4NXI A;  1ZZY A;  3TKS E;  1IYI A;  5IMD A;  2DJ0 A;  2ALB A;  1AQW A;  2WRT A;  1V58 A;  3MSZ A;  1C72 A;  3PH9 A;  1XW6 A;  3HJO A;  1FOV A;  18GS A;  2C0F A;  2N5F A;  3I9V 2;  1KBN A;  4GQC A;  4F9Z A;  1UC7 A;  3EMX A;  3HZ8 A;  1XPV A;  2I3Y A;  1K0N A;  4PUA A;  1A0F A;  3KJY A;  1PMT A;  4I8B A;  2HSH A;  1ERU A;  3H1N A;  1SYX A;  1BYE A;  2PER A;  2MMO A;  3VK9 A;  1B4Q A;  1GTU A;  3DYR A;  3UVT A;  2XBQ A;  4MK3 A;  4ZBB A;  2P31 A;  4NWY A;  6GSY A;  1AC1 A;  1BQ7 A;  3Q18 A;  1HD2 A;  3VWV A;  3UAR A;  3WD6 A;  3VI5 A;  4TR1 A;  2JL4 A;  5ECQ B;  2AV4 A;  4Z7X A;  6GSS A;  1OE7 A;  2WGR A;  2C3T A;  1ABA A;  1T7P B;  1SKW B;  3VI7 A;  4F2I A;  3QMX A;  4NHZ A;  1R5A A;  4XS4 B;  3C71 A;  4ML6 A;  5KN0 A;  2MMZ A;  3KTL A;  3VPT A;  3TKS C;  1B48 A;  4HI7 A;  4XRD A;  4MF6 A;  3LSZ A;  4FYC A;  3HKR A;  5IOX A;  2F9S A;  4AJ8 A;  2OAD A;  1OC9 A;  5DAL A;  1DSB A;  1EGO A;  2GLR A;  3IAM 2;  1JZW A;  1HNC A;  4IN0 A;  4HU7 A;  1ZL9 A;  2NVL A;  2B7J A;  1A23 A;  2X8C A;  2NDO A;  3WGX A;  2LS5 A;  1XWA A;  4MPF A;  5DJL A;  4CHS A;  3CSJ A;  5H5R A;  2N5A A;  4J57 E;  3QAW A;  2BMX A;  3VWX A;  1GUK A;  4D73 A;  2AHE A;  4PQH A;  3GFK A;  1QUW A;  2XBI A;  3FW2 A;  1JLV A;  3F8U A;  1TRS A;  4OD7 A;  3MWH A;  1O6J A;  2GZP A;  2GSR A;  4N0V A;  3PR8 A;  3E3E A;  3RPN A;  1FAA A;  4L5O A;  5G5F A;  4ACS A;  2DMM A;  7GSS A;  4G10 A;  3WGE A;  1QK8 A;  1Y6E A;  4LA1 A;  2A2R A;  3L0H A;  4TN8 A;  3RAZ A;  1BX9 A;  2FWH A;  2B5X A;  1SJI A;  3GL5 A;  2VCQ A;  4I97 A;  1GTI A;  2PVQ A;  1AIU A;  2H72 A;  4FYB A;  3QPM A;  4JBB A;  3FR3 A;  5EL8 A;  1SD9 A;  3RBT A;  3IXR A;  1V9W A;  1U88 A;  3FEU A;  2VL2 A;  4BL7 A;  1EWX A;  2H01 A;  4LL1 B;  1N8J A;  2H0H A;  2K8V A;  2MMA A;  5B6M A;  4HU9 A;  1T4Y A;  3OR5 A;  4HZ4 A;  4ZL7 A;  2I9H A;  2R4V A;  3FZ5 A;  1N2A A;  4Q5F A;  3ZML A;  3BJ5 A;  4YAP A;  1B8X A;  5HFG A;  4KW6 A;  2WUL A;  1O81 A;  2V1M A;  2R5G A;  2JSY A;  4ZIJ A;  1K3L A;  4JZQ A;  5EPF A;  1VF2 A;  3CRT A;  5AGY A;  5AN1 A;  3M1G A;  3O3T A;  1GWC A;  3Q19 A;  3UBK A;  2KOK A;  3BOA A;  2HRN A;  1TK5 B;  5CRW A;  4DSS B;  1PKW A;  4V2N A;  4PQ1 A;  2NPB A;  4OO5 A;  4ZB9 A;  14GS A;  4HQZ A;  5ECM B;  1PKZ A;  1ZCP A;  1M2D A;  3TUE A;  3VWW A;  2IMI A;  1HYU A;  1Y25 A;  1Z9H A;  4XHM A;  4Q5R A;  2OA7 A;  3KXO A;  3H4K A;  1G0T A;  1K0A A;  2V2G A;  4ECC A;  3W6G A;  2IWT A;  1WWJ A;  5FHI A;  5KN3 A;  2VD0 A;  4XS1 A;  1M2B A;  1PGT A;  2LRT A;  1SKR B;  4RQR A;  4ZXG A;  2EIO A;  2RII A;  3FR9 A;  3GUS A;  1TU7 A;  1XXU A;  5ID2 A;  1J9B A;  1JZR A;  5CRH A;  3U5R E;  3TDG A;  4CW9 A;  20GS A;  2GT5 A;  4K1F A;  3PGT A;  1MDJ A;  3VPQ A;  2J23 A;  5CRG A;  2M80 A;  3FHK A;  1AAZ A;  2C4J A;  4ZB8 A;  3ZFL A;  2LJR A;  5F07 A;  2YZH A;  2E2G A;  2H70 A;  2DJ1 A;  4L0W A;  3E0U A;  1U3I A;  1OKD A;  3ED3 A;  2WS2 A;  4TR0 A;  1EZK A;  2LRN A;  3GN3 A;  4XCS A;  1R4W A;  2FD3 A;  4K2D A;  1XIY A;  1XOB A;  3C7M A;  1K0C A;  4HDE A;  3FRC A;  16GS A;  4KH7 A;  2YNX A;  4ZBA A;  1A0R P;  2CVK A;  2IPA A;  2RUE A;  1YY7 A;  1G6Y A;  1T1V A;  2JZS A;  1GUL A;  3IA1 A;  4O7H A;  2H6Z A;  4PUF C;  4POL A;  4POB A;  2WCI A;  1PRX A;  3MNG A;  5GST A;  4YQV A;  1U3A A;  2CT6 A;  4IBP A;  1M9B A;  2P0G A;  2YV9 A;  3KCM A;  3ZRD A;  2JSZ A;  1SL2 B;  1QFN A;  1VF3 A;  4EE0 A;  1MTC A;  2M72 A;  5CRD A;  4XIH A;  2H1D A;  1AUC A;  1Z5Y E;  2YV7 A;  2VOC A;  3GIX A;  4MP4 A;  4MZC A;  2O89 A;  3D21 A;  4MCU A;  5AIV A;  3IOS A;  13GS A;  2CZ3 A;  2XC2 A;  3A3T A;  1F2E A;  4EF0 A;  3CXG A;  2LNT A;  4MJA A;  2YN1 A;  2F8A A;  2EIR A;  4L5L A;  1H4O A;  5DAK B;  4LL4 B;  4IW9 A;  4QL7 A;  3QAG A;  4V1A g;  4IQA A;  3O76 A;  2LQQ A;  4PXO A;  4N11 A;  3TKQ A;  1R26 A;  3CTF A;  2GQM A;  5J9C A;  3ZIJ A;  2E0Q A;  3ZVJ A;  4OFT A;  2GGT A;  3ME8 A;  2DBC A;  1J08 A;  3KEB A;  4K7I A;  1GNW A;  5CYY A;  2JZR A;  2FWG A;  4EVM A;  1F6M C;  4K8M A;  1H75 A;  1SJZ A;  4P3Y B;  4BWQ A;  4I6X A;  2B5E A;  5G1L A;  3KH7 A;  1K3O A;  1X9W B;  4ZB6 A;  1YZX A;  1ZYQ B;  2MBS A;  1FB6 A;  3D0Z A;  4IEL A;  1TRW A;  1S3A A;  4EO3 A;  5B8A A;  2PWJ A;  5ECL B;  3GTU B;  4F03 A;  3G7I A;  2NBS A;  5IMV A;  1TK8 B;  2PN8 A;  1T8E B;  2IMK A;  1KTE A;  3TB2 A;  3GKX A;  5F05 A;  2R2J A;  3LXZ A;  5A4V A;  4I2T A;  2AJQ B;  3F6F A;  3FK8 A;  3EE2 A;  1XCC A;  3GYK A;  1URM A;  2ES7 A;  2V32 A;  2GZY A;  5KN2 A;  4NMU A;  3UIW A;  2C80 A;  2CX4 A;  4G2E A;  3EU3 A;  1FW1 A;  2VD1 A;  1NHO A;  5FT3 A;  3LQ7 A;  2PPT A;  2PU9 C;  2LNS A;  1GSF A;  3IPZ A;  4PNG A;  1R7H A;  1DE2 A;  4O92 A;  1RW1 A;  5A4W A;  3I69 A;  2IMD A;  3EMP A;  4GSN A;  4GQF A;  3G7Y A;  3ERW A;  2DSA A;  2LV3 A;  4MLY A;  3HY2 A;  2I81 A;  3TKS A;  3D4M A;  4JE1 A;  9GSS A;  4MAB A;  1F9M A;  3BD2 A;  3J7Y b;  2VLU A;  1W4V