4KW6A

Crystal structure of peroxiredoxin-1 (c-terminal truncation mutant) from the human hookworm ancylostoma ceylanicum bound to conoidin a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
172
structure length
172
Chain Sequence
HMSKAFIGKPAPDFATKAVFDGDFVDVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRFPEFKNLNVAVLACSTDSVFSHLAWINTPRKHGGLGDMKIPVLADTNHQIAKDYGVLKDDEGIAYRGLFIIDPKGILRQITINDLPVGRSVDETLRLVQAFQYTDKHGEVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Peroxiredoxin-1
publication title Peroxiredoxin-1 from the Human Hookworm Ancylostoma ceylanicum Forms a Stable Oxidized Decamer and Is Covalently Inhibited by Conoidin A.
pubmed doi rcsb
source organism Ancylostoma ceylanicum
total genus 52
structure length 172
sequence length 172
chains with identical sequence B, C, D, E
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2013-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4kw6A00
1KBNA 1ZL9A 2RM5A 1ERWA 1X9WB 2CAQA 3ZIJA 2YJ7A 3L9UA 3ERGA 1TRVA 3BJ5A 3HVSA 2L5OA 2FA8A 1AXDA 4ECCA 2JADA 2B6MA 4NMUA 3KIJA 4O7HA 5LNKe 2VL2C 1S3CA 4FYCA 2F9SA 2CAIA 5FHIA 4LLRA 3IRAA 5H5SA 3J7Yk 1ZYEA 1EWXA 1XWBA 4PQIA 3ERWA 1SENA 3N9JA 2YWMA 4ILFA 3P8WA 3QD9A 2ZNMA 2YWOA 1OC9A 3C7MA 2LRNA 2GLRA 1M0UA 3GTUB 4PGTA 3ZRDA 4ZL7A 2NBSA 2EIOA 2N5BA 1PN9A 1BYEA 2VM1A 3LG6A 1ML6A 5F07A 3GNJA 1T8EB 1V57A 4MPFA 1MD3A 3HJMA 3M3MA 5CRHA 4NWYA 1M7TA 3MDKA 4F0BA 2O8VB 4ECBA 5IMAA 2HSHA 1YJ6A 4EC0A 1AQVA 4MJBA 2R5GA 3KM6A 1K0DA 4IJ3A 4ECIA 1XWKA 3HZ4A 3FZ5A 1GP1A 2LKUA 1FOVA 3LYKA 1Z7PA 3IV4A 1SL2B 2GGTA 3SWLA 3TB2A 1ERVA 2RLIA 5LCZA 2DJ2A 1Z3EA 4F2IA 1A0FA 3TRPA 3IHQA 1O8XA 1PD21 3GSSA 1SKSB 2DLXA 4MF5A 4ULXA 3QFAC 5H5QA 1GUMA 1TK5B 1ILOA 2P31A 2C4JA 1G0TA 3CYNA 4ML6A 5G2ZA 3TOTA 1URMA 5L71A 2REMA 2IWTA 2GZPA 3UVHA 3GKMA 5D9TA 2HI7A 1BAYA 2AJQB 4ZILA 1WMJA 4FH8A 5J41A 3RPPA 2MYGA 1T3BA 1WWJA 4QL9A 3F9UA 4WKWA 3ME7A 3F0IA 1GSUA 2L57A 2YWNA 2OE0A 3DWVA 1MDKA 1O85A 3DD3A 4LMWA 1GSFA 1J0FA 4MJEA 1HNAA 4WBJA 3KGKA 1Z6MA 4TR0A 2P5QA 3EU3A 5DAKB 2PPTA 3KEBA 1XW6A 1F6MC 1U6TA 3W8SA 4F03A 2C0DA 1QFNA 1KNGA 4KB3A 3HY2A 1YY7A 6GSXA 1TK8B 2LJKA 1AAZA 3A5WA 1ON4A 4N0VA 4LMVA 1AQWA 4TRXA 2CVBA 2AV4A 4GSTA 3TKQA 4JU5A 4HOJA 4KCAA 5ECHB 5J9CA 2X8HA 2PMTA 2H1DA 2L4CA 4MF6A 2NVLA 2R37A 2TIRA 4KDYA 8GSSA 1XWAA 1TOFA 3QCPA 3W6GA 1TJDA 2CX3A 2YOIA 2V1MA 4EDYA 3BCIA 4DSRA 3VWWA 1GNEA 4Z7XA 4NAXA 3KH9A 3C8EA 4HDEA 1QMVA 3IAM2 4I8BA 1WE0A 3ZFBA 3ZTLA 4J57E 5CYYA 2WFCA 3Q74A 4WR5A 5G5FA 1Z5YE 3TKSA 2JZRA 5D9VA 2HE3A 1GLQA 4IELA 2YWIA 5B8AA 1XOBA 3ZYWA 2WCIA 2CZ2A 4K8MA 4OFTA 3CMIA 4Q5QA 3EU4A 3GKXA 3GSTA 5DALB 2MBSA 1G6WA 1NHOA 4H86A 4IBPA 2GQMA 3HZ8A 2H74A 4V1Ap 2IMEA 1MDIA 4GCIA 4JRRA 4IN0A 5IM9A 2A4VA 3TJFA 1OAZA 1T00A 5HR3A 2E2MA 1DUGA 5D9XA 2O7KA 4HUAA 2HXKA 4RQXA 4MH3A 5D9WA 4HS1A 1UA5A 1QK8A 2E0QA 4POMA 4EDZA 4ML1A 1BQ7A 5B8BA 2C3TA 2YZUA 1RQMA 2HLSA 1DBYA 4PXOA 3FR6A 2CV4A 3GN3A 3MWHA 2H71A 4I2TA 1EP8A 4V2MA 3NIVA 1JZWA 1IYIA 4G10A 4OFNA 1I9DA 1JZOA 1OYJA 4NHZA 2V2GA 1G6YA 1UN2A 4MZCA 3D4TA 3GX8A 3UAPA 3SBCA 2J9HA 2P5RA 3O76A 3TJBA 4PNFA 4LL4B 3QOUA 4YQUA 2VUPA 1Q98A 4TXVA 4E8EA 2HZFA 2CA8A 2M72A 4WF4A 1JZDA 5A4WA 3BBYA 1CQGA 3EMXA 3M0FA 6GSUA 1SJZA 1GULA 5HQPA 2GT6A 3GA4A 1FB0A 3F4TA 2KHPA 1XVWA 1E6BA 3TJJA 1F2EA 4PQ1A 2FNOA 1FHEA 2WS2A 4G19A 3UARA 3PR8A 5IMFA 3CTGA 2TRCP 3RPNA 1EZKA 2B5YA 3VK9A 4DVCA 5GSSA 3L0HA 1X5EA 3LEFA 5B7CA 3E0UA 1K0BA 2OE3A 1XW9A 5KN3A 2VCWA 1ACVA 1OKDA 2VL2A 2F51A 2H66A 2VCQA 1SYXA 2LS5A 3HVXA 1THOA 1VF2A 1ZOFA 1SKRB 2B7JA 4OD7A 4HEA2 4JR6A 2KP2A 5HR0A 6GSSA 2FWGA 4TR3A 3VWVA 2OKAA 3DMLA 3A3TA 4MPGA 1ZGNA 2B1LA 1VGLA 3CSHA 1TTZA 5JCGA 2GVPA 1QQ2A 4IKHA 2GSTA 4TN8A 2MBTA 1PRXA 1SK1A 3PH9A 4QQ7A 5G1LA 3CTFA 1V40A 5IPGA 1V2AA 2PUKC 1A0RP 4ZXGA 2LNTA 3D21A 2H73A 4F9ZA 1A23A 4HJMA 3EINA 2PN8A 2M46A 4GXZA 4IP1A 4GRFA 3WT2A 2YPMA 1B4QA 2RM6A 2C3NA 4YAVA 1EP7A 2GZZA 1R26A 3JCML 1AW9A 2B5XA 5J5NA 3LXTA 5HFGA 5AIXA 1SKWB 2JSZA 5KN2A 1EV4A 4I2UA 4JBBA 4XRAA 2LQQA 5J9BA 2YNXA 4PURA 5DBQA 1IYHA 5CAXA 2DSAA 4FIWA 1MDJA 5CRWA 3MSZA 5B6MA 1JZRA 1S3DA 1T4YA 1BJXA 4ACSA 1FB6A 4X43A 2H6ZA 3D6IA 5DCGA 4P3YB 5DJMA 5DVBA 2GSRA 1T7PB 2NDOA 2WGRA 3P2AA 3TKRA 3VPTA 2B7KA 2O87A 2RUEA 4BA7A 4KSMA 2L4QA 4PNGA 2VLVA 11GSA 4LL1B 4Q5NA 3O6TA 4BVXA 4WF5A 1HNBA 2H8LA 1NW2A 4EUYA 1K0AA 3L78A 1T1VA 1EEJA 3C1RA 1E2YA 1VRSD 5B6NA 3UL3A 4TVEA 1O6JA 2LRTA 4XTSA 2QC7A 4MCUA 2V32A 3DRNA 3OR5A 2HZEA 2I3YA 1SK2A 4O32A 2N5AA 1OVNA 5G30A 1YZXA 2HSYA 2GQLA 2CX4A 2VCXA 4IGJA 2YCDA 2DIYA 1J08A 3AY8A 5JCUA 5CNWA 4K1FA 5DAKA 4V2NA 4K7OA 2WB9A 1GUHA 2GT5A 1GTAA 1SJ6A 1CQHA 2DJ3A 2VCZA 2BTOT 4IJIA 1Y6EA 3VI7A 3F8UA 3ZZXA 5KEJA 3GL5A 4JEDA 2QSIA 4GTUA 5C04A 3ZREA 7GSSA 3FZ4A 4JE1A 3HCZA 4BPYA 3CSIA 1UC7A 1MEKA 3APSA 5IMZA 5E4WA 3KP9A 2K18A 4V1Ag 5CRGA 4N30A 1U87A 4V2LA 4YQMA 2MMOA 1M9AA 4X0XA 1O7UA 2B3SA 4QL7A 5D73A 3QAWA 2H19A 1GTIA 2ZCTA 2XHFA 1JLVA 