A;  5D73 A;  3EUR A;  3M9J A;  4MH3 A;  1V2A A;  5FWG A;  2O7K A;  2TRX A;  5DCH A;  2HZE B;  4ECJ A;  5B6N A;  2H6Y A;  2H1B A;  1E2Y A;  4XTS A;  4AGS A;  3GH6 A;  4TW5 A;  4XRA A;  1MEK A;  4MF5 A;  2CZ2 A;  2FA4 A;  1M99 A;  4GCI A;  4OFN A;  1RK4 A;  2G2Q A;  4POM A;  4DEJ A;  3GST A;  3GA4 A;  17GS A;  4TXO A;  5LD0 A;  3GKN A;  3HJP A;  3SWL A;  4BWS A;  3IDV A;  2YJ7 A;  3GSS A;  1PA3 A;  4BPY A;  1OKT A;  2F3M A;  5IPH A;  3GX0 A;  2KUC A;  5AIX A;  2BTO T;  3PIN A;  4KDU A;  2H19 A;  1PSQ A;  2YAN A;  3UEM A;  3L4N A;  1JFU A;  4GST A;  4ILF A;  2VCZ A;  1TK0 B;  3M8N A;  2VAF A;  2DJK A;  4DVC A;  1SEN A;  4HOJ A;  4EL1 A;  1SKS B;  1BG5 A;  3KZQ A;  1X5C A;  2H1G A;  3QFA C;  2VLT A;  2KP1 A;  4F0B A;  4MMM A;  2GZZ A;  1SYR A;  4PNF A;  4OCE A;  1M2A A;  1WJK A;  1Z7P A;  1FO5 A;  3HXS A;  3TJG A;  2A4V A;  2YWM A;  1V57 A;  3G9B A;  5JWO B;  1V40 A;  1VF4 A;  2ZCT A;  4KAE A;  5GSS A;  1MD3 A;  2BJX A;  5CAX A;  3HDC A;  3IK9 A;  4ECI A;  5D93 A;  1YEX A;  4KSM A;  5IM9 A;  5ID2 B;  2WFC A;  1B9Y C;  2B3S A;  2LTK A;  1QGV A;  2CQ9 A;  5CRE A;  4E8H A;  3VLN A;  1GLQ A;  1PL1 A;  4GXZ A;  3P90 A;  3QCP A;  3QFB C;  4TXV A;  4O5R A;  2GSQ A;  5GAP D;  2FCH A;  5EY6 A;  1K0B A;  1XWG A;  5ENU A;  4I5Q A;  1GSD A;  2GST A;  2ZNM A;  1S3C A;  3ZVJ D;  1GNE A;  1LBK A;  3C1R A;  2LEG A;  3DIE A;  3LFL A;  2IFQ B;  1A2M A;  4F0C A;  4LMV A;  5DQS A;  1XVQ A;  1ERW A;  3GL3 A;  3ZZX A;  1I9D A;  2H71 A;  2X8G A;  3N5O A;  4EUY A;  3IAS 2;  1F3A A;  2HNL A;  2E7P A;  5JCG A;  4ISD A;  4ID0 A;  4KCA A;  2V6O A;  4N30 A;  3Q74 A;  1J0F A;  4GWR A;  1I5G A;  3L9U A;  6GST A;  1KEB A;  1PX6 A;  4EC0 A;  2LJA A;  1YF0 A;  1TI3 A;  3DKS A;  5G31 A;  1G6W A;  3DWV A;  3F9U A;  1GSQ A;  5D8I A;  1EV4 A;  4WKW A;  4JR4 A;  4XS4 A;  2OJL A;  4TVE A;  1K0M A;  3S9F A;  4IJI A;  6GSX A;  2H8L A;  4RI6 A;  3FZA A;  1Q4J A;  4E8E A;  2IL3 A;  3TJJ A;  1JZO A;  1V98 A;  3IBH A;  2P5Q A;  4FIW A;  2WB9 A;  3UBL A;  1QMV A;  3NIV A;  3TOU A;  3RHC A;  3NOF A;  2H30 A;  5HFK A;  4LLR A;  4WF5 A;  1XW9 A;  2QC7 A;  3KD0 A;  2REM A;  1NHY A;  2DJJ A;  4GRF A;  5J5N A;  1OYJ A;  1XFL A;  2HLS A;  2QSI A;  3GMF A;  1SJ6 A;  1YF1 A;  2J9H A;  3D4T A;  5DVB A;  1JZD A;  3BBY A;  1GSY A;  4RQX A;  3HCZ A;  5J9B A;  1B9X C;  2L5L A;  4IKH A;  4YQM A;  2FY6 A;  2LJK A;  1BED A;  1EP7 A;  2VUP A;  2CVB A;  3IV4 A;  5IPG A;  1PD2 1;  4TKY A;  5JCW A;  3FZ4 A;  3C8E A;  1LJR A;  1HNB A;  3G7J A;  3IK7 A;  4FO5 A;  3L9V A;  3I43 A;  3U6V A;  5ECK B;  4HQS A;  3CYN A;  2P5R A;  3L78 A;  3EWL A;  3IRA A;  4F82 A;  5JWQ B;  5KN1 A;  1DUG A;  2PMT A;  2GTU A;  2M46 A;  1WRY A;  3LJR A;  4X1U A;  4IQ1 A;  5KEJ A;  2YWI A;  5IMZ A;  5E4W A;  2HI7 A;  4JU5 A;  2H76 A;  4J2F A;  2H6X A;  1X5E A;  4HEA 2;  5GAN D;  1EEJ A;  1E6B A;  1OVN A;  2HSY A;  4EXJ A;  2C0D A;  3LYK A;  3UVH A;  1SL1 B;  5G2Z A;  2GQK A;  2X99 A;  5G5E A;  3DRN A;  1MDI A;  4LMW A;  2OE1 A;  1SL0 B;  4V2L A;  2VCW A;  3APO A;  3UOM A;  4Q5Q A;  5DBQ A;  2PVO C;  3IE3 A;  1JHB A;  1WP0 A;  2VLV A;  1XW5 A;  1U87 A;  4MF7 A;  4KE3 A;  4DSS A;  5ECS A;  1TXX A;  2JAC A;  3HVV A;  2B1K A;  5HQP A;  3N9J A;  4GF0 A;  3FZ9 A;  3GRX A;  3ZIV A;  5DCG A;  1ILO A;  1YEP A;  3LOR A;  2FUG 2;  2E2M A;  3NZN A;  2L6C A;  5ECH B;  1TU8 A;  3ZRE A;  5IIZ A;  5ECR B;  5D9V A;  5J4U A;  2L6D A;  1PL2 A;  1GLP A;  2JU5 A;  2VIM A;  1W89 A;  3P2A A;  5COH A;  2H66 A;  2KHP A;  4K0N A;  1XVW A;  3DML A;  3EIN A;  1A8L A;  3HVS A;  3APQ A;  3UL3 A;  1GSS A;  3LEF A;  1SD8 A;  4PQI A;  4Q5N A;  4WXT A;  4TR1 B;  5ECP B;  2I1U A;  3US3 A;  3HJM A;  3MDK A;  2FLS A;  4HJ2 A;  4RI7 A;  4GSS A;  3M0F A;  1X5D A;  5ABR A;  3H93 A;  1VRS D;  3DD3 A;  1AQV A;  1F37 A;  4FYU A;  4MZW A;  3CSH A;  2MMN A;  5HFI A;  2I4A A;  2EIQ A;  2VM2 A;  3P8W A;  5B7C A;  1LU4 A;  3SBC A;  3TJK A;  1M7T A;  2HFD A;  5HR2 A;  1SK2 A;  2D2Z A;  3LG6 A;  5F06 A;  3WT2 A;  2PGT A;  2QKE A;  3DXB A;  1OC9 B;  5DAL B;  3F3R A;  4WF4 A;  3TGZ A;  4TOP A;  2YP6 A;  2DJ2 A;  4K0G A;  3ZMK A;  1XWB A;  2R3X A;  4MJC A;  1OAZ A;  2A2S A;  4PUR A;  4MA9 A;  2C3Q A;  3W8S A;  3JCM L;  1A2J A;  5ELG A;  1TTZ A;  2RUF A;  4DSR A;  5B8B A;  4D73 B;  2C3N A;  1QXH A;  5CO3 A;  2IJY A;  3ZYW A;  5F0G A;  2L5O A;  1K3Y A;  2Z9S A;  5IO0 A;  1TDI A;  4NAX A;  2X64 A;  1GUM A;  2C0G A;  4WR5 A;  3ZTL A;  3WGD A;  1ON4 A;  2TRC P;  4K7O A;  3HVX A; 
#chains in the Genus database with same CATH topology