4L5LA 1X0RA 3IPZA 3WD6A 3GH9A 5IO2A 2CT6A 2LJAA 2RUFA 5J3RA 2JZTA 3ZMKA 2JSYA 2I1UA 5JCWA 3KP8A 3L9VA 4HZ4A 4TKYA 1XFLA 2DMMA 2XPDA 3HKRA 3ZLPA 1ERTA 1B9YC 14GSA 1TRUA 2C8UA 2FA4A 2PERA 5DDLA 3RAZA 4NV2A 1A2MA 2HRNA 2VD1A 3QFBC 4AJ7A 4DSSB 3DVXA 2LUSA 1JHBA 4TR1A 4IVFA 2HZEB 2VIMA 4PUAA 3HJPA 2KP1A 1TI3A 1VF4A 5DALA 2XBIA 3R2QA 1BEDA 2D2ZA 3HXSA 2LSTA 9GSSA 4PUFC 5JWOB 3IE3A 3QMXA 4IQAA 1GSSA 2JU5A 6GSTA 3M9JA 1K0NA 3FY7A 1G7EA 3D22A 1AQXA 5EY6A 3TJKA 1DE1A 5IOXA 3GRXA 2N5FA 3GKKA 4WBRD 2XC2A 1F3BA 1PGTA 5HFKA 3IK7A 3F63A 4MK3A 3UBKA 2IN3A 4KH7A 3GV1A 3WGXA 2YN1A 2IL3A 4RQRA 4K0NA 1Z6NA 2V6OA 1GRXA 1V9WA 5KN1A 2IMIA 1PMTA 1ZCPA 4XS4A 4XS6A 4KNDA 4L0WA 2IIYA 3VPQA 2AHEA 3IOSA 3M1GA 2K8VA 1S3AA 1FVKA 4K7IA 1YDKA 2ZUPA 4KDXA 4ZB8A 4TXOA 1KTEA 3GL3A 2OBKA 2X8GA 1TP9A 4FO5A 1J9BA 3KZQA 2NTOA 4MF7A 4KA0A 1U3AA 1K3LA 3DXBA 1JFUA 1NM3A 4HU7A 4TR1B 2H1GA 2I9HA 3LWAA 1OE7A 2IMKA 1XVQA 1XWGA 5ID2B 3FKFA 3TCOA 2EC4A 3I6AA 4YAPA 3UIWA 4HZ2A 1ZMAA 2CVDA 2KLXA 4KCEA 2VCTA 2OJLA 4I5QA 3DYRA 1OC3A 4L5OA 4IHUA 2BMXA 4MLYA 3EWLA 1V58A 1PL1A 2C0EA 2YZHA 3C1SA 2OADA 3P7XA 19GSA 1FO5A 3WGEA 4GSNA 1XWCA 4MMMA 1EEMA 2H72A 4MDCA 5JWQB 2PVQA 3GFKA 3F3QA 1A2LA 4OO5A 1PSQA 1ABAA 1I5GA 5A5KA 2E7PA 2KOKA 3MNGA 3A2XA 3ERFA 4WETA 2V6KA 2L6CA 1YQ1A 1XOAA 4BWSA 1WP0A 4DEJA 4EVMA 4AF2A 2DJ1A 2MMAA 3ED3A 4XS4B 5ECSA 1HD2A 1B4PA 4O5RA 4PX1A 5EPFA 1SJIA 1TU7A 4L8EA 4TXOB 3LJRA 4I6XA 1XXUA 1FG4A 1ERUA 2ES7A 3HVVA 1H4OA 2G0FA 1WPIA 4KGIA 3TUEA 16GSA 2H30A 2X99A 2FHEA 2WJUA 3FRCA 3LSZA 2Z9SA 3IC4A 1YKAA 5IMDA 1TU8A 3APQA 3GIXA 1TRWA 4BL7A 2L59A 4WR4A 2L5LA 5D8IA 2B5EA 1NHYA 3DVWA 2DC5A 3GH6A 4XCSA 3PGTA 3K8NA 1Z9HA 2IJYA 5CP1A 4ISDA 1PL2A 3VLNA 1XCCA 5ELGA 3F6FA 3VURA 5EL8A 1RW1A 1USBA 5ECQB 4F0CA 2DMLA 3RHCA 2RIIA 4POKA 4GWRA 3ZL5A 5IPHA 4IS0A 4IQ1A 3VFIA 1GUKA 3FW2A 1ZYQB 3O3TA 5INYA 2VAFA 2PU9C 3HJOA 4ZB6A 1SK0A 2F8FA 1B48A 4E8HA 5EVOA 3H93A 2DBCA 2MMZA 2H70A 1XIYA 1Y25A 3S9FA 5ECPB 4I97A 2FCHA 1U88A 1KEBA 1PQNA 3NZNA 2LQOA 2CZ3A 5GZZB 3DKSA 2WRTA 1SD9A 2ON7A 1PX6A 2H76A 1A8LA 3IAS2 1MD4A 4ZL8A 5G5EA 2I4AA 1K0CA 3ZMLA 1DSBA 2YJHA 2BJXA 5IOWA 5FT3A 1SU9A 3VI5A 5C00A 3CBUA 3ZIVA 1OE8A 4POBA 3WYWA 5F0GA 1W4VA 3EYTA 3DEXA 3FHKA 3ZITA 2JZSA 1BG5A 3IDVA 3F4SA 3H4KA 2LV3A 3FR3A 1G7OA 4HQSA 1LJRA 2VL3A 3D5JA 4G9HA 4ZBDA 4KUNA 2XPEA 4BWQA 3M9KA 3A2VA 4OCFA 4L0UA 4K9ZA 3RHBA 22GSA 1F37A 1SL1B 4EXJA 4CHSA 1A2JA 3EURA 2PVOC 4ZBBA 4RUVA 5ECKB 3GURA 2EIQA 4K0GA 3TKPA 2VM2A 4EF0A 3E9JB 1GNWA 3APOA 5E59A 3TOUA 2WULA 2H0IA 5ELAA 1V98A 2C0GA 4OCEA 3GX0A 1R5AA 5A4VA 3FK8A 1XBSA 1HQOA 3GUSA 1X9SB 4WXTA 1PX7A 1AUCA 4NV5A 1T4ZA 4IP6A 3F4RA 4YQVA 2CQ9A 3KMNA 5F8BA 4ID0A 2LJRA 2P0GA 1NSWA 5F05A 4TOPA 2TRXA 4ZL9A 3UJ1A 3DIEA 1FW1A 4BVYA 2WZ9A 5DJLA 1FVJA 3FZ9A 3MAKA 4YH2A 5AIVA 1A8YA 2R4VA 1TRSA 4EE0A 3BD2A 3F3RA 5LD0A 2O85A 2GTUA 1Z7RA 1Q4JA 1GSYA 2FY6A 3FZAA 5ECOB 4DSSA 1WRYA 1X5DA 2K8SA 4X1UA 17GSA 2ALBA 5KN0A 4IW9A 4AJ6A 3KMOA 3WGDA 3IBHA 1TK0B 2IMDA 4K2DA 3W8JA 3HD5A 3H8QA 2QGVA 1RK4A 3TRQA 2K9FA 3IR4A 2FUG2 4MA9A 3G9BA 5G31A 2G2QA 3HYPA 4MH2A 3TRXA 4HI7A 4J2FA 4ZB9A 1VF1A 5DCHA 1K0OA 1GTBA 2H75A 2IPAA 1R7HA 2V41A 5AN1A 4ECJA 2VD0A 2DJJA 2R2JA 3LYPA 5COHA 3RDWA 1R5PA 5CREA 2DIZA 3V1WA 2FWEA 4K7NA 3EMPA 3GHAA 2H0GA 3TGZA 5ECLB 5ECIB 2DJ0A 1GSEA 3I69A 5HR2A 3LORA 3H1NA 4NHWA 5IIZA 2OACA 4NXIA 4EO3A 4KSOA 3KXOA 1N8JA 4MABA 1K3YA 4ZBAA 5HFIA 4AGSA 1OC9B 3C71A 2HNLA 5AISA 1M2AA 1TKDB 1LU4A 5GSTA 1PKZA 1PKWA 1YEXA 1M2BA 1A24A 1THXA 4MZBA 2GZYA 4GF0A 2A2SA 3E3EA 4GQCA 5D96A 4GQFA 5CO3A 5ECRB 1R4WA 1AIUA 2H1AA 2L6DA 1F3AA 1B8XA 1O8WA 2HFDA 2LTKA 4HJ2A 1X9MB 5G1KA 5ID2A 3DGQA 2GSSA 3TJGA 3G7JA 3QDNA 2EIRA 3Q6OA 2VO4A 3L4NA 4ZIJA 3N5OA 3UBLA 4XIHA 20GSA 5F06A 1GWCA 2FWHA 2GQKA 2OE1A 2AYTA 4HU9A 1SL0B 1N2AA 1YF1A 1FAAA 5IMCA 4N11A 2PBJA 5JWRB 2R6KA 4XHMA 2HYXA 4Q5FA 3IXRA 2H6YA 10GSA 2B1KA 2H0HA 1QXHA 5AGYA 2YV7A 1XZOA 3GKNA 2I81A 2VLTA 5HR1A 3H79A 2LNSA 2ON5A 5ECMB 1OC8A 2GSQA 2KUCA 5H5RA 2C1YA 2H01A 2HRFA 3HA9A 2O89A 3CSJA 1EOHA 3CRUA 1M99A 1K0MA 2DJKA 2VLUA 1EOGA 2H1BA 3Q18A 5ECNB 1WIKA 4GLTA 5FWGA 4OMVA 4K6XA 4KDUA 3UEMA 18GSA 1HYUA 3BOAA 1XPVA 3WT1A 4N10A 1F9MA 2R3XA 4OFMA 1LBKA 3LXZA 4CDOA 2YV9A 3US3A 4J56E 4OO4A 4KW6A 1TXXA 3GMFA 5CRDA 4D73A 2VOCA 4CW9A 3UVTA 2X64A 4AJ8A 2VL9A 3KH7A 2OA7A 1GL8A 4GSSA 4EL1A 4MP4A 3U6VA 1GSQA 2JL4A 12GSA 1XW5A 1QGVA 4MJCA 4TW5A 5DQSA 4F82A 1TW9A 4PQHA 3UMAA 3C73A 1VF3A 3P90A 3ZVJA 4Q5RA 2MMNA 3KCMA 2IMFA 3TKSE 2J23A 2IFQA 3U5RE 5DQYA 2MZCA 2F8AA 2QKEA 4LA1A 3QR6A 3KTBA 1GTUA 3LFLA 1TI1A 4JZQA 3CXGA 2PWJA 3CRTA 2GS3A 3GYKA 3UOMA 1EGRA 3LQ7A 5IMVA 3IK9A 3HHVA 1GLPA 2WDUA 2PGTA 13GSA 2YP6A 2YANA 4FYUA 2NPBA 5IO0A 1O73A 1UVZA 6GSYA 3VWXA 1C72A 3TKSC 3QAVA 1TDIA 2C80A 2C3QA 1X5CA 1OKTA 3KD0A 3A2WA 1DE2A 4DSQA 1ZZYA 1GSDA 2FGXA 2OBIA 1H75A 3ZVJD 1SD8A 4EKZA 2C0FA 3ZFLA 5GAND 4D73B 3I9V2 2X8CA 4KAEA 3F6DA 2H6XA 3HDCA 4FYBA 5D93A 1PA3A 1YKCA 4OWYA 3EVIA 4KE3A 2AUVA 3KJYA 2JACA 2A2RA 1BX9A 1MTCA 3D4MA 1M9BA 4MJAA 1YF0A 1ST9A 3NOFA 2IFQB 1EGOA 1WOUA 1U3IA 3QPMA 4O92A 1O81A 6GSVA 4RI6A 1QUWA 4JR4A 1GH2A 5ENUA 2AB6A 3FR9A 5A4UA 4XS1A 3FYGA 4XRDA 3FEUA 4KX4A 2HT9A 4MZWA 3D0ZA 2FD3A 4HQZA 2M80A 5IQYA 3EC3A 1WJKA 3KTLA 3VWUA 3J7Yb 3M8NA 2LRCA 5GAPD 1YEPA 2GDRA 1SYRA 4RI7A 1EV9A 2AAWA 4N0ZA 1HNCA 3LGCA 4POLA 1M2DA 1K3OA 6GSWA 4G2EA 3IA1A 1B9XC 3ISOA 3GTUA 3G7YA 1AC1A 3EE2A 3G7IA 3TDGA 2E2GA 2FLSA 4TR4A 2LEGA 4NPBA 3I43A 3Q19A 4WEYA 2K6VA 3RBTA 3L9SA 3PINA 2FWFA 3BCKA 3QAGA 1JLWA 2F3MA 3ME8A 5ABRA 1W89A 2XBQA 2CVKA 2VCVA 5J4UA
chains in the Genus database with same CATH superfamily
1KBNA 1XG8A 1ZL9A 2RM5A 1ERWA 1X9WB 3LW9A 2CAQA 3HVNA 3ZIJA 2YJ7A 3L9UA 3ERGA 1TRVA 3BJ5A 3HVSA 2L5OA 2FA8A 1AXDA 4ECCA 2JADA 2B6MA 4NMUA 3KIJA 4O7HA 5LNKe 2VL2C 1S3CA 4FYCA 2F9SA 2CAIA 5FHIA 4LLRA 3IRAA 4G0KA 5H5SA 3J7Yk 1ZYEA 1EWXA 1XWBA 4PQIA 3ERWA 1SENA 3N9JA 2YWMA 4ILFA 3P8WA 3QD9A 2ZNMA 2YWOA 1OC9A 3C7MA 2LRNA 2GLRA 1M0UA 3GTUB 4PGTA 3ZRDA 4ZL7A 2NBSA 2A4HA 2EIOA 2N5BA 1PN9A 4K5SA 1BYEA 2VM1A 3LG6A 1ML6A 5F07A 4Z2UA 3GNJA 1T8EB 1V57A 4MPFA 1MD3A 3HJMA 3M3MA 5CRHA 4NWYA 1M7TA 3MDKA 4F0BA 2O8VB 4ECBA 5IMAA 2HSHA 1YJ6A 4EC0A 1AQVA 4MJBA 2R5GA 3KM6A 1K0DA 4IJ3A 4PTSA 4ECIA 1XWKA 3HZ4A 3FZ5A 1GP1A 2LKUA 1FOVA 3LYKA 1Z7PA 3IV4A 1SL2B 2GGTA 3SWLA 3TB2A 1ERVA 2RLIA 5LCZA 2DJ2A 1Z3EA 4F2IA 1A0FA 3TRPA 3IHQA 1O8XA 1PD21 3GSSA 1SKSB 2DLXA 4MF5A 4ULXA 3QFAC 5H5QA 1GUMA 1TK5B 1ILOA 2P31A 2C4JA 1G0TA 3CYNA 4ML6A 5G2ZA 3TOTA 1URMA 5L71A 2REMA 2IWTA 2GZPA 3UVHA 3GKMA 5D9TA 2HI7A 1BAYA 2AJQB 4ZILA 1WMJA 1FOHA 4FH8A 5J41A 3FMWA 3RPPA 2MYGA 1T3BA 1WWJA 4YKGA 4QL9A 3F9UA 4WKWA 3ME7A 3F0IA 1GSUA 2L57A 2HSMA 2YWNA 2OE0A 3DWVA 1MDKA 1O85A 3DD3A 4LMWA 1GSFA 1J0FA 4MJEA 1HNAA 4WBJA 3KGKA 1Z6MA 4TR0A 2P5QA 4A5PA 3EU3A 1PFOA 4X4JA 5DAKB 2PPTA 3KEBA 1XW6A 1F6MC 1U6TA 3W8SA 4F03A 2C0DA 1QFNA 1KNGA 4KB3A 3HY2A 1YY7A 6GSXA 1TK8B 2LJKA 1AAZA 3A5WA 1ON4A 4N0VA 4LMVA 1AQWA 4TRXA 2CVBA 4GSTA 2AV4A 2X4AA 3TKQA 4JU5A 4HOJA 4KCAA 4YKFA 5ECHB 5J9CA 2X8HA 2PMTA 2H1DA 2L4CA 4MF6A 2NVLA 2R37A 2TIRA 4KDYA 5KOXA 8GSSA 1XWAA 1TOFA 3QCPA 3W6GA 1TJDA 2CX3A 2YOIA 2V1MA 4EDYA 3BCIA 4DSRA 3VWWA 1GNEA 4Z7XA 4NAXA 3KH9A 3C8EA 4HDEA 1QMVA 3IAM2 4I8BA 1WE0A 3ZFBA 3ZTLA 4J57E 5CYYA 2WFCA 3Q74A 4WR5A 5G5FA 1Z5YE 3TKSA 2JZRA 5D9VA 2HE3A 1GLQA 4IELA 2YWIA 5B8AA 1XOBA 3ZYWA 2WCIA 2CZ2A 4K8MA 4OFTA 3CMIA 4Q5QA 4HSCX 3EU4A 3GKXA 3GSTA 5DALB 2MBSA 1G6WA 1NHOA 4H86A 4IBPA 2GQMA 3HZ8A 2H74A 4V1Ap 2IMEA 1MDIA 4GCIA 4JRRA 4IN0A 5IM9A 2A4VA 3TJFA 1OAZA 1T00A 5HR3A 2E2MA 1DUGA 5D9XA 2O7KA 4HUAA 2HXKA 4RQXA 4MH3A 5D9WA 4HS1A 1UA5A 1QK8A 2E0QA 4POMA 4EDZA 4ML1A 1BQ7A 5B8BA 2C3TA 2YZUA 1RQMA 2HLSA 1DBYA 4PXOA 3FR6A 2CV4A 3GN3A 3MWHA 2H71A 4I2TA 2R0GA 1EP8A 4V2MA 3NIVA 1JZWA 1IYIA 4G10A 4OFNA 1I9DA 1JZOA 1OYJA 4NHZA 4CY6A 2V2GA 1G6YA 1UN2A 4MZCA 3D4TA 3GX8A 3UAPA 3SBCA 2J9HA 2P5RA 3O76A 3TJBA 4PNFA 4LL4B 3QOUA 4YQUA 2VUPA 1Q98A 4TXVA 4E8EA 2HZFA 2CA8A 2M72A 4WF4A 2DKIA 1JZDA 5A4WA 3BBYA 1CQGA 3EMXA 3M0FA 6GSUA 1SJZA 1GULA 5HQPA 2GT6A 3GA4A 1FB0A 3F4TA 2KHPA 1XVWA 1E6BA 3TJJA 1F2EA 4PQ1A 2FNOA 1FHEA 2WS2A 4G19A 3UARA 3PR8A 5IMFA 3CTGA 2TRCP 3RPNA 1EZKA 2B5YA 3VK9A 4DVCA 5GSSA 3L0HA 1X5EA 3LEFA 5B7CA 3E0UA 1K0BA 2OE3A 1XW9A 5KN3A 2VCWA 1ACVA 1OKDA 2VL2A 2F51A 2H66A 2VCQA 1SYXA 2LS5A 3HVXA 1THOA 5BMUA 1VF2A 1ZOFA 4CY8A 1SKRB 2B7JA 4OD7A 4HEA2 4JR6A 2KP2A 4MNNA 5HR0A 6GSSA 2FWGA 4TR3A 3VWVA 1ZYPA 2OKAA 3DMLA 3A3TA 4MPGA 1ZGNA 2B1LA 1VGLA 3CSHA 1TTZA 5JCGA 2GVPA 1QQ2A 4IKHA 2GSTA 4TN8A 2MBTA 1PRXA 1SK1A 3PH9A 4QQ7A 5G1LA 3CTFA 1V40A 5IPGA 1V2AA 2PUKC 1A0RP 4ZXGA 2LNTA 3D21A 2H73A 4F9ZA 1A23A 4HJMA 3EINA 2PN8A 2M46A 4GXZA 4IP1A 4GRFA 3WT2A 2YPMA 1B4QA 2RM6A 2C3NA 4YAVA 1EP7A 2GZZA 1R26A 3JCML 1AW9A 2B5XA 5J5NA 3LXTA 5HFGA 5AIXA 1SKWB 2JSZA 5KN2A 1EV4A 4I2UA 4JBBA 4XRAA 2LQQA 5J9BA 2YNXA 4PURA 5DBQA 1IYHA 5CAXA 2DSAA 4FIWA 1MDJA 5CRWA 3MSZA 5B6MA 1JZRA 1S3DA 1T4YA 1BJXA 4ACSA 1FB6A 4X43A 2H6ZA 3D6IA 5DCGA 4P3YB 5DJMA 5DVBA 2GSRA 1T7PB 2NDOA 2WGRA 3P2AA 3TKRA 4USSA 3VPTA 2B7KA 2O87A 2RUEA 4BA7A 4KSMA 2L4QA 4PNGA 2VLVA 11GSA 4LL1B 4Q5NA 3O6TA 4BVXA 4WF5A 1HNBA 2H8LA 1NW2A 4EUYA 1K0AA 3L78A 1T1VA 1EEJA 3C1RA 1E2YA 2DKHA 1VRSD 5B6NA 3UL3A 4TVEA 1O6JA 2LRTA 4XTSA 2QC7A 4MCUA 2V32A 3DRNA 3OR5A 2HZEA 2I3YA 1SK2A 4O32A 2N5AA 1OVNA 5G30A 1YZXA 2HSYA 2GQLA 2CX4A 2VCXA 4IGJA 2YCDA 2DIYA 1J08A 3AY8A 5JCUA 5CNWA 4K1FA 5DAKA 4V2NA 4K7OA 2WB9A 1GUHA 2GT5A 1GTAA 1SJ6A 1CQHA 2DJ3A 2VCZA 2BTOT 4IJIA 1Y6EA 3VI7A 3F8UA 3ZZXA 5KEJA 3GL5A 4JEDA 2QSIA 4GTUA 5C04A 3ZREA 7GSSA 3FZ4A 4JE1A 3HCZA 4BPYA 1S3RA 3CSIA 1UC7A 1MEKA 3APSA 5IMZA 5E4WA 3KP9A 2K18A 4V1Ag 5CRGA 4N30A 1U87A 4G0IA 4V2LA 4YQMA 2MMOA 1M9AA 4X0XA 1O7UA 2B3SA 4QL7A 4BVYB 5D73A 3QAWA 2H19A 1GTIA 2ZCTA 2XHFA 1JLVA 4L5LA 1X0RA 3IPZA 3WD6A 3GH9A 4BVXB 5IO2A 2CT6A 2LJAA 2RUFA 2HRKA 2JZTA 5J3RA 3ZMKA 2JSYA 2I1UA 