 3CBU A;  12GS A;  3HA9 A;  4AF2 A;  4QL9 A;  4WR4 A;  19GS A;  4AJ6 A;  1TOF A;  2OAC A;  5J3R A;  1ZYN A;  3KP8 A;  5DAK A;  3BCK A;  3ERG A;  3CSI A;  3P7X A;  1GTB A;  3CQF A;  1EOH A;  4HS1 A;  5LNK e;  5F8B A;  2XPE A;  3L9S A;  5DJM A;  1TRV A;  2V6K A;  1ZYE A;  4J56 E;  5C04 A;  3GH9 A;  2GVP A;  4KSO A;  5LCZ A;  3RDW A;  4WBJ A;  2O85 A;  2HRF A;  3RHB A;  4BL7 B;  4IJ3 A;  1THX A;  2XHF A;  4EIQ A;  4IHU A;  5IMC A;  1GL8 A;  1DBY A;  3GNJ A;  2OE3 A;  1JLW A;  3QR6 A;  3VWU A;  4DSQ A;  4PX1 A;  2PBJ A;  1HQO A;  1PN0 A;  3ERF A;  1K0D A;  2OKA A;  1B4P A;  1KNG A;  3GV1 A;  1T4Z A;  4H86 A;  3W8J A;  2WDU A;  1ERV A;  3GKM A;  2XPD A;  3J7Y k;  3DEX A;  2H74 A;  4NHW A;  2DIY A;  4MDC A;  2HRA A;  2MBT A;  1AXD A;  4MPG A;  5INY A;  1Z3E A;  1PQN A;  3GTU A;  4KX4 A;  1A2L A;  1TP9 A;  3TJF A;  5BRT A;  5H5Q A;  1OC3 A;  2GT6 A;  2DC5 A;  4V2M A;  1WIK A;  5ECN B;  3A2X A;  2HE3 A;  2YZU A;  3KTB A;  5CNW A;  3TRP A;  2VO4 A;  4G0I A;  5IMA A;  4JRR A;  2YWN A;  3IHQ A;  5D9T A;  1T00 A;  2WZ9 A;  4I2U A;  1THO A;  1YJ6 A;  2TIR A;  3ISO A;  2L57 A;  2H0G A;  3FY7 A;  1YKA A;  1EEM A;  3MAK A;  3FMW A;  3C1S A;  5IOW A;  5L71 A;  1TKD B;  2AB6 A;  2HZF A;  1VF1 A;  3ZFB A;  4CDO A;  4TR3 A;  4ZL9 A;  4Z2T A;  4KDY A;  4OFM A;  3BCI A;  2CAQ A;  2C8U A;  2CX3 A;  5IO2 A;  2B6M A;  3HZ4 A;  5D96 A;  1FB0 A;  4X0X A;  2H0I A;  4OWY A;  4WBR D;  1SK0 A;  4BA7 A;  3F3Q A;  2FHE A;  3IR4 A;  2YOI A;  4POK A;  5HR0 A;  1X0R A;  3A5W A;  5J41 A;  1OE8 A;  3TRQ A;  4X43 A;  2HZE A;  4YH2 A;  1UA5 A;  3D22 A;  4KB3 A;  2RLI A;  3D5J A;  2ZUP A;  1O85 A;  2NTO A;  1R5P A;  5ELA A;  5G30 A;  1BJX A;  1SU9 A;  4YKF A;  4TR4 A;  1PX7 A;  5HR1 A;  3EYT A;  4IGJ A;  4YKG A;  6GSW A;  1RQM A;  3WYW A;  2K8S A;  4RUV A;  1VGL A;  4XS6 A;  5DDL A;  1PN9 A;  2FWE A;  2CAI A;  1X9M B;  1XZO A;  2LRC A;  3DGQ A;  4N10 A;  3I6A A;  3ME7 A;  2IN3 A;  1O73 A;  1CQH A;  1EV9 A;  3QDN A;  5EVO A;  1GTA A;  2PUK C;  2FGX A;  2H75 A;  1TI1 A;  2YJH A;  4K5S A;  4MZB A;  3EU4 A;  1XWK A;  2K6V A;  4JED A;  4PGT A;  2EC4 A;  2KLX A;  3KGK A;  1ST9 A;  2L4Q A;  3TKP A;  3K8N A;  1FVJ A;  2LKU A;  4EIP A;  2VCV A;  4K6X A;  1MD4 A;  3TKR A;  3EVI A;  3APS A;  5H5S A;  2VCT A;  2R6K A;  2OBI A;  4TRX A;  4OO4 A;  1WPI A;  3LWA A;  1WMJ A;  3TOT A;  2R37 A;  3QOU A;  1DE1 A;  1G7E A;  3R2Q A;  5A4U A;  1NM3 A;  3CTG A;  4K7N A;  2ON5 A;  2DKI A;  11GS A;  2HYX A;  1GSU A;  3FYG A;  4V1A p;  1HNA A;  1TJD A;  3TCO A;  2N5B A;  2VL2 C;  2AAW A;  3A2W A;  4GLT A;  4BVX A;  3VUR A;  1GSE A;  3UMA A;  1XG8 A;  1SK1 A;  2OE0 A;  2RM6 A;  3KM6 A;  1NSW A;  2CVD A;  3FR6 A;  3F0I A;  3VFI A;  2V41 A;  4G0L A;  2FWF A;  4ECB A;  22GS A;  5IQY A;  3LYP A;  2FNO A;  1WE0 A;  1ERT A;  3QAV A;  5D9W A;  1UN2 A;  2AYT A;  2JAD A;  4NV2 A;  3C73 A;  3F63 A;  2L59 A;  2IFQ A;  1AQX A;  1XBS A;  2VM1 A;  4L0U A;  3EC3 A;  3AY8 A;  2X49 A;  2B1L A;  5ECO B;  4BVY A;  1IYH A;  2IMF A;  2IIY A;  2LQO A;  4NV5 A;  3HYP A;  2HT9 A;  1XWC A;  1XOA A;  4JR6 A;  4ML1 A;  4K5R A;  3DVX A;  2VL9 A;  4FH8 A;  1ZOF A;  5JCU A;  1K0O A;  2CA8 A;  1OC8 A;  4MJB A;  4KGI A;  2L4C A;  3TRX A;  4KA0 A;  6GSV A;  2R0C A;  4IP6 A;  2AUV A;  2X8H A;  3QD9 A;  2DML A;  4ZBD A;  1Z6N A;  2HXK A;  3D6I A;  4OMV A;  1GUH A;  2GDR A;  2QGV A;  1CQG A;  1GRX A;  4WEY A;  3FKF A;  3ZL5 A;  4N0Z A;  2JZT A;  2YPM A;  2VCX A;  4KND A;  2X4A A;  2H73 A;  2WJU A;  3M9K A;  1USB A;  3GHA A;  1UVZ A;  5ECI B;  1BAY A;  1O8X A;  2K18 A;  3M3M A;  3TJB A;  4EDY A;  4EDZ A;  3UJ1 A;  1ZYP A;  3O6T A;  1O8W A;  1YKC A;  1MDK A;  1GH2 A;  2GQL A;  5CP1 A;  3KP9 A;  4IP1 A;  3GKK A;  4K9Z A;  2MYG A;  1T3B A;  3HHV A;  1FVK A;  8GSS A;  3LGC A;  2DIZ A;  1QQ2 A;  2B5Y A;  3CMI A;  3KIJ A;  3ZLP A;  3KMN A;  3RPP A;  1AW9 A;  1S3D A;  2F51 A;  1F3B A;  5AIS A;  3E9J B;  4ZL8 A;  2DLX A;  5KOW A;  2C0E A;  5D9X A;  1Q98 A;  4QQ7 A;  5HR3 A;  2G0F A;  1WOU A;  3V1W A;  4WET A;  1ZMA A;  3KMO A;  4IVF A;  1EP8 A;  1A24 A;  3ZIT A;  2ON7 A;  1TW9 A;  4GTU A;  2K9F A;  5IMF A;  1YDK A;  2OBK A;  2GSS A;  1M3J A;  4TXO B;  1YQ1 A;  2O8V B;  1U6T A;  4KCE A;  1ACV A;  3IC4 A;  4MH2 A;  2FA8 A;  1Z6M A;  2YCD A;  3F4S A;  4HUA A;  4ULX A;  4EKZ A;  1FHE A;  2CV4 A;  3F4T A;  2MZC A;  6GSU A;  1X9S B;  1M9A A;  2GS3 A;  4L8E A;  5GZZ B;  5DQY A;  4AJ7 A;  2B7K A;  4YAV A;  1TRU A;  3UAP A;  1GP1 A;  4G19 A;  4MJE A;  5G1K A;  3H8Q A;  3KH9 A;  4O32 A;  1ZGN A;  2DJ3 A;  2IME A;  3HD5 A;  3CRU A;  1G7O A;  3H79 A;  1EGR A;  10GS A;  5JWR B;  5C00 A;  2LST A;  5E59 A;  1Z7R A;  4KUN A;  3DVW A;  1O7U A;  4HJM A;  3HVN A;  2VL3 A;  1FG4 A;  1NW2 A;  3GUR A;  1EOG A;  2YWO A;  3A2V A;  1M0U A;  2RM5 A;  2H1A A;  3Q6O A;  5A5K A;  2A4H A;  2C1Y A;  3F6D A;  4NPB A;  2KP2 A;  3F4R A;  4HZ2 A;  4OCF A;  4G9H A;  3WT1 A;  4YQU A;  2F8F A;  4ZIL A;  4KDX A;  3LXT A;  3EPT A;  2O87 A;  1ML6 A;  1A8Y A;  4IS0 A;  2LUS A;  3GX8 A;  4NXI A;  1ZZY A;  3TKS E;  1IYI A;  5IMD A;  2DJ0 A;  2ALB A;  1AQW A;  2WRT A;  1PFO A;  1V58 A;  3MSZ A;  1C72 A;  3PH9 A;  1XW6 A;  3HJO A;  1FOV A;  18GS A;  2C0F A;  2N5F A;  3I9V 2;  1KBN A;  4GQC A;  4F9Z A;  1UC7 A;  3EMX A;  3HZ8 A;  1XPV A;  2I3Y A;  1K0N A;  4PUA A;  1A0F A;  3KJY A;  1PMT A;  4I8B A;  2QA1 A;  2HSH A;  1ERU A;  3H1N A;  1SYX A;  1BYE A;  2PER A;  2MMO A;  3VK9 A;  1B4Q A;  1GTU A;  3DYR A;  3UVT A;  2XBQ A;  4MK3 A;  4ZBB A;  3IHG A;  2P31 A;  4NWY A;  6GSY A;  1AC1 A;  1BQ7 A;  3Q18 A;  1HD2 A;  3VWV A;  3UAR A;  3WD6 A;  3VI5 A;  4TR1 A;  2JL4 A;  4Z2R A;  5ECQ B;  2AV4 A;  4Z7X A;  6GSS A;  1OE7 A;  2WGR A;  2C3T A;  1ABA A;  1T7P B;  1SKW B;  3VI7 A;  4F2I A;  3QMX A;  4NHZ A;  1R5A A;  4XS4 B;  3C71 A;  4ML6 A;  5KN0 A;  2MMZ A;  3KTL A;  3VPT A;  3TKS C;  1B48 A;  4HI7 A;  4XRD A;  4MF6 A;  3LSZ A;  4FYC A;  3HKR A;  5IOX A;  2F9S A;  4AJ8 A;  2OAD A;  1OC9 A;  5DAL A;  1DSB A;  1EGO A;  2GLR A;  3IAM 2;  1JZW A;  1HNC A;  4IN0 A;  4HU7 A;  1ZL9 A;  2NVL A;  2B7J A;  1A23 A;  2X8C A;  2NDO A;  3WGX A;  2LS5 A;  1XWA A;  4MPF A;  5DJL A;  4CHS A;  3CSJ A;  5H5R A;  2N5A A;  4J57 E;  3QAW A;  2BMX A;  3VWX A;  1GUK A;  4D73 A;  3MYD A;  2AHE A;  4PQH A;  3GFK A;  1QUW A;  2XBI A;  3FW2 A;  4BVX B;  1JLV A;  3F8U A;  1TRS A;  4OD7 A;  3MWH A;  1O6J A;  2GZP A;  2GSR A;  4N0V A;  3PR8 A;  3E3E A;  3RPN A;  1FAA A;  4L5O A;  5G5F A;  4ACS A;  2DMM A;  7GSS A;  4G10 A;  3WGE A;  1QK8 A;  1Y6E A;  4LA1 A;  2A2R A;  3L0H A;  4TN8 A;  3RAZ A;  1BX9 A;  2FWH A;  2B5X A;  1SJI A;  3GL5 A;  2VCQ A;  3PPU A;  4I97 A;  1GTI A;  2PVQ A;  1AIU A;  2H72 A;  4FYB A;  3QPM A;  4JBB A;  3FR3 A;  5EL8 A;  1SD9 A;  3RBT A;  3IXR A;  1V9W A;  1U88 A;  3FEU A;  2VL2 A;  4BL7 A;  1EWX A;  2H01 A;  4LL1 B;  1N8J A;  2H0H A;  2K8V A;  2MMA A;  5B6M A;  4HU9 A;  1T4Y A;  3OR5 A;  4HZ4 A;  4ZL7 A;  2I9H A;  2R4V A;  3FZ5 A;  1N2A A;  4Q5F A;  3ZML A;  4CY6 A;  3BJ5 A;  4YAP A;  1B8X A;  5HFG A;  4KW6 A;  2WUL A;  1O81 A;  2V1M A;  2R5G A;  2JSY A;  4O5Q A;  1K3L A;  4JZQ A;  5EPF A;  4ZIJ A;  1S3R A;  1VF2 A;  3CRT A;  5AGY A;  5AN1 A;  3M1G A;  3O3T A;  4USS A;  1GWC A;  3Q19 A;  3UBK A;  2KOK A;  3BOA A;  2HRN A;  1TK5 B;  5CRW A;  4DSS B;  1PKW A;  4V2N A;  4PQ1 A;  2NPB A;  4OO5 A;  4ZB9 A;  14GS A;  4HQZ A;  5ECM B;  1PKZ A;  1ZCP A;  1M2D A;  3TUE A;  3VWW A;  2IMI A;  1HYU A;  2HRK A;  1Y25 A;  1Z9H A;  4XHM A;  4Q5R A;  2OA7 A;  3IC8 A;  3H4K A;  3KXO A;  1G0T A;  1K0A A;  2V2G A;  4ECC A;  3W6G A;  2IWT A;  1WWJ A;  5FHI A;  5KN3 A;  2VD0 A;  4XS1 A;  1M2B A;  1PGT A;  2LRT A;  1SKR B;  4RQR A;  4ZXG A;  2EIO A;  2RII A;  3FR9 A;  3GUS A;  1TU7 A;  1XXU A;  5ID2 A;  1J9B A;  1JZR A;  5CRH A;  3U5R E;  3TDG A;  4CW9 A;  20GS A;  2GT5 A;  4K1F A;  3PGT A;  1MDJ A;  3VPQ A;  2J23 A;  5CRG A;  2M80 A;  3FHK A;  1AAZ A;  2C4J A;  4ZB8 A;  3ZFL A;  2LJR A;  5F07 A;  2YZH A;  2E2G A;  2H70 A;  2DJ1 A;  4L0W A;  3E0U A;  1U3I A;  1OKD A;  3ED3 A;  2WS2 A;  4TR0 A;  1EZK A;  2LRN A;  3GN3 A;  4XCS A;  1R4W A;  2FD3 A;  4K2D A;  1XIY A;  1XOB A;  3C7M A;  1K0C A;  4HDE A;  3FRC A;  16GS A;  4KH7 A;  2YNX A;  4ZBA A;  2HSM A;  1A0R P;  2CVK A;  2IPA A;  2RUE A;  1YY7 A;  1G6Y A;  1T1V A;  2JZS A;  4PTS A;  1GUL A;  3IA1 A;  4O7H A;  2H6Z A;  4PUF C;  4POL A;  4POB A;  2WCI A;  1PRX A;  3MNG A;  5GST A;  4YQV A;  1U3A A;  2CT6 A;  4IBP A;  1M9B A;  2P0G A;  2YV9 A;  3KCM A;  3ZRD A;  2JSZ A;  1SL2 B;  1QFN A;  1VF3 A;  4EE0 A;  1MTC A;  2M72 A;  5CRD A;  4XIH A;  2H1D A;  1AUC A;  1Z5Y E;  3MIX A;  2YV7 A;  2VOC A;  3GIX A;  4MP4 A;  4MZC A;  2O89 A;  3D21 A;  4MCU A;  5AIV A;  3IOS A;  5BMU A;  13GS A;  2CZ3 A;  2XC2 A;  3A3T A;  1F2E A;  4EF0 A;  3CXG A;  4G0K A;  2LNT A;  4MJA A;  2YN1 A;  2F8A A;  2EIR A;  4L5L A;  1H4O A;  5DAK B;  4LL4 B;  4IW9 A;  4QL7 A;  3QAG A;  4V1A g;  4IQA A;  3O76 A;  2LQQ A;  4PXO A;  4N11 A;  3TKQ A;  1R26 A;  3CTF A;  2GQM A;  5J9C A;  3ZIJ A;  2E0Q A;  3ZVJ A;  4OFT A;  2GGT A;  3ME8 A;  2DBC A;  1J08 A;  3KEB A;  4K7I A;  1GNW A;  5CYY A;  2JZR A;  2FWG A;  4EVM A;  1F6M C;  4K8M A;  1H75 A;  1SJZ A;  4P3Y B;  4BWQ A;  4I6X A;  2B5E A;  5G1L A;  3KH7 A;  4A5P A;  1K3O A;  1X9W B;  4ZB6 A;  1YZX A;  1ZYQ B;  2MBS A;  1FB6 A;  3D0Z A;  4IEL A;  1TRW A;  1S3A A;  4EO3 A;  5B8A A;  2PWJ A;  5ECL B;  3GTU B;  4F03 A;  4FQU A;  3G7I A;  2NBS A;  5IMV A;  1TK8 B;  2PN8 A;  1T8E B;  2IMK A;  1KTE A;  3TB2 A;  3GKX A;  5F05 A;  3A5I A;  2R2J A;  3LXZ A;  5A4V A;  4I2T A;  2AJQ B;  2QA2 A;  3F6F A;  3FK8 A;  3EE2 A;  1XCC A;  3GYK A;  1URM A;  2ES7 A;  2V32 A;  2GZY A;  5KN2 A;  4NMU A;  3UIW A;  2C80 A;  2CX4 A;  2R0G A;  4G2E A;  3EU3 A;  1FW1 A;  2VD1 A;  1NHO A;  5FT3 A;  3LQ7 A;  2PPT A;  2PU9 C;  2LNS A;  1GSF A;  3IPZ A;  4PNG A;  1R7H A;  1DE2 A;  4O92 A;  1RW1 A;  5A4W A;  3I69 A;  2IMD A;  3EMP A;  4GSN A;  4GQF A;  3G7Y A;  3ERW A;  2DSA A;  2LV3 A;  4MLY A;  3HY2 A;  2I81 A;  3TKS A;  4ICY A;  3D4M A;  4JE1 A;  9GSS A;  4MAB A;  1F9M A;  3BD2 A;  3J7Y b;  2VLU A;  1W4V A;  5D73 A;  3EUR A;  3M9J A;  4MH3 A;  1V2A A;  5FWG A;  2O7K A;  2TRX A;  5DCH A;  2HZE B;  4ECJ A;  5B6N A;  2H6Y A;  2H1B A;  1E2Y A;  4XTS A;  4AGS A;  3GH6 A;  4TW5 A;  4XRA A;  1MEK A;  4MF5 A;  2CZ2 A;  2FA4 A;  1M99 A;  4GCI A;  2R0P A;  4OFN A;  1RK4 A;  2G2Q A;  4POM A;  4DEJ A;  3GST A;  3GA4 A;  17GS A;  4TXO A;  5LD0 A;  3GKN A;  3HJP A;  3SWL A;  4BWS A;  4HSC X;  3IDV A;  2YJ7 A;  3GSS A;  1PA3 A;  4BPY A;  1OKT A;  2F3M A;  5IPH A;  3GX0 A;  2KUC A;  5AIX A;  2BTO T;  3PIN A;  4KDU A;  2H19 A;  4CY8 A;  1PSQ A;  1FOH A;  2YAN A;  3UEM A;  3L4N A;  1JFU A;  4GST A;  4ILF A;  2VCZ A;  1TK0 B;  3M8N A;  2VAF A;  2DJK A;  4DVC A;  1SEN A;  4HOJ A;  4EL1 A;  1SKS B;  1BG5 A;  3KZQ A;  1X5C A;  2H1G A;  3QFA C;  2VLT A;  2KP1 A;  4F0B A;  4MMM A;  2GZZ A;  1SYR A;  4PNF A;  4OCE A;  1M2A A;  1WJK A;  1Z7P A;  1FO5 A;  3HXS A;  3TJG A;  2A4V A;  2YWM A;  1V57 A;  3G9B A;  5JWO B;  1V40 A;  1VF4 A;  2ZCT A;  4KF9 A;  4KAE A;  5GSS A;  1MD3 A;  2BJX A;  5CAX A;  3HDC A;  3IK9 A;  4ECI A;  5D93 A;  1YEX A;  4KSM A;  5IM9 A;  5ID2 B;  2WFC A;  1B9Y C;  2B3S A;  2LTK A;  1QGV A;  2CQ9 A;  5CRE A;  4E8H A;  3VLN A;  1GLQ A;  1PL1 A;  4GXZ A;  3P90 A;  3QCP A;  3QFB C;  4TXV A;  4O5R A;  4BIK A;  2GSQ A;  5GAP D;  2FCH A;  5EY6 A;  1K0B A;  1XWG A;  5ENU A;  4I5Q A;  1GSD A;  2GST A;  2ZNM A;  1S3C A;  3ZVJ D;  1GNE A;  1LBK A;  3C1R A;  2LEG A;  3DIE A;  3LFL A;  2IFQ B;  1A2M A;  4F0C A;  4LMV A;  5DQS A;  1XVQ A;  1ERW A;  3GL3 A;  3ZZX A;  1I9D A;  2H71 A;  1M3I A;  2X8G A;  3N5O A;  3IAS 2;  4EUY A;  4BVY B;  1F3A A;  2HNL A;  2E7P A;  5JCG A;  4ISD A;  4ID0 A;  4KCA A;  2V6O A;  4N30 A;  3Q74 A;  1J0F A;  4GWR A;  1I5G A;  3L9U A;  6GST A;  1KEB A;  1PX6 A;  4EC0 A;  2LJA A;  1YF0 A;  1TI3 A;  3DKS A;  5G31 A;  1G6W A;  3DWV A;  3F9U A;  1GSQ A;  5D8I A;  1EV4 A;  4WKW A;  2UZ8 A;  4JR4 A;  4XS4 A;  2OJL A;  4TVE A;  1K0M A;  3S9F A;  4IJI A;  6GSX A;  2H8L A;  4RI6 A;  3FZA A;  1Q4J A;  4E8E A;  2IL3 A;  3TJJ A;  1JZO A;  1V98 A;  2A2P A;  3IBH A;  2P5Q A;  4FIW A;  2WB9 A;  3UBL A;  1QMV A;  3NIV A;  3TOU A;  3RHC A;  3NOF A;  2H30 A;  5HFK A;  4LLR A;  4WF5 A;  1XW9 A;  2QC7 A;  3KD0 A;  2REM A;  1NHY A;  2DJJ A;  4GRF A;  4X4J A;  5J5N A;  1OYJ A;  1XFL A;  2HLS A;  2QSI A;  3GMF A;  1SJ6 A;  1YF1 A;  2J9H A;  3D4T A;  5DVB A;  1JZD A;  3BBY A;  3R3E A;  1GSY A;  4RQX A;  3HCZ A;  5J9B A;  1B9X C;  2L5L A;  4IKH A;  4YQM A;  2FY6 A;  2LJK A;  1BED A;  1EP7 A;  2VUP A;  2CVB A;  3IV4 A;  5IPG A;  1PD2 1;  4TKY A;  5JCW A;  3FZ4 A;  3C8E A;  1LJR A;  1HNB A;  3G7J A;  3IK7 A;  4K2X A;  4FO5 A;  3L9V A;  3I43 A;  3U6V A;  5ECK B;  4HQS A;  3CYN A;  2P5R A;  3L78 A;  3EWL A;  3IRA A;  4F82 A;  5JWQ B;  5KN1 A;  1DUG A;  2PMT A;  2GTU A;  2M46 A;  4Z2U A;  1WRY A;  3LJR A;  4X1U A;  4IQ1 A;  5KEJ A;  2YWI A;  5IMZ A;  5E4W A;  2HI7 A;  4O5U A;  4JU5 A;  2H76 A;  5KOX A;  4J2F A;  2H6X A;  1X5E A;  4HEA 2;  5GAN D;  1EEJ A;  1E6B A;  1OVN A;  2HSY A;  4EXJ A;  2C0D A;  3LYK A;  3UVH A;  1SL1 B;  5G2Z A;  2GQK A;  2X99 A;  5G5E A;  3DRN A;  1MDI A;  4LMW A;  2OE1 A;  1SL0 B;  4V2L A;  2VCW A;  3APO A;  3UOM A;  4Q5Q A;  5DBQ A;  2PVO C;  3IE3 A;  1JHB A;  1WP0 A;  2VLV A;  1XW5 A;  1U87 A;  4MF7 A;  4KE3 A;  4DSS A;  5ECS A;  1TXX A;  2JAC A;  3HVV A;  2B1K A;  5HQP A;  3N9J A;  4GF0 A;  3FZ9 A;  3GRX A;  3ZIV A;  5DCG A;  1ILO A;  1YEP A;  3LOR A;  2FUG 2;  2E2M A;  3NZN A;  2L6C A;  5ECH B;  1TU8 A;  3ZRE A;  5IIZ A;  5ECR B;  5D9V A;  5J4U A;  2L6D A;  1PL2 A;  1GLP A;  2JU5 A;  2VIM A;  1W89 A;  3P2A A;  5COH A;  2H66 A;  2KHP A;  4K0N A;  1XVW A;  3DML A;  3EIN A;  1A8L A;  3HVS A;  3APQ A;  3UL3 A;  1GSS A;  3LEF A;  1SD8 A;  4PQI A;  4Q5N A;  4WXT A;  4TR1 B;  5ECP B;  2I1U A;  3US3 A;  3LW9 A;  3HJM A;  3MDK A;  2FLS A;  4HJ2 A;  4RI7 A;  4GSS A;  3M0F A;  1X5D A;  5ABR A;  3H93 A;  1VRS D;  3DD3 A;  1AQV A;  1F37 A;  4FYU A;  4MZW A;  3CSH A;  2MMN A;  5HFI A;  2I4A A;  2EIQ A;  2VM2 A;  3P8W A;  5B7C A;  1LU4 A;  2DKH A;  3SBC A;  3TJK A;  1M7T A;  2HFD A;  5HR2 A;  1SK2 A;  4MNN A;  2D2Z A;  3LG6 A;  5F06 A;  3WT2 A;  2PGT A;  2QKE A;  3DXB A;  1OC9 B;  5DAL B;  3F3R A;  4WF4 A;  3TGZ A;  4TOP A;  2YP6 A;  2DJ2 A;  4K0G A;  3ZMK A;  1XWB A;  2R3X A;  4MJC A;  1OAZ A;  2A2S A;  4PUR A;  4MA9 A;  2C3Q A;  3W8S A;  3JCM L;  1A2J A;  5ELG A;  1TTZ A;  2RUF A;  4DSR A;  5B8B A;  4D73 B;  2C3N A;  1QXH A;  5CO3 A;  2IJY A;  3ZYW A;  5F0G A;  2L5O A;  1K3Y A;  2Z9S A;  5IO0 A;  1TDI A;  4NAX A;  2X64 A;  1GUM A;  2C0G A;  4WR5 A;  3ZTL A;  3WGD A;  1ON4 A;  2TRC P;  4K7O A;  3HVX A; 
#chains in the Genus database with same CATH homology
 3CBU A;  12GS A;  3HA9 A;  4AF2 A;  4QL9 A;  4WR4 A;  19GS A;  4AJ6 A;  1TOF A;  2OAC A;  5J3R A;  1ZYN A;  3KP8 A;  5DAK A;  3BCK A;  3ERG A;  3CSI A;  3P7X A;  1GTB A;  1EOH A;  4HS1 A;  5LNK e;  5F8B A;  2XPE A;  3L9S A;  5DJM A;  1TRV A;  2V6K A;  1ZYE A;  4J56 E;  5C04 A;  3GH9 A;  2GVP A;  4KSO A;  5LCZ A;  3RDW A;  4WBJ A;  2O85 A;  2HRF A;  3RHB A;  4BL7 B;  4IJ3 A;  1THX A;  2XHF A;  4EIQ A;  4IHU A;  5IMC A;  1GL8 A;  1DBY A;  3GNJ A;  2OE3 A;  1JLW A;  3QR6 A;  3VWU A;  4DSQ A;  4PX1 A;  2PBJ A;  1HQO A;  1PN0 A;  3ERF A;  1K0D A;  2OKA A;  1B4P A;  1KNG A;  3GV1 A;  1T4Z A;  4H86 A;  3W8J A;  2WDU A;  1ERV A;  3GKM A;  2XPD A;  3J7Y k;  3DEX A;  2H74 A;  4NHW A;  2DIY A;  4MDC A;  2HRA A;  2MBT A;  1AXD A;  4MPG A;  5INY A;  1Z3E A;  1PQN A;  3GTU A;  4KX4 A;  1A2L A;  1TP9 A;  3TJF A;  5BRT A;  5H5Q A;  1OC3 A;  2GT6 A;  2DC5 A;  4V2M A;  1WIK A;  5ECN B;  3A2X A;  2HE3 A;  2YZU A;  3KTB A;  5CNW A;  3TRP A;  2VO4 A;  4G0I A;  5IMA A;  4JRR A;  2YWN A;  3IHQ A;  5D9T A;  1T00 A;  2WZ9 A;  4I2U A;  1THO A;  1YJ6 A;  2TIR A;  3ISO A;  2L57 A;  2H0G A;  3FY7 A;  1YKA A;  1EEM A;  3MAK A;  3FMW A;  3C1S A;  5IOW A;  5L71 A;  1TKD B;  2AB6 A;  2HZF A;  1VF1 A;  3ZFB A;  4CDO A;  4TR3 A;  4ZL9 A;  4Z2T A;  4KDY A;  4OFM A;  3BCI A;  2CAQ A;  2C8U A;  2CX3 A;  5IO2 A;  2B6M A;  3HZ4 A;  5D96 A;  1FB0 A;  4X0X A;  2H0I A;  4OWY A;  4WBR D;  1SK0 A;  4BA7 A;  3F3Q A;  2FHE A;  3IR4 A;  2YOI A;  4POK A;  5HR0 A;  1X0R A;  3A5W A;  5J41 A;  1OE8 A;  3TRQ A;  4X43 A;  2HZE A;  4YH2 A;  1UA5 A;  3D22 A;  4KB3 A;  2RLI A;  3D5J A;  2ZUP A;  1O85 A;  2NTO A;  1R5P A;  5ELA A;  5G30 A;  1BJX A;  1SU9 A;  4YKF A;  4TR4 A;  1PX7 A;  5HR1 A;  3EYT A;  4IGJ A;  4YKG A;  6GSW A;  1RQM A;  3WYW A;  2K8S A;  4RUV A;  1VGL A;  4XS6 A;  5DDL A;  1PN9 A;  2FWE A;  2CAI A;  1X9M B;  1XZO A;  2LRC A;  3DGQ A;  4N10 A;  3I6A A;  3ME7 A;  2IN3 A;  1O73 A;  1CQH A;  1EV9 A;  3QDN A;  5EVO A;  1GTA A;  2PUK C;  2FGX A;  2H75 A;  1TI1 A;  2YJH A;  4K5S A;  4MZB A;  3EU4 A;  1XWK A;  2K6V A;  4JED A;  4PGT A;  2EC4 A;  2KLX A;  3KGK A;  1ST9 A;  2L4Q A;  3TKP A;  3K8N A;  1FVJ A;  2LKU A;  4EIP A;  2VCV A;  4K6X A;  1MD4 A;  3TKR A;  3EVI A;  3APS A;  5H5S A;  2VCT A;  2R6K A;  2OBI A;  4TRX A;  4OO4 A;  1WPI A;  3LWA A;  1WMJ A;  3TOT A;  2R37 A;  3QOU A;  1DE1 A;  1G7E A;  3R2Q A;  5A4U A;  1NM3 A;  3CTG A;  4K7N A;  2ON5 A;  2DKI A;  11GS A;  2HYX A;  1GSU A;  3FYG A;  4V1A p;  1HNA A;  1TJD A;  3TCO A;  2N5B A;  2VL2 C;  2AAW A;  3A2W A;  4GLT A;  4BVX A;  3VUR A;  1GSE A;  3UMA A;  1SK1 A;  2OE0 A;  2RM6 A;  3KM6 A;  1NSW A;  2CVD A;  3FR6 A;  3F0I A;  3VFI A;  2V41 A;  4G0L A;  2FWF A;  4ECB A;  22GS A;  5IQY A;  3LYP A;  2FNO A;  1WE0 A;  1ERT A;  3QAV A;  5D9W A;  1UN2 A;  2AYT A;  2JAD A;  4NV2 A;  3C73 A;  3F63 A;  2L59 A;  2IFQ A;  1AQX A;  1XBS A;  2VM1 A;  4L0U A;  3EC3 A;  3AY8 A;  2X49 A;  2B1L A;  5ECO B;  4BVY A;  1IYH A;  2IMF A;  2IIY A;  2LQO A;  4NV5 A;  3HYP A;  2HT9 A;  1XWC A;  1XOA A;  4JR6 A;  4ML1 A;  4K5R A;  3DVX A;  2VL9 A;  4FH8 A;  1ZOF A;  5JCU A;  1K0O A;  2CA8 A;  1OC8 A;  4MJB A;  4KGI A;  2L4C A;  3TRX A;  4KA0 A;  6GSV A;  2R0C A;  4IP6 A;  2AUV A;  2X8H A;  3QD9 A;  2DML A;  4ZBD A;  1Z6N A;  2HXK A;  3D6I A;  4OMV A;  1GUH A;  2GDR A;  2QGV A;  1CQG A;  1GRX A;  4WEY A;  3FKF A;  3ZL5 A;  4N0Z A;  2JZT A;  2YPM A;  2VCX A;  4KND A;  2X4A A;  2H73 A;  2WJU A;  3M9K A;  1USB A;  3GHA A;  1UVZ A;  5ECI B;  1BAY A;  1O8X A;  2K18 A;  3M3M A;  3TJB A;  4EDY A;  4EDZ A;  3UJ1 A;  1ZYP A;  3O6T A;  1O8W A;  1YKC A;  1MDK A;  1GH2 A;  2GQL A;  5CP1 A;  3KP9 A;  4IP1 A;  3GKK A;  4K9Z A;  2MYG A;  1T3B A;  3HHV A;  1FVK A;  8GSS A;  3LGC A;  2DIZ A;  1QQ2 A;  2B5Y A;  3CMI A;  3KIJ A;  3ZLP A;  3KMN A;  3RPP A;  1AW9 A;  1S3D A;  2F51 A;  1F3B A;  5AIS A;  3E9J B;  4ZL8 A;  2DLX A;  5KOW A;  2C0E A;  5D9X A;  1Q98 A;  4QQ7 A;  5HR3 A;  2G0F A;  1WOU A;  3V1W A;  4WET A;  1ZMA A;  3KMO A;  4IVF A;  1EP8 A;  1A24 A;  3ZIT A;  2ON7 A;  1TW9 A;  4GTU A;  2K9F A;  5IMF A;  1YDK A;  2OBK A;  2GSS A;  4TXO B;  1YQ1 A;  2O8V B;  1U6T A;  4KCE A;  1ACV A;  3IC4 A;  4MH2 A;  2FA8 A;  1Z6M A;  2YCD A;  3F4S A;  4HUA A;  4ULX A;  4EKZ A;  1FHE A;  2CV4 A;  3F4T A;  2MZC A;  6GSU A;  1X9S B;  1M9A A;  2GS3 A;  4L8E A;  5GZZ B;  5DQY A;  4AJ7 A;  2B7K A;  4YAV A;  1TRU A;  3UAP A;  1GP1 A;  4G19 A;  4MJE A;  5G1K A;  3H8Q A;  3KH9 A;  4O32 A;  1ZGN A;  2DJ3 A;  2IME A;  3HD5 A;  3CRU A;  1G7O A;  3H79 A;  1EGR A;  10GS A;  5JWR B;  5C00 A;  2LST A;  5E59 A;  1Z7R A;  4KUN A;  3DVW A;  1O7U A;  4HJM A;  2VL3 A;  1FG4 A;  1NW2 A;  3GUR A;  1EOG A;  2YWO A;  3A2V A;  1M0U A;  2RM5 A;  2H1A A;  3Q6O A;  5A5K A;  2A4H A;  2C1Y A;  3F6D A;  4NPB A;  2KP2 A;  3F4R A;  4HZ2 A;  4OCF A;  4G9H A;  3WT1 A;  4YQU A;  2F8F A;  4ZIL A;  4KDX A;  3LXT A;  3EPT A;  2O87 A;  1ML6 A;  1A8Y A;  4IS0 A;  2LUS A;  3GX8 A;  4NXI A;  1ZZY A;  3TKS E;  1IYI A;  5IMD A;  2DJ0 A;  2ALB A;  1AQW A;  2WRT A;  1V58 A;  3MSZ A;  1C72 A;  3PH9 A;  1XW6 A;  3HJO A;  1FOV A;  18GS A;  2C0F A;  2N5F A;  3I9V 2;  1KBN A;  4GQC A;  4F9Z A;  1UC7 A;  3EMX A;  3HZ8 A;  1XPV A;  2I3Y A;  1K0N A;  4PUA A;  1A0F A;  3KJY A;  1PMT A;  4I8B A;  2QA1 A;  2HSH A;  1ERU A;  3H1N A;  1SYX A;  1BYE A;  2PER A;  2MMO A;  3VK9 A;  1B4Q A;  1GTU A;  3DYR A;  3UVT A;  2XBQ A;  4MK3 A;  4ZBB A;  3IHG A;  2P31 A;  4NWY A;  6GSY A;  1AC1 A;  1BQ7 A;  3Q18 A;  1HD2 A;  3VWV A;  3UAR A;  3WD6 A;  3VI5 A;  4TR1 A;  2JL4 A;  4Z2R A;  5ECQ B;  2AV4 A;  4Z7X A;  6GSS A;  1OE7 A;  2WGR A;  2C3T A;  1ABA A;  1T7P B;  1SKW B;  3VI7 A;  4F2I A;  3QMX A;  4NHZ A;  1R5A A;  4XS4 B;  3C71 A;  4ML6 A;  5KN0 A;  2MMZ A;  3KTL A;  3VPT A;  3TKS C;  1B48 A;  4HI7 A;  4XRD A;  4MF6 A;  3LSZ A;  4FYC A;  3HKR A;  5IOX A;  2F9S A;  4AJ8 A;  2OAD A;  1OC9 A;  5DAL A;  1DSB A;  1EGO A;  2GLR A;  3IAM 2;  1JZW A;  1HNC A;  4IN0 A;  4HU7 A;  1ZL9 A;  2NVL A;  2B7J A;  1A23 A;  2X8C A;  2NDO A;  3WGX A;  2LS5 A;  1XWA A;  4MPF A;  5DJL A;  4CHS A;  3CSJ A;  5H5R A;  2N5A A;  4J57 E;  3QAW A;  2BMX A;  3VWX A;  1GUK A;  4D73 A;  3MYD A;  2AHE A;  4PQH A;  3GFK A;  1QUW A;  2XBI A;  3FW2 A;  4BVX B;  1JLV A;  3F8U A;  1TRS A;  4OD7 A;  3MWH A;  1O6J A;  2GZP A;  2GSR A;  4N0V A;  3PR8 A;  3E3E A;  3RPN A;  1FAA A;  4L5O A;  5G5F A;  4ACS A;  2DMM A;  7GSS A;  4G10 A;  3WGE A;  1QK8 A;  1Y6E A;  4LA1 A;  2A2R A;  3L0H A;  4TN8 A;  3RAZ A;  1BX9 A;  2FWH A;  2B5X A;  1SJI A;  3GL5 A;  2VCQ A;  3PPU A;  4I97 A;  1GTI A;  2PVQ A;  1AIU A;  2H72 A;  4FYB A;  3QPM A;  4JBB A;  3FR3 A;  5EL8 A;  1SD9 A;  3RBT A;  3IXR A;  1V9W A;  1U88 A;  3FEU A;  2VL2 A;  4BL7 A;  1EWX A;  2H01 A;  4LL1 B;  1N8J A;  2H0H A;  2K8V A;  2MMA A;  5B6M A;  4HU9 A;  1T4Y A;  3OR5 A;  4HZ4 A;  4ZL7 A;  2I9H A;  2R4V A;  3FZ5 A;  1N2A A;  4Q5F A;  3ZML A;  4CY6 A;  3BJ5 A;  4YAP A;  1B8X A;  5HFG A;  4KW6 A;  2WUL A;  1O81 A;  2V1M A;  2R5G A;  2JSY A;  4O5Q A;  1K3L A;  4JZQ A;  5EPF A;  4ZIJ A;  1VF2 A;  3CRT A;  5AGY A;  5AN1 A;  3M1G A;  3O3T A;  4USS A;  1GWC A;  3Q19 A;  3UBK A;  2KOK A;  3BOA A;  2HRN A;  1TK5 B;  5CRW A;  4DSS B;  1PKW A;  4V2N A;  4PQ1 A;  2NPB A;  4OO5 A;  4ZB9 A;  14GS A;  4HQZ A;  5ECM B;  1PKZ A;  1ZCP A;  1M2D A;  3TUE A;  3VWW A;  2IMI A;  1HYU A;  2HRK A;  1Y25 A;  1Z9H A;  4XHM A;  4Q5R A;  2OA7 A;  3IC8 A;  3H4K A;  3KXO A;  1G0T A;  1K0A A;  2V2G A;  4ECC A;  3W6G A;  2IWT A;  1WWJ A;  5FHI A;  5KN3 A;  2VD0 A;  4XS1 A;  1M2B A;  1PGT A;  2LRT A;  1SKR B;  4RQR A;  4ZXG A;  2EIO A;  2RII A;  3FR9 A;  3GUS A;  1TU7 A;  1XXU A;  5ID2 A;  1J9B A;  1JZR A;  5CRH A;  3U5R E;  3TDG A;  4CW9 A;  20GS A;  2GT5 A;  4K1F A;  3PGT A;  1MDJ A;  3VPQ A;  2J23 A;  5CRG A;  2M80 A;  3FHK A;  1AAZ A;  2C4J A;  4ZB8 A;  3ZFL A;  2LJR A;  5F07 A;  2YZH A;  2E2G A;  2H70 A;  2DJ1 A;  4L0W A;  3E0U A;  1U3I A;  1OKD A;  3ED3 A;  2WS2 A;  4TR0 A;  1EZK A;  2LRN A;  3GN3 A;  4XCS A;  1R4W A;  2FD3 A;  4K2D A;  1XIY A;  1XOB A;  3C7M A;  1K0C A;  4HDE A;  3FRC A;  16GS A;  4KH7 A;  2YNX A;  4ZBA A;  2HSM A;  1A0R P;  2CVK A;  2IPA A;  2RUE A;  1YY7 A;  1G6Y A;  1T1V A;  2JZS A;  4PTS A;  1GUL A;  3IA1 A;  4O7H A;  2H6Z A;  4PUF C;  4POL A;  4POB A;  2WCI A;  1PRX A;  3MNG A;  5GST A;  4YQV A;  1U3A A;  2CT6 A;  4IBP A;  1M9B A;  2P0G A;  2YV9 A;  3KCM A;  3ZRD A;  2JSZ A;  1SL2 B;  1QFN A;  1VF3 A;  4EE0 A;  1MTC A;  2M72 A;  5CRD A;  4XIH A;  2H1D A;  1AUC A;  1Z5Y E;  3MIX A;  2YV7 A;  2VOC A;  3GIX A;  4MP4 A;  4MZC A;  2O89 A;  3D21 A;  4MCU A;  5AIV A;  3IOS A;  5BMU A;  13GS A;  2CZ3 A;  2XC2 A;  3A3T A;  1F2E A;  4EF0 A;  3CXG A;  4G0K A;  2LNT A;  4MJA A;  2YN1 A;  2F8A A;  2EIR A;  4L5L A;  1H4O A;  5DAK B;  4LL4 B;  4IW9 A;  4QL7 A;  3QAG A;  4V1A g;  4IQA A;  3O76 A;  2LQQ A;  4PXO A;  4N11 A;  3TKQ A;  1R26 A;  3CTF A;  2GQM A;  5J9C A;  3ZIJ A;  2E0Q A;  3ZVJ A;  4OFT A;  2GGT A;  3ME8 A;  2DBC A;  1J08 A;  3KEB A;  4K7I A;  1GNW A;  5CYY A;  2JZR A;  2FWG A;  4EVM A;  1F6M C;  4K8M A;  1H75 A;  1SJZ A;  4P3Y B;  4BWQ A;  4I6X A;  2B5E A;  5G1L A;  3KH7 A;  4A5P A;  1K3O A;  1X9W B;  4ZB6 A;  1YZX A;  1ZYQ B;  2MBS A;  1FB6 A;  3D0Z A;  4IEL A;  1TRW A;  1S3A A;  4EO3 A;  5B8A A;  2PWJ A;  5ECL B;  3GTU B;  4F03 A;  4FQU A;  3G7I A;  2NBS A;  5IMV A;  1TK8 B;  2PN8 A;  1T8E B;  2IMK A;  1KTE A;  3TB2 A;  3GKX A;  5F05 A;  3A5I A;  2R2J A;  3LXZ A;  5A4V A;  4I2T A;  2AJQ B;  2QA2 A;  3F6F A;  3FK8 A;  3EE2 A;  1XCC A;  3GYK A;  1URM A;  2ES7 A;  2V32 A;  2GZY A;  5KN2 A;  4NMU A;  3UIW A;  2C80 A;  2CX4 A;  2R0G A;  4G2E A;  3EU3 A;  1FW1 A;  2VD1 A;  1NHO A;  5FT3 A;  3LQ7 A;  2PPT A;  2PU9 C;  2LNS A;  1GSF A;  3IPZ A;  4PNG A;  1R7H A;  1DE2 A;  4O92 A;  1RW1 A;  5A4W A;  3I69 A;  2IMD A;  3EMP A;  4GSN A;  4GQF A;  3G7Y A;  3ERW A;  2DSA A;  2LV3 A;  4MLY A;  3HY2 A;  2I81 A;  3TKS A;  4ICY A;  3D4M A;  4JE1 A;  9GSS A;  4MAB A;  1F9M A;  3BD2 A;  3J7Y b;  2VLU A;  1W4V A;  5D73 A;  3EUR A;  3M9J A;  4MH3 A;  1V2A A;  5FWG A;  2O7K A;  2TRX A;  5DCH A;  2HZE B;  4ECJ A;  5B6N A;  2H6Y A;  2H1B A;  1E2Y A;  4XTS A;  4AGS A;  3GH6 A;  4TW5 A;  4XRA A;  1MEK A;  4MF5 A;  2CZ2 A;  2FA4 A;  1M99 A;  4GCI A;  2R0P A;  4OFN A;  1RK4 A;  2G2Q A;  4POM A;  4DEJ A;  3GST A;  3GA4 A;  17GS A;  4TXO A;  5LD0 A;  3GKN A;  3HJP A;  3SWL A;  4BWS A;  3IDV A;  2YJ7 A;  3GSS A;  1PA3 A;  4BPY A;  1OKT A;  2F3M A;  5IPH A;  3GX0 A;  2KUC A;  5AIX A;  2BTO T;  3PIN A;  4KDU A;  2H19 A;  4CY8 A;  1PSQ A;  1FOH A;  2YAN A;  3UEM A;  3L4N A;  1JFU A;  4GST A;  4ILF A;  2VCZ A;  1TK0 B;  3M8N A;  2VAF A;  2DJK A;  4DVC A;  1SEN A;  4HOJ A;  4EL1 A;  1SKS B;  1BG5 A;  3KZQ A;  1X5C A;  2H1G A;  3QFA C;  2VLT A;  2KP1 A;  4F0B A;  4MMM A;  2GZZ A;  1SYR A;  4PNF A;  4OCE A;  1M2A A;  1WJK A;  1Z7P A;  1FO5 A;  3HXS A;  3TJG A;  2A4V A;  2YWM A;  1V57 A;  3G9B A;  5JWO B;  1V40 A;  1VF4 A;  2ZCT A;  4KF9 A;  4KAE A;  5GSS A;  1MD3 A;  2BJX A;  5CAX A;  3HDC A;  3IK9 A;  4ECI A;  5D93 A;  1YEX A;  4KSM A;  5IM9 A;  5ID2 B;  2WFC A;  1B9Y C;  2B3S A;  2LTK A;  1QGV A;  2CQ9 A;  5CRE A;  4E8H A;  3VLN A;  1GLQ A;  1PL1 A;  4GXZ A;  3P90 A;  3QCP A;  3QFB C;  4TXV A;  4O5R A;  2GSQ A;  5GAP D;  2FCH A;  5EY6 A;  1K0B A;  1XWG A;  5ENU A;  4I5Q A;  1GSD A;  2GST A;  2ZNM A;  1S3C A;  3ZVJ D;  1GNE A;  1LBK A;  3C1R A;  2LEG A;  3DIE A;  3LFL A;  2IFQ B;  1A2M A;  4F0C A;  4LMV A;  5DQS A;  1XVQ A;  1ERW A;  3GL3 A;  3ZZX A;  1I9D A;  2H71 A;  2X8G A;  3N5O A;  4EUY A;  3IAS 2;  4BVY B;  1F3A A;  2HNL A;  2E7P A;  5JCG A;  4ISD A;  4ID0 A;  4KCA A;  2V6O A;  4N30 A;  3Q74 A;  1J0F A;  4GWR A;  1I5G A;  3L9U A;  6GST A;  1KEB A;  1PX6 A;  4EC0 A;  2LJA A;  1YF0 A;  1TI3 A;  3DKS A;  5G31 A;  1G6W A;  3DWV A;  3F9U A;  1GSQ A;  5D8I A;  1EV4 A;  4WKW A;  2UZ8 A;  4JR4 A;  4XS4 A;  2OJL A;  4TVE A;  1K0M A;  3S9F A;  4IJI A;  6GSX A;  2H8L A;  4RI6 A;  3FZA A;  1Q4J A;  4E8E A;  2IL3 A;  3TJJ A;  1JZO A;  1V98 A;  2A2P A;  3IBH A;  2P5Q A;  4FIW A;  2WB9 A;  3UBL A;  1QMV A;  3NIV A;  3TOU A;  3RHC A;  3NOF A;  2H30 A;  5HFK A;  4LLR A;  4WF5 A;  1XW9 A;  2QC7 A;  3KD0 A;  2REM A;  1NHY A;  2DJJ A;  4GRF A;  4X4J A;  5J5N A;  1OYJ A;  1XFL A;  2HLS A;  2QSI A;  3GMF A;  1SJ6 A;  1YF1 A;  2J9H A;  3D4T A;  5DVB A;  1JZD A;  3BBY A;  3R3E A;  1GSY A;  4RQX A;  3HCZ A;  5J9B A;  1B9X C;  2L5L A;  4IKH A;  4YQM A;  2FY6 A;  2LJK A;  1BED A;  1EP7 A;  2VUP A;  2CVB A;  3IV4 A;  5IPG A;  1PD2 1;  4TKY A;  5JCW A;  3FZ4 A;  3C8E A;  1LJR A;  1HNB A;  3G7J A;  3IK7 A;  4K2X A;  4FO5 A;  3L9V A;  3I43 A;  3U6V A;  5ECK B;  4HQS A;  3CYN A;  2P5R A;  3L78 A;  3EWL A;  3IRA A;  4F82 A;  5JWQ B;  5KN1 A;  1DUG A;  2PMT A;  2GTU A;  2M46 A;  4Z2U A;  1WRY A;  3LJR A;  4X1U A;  4IQ1 A;  5KEJ A;  2YWI A;  5IMZ A;  5E4W A;  2HI7 A;  4O5U A;  4JU5 A;  2H76 A;  5KOX A;  4J2F A;  2H6X A;  1X5E A;  4HEA 2;  5GAN D;  1EEJ A;  1E6B A;  1OVN A;  2HSY A;  4EXJ A;  2C0D A;  3LYK A;  3UVH A;  1SL1 B;  5G2Z A;  2GQK A;  2X99 A;  5G5E A;  3DRN A;  1MDI A;  4LMW A;  2OE1 A;  1SL0 B;  4V2L A;  2VCW A;  3APO A;  3UOM A;  4Q5Q A;  5DBQ A;  2PVO C;  3IE3 A;  1JHB A;  1WP0 A;  2VLV A;  1XW5 A;  1U87 A;  4MF7 A;  4KE3 A;  4DSS A;  5ECS A;  1TXX A;  2JAC A;  3HVV A;  2B1K A;  5HQP A;  3N9J A;  4GF0 A;  3FZ9 A;  3GRX A;  3ZIV A;  5DCG A;  1ILO A;  1YEP A;  3LOR A;  2FUG 2;  2E2M A;  3NZN A;  2L6C A;  5ECH B;  1TU8 A;  3ZRE A;  5IIZ A;  5ECR B;  5D9V A;  5J4U A;  2L6D A;  1PL2 A;  1GLP A;  2JU5 A;  2VIM A;  1W89 A;  3P2A A;  5COH A;  2H66 A;  2KHP A;  4K0N A;  1XVW A;  3DML A;  3EIN A;  1A8L A;  3HVS A;  3APQ A;  3UL3 A;  1GSS A;  3LEF A;  1SD8 A;  4PQI A;  4Q5N A;  4WXT A;  4TR1 B;  5ECP B;  2I1U A;  3US3 A;  3LW9 A;  3HJM A;  3MDK A;  2FLS A;  4HJ2 A;  4RI7 A;  4GSS A;  3M0F A;  1X5D A;  5ABR A;  3H93 A;  1VRS D;  3DD3 A;  1AQV A;  1F37 A;  4FYU A;  4MZW A;  3CSH A;  2MMN A;  5HFI A;  2I4A A;  2EIQ A;  2VM2 A;  3P8W A;  5B7C A;  1LU4 A;  2DKH A;  3SBC A;  3TJK A;  1M7T A;  2HFD A;  5HR2 A;  1SK2 A;  4MNN A;  2D2Z A;  3LG6 A;  5F06 A;  3WT2 A;  2PGT A;  2QKE A;  3DXB A;  1OC9 B;  5DAL B;  3F3R A;  4WF4 A;  3TGZ A;  4TOP A;  2YP6 A;  2DJ2 A;  4K0G A;  3ZMK A;  1XWB A;  2R3X A;  4MJC A;  1OAZ A;  2A2S A;  4PUR A;  4MA9 A;  2C3Q A;  3W8S A;  3JCM L;  1A2J A;  5ELG A;  1TTZ A;  2RUF A;  4DSR A;  5B8B A;  4D73 B;  2C3N A;  1QXH A;  5CO3 A;  2IJY A;  3ZYW A;  5F0G A;  2L5O A;  1K3Y A;  2Z9S A;  5IO0 A;  1TDI A;  4NAX A;  2X64 A;  1GUM A;  2C0G A;  4WR5 A;  3ZTL A;  3WGD A;  1ON4 A;  2TRC P;  4K7O A;  3HVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...