5JCWA 3KP8A 3L9VA 4HZ4A 4TKYA 1XFLA 2DMMA 2XPDA 3HKRA 3ZLPA 1ERTA 1B9YC 14GSA 1TRUA 2C8UA 2FA4A 2PERA 5DDLA 3RAZA 4NV2A 1A2MA 2HRNA 2VD1A 3QFBC 4AJ7A 4DSSB 3DVXA 2LUSA 1JHBA 4TR1A 4IVFA 2HZEB 2VIMA 4PUAA 3HJPA 2KP1A 1TI3A 1VF4A 5DALA 2XBIA 3R2QA 1BEDA 2D2ZA 3HXSA 2LSTA 9GSSA 4PUFC 5JWOB 3IE3A 3QMXA 4IQAA 1GSSA 2JU5A 6GSTA 3M9JA 1K0NA 3FY7A 1G7EA 3D22A 1AQXA 5EY6A 3TJKA 1DE1A 5IOXA 3GRXA 2N5FA 3GKKA 4WBRD 2XC2A 1F3BA 1PGTA 5HFKA 3IK7A 3F63A 4MK3A 3UBKA 2IN3A 4KH7A 3GV1A 3WGXA 2YN1A 2IL3A 3IC8A 4RQRA 4K0NA 1Z6NA 2V6OA 1GRXA 1V9WA 5KN1A 2IMIA 1PMTA 1ZCPA 4XS4A 4XS6A 3R3EA 4KNDA 2IIYA 4L0WA 3VPQA 2AHEA 3IOSA 3M1GA 2K8VA 1S3AA 1FVKA 4K7IA 4O5UA 1YDKA 2ZUPA 4KDXA 4ZB8A 4TXOA 1KTEA 3GL3A 2OBKA 2X8GA 1TP9A 4FO5A 1J9BA 3KZQA 2NTOA 4MF7A 4KA0A 1U3AA 1K3LA 3DXBA 1JFUA 1NM3A 4HU7A 4TR1B 2H1GA 2I9HA 3LWAA 1OE7A 2IMKA 1XVQA 1XWGA 5ID2B 3FKFA 3TCOA 2EC4A 3I6AA 4YAPA 3UIWA 4HZ2A 1ZMAA 2CVDA 2KLXA 4KCEA 2VCTA 2OJLA 4I5QA 3DYRA 1OC3A 4L5OA 4IHUA 2BMXA 4MLYA 3EWLA 1V58A 1PL1A 2C0EA 2YZHA 3C1SA 2OADA 3P7XA 19GSA 1FO5A 3WGEA 4GSNA 1XWCA 4MMMA 1EEMA 2H72A 4MDCA 5JWQB 2PVQA 3GFKA 3F3QA 1A2LA 4OO5A 1PSQA 1ABAA 1I5GA 5A5KA 2E7PA 2KOKA 3MNGA 3A2XA 3ERFA 4WETA 2V6KA 2L6CA 1YQ1A 1XOAA 4BWSA 1WP0A 4DEJA 4EVMA 4AF2A 2DJ1A 2MMAA 3ED3A 4XS4B 5ECSA 1HD2A 1B4PA 4O5RA 4PX1A 5EPFA 1SJIA 1TU7A 4L8EA 4TXOB 3LJRA 4I6XA 1XXUA 3PPUA 1FG4A 1ERUA 2ES7A 3HVVA 1H4OA 2G0FA 1WPIA 4KGIA 3TUEA 16GSA 2H30A 2X99A 2FHEA 2WJUA 3FRCA 3LSZA 2Z9SA 3IC4A 1YKAA 5IMDA 1TU8A 3APQA 3GIXA 1TRWA 4BL7A 4FQUA 2L59A 4WR4A 2L5LA 5D8IA 2B5EA 1NHYA 3DVWA 2DC5A 3GH6A 4XCSA 2UZ8A 3PGTA 3K8NA 1Z9HA 2IJYA 5CP1A 4ISDA 1PL2A 3VLNA 1XCCA 5ELGA 3F6FA 3VURA 5EL8A 1RW1A 1USBA 5ECQB 4F0CA 2DMLA 3RHCA 2RIIA 4POKA 4GWRA 3ZL5A 5IPHA 4IS0A 3IHGA 4IQ1A 3VFIA 1GUKA 3FW2A 1ZYQB 3O3TA 5INYA 2VAFA 2PU9C 3HJOA 4ZB6A 1SK0A 2F8FA 1B48A 4E8HA 5EVOA 3H93A 2DBCA 2MMZA 2H70A 1XIYA 1Y25A 3S9FA 5ECPB 4I97A 2FCHA 1U88A 1KEBA 1PQNA 3NZNA 2LQOA 2CZ3A 5GZZB 3DKSA 2WRTA 1SD9A 2ON7A 1PX6A 2H76A 1A8LA 3IAS2 1MD4A 4ZL8A 5G5EA 2I4AA 1K0CA 3ZMLA 1DSBA 2YJHA 2BJXA 4BL7B 5IOWA 5FT3A 1SU9A 3VI5A 5C00A 3CBUA 3ZIVA 1OE8A 4POBA 3WYWA 5F0GA 1W4VA 3EYTA 3DEXA 3FHKA 3ZITA 2JZSA 1BG5A 3IDVA 3F4SA 3H4KA 2LV3A 3FR3A 1G7OA 4HQSA 1LJRA 2VL3A 3D5JA 4G9HA 4ZBDA 4KUNA 2XPEA 4BWQA 3CQFA 3M9KA 3A2VA 4OCFA 4L0UA 4K9ZA 3RHBA 22GSA 1F37A 1SL1B 4EXJA 4CHSA 1A2JA 3EURA 2PVOC 4ZBBA 4RUVA 5ECKB 3GURA 3MIXA 2EIQA 4K0GA 3TKPA 2VM2A 4EF0A 3E9JB 1GNWA 3APOA 5E59A 3TOUA 2WULA 2H0IA 5ELAA 1V98A 2C0GA 4OCEA 3GX0A 1R5AA 5A4VA 3FK8A 1XBSA 1HQOA 3GUSA 1X9SB 4WXTA 1PX7A 1AUCA 4NV5A 1T4ZA 4IP6A 3F4RA 4YQVA 2CQ9A 3KMNA 3MYDA 5F8BA 4ID0A 2LJRA 2P0GA 5BRTA 1NSWA 5F05A 4TOPA 2TRXA 4ZL9A 3UJ1A 3DIEA 1FW1A 4BVYA 2WZ9A 5DJLA 1FVJA 3FZ9A 3MAKA 4YH2A 5AIVA 1A8YA 2R4VA 1TRSA 4EE0A 3BD2A 3F3RA 5LD0A 2O85A 2GTUA 1Z7RA 1Q4JA 1GSYA 2FY6A 3FZAA 5ECOB 4DSSA 1WRYA 1X5DA 2K8SA 4X1UA 17GSA 2ALBA 5KN0A 4IW9A 4AJ6A 3KMOA 3WGDA 3IBHA 1TK0B 2IMDA 4K2DA 3W8JA 3HD5A 3H8QA 2QGVA 1RK4A 3TRQA 2K9FA 3IR4A 2FUG2 4MA9A 3G9BA 1M3JA 4KF9A 4K5RA 5G31A 2G2QA 3HYPA 4MH2A 3TRXA 4HI7A 4J2FA 4ZB9A 1VF1A 5DCHA 2HRAA 1K0OA 1GTBA 2H75A 2IPAA 1R7HA 2V41A 5AN1A 4ECJA 2VD0A 2DJJA 2R2JA 3LYPA 5COHA 3RDWA 1R5PA 5CREA 2DIZA 3V1WA 4Z2TA 2FWEA 1PN0A 4K7NA 3EMPA 3GHAA 2H0GA 3TGZA 5ECLB 2QA1A 5ECIB 2DJ0A 1GSEA 3I69A 5HR2A 3LORA 1M3IA 3H1NA 4NHWA 4K2XA 5IIZA 2OACA 4NXIA 4EO3A 4KSOA 3KXOA 5KOWA 1N8JA 4MABA 1K3YA 4ZBAA 5HFIA 4AGSA 1OC9B 3C71A 2HNLA 5AISA 1M2AA 1TKDB 1LU4A 5GSTA 1PKZA 1PKWA 1YEXA 1M2BA 1A24A 1THXA 4MZBA 2GZYA 4GF0A 2A2SA 3E3EA 4GQCA 5D96A 4GQFA 5CO3A 5ECRB 1R4WA 1AIUA 2H1AA 2L6DA 1F3AA 1B8XA 1O8WA 2HFDA 2LTKA 4HJ2A 1X9MB 5G1KA 5ID2A 3DGQA 2GSSA 3TJGA 3G7JA 3QDNA 2EIRA 3Q6OA 2VO4A 3L4NA 2X49A 4ZIJA 3N5OA 3UBLA 4XIHA 20GSA 5F06A 1GWCA 2FWHA 2GQKA 2OE1A 2AYTA 4HU9A 1SL0B 2A2PA 1N2AA 1YF1A 1FAAA 5IMCA 4N11A 2PBJA 5JWRB 2R6KA 4XHMA 2HYXA 4Q5FA 3IXRA 2H6YA 10GSA 2B1KA 2H0HA 1QXHA 5AGYA 2YV7A 1XZOA 3GKNA 2I81A 2VLTA 5HR1A 3H79A 2LNSA 2ON5A 5ECMB 1OC8A 2GSQA 2KUCA 5H5RA 2C1YA 2H01A 2HRFA 3HA9A 2O89A 3CSJA 1EOHA 3CRUA 1M99A 1K0MA 2DJKA 2VLUA 1EOGA 2H1BA 3Q18A 5ECNB 1WIKA 4GLTA 5FWGA 4OMVA 4K6XA 4KDUA 3UEMA 18GSA 1HYUA 3BOAA 1XPVA 3WT1A 4N10A 1F9MA 2R3XA 4BIKA 4OFMA 1LBKA 3LXZA 4CDOA 2YV9A 3US3A 4J56E 4OO4A 4KW6A 1TXXA 3GMFA 5CRDA 4D73A 2VOCA 4CW9A 3UVTA 2X64A 4AJ8A 2VL9A 3KH7A 2OA7A 1GL8A 4GSSA 4EL1A 4MP4A 3U6VA 1GSQA 2JL4A 12GSA 1XW5A 1QGVA 4MJCA 4EIPA 4TW5A 5DQSA 4F82A 1TW9A 4PQHA 4EIQA 3UMAA 3C73A 1VF3A 3P90A 3ZVJA 4Q5RA 2MMNA 3KCMA 2IMFA 3TKSE 4ICYA 2J23A 2IFQA 3U5RE 5DQYA 2MZCA 2F8AA 2QKEA 2R0PA 4LA1A 3QR6A 3KTBA 1GTUA 3LFLA 1TI1A 4JZQA 3CXGA 2PWJA 3CRTA 2GS3A 3GYKA 3UOMA 1EGRA 3LQ7A 5IMVA 3IK9A 3HHVA 1GLPA 2WDUA 2PGTA 13GSA 2YP6A 2YANA 4FYUA 2NPBA 5IO0A 2QA2A 1O73A 1UVZA 6GSYA 3VWXA 1C72A 3TKSC 3EPTA 3QAVA 1TDIA 2C80A 2C3QA 1X5CA 1OKTA 3KD0A 3A2WA 1DE2A 4DSQA 1ZZYA 1GSDA 2FGXA 2OBIA 1H75A 3ZVJD 1SD8A 4EKZA 2C0FA 4Z2RA 3ZFLA 5GAND 4D73B 3I9V2 2X8CA 4KAEA 3F6DA 2H6XA 3HDCA 4FYBA 5D93A 1PA3A 1YKCA 4OWYA 3EVIA 4KE3A 2AUVA 3KJYA 2JACA 2A2RA 1BX9A 1MTCA 3D4MA 1M9BA 4MJAA 1YF0A 1ST9A 3NOFA 2IFQB 1EGOA 1WOUA 1U3IA 3QPMA 4O92A 1O81A 6GSVA 4RI6A 1QUWA 4JR4A 1GH2A 5ENUA 2AB6A 3FR9A 5A4UA 4XS1A 3FYGA 4XRDA 3FEUA 4KX4A 2HT9A 4MZWA 4O5QA 3D0ZA 2FD3A 4HQZA 2M80A 5IQYA 3EC3A 1WJKA 3KTLA 3VWUA 3J7Yb 3M8NA 2LRCA 5GAPD 1YEPA 2GDRA 1SYRA 4RI7A 1EV9A 2AAWA 4N0ZA 1HNCA 3LGCA 4POLA 2R0CA 1ZYNA 1M2DA 1K3OA 6GSWA 4G2EA 3IA1A 1B9XC 3ISOA 3GTUA 3G7YA 4G0LA 1AC1A 3EE2A 3G7IA 3TDGA 2E2GA 2FLSA 4TR4A 2LEGA 4NPBA 3I43A 3Q19A 4WEYA 2K6VA 3RBTA 3L9SA 3PINA 3A5IA 2FWFA 3BCKA 3QAGA 1JLWA 2F3MA 3ME8A 5ABRA 1W89A 2XBQA 2CVKA 2VCVA 5J4UA
chains in the Genus database with same CATH topology
1KBNA 1ZL9A 2RM5A 1ERWA 1X9WB 3LW9A 2CAQA 3ZIJA 2YJ7A 3L9UA 3ERGA 1TRVA 3BJ5A 3HVSA 2L5OA 2FA8A 1AXDA 4ECCA 2JADA 2B6MA 4NMUA 3KIJA 4O7HA 5LNKe 2VL2C 1S3CA 4FYCA 2F9SA 2CAIA 5FHIA 4LLRA 3IRAA 4G0KA 5H5SA 3J7Yk 1ZYEA 1EWXA 1XWBA 4PQIA 3ERWA 1SENA 3N9JA 2YWMA 4ILFA 3P8WA 3QD9A 2ZNMA 2YWOA 1OC9A 3C7MA 2LRNA 2GLRA 1M0UA 3GTUB 4PGTA 3ZRDA 4ZL7A 2NBSA 2A4HA 2EIOA 2N5BA 1PN9A 4K5SA 1BYEA 2VM1A 3LG6A 1ML6A 5F07A 4Z2UA 3GNJA 1T8EB 1V57A 4MPFA 1MD3A 3HJMA 3M3MA 5CRHA 4NWYA 1M7TA 3MDKA 4F0BA 2O8VB 4ECBA 5IMAA 2HSHA 1YJ6A 4EC0A 1AQVA 4MJBA 2R5GA 3KM6A 1K0DA 4IJ3A 4PTSA 4ECIA 1XWKA 3HZ4A 3FZ5A 1GP1A 2LKUA 1FOVA 3LYKA 1Z7PA 3IV4A 1SL2B 2GGTA 3SWLA 3TB2A 1ERVA 2RLIA 5LCZA 2DJ2A 1Z3EA 4F2IA 1A0FA 3TRPA 3IHQA 1O8XA 1PD21 3GSSA 1SKSB 2DLXA 4MF5A 4ULXA 3QFAC 5H5QA 1GUMA 1TK5B 1ILOA 2P31A 2C4JA 1G0TA 3CYNA 4ML6A 5G2ZA 3TOTA 1URMA 5L71A 2REMA 2IWTA 2GZPA 3UVHA 3GKMA 5D9TA 2HI7A 1BAYA 2AJQB 4ZILA 1WMJA 1FOHA 4FH8A 5J41A 3FMWA 3RPPA 2MYGA 1T3BA 1WWJA 4YKGA 4QL9A 3F9UA 4WKWA 3ME7A 3F0IA 1GSUA 2L57A 2HSMA 2YWNA 2OE0A 3DWVA 1MDKA 1O85A 3DD3A 4LMWA 1GSFA 1J0FA 4MJEA 1HNAA 4WBJA 3KGKA 1Z6MA 4TR0A 2P5QA 4A5PA 3EU3A 4X4JA 5DAKB 2PPTA 3KEBA 1XW6A 1F6MC 1U6TA 3W8SA 4F03A 2C0DA 1QFNA 1KNGA 4KB3A 3HY2A 1YY7A 6GSXA 1TK8B 2LJKA 1AAZA 3A5WA 1ON4A 4N0VA 4LMVA 1AQWA 4TRXA 2CVBA 4GSTA 2AV4A 2X4AA 3TKQA 4JU5A 4HOJA 4KCAA 4YKFA 5ECHB 5J9CA 2X8HA 2PMTA 2H1DA 2L4CA 4MF6A 2NVLA 2R37A 2TIRA 4KDYA 5KOXA 8GSSA 1XWAA 1TOFA 3QCPA 3W6GA 1TJDA 2CX3A 2YOIA 2V1MA 4EDYA 3BCIA 4DSRA 3VWWA 1GNEA 4Z7XA 4NAXA 3KH9A 3C8EA 4HDEA 1QMVA 3IAM2 4I8BA 1WE0A 3ZFBA 3ZTLA 4J57E 5CYYA 2WFCA 3Q74A 4WR5A 5G5FA 1Z5YE 3TKSA 2JZRA 5D9VA 2HE3A 1GLQA 4IELA 2YWIA 5B8AA 1XOBA 3ZYWA 2WCIA 2CZ2A 4K8MA 4OFTA 3CMIA 4Q5QA 3EU4A 3GKXA 3GSTA 5DALB 2MBSA 1G6WA 1NHOA 4H86A 4IBPA 2GQMA 3HZ8A 2H74A 4V1Ap 2IMEA 1MDIA 4GCIA 4JRRA 4IN0A 5IM9A 2A4VA 3TJFA 1OAZA 1T00A 5HR3A 2E2MA 1DUGA 5D9XA 2O7KA 4HUAA 2HXKA 4RQXA 4MH3A 5D9WA 4HS1A 1UA5A 1QK8A 2E0QA 4POMA 4EDZA 4ML1A 1BQ7A 5B8BA 2C3TA 2YZUA 1RQMA 2HLSA 1DBYA 4PXOA 3FR6A 2CV4A 3GN3A 3MWHA 2H71A 4I2TA 2R0GA 1EP8A 4V2MA 3NIVA 1JZWA 1IYIA 4G10A 4OFNA 1I9DA 1JZOA 1OYJA 4NHZA 4CY6A 2V2GA 1G6YA 1UN2A 4MZCA 3D4TA 3GX8A 3UAPA 3SBCA 2J9HA 2P5RA 3O76A 3TJBA 4PNFA 4LL4B 3QOUA 4YQUA 2VUPA 1Q98A 4TXVA 4E8EA 2HZFA 2CA8A 2M72A 4WF4A 2DKIA 1JZDA 5A4WA 3BBYA 1CQGA 3EMXA 3M0FA 6GSUA 1SJZA 1GULA 5HQPA 2GT6A 3GA4A 1FB0A 3F4TA 2KHPA 1XVWA 1E6BA 3TJJA 1F2EA 4PQ1A 2FNOA 1FHEA 2WS2A 4G19A 3UARA 3PR8A 5IMFA 3CTGA 2TRCP 3RPNA 1EZKA 2B5YA 3VK9A 4DVCA 5GSSA 3L0HA 1X5EA 3LEFA 5B7CA 3E0UA 1K0BA 2OE3A 1XW9A 5KN3A 2VCWA 1ACVA 1OKDA 2VL2A 2F51A 2H66A 2VCQA 1SYXA 2LS5A 3HVXA 1THOA 5BMUA 1VF2A 1ZOFA 4CY8A 1SKRB 2B7JA 4OD7A 4HEA2 4JR6A 2KP2A 4MNNA 5HR0A 6GSSA 2FWGA 4TR3A 3VWVA 1ZYPA 2OKAA 3DMLA 3A3TA 4MPGA 1ZGNA 2B1LA 1VGLA 3CSHA 1TTZA 5JCGA 2GVPA 1QQ2A 4IKHA 2GSTA 4TN8A 2MBTA 1PRXA 1SK1A 3PH9A 4QQ7A 5G1LA 3CTFA 1V40A 5IPGA 1V2AA 2PUKC 1A0RP 4ZXGA 2LNTA 3D21A 2H73A 4F9ZA 1A23A 4HJMA 3EINA 2PN8A 2M46A 4GXZA 4IP1A 4GRFA 3WT2A 2YPMA 1B4QA 2RM6A 2C3NA 4YAVA 1EP7A 2GZZA 1R26A 3JCML 1AW9A 2B5XA 5J5NA 3LXTA 5HFGA 5AIXA 1SKWB 2JSZA 5KN2A 1EV4A 4I2UA 4JBBA 4XRAA 2LQQA 5J9BA 2YNXA 4PURA 5DBQA 1IYHA 5CAXA 2DSAA 4FIWA 1MDJA 5CRWA 3MSZA 5B6MA 1JZRA 1S3DA 1T4YA 1BJXA 4ACSA 1FB6A 4X43A 2H6ZA 3D6IA 5DCGA 4P3YB 5DJMA 5DVBA 2GSRA 1T7PB 2NDOA 2WGRA 3P2AA 3TKRA 4USSA 3VPTA 2B7KA 2O87A 2RUEA 4BA7A 4KSMA 2L4QA 4PNGA 2VLVA 11GSA 4LL1B 4Q5NA 3O6TA 4BVXA 4WF5A 1HNBA 2H8LA 1NW2A 4EUYA 1K0AA 3L78A 1T1VA 1EEJA 3C1RA 1E2YA 2DKHA 1VRSD 5B6NA 3UL3A 4TVEA 1O6JA 2LRTA 4XTSA 2QC7A 4MCUA 2V32A 3DRNA 3OR5A 2HZEA 2I3YA 1SK2A 4O32A 2N5AA 1OVNA 5G30A 1YZXA 2HSYA 2GQLA 2CX4A 2VCXA 4IGJA 2YCDA 2DIYA 1J08A 3AY8A 5JCUA 5CNWA 4K1FA 5DAKA 4V2NA 4K7OA 2WB9A 1GUHA 2GT5A 1GTAA 1SJ6A 1CQHA 2DJ3A 2VCZA 2BTOT 4IJIA 1Y6EA 3VI7A 3F8UA 3ZZXA 5KEJA 3GL5A 4JEDA 2QSIA 4GTUA 5C04A 3ZREA 7GSSA 3FZ4A 4JE1A 3HCZA 4BPYA 3CSIA 1UC7A 1MEKA 3APSA 5IMZA 5E4WA 3KP9A 2K18A 4V1Ag 5CRGA 4N30A 1U87A 4G0IA 4V2LA 4YQMA 2MMOA 1M9AA 4X0XA 1O7UA 2B3SA 4QL7A 4BVYB 5D73A 3QAWA 2H19A 1GTIA 2ZCTA 2XHFA 1JLVA 4L5LA 1X0RA 3IPZA 3WD6A 3GH9A 4BVXB 5IO2A 2CT6A 2LJAA 2RUFA 2HRKA 2JZTA 5J3RA 3ZMKA 2JSYA 2I1UA 5JCWA 3KP8A 3L9VA 4HZ4A 4TKYA 1XFLA 2DMMA 2XPDA 3HKRA 3ZLPA 1ERTA 1B9YC 14GSA 1TRUA 2C8UA 2FA4A 2PERA 5DDLA 3RAZA 4NV2A 1A2MA 2HRNA 2VD1A 3QFBC 4AJ7A 4DSSB 3DVXA 2LUSA 1JHBA 4TR1A 4IVFA 2HZEB 2VIMA 4PUAA 3HJPA 2KP1A 1TI3A 1VF4A 5DALA 2XBIA 3R2QA 1BEDA 2D2ZA 3HXSA 2LSTA 9GSSA 4PUFC 5JWOB 3IE3A 3QMXA 4IQAA 1GSSA 2JU5A 6GSTA 3M9JA 1K0NA 3FY7A 1G7EA 3D22A 1AQXA 5EY6A 3TJKA 1DE1A 5IOXA 3GRXA 2N5FA 3GKKA 4WBRD 2XC2A 1F3BA 1PGTA 5HFKA 3IK7A 3F63A 4MK3A 3UBKA 2IN3A 4KH7A 3GV1A 3WGXA 2YN1A 2IL3A 3IC8A 4RQRA 4K0NA 1Z6NA 2V6OA 1GRXA 1V9WA 5KN1A 2IMIA 1PMTA 1ZCPA 4XS4A 4XS6A 3R3EA 4KNDA 2IIYA 4L0WA 3VPQA 2AHEA 3IOSA 3M1GA 2K8VA 1S3AA 1FVKA 4K7IA 4O5UA 1YDKA 2ZUPA 4KDXA 4ZB8A 4TXOA 1KTEA 3GL3A 2OBKA 2X8GA 1TP9A 4FO5A 1J9BA 3KZQA 2NTOA 4MF7A 4KA0A 1U3AA 1K3LA 3DXBA 1JFUA 1NM3A 4HU7A 4TR1B 2H1GA 2I9HA 3LWAA 1OE7A 2IMKA 1XVQA 1XWGA 5ID2B 3FKFA 3TCOA 2EC4A 3I6AA 4YAPA 3UIWA 4HZ2A 1ZMAA 2CVDA 2KLXA 4KCEA 2VCTA 2OJLA 4I5QA 3DYRA 1OC3A 4L5OA 4IHUA 2BMXA 4MLYA 3EWLA 1V58A 1PL1A 2C0EA 2YZHA 3C1SA 2OADA 3P7XA 19GSA 1FO5A 3WGEA 4GSNA 1XWCA 4MMMA 1EEMA 2H72A 4MDCA 5JWQB 2PVQA 3GFKA 3F3QA 1A2LA 4OO5A 1PSQA 1ABAA 1I5GA 5A5KA 2E7PA 2KOKA 3MNGA 3A2XA 3ERFA 4WETA 2V6KA 2L6CA 1YQ1A 1XOAA 4BWSA 1WP0A 4DEJA 4EVMA 4AF2A 2DJ1A 2MMAA 3ED3A 4XS4B 5ECSA 1HD2A 1B4PA 4O5RA 4PX1A 5EPFA 1SJIA 1TU7A 4L8EA 4TXOB 3LJRA 4I6XA 1XXUA 3PPUA 1FG4A 1ERUA 2ES7A 3HVVA 1H4OA 2G0FA 1WPIA 4KGIA 3TUEA 16GSA 2H30A 2X99A 2FHEA 2WJUA 3FRCA 3LSZA 2Z9SA 3IC4A 1YKAA 5IMDA 1TU8A 3APQA 3GIXA 1TRWA 4BL7A 4FQUA 2L59A 4WR4A 2L5LA 5D8IA 2B5EA 1NHYA 3DVWA 2DC5A 3GH6A 4XCSA 2UZ8A 3PGTA 3K8NA 1Z9HA 2IJYA 5CP1A 4ISDA 1PL2A 3VLNA 1XCCA 5ELGA 3F6FA 3VURA 5EL8A 1RW1A 1USBA 5ECQB 4F0CA 2DMLA 3RHCA 2RIIA 4POKA 4GWRA 3ZL5A 5IPHA 4IS0A 3IHGA 4IQ1A 3VFIA 1GUKA 3FW2A 1ZYQB 3O3TA 5INYA 2VAFA 2PU9C 3HJOA 4ZB6A 1SK0A 2F8FA 1B48A 4E8HA 5EVOA 3H93A 2DBCA 2MMZA 2H70A 1XIYA 1Y25A 3S9FA 5ECPB 4I97A 2FCHA 1U88A 1KEBA 1PQNA 3NZNA 2LQOA 2CZ3A 5GZZB 3DKSA 2WRTA 1SD9A 2ON7A 1PX6A 2H76A 1A8LA 3IAS2 1MD4A 4ZL8A 5G5EA 2I4AA 1K0CA 3ZMLA 1DSBA 2YJHA 2BJXA 4BL7B 5IOWA 5FT3A 1SU9A 3VI5A 5C00A 3CBUA 3ZIVA 1OE8A 4POBA 3WYWA 5F0GA 1W4VA 3EYTA 3DEXA 3FHKA 3ZITA 2JZSA 1BG5A 3IDVA 3F4SA 3H4KA 2LV3A 3FR3A 1G7OA 4HQSA 1LJRA 2VL3A 3D5JA 4G9HA 4ZBDA 4KUNA 2XPEA 4BWQA 3M9KA 3A2VA 4OCFA 4L0UA 4K9ZA 3RHBA 22GSA 1F37A 1SL1B 4EXJA 4CHSA 1A2JA 3EURA 2PVOC 4ZBBA 4RUVA 5ECKB 3GURA 3MIXA 2EIQA 4K0GA 3TKPA 2VM2A 4EF0A 3E9JB 1GNWA 3APOA 5E59A 3TOUA 2WULA 2H0IA 5ELAA 1V98A 2C0GA 4OCEA 3GX0A 1R5AA 5A4VA 3FK8A 1XBSA 1HQOA 3GUSA 1X9SB 4WXTA 1PX7A 1AUCA 4NV5A 1T4ZA 4IP6A 3F4RA 4YQVA 2CQ9A 3KMNA 3MYDA 5F8BA 4ID0A 2LJRA 2P0GA 5BRTA 1NSWA 5F05A 4TOPA 2TRXA 4ZL9A 3UJ1A 3DIEA 1FW1A 4BVYA 2WZ9A 5DJLA 1FVJA 3FZ9A 3MAKA 4YH2A 5AIVA 1A8YA 2R4VA 1TRSA 4EE0A 3BD2A 3F3RA 5LD0A 2O85A 2GTUA 1Z7RA 1Q4JA 1GSYA 2FY6A 3FZAA 5ECOB 4DSSA 1WRYA 1X5DA 2K8SA 4X1UA 17GSA 2ALBA 5KN0A 4IW9A 4AJ6A 3KMOA 3WGDA 3IBHA 1TK0B 2IMDA 4K2DA 3W8JA 3HD5A 3H8QA 2QGVA 1RK4A 3TRQA 2K9FA 3IR4A 2FUG2 4MA9A 3G9BA 4KF9A 4K5RA 5G31A 2G2QA 3HYPA 4MH2A 3TRXA 4HI7A 4J2FA 4ZB9A 1VF1A 5DCHA 2HRAA 1K0OA 1GTBA 2H75A 2IPAA 1R7HA 2V41A 5AN1A 4ECJA 2VD0A 2DJJA 2R2JA 3LYPA 5COHA 3RDWA 1R5PA 5CREA 2DIZA 3V1WA 4Z2TA 2FWEA 1PN0A 4K7NA 3EMPA 3GHAA 2H0GA 3TGZA 5ECLB 2QA1A 5ECIB 2DJ0A 1GSEA 3I69A 5HR2A 3LORA 3H1NA 4NHWA 4K2XA 5IIZA 2OACA 4NXIA 4EO3A 4KSOA 3KXOA 5KOWA 1N8JA 4MABA 1K3YA 4ZBAA 5HFIA 4AGSA 1OC9B 3C71A 2HNLA 5AISA 1M2AA 1TKDB 1LU4A 5GSTA 1PKZA 1PKWA 1YEXA 1M2BA 1A24A 1THXA 4MZBA 2GZYA 4GF0A 2A2SA 3E3EA 4GQCA 5D96A 4GQFA 5CO3A 5ECRB 1R4WA 1AIUA 2H1AA 2L6DA 1F3AA 1B8XA 1O8WA 2HFDA 2LTKA 4HJ2A 1X9MB 5G1KA 5ID2A 3DGQA 2GSSA 3TJGA 3G7JA 3QDNA 2EIRA 3Q6OA 2VO4A 3L4NA 2X49A 4ZIJA 3N5OA 3UBLA 4XIHA 20GSA 5F06A 1GWCA 2FWHA 2GQKA 2OE1A 2AYTA 4HU9A 1SL0B 2A2PA 1N2AA 1YF1A 1FAAA 5IMCA 4N11A 2PBJA 5JWRB 2R6KA 4XHMA 2HYXA 4Q5FA 3IXRA 2H6YA 10GSA 2B1KA 2H0HA 1QXHA 5AGYA 2YV7A 1XZOA 3GKNA 2I81A 2VLTA 5HR1A 3H79A 2LNSA 2ON5A 5ECMB 1OC8A 2GSQA 2KUCA 5H5RA 2C1YA 2H01A 2HRFA 3HA9A 2O89A 3CSJA 1EOHA 3CRUA 1M99A 1K0MA 2DJKA 2VLUA 1EOGA 2H1BA 3Q18A 5ECNB 1WIKA 4GLTA 5FWGA 4OMVA 4K6XA 4KDUA 3UEMA 18GSA 1HYUA 3BOAA 1XPVA 3WT1A 4N10A 1F9MA 2R3XA 4OFMA 1LBKA 3LXZA 4CDOA 2YV9A 3US3A 4J56E 4OO4A 4KW6A 1TXXA 3GMFA 5CRDA 4D73A 2VOCA 4CW9A 3UVTA 2X64A 4AJ8A 2VL9A 3KH7A 2OA7A 1GL8A 4GSSA 4EL1A 4MP4A 3U6VA 1GSQA 2JL4A 12GSA 1XW5A 1QGVA 4MJCA 4EIPA 4TW5A 5DQSA 4F82A 1TW9A 4PQHA 4EIQA 3UMAA 3C73A 1VF3A 3P90A 3ZVJA 4Q5RA 2MMNA 3KCMA 2IMFA 3TKSE 4ICYA 2J23A 2IFQA 3U5RE 5DQYA 2MZCA 2F8AA 2QKEA 2R0PA 4LA1A 3QR6A 3KTBA 1GTUA 3LFLA 1TI1A 4JZQA 3CXGA 2PWJA 3CRTA 2GS3A 3GYKA 3UOMA 1EGRA 3LQ7A 5IMVA 3IK9A 3HHVA 1GLPA 2WDUA 2PGTA 13GSA 2YP6A 2YANA 4FYUA 2NPBA 5IO0A 2QA2A 1O73A 1UVZA 6GSYA 3VWXA 1C72A 3TKSC 3EPTA 3QAVA 1TDIA 2C80A 2C3QA 1X5CA 1OKTA 3KD0A 3A2WA 1DE2A 4DSQA 1ZZYA 1GSDA 2FGXA 2OBIA 1H75A 3ZVJD 1SD8A 4EKZA 2C0FA 4Z2RA 3ZFLA 5GAND 4D73B 3I9V2 2X8CA 4KAEA 3F6DA 2H6XA 3HDCA 4FYBA 5D93A 1PA3A 1YKCA 4OWYA 3EVIA 4KE3A 2AUVA 3KJYA 2JACA 2A2RA 1BX9A 1MTCA 3D4MA 1M9BA 4MJAA 1YF0A 1ST9A 3NOFA 2IFQB 1EGOA 1WOUA 1U3IA 3QPMA 4O92A 1O81A 6GSVA 4RI6A 1QUWA 4JR4A 1GH2A 5ENUA 2AB6A 3FR9A 5A4UA 4XS1A 3FYGA 4XRDA 3FEUA 4KX4A 2HT9A 4MZWA 4O5QA 3D0ZA 2FD3A 4HQZA 2M80A 5IQYA 3EC3A 1WJKA 3KTLA 3VWUA 3J7Yb 3M8NA 2LRCA 5GAPD 1YEPA 2GDRA 1SYRA 4RI7A 1EV9A 2AAWA 4N0ZA 1HNCA 3LGCA 4POLA 2R0CA 1ZYNA 1M2DA 1K3OA 6GSWA 4G2EA 3IA1A 1B9XC 3ISOA 3GTUA 3G7YA 4G0LA 1AC1A 3EE2A 3G7IA 3TDGA 2E2GA 2FLSA 4TR4A 2LEGA 4NPBA 3I43A 3Q19A 4WEYA 2K6VA 3RBTA 3L9SA 3PINA 3A5IA 2FWFA 3BCKA 3QAGA 1JLWA 2F3MA 3ME8A 5ABRA 1W89A 2XBQA 2CVKA 2VCVA 5J4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBN A;  1ZL9 A;  2RM5 A;  1ERW A;  1X9W B;  2CAQ A;  3ZIJ A;  2YJ7 A;  3L9U A;  3ERG A;  1TRV A;  3BJ5 A;  3HVS A;  2L5O A;  2FA8 A;  1AXD A;  4ECC A;  2JAD A;  2B6M A;  4NMU A;  3KIJ A;  4O7H A;  5LNK e;  2VL2 C;  1S3C A;  4FYC A;  2F9S A;  2CAI A;  5FHI A;  4LLR A;  3IRA A;  5H5S A;  3J7Y k;  1ZYE A;  1EWX A;  1XWB A;  4PQI A;  3ERW A;  1SEN A;  3N9J A;  2YWM A;  4ILF A;  3P8W A;  3QD9 A;  2ZNM A;  2YWO A;  1OC9 A;  3C7M A;  2LRN A;  2GLR A;  1M0U A;  3GTU B;  4PGT A;  3ZRD A;  4ZL7 A;  2NBS A;  2EIO A;  2N5B A;  1PN9 A;  1BYE A;  2VM1 A;  3LG6 A;  1ML6 A;  5F07 A;  3GNJ A;  1T8E B;  1V57 A;  4MPF A;  1MD3 A;  3HJM A;  3M3M A;  5CRH A;  4NWY A;  1M7T A;  3MDK A;  4F0B A;  2O8V B;  4ECB A;  5IMA A;  2HSH A;  1YJ6 A;  4EC0 A;  1AQV A;  4MJB A;  2R5G A;  3KM6 A;  1K0D A;  4IJ3 A;  4ECI A;  1XWK A;  3HZ4 A;  3FZ5 A;  1GP1 A;  2LKU A;  1FOV A;  3LYK A;  1Z7P A;  3IV4 A;  1SL2 B;  2GGT A;  3SWL A;  3TB2 A;  1ERV A;  2RLI A;  5LCZ A;  2DJ2 A;  1Z3E A;  4F2I A;  1A0F A;  3TRP A;  3IHQ A;  1O8X A;  1PD2 1;  3GSS A;  1SKS B;  2DLX A;  4MF5 A;  4ULX A;  3QFA C;  5H5Q A;  1GUM A;  1TK5 B;  1ILO A;  2P31 A;  2C4J A;  1G0T A;  3CYN A;  4ML6 A;  5G2Z A;  3TOT A;  1URM A;  5L71 A;  2REM A;  2IWT A;  2GZP A;  3UVH A;  3GKM A;  5D9T A;  2HI7 A;  1BAY A;  2AJQ B;  4ZIL A;  1WMJ A;  4FH8 A;  5J41 A;  3RPP A;  2MYG A;  1T3B A;  1WWJ A;  4QL9 A;  3F9U A;  4WKW A;  3ME7 A;  3F0I A;  1GSU A;  2L57 A;  2YWN A;  2OE0 A;  3DWV A;  1MDK A;  1O85 A;  3DD3 A;  4LMW A;  1GSF A;  1J0F A;  4MJE A;  1HNA A;  4WBJ A;  3KGK A;  1Z6M A;  4TR0 A;  2P5Q A;  3EU3 A;  5DAK B;  2PPT A;  3KEB A;  1XW6 A;  1F6M C;  1U6T A;  3W8S A;  4F03 A;  2C0D A;  1QFN A;  1KNG A;  4KB3 A;  3HY2 A;  1YY7 A;  6GSX A;  1TK8 B;  2LJK A;  1AAZ A;  3A5W A;  1ON4 A;  4N0V A;  4LMV A;  1AQW A;  4TRX A;  2CVB A;  2AV4 A;  4GST A;  3TKQ A;  4JU5 A;  4HOJ A;  4KCA A;  5ECH B;  5J9C A;  2X8H A;  2PMT A;  2H1D A;  2L4C A;  4MF6 A;  2NVL A;  2R37 A;  2TIR A;  4KDY A;  8GSS A;  1XWA A;  1TOF A;  3QCP A;  3W6G A;  1TJD A;  2CX3 A;  2YOI A;  2V1M A;  4EDY A;  3BCI A;  4DSR A;  3VWW A;  1GNE A;  4Z7X A;  4NAX A;  3KH9 A;  3C8E A;  4HDE A;  1QMV A;  3IAM 2;  4I8B A;  1WE0 A;  3ZFB A;  3ZTL A;  4J57 E;  5CYY A;  2WFC A;  3Q74 A;  4WR5 A;  5G5F A;  1Z5Y E;  3TKS A;  2JZR A;  5D9V A;  2HE3 A;  1GLQ A;  4IEL A;  2YWI A;  5B8A A;  1XOB A;  3ZYW A;  2WCI A;  2CZ2 A;  4K8M A;  4OFT A;  3CMI A;  4Q5Q A;  3EU4 A;  3GKX A;  3GST A;  5DAL B;  2MBS A;  1G6W A;  1NHO A;  4H86 A;  4IBP A;  2GQM A;  3HZ8 A;  2H74 A;  4V1A p;  2IME A;  1MDI A;  4GCI A;  4JRR A;  4IN0 A;  5IM9 A;  2A4V A;  3TJF A;  1OAZ A;  1T00 A;  5HR3 A;  2E2M A;  1DUG A;  5D9X A;  2O7K A;  4HUA A;  2HXK A;  4RQX A;  4MH3 A;  5D9W A;  4HS1 A;  1UA5 A;  1QK8 A;  2E0Q A;  4POM A;  4EDZ A;  4ML1 A;  1BQ7 A;  5B8B A;  2C3T A;  2YZU A;  1RQM A;  2HLS A;  1DBY A;  4PXO A;  3FR6 A;  2CV4 A;  3GN3 A;  3MWH A;  2H71 A;  4I2T A;  1EP8 A;  4V2M A;  3NIV A;  1JZW A;  1IYI A;  4G10 A;  4OFN A;  1I9D A;  1JZO A;  1OYJ A;  4NHZ A;  2V2G A;  1G6Y A;  1UN2 A;  4MZC A;  3D4T A;  3GX8 A;  3UAP A;  3SBC A;  2J9H A;  2P5R A;  3O76 A;  3TJB A;  4PNF A;  4LL4 B;  3QOU A;  4YQU A;  2VUP A;  1Q98 A;  4TXV A;  4E8E A;  2HZF A;  2CA8 A;  2M72 A;  4WF4 A;  1JZD A;  5A4W A;  3BBY A;  1CQG A;  3EMX A;  3M0F A;  6GSU A;  1SJZ A;  1GUL A;  5HQP A;  2GT6 A;  3GA4 A;  1FB0 A;  3F4T A;  2KHP A;  1XVW A;  1E6B A;  3TJJ A;  1F2E A;  4PQ1 A;  2FNO A;  1FHE A;  2WS2 A;  4G19 A;  3UAR A;  3PR8 A;  5IMF A;  3CTG A;  2TRC P;  3RPN A;  1EZK A;  2B5Y A;  3VK9 A;  4DVC A;  5GSS A;  3L0H A;  1X5E A;  3LEF A;  5B7C A;  3E0U A;  1K0B A;  2OE3 A;  1XW9 A;  5KN3 A;  2VCW A;  1ACV A;  1OKD A;  2VL2 A;  2F51 A;  2H66 A;  2VCQ A;  1SYX A;  2LS5 A;  3HVX A;  1THO A;  1VF2 A;  1ZOF A;  1SKR B;  2B7J A;  4OD7 A;  4HEA 2;  4JR6 A;  2KP2 A;  5HR0 A;  6GSS A;  2FWG A;  4TR3 A;  3VWV A;  2OKA A;  3DML A;  3A3T A;  4MPG A;  1ZGN A;  2B1L A;  1VGL A;  3CSH A;  1TTZ A;  5JCG A;  2GVP A;  1QQ2 A;  4IKH A;  2GST A;  4TN8 A;  2MBT A;  1PRX A;  1SK1 A;  3PH9 A;  4QQ7 A;  5G1L A;  3CTF A;  1V40 A;  5IPG A;  1V2A A;  2PUK C;  1A0R P;  4ZXG A;  2LNT A;  3D21 A;  2H73 A;  4F9Z A;  1A23 A;  4HJM A;  3EIN A;  2PN8 A;  2M46 A;  4GXZ A;  4IP1 A;  4GRF A;  3WT2 A;  2YPM A;  1B4Q A;  2RM6 A;  2C3N A;  4YAV A;  1EP7 A;  2GZZ A;  1R26 A;  3JCM L;  1AW9 A;  2B5X A;  5J5N A;  3LXT A;  5HFG A;  5AIX A;  1SKW B;  2JSZ A;  5KN2 A;  1EV4 A;  4I2U A;  4JBB A;  4XRA A;  2LQQ A;  5J9B A;  2YNX A;  4PUR A;  5DBQ A;  1IYH A;  5CAX A;  2DSA A;  4FIW A;  1MDJ A;  5CRW A;  3MSZ A;  5B6M A;  1JZR A;  1S3D A;  1T4Y A;  1BJX A;  4ACS A;  1FB6 A;  4X43 A;  2H6Z A;  3D6I A;  5DCG A;  4P3Y B;  5DJM A;  5DVB A;  2GSR A;  1T7P B;  2NDO A;  2WGR A;  3P2A A;  3TKR A;  3VPT A;  2B7K A;  2O87 A;  2RUE A;  4BA7 A;  4KSM A;  2L4Q A;  4PNG A;  2VLV A;  11GS A;  4LL1 B;  4Q5N A;  3O6T A;  4BVX A;  4WF5 A;  1HNB A;  2H8L A;  1NW2 A;  4EUY A;  1K0A A;  3L78 A;  1T1V A;  1EEJ A;  3C1R A;  1E2Y A;  1VRS D;  5B6N A;  3UL3 A;  4TVE A;  1O6J A;  2LRT A;  4XTS A;  2QC7 A;  4MCU A;  2V32 A;  3DRN A;  3OR5 A;  2HZE A;  2I3Y A;  1SK2 A;  4O32 A;  2N5A A;  1OVN A;  5G30 A;  1YZX A;  2HSY A;  2GQL A;  2CX4 A;  2VCX A;  4IGJ A;  2YCD A;  2DIY A;  1J08 A;  3AY8 A;  5JCU A;  5CNW A;  4K1F A;  5DAK A;  4V2N A;  4K7O A;  2WB9 A;  1GUH A;  2GT5 A;  1GTA A;  1SJ6 A;  1CQH A;  2DJ3 A;  2VCZ A;  2BTO T;  4IJI A;  1Y6E A;  3VI7 A;  3F8U A;  3ZZX A;  5KEJ A;  3GL5 A;  4JED A;  2QSI A;  4GTU A;  5C04 A;  3ZRE A;  7GSS A;  3FZ4 A;  4JE1 A;  3HCZ A;  4BPY A;  3CSI A;  1UC7 A;  1MEK A;  3APS A;  5IMZ A;  5E4W A;  3KP9 A;  2K18 A;  4V1A g;  5CRG A;  4N30 A;  1U87 A;  4V2L A;  4YQM A;  2MMO A;  1M9A A;  4X0X A;  1O7U A;  2B3S A;  4QL7 A;  5D73 A;  3QAW A;  2H19 A;  1GTI A;  2ZCT A;  2XHF A;  1JLV A;  4L5L A;  1X0R A;  3IPZ A;  3WD6 A;  3GH9 A;  5IO2 A;  2CT6 A;  2LJA A;  2RUF A;  5J3R A;  2JZT A;  3ZMK A;  2JSY A;  2I1U A;  5JCW A;  3KP8 A;  3L9V A;  4HZ4 A;  4TKY A;  1XFL A;  2DMM A;  2XPD A;  3HKR A;  3ZLP A;  1ERT A;  1B9Y C;  14GS A;  1TRU A;  2C8U A;  2FA4 A;  2PER A;  5DDL A;  3RAZ A;  4NV2 A;  1A2M A;  2HRN A;  2VD1 A;  3QFB C;  4AJ7 A;  4DSS B;  3DVX A;  2LUS A;  1JHB A;  4TR1 A;  4IVF A;  2HZE B;  2VIM A;  4PUA A;  3HJP A;  2KP1 A;  1TI3 A;  1VF4 A;  5DAL A;  2XBI A;  3R2Q A;  1BED A;  2D2Z A;  3HXS A;  2LST A;  9GSS A;  4PUF C;  5JWO B;  3IE3 A;  3QMX A;  4IQA A;  1GSS A;  2JU5 A;  6GST A;  3M9J A;  1K0N A;  3FY7 A;  1G7E A;  3D22 A;  1AQX A;  5EY6 A;  3TJK A;  1DE1 A;  5IOX A;  3GRX A;  2N5F A;  3GKK A;  4WBR D;  2XC2 A;  1F3B A;  1PGT A;  5HFK A;  3IK7 A;  3F63 A;  4MK3 A;  3UBK A;  2IN3 A;  4KH7 A;  3GV1 A;  3WGX A;  2YN1 A;  2IL3 A;  4RQR A;  4K0N A;  1Z6N A;  2V6O A;  1GRX A;  1V9W A;  5KN1 A;  2IMI A;  1PMT A;  1ZCP A;  4XS4 A;  4XS6 A;  4KND A;  4L0W A;  2IIY A;  3VPQ A;  2AHE A;  3IOS A;  3M1G A;  2K8V A;  1S3A A;  1FVK A;  4K7I A;  1YDK A;  2ZUP A;  4KDX A;  4ZB8 A;  4TXO A;  1KTE A;  3GL3 A;  2OBK A;  2X8G A;  1TP9 A;  4FO5 A;  1J9B A;  3KZQ A;  2NTO A;  4MF7 A;  4KA0 A;  1U3A A;  1K3L A;  3DXB A;  1JFU A;  1NM3 A;  4HU7 A;  4TR1 B;  2H1G A;  2I9H A;  3LWA A;  1OE7 A;  2IMK A;  1XVQ A;  1XWG A;  5ID2 B;  3FKF A;  3TCO A;  2EC4 A;  3I6A A;  4YAP A;  3UIW A;  4HZ2 A;  1ZMA A;  2CVD A;  2KLX A;  4KCE A;  2VCT A;  2OJL A;  4I5Q A;  3DYR A;  1OC3 A;  4L5O A;  4IHU A;  2BMX A;  4MLY A;  3EWL A;  1V58 A;  1PL1 A;  2C0E A;  2YZH A;  3C1S A;  2OAD A;  3P7X A;  19GS A;  1FO5 A;  3WGE A;  4GSN A;  1XWC A;  4MMM A;  1EEM A;  2H72 A;  4MDC A;  5JWQ B;  2PVQ A;  3GFK A;  3F3Q A;  1A2L A;  4OO5 A;  1PSQ A;  1ABA A;  1I5G A;  5A5K A;  2E7P A;  2KOK A;  3MNG A;  3A2X A;  3ERF A;  4WET A;  2V6K A;  2L6C A;  1YQ1 A;  1XOA A;  4BWS A;  1WP0 A;  4DEJ A;  4EVM A;  4AF2 A;  2DJ1 A;  2MMA A;  3ED3 A;  4XS4 B;  5ECS A;  1HD2 A;  1B4P A;  4O5R A;  4PX1 A;  5EPF A;  1SJI A;  1TU7 A;  4L8E A;  4TXO B;  3LJR A;  4I6X A;  1XXU A;  1FG4 A;  1ERU A;  2ES7 A;  3HVV A;  1H4O A;  2G0F A;  1WPI A;  4KGI A;  3TUE A;  16GS A;  2H30 A;  2X99 A;  2FHE A;  2WJU A;  3FRC A;  3LSZ A;  2Z9S A;  3IC4 A;  1YKA A;  5IMD A;  1TU8 A;  3APQ A;  3GIX A;  1TRW A;  4BL7 A;  2L59 A;  4WR4 A;  2L5L A;  5D8I A;  2B5E A;  1NHY A;  3DVW A;  2DC5 A;  3GH6 A;  4XCS A;  3PGT A;  3K8N A;  1Z9H A;  2IJY A;  5CP1 A;  4ISD A;  1PL2 A;  3VLN A;  1XCC A;  5ELG A;  3F6F A;  3VUR A;  5EL8 A;  1RW1 A;  1USB A;  5ECQ B;  4F0C A;  2DML A;  3RHC A;  2RII A;  4POK A;  4GWR A;  3ZL5 A;  5IPH A;  4IS0 A;  4IQ1 A;  3VFI A;  1GUK A;  3FW2 A;  1ZYQ B;  3O3T A;  5INY A;  2VAF A;  2PU9 C;  3HJO A;  4ZB6 A;  1SK0 A;  2F8F A;  1B48 A;  4E8H A;  5EVO A;  3H93 A;  2DBC A;  2MMZ A;  2H70 A;  1XIY A;  1Y25 A;  3S9F A;  5ECP B;  4I97 A;  2FCH A;  1U88 A;  1KEB A;  1PQN A;  3NZN A;  2LQO A;  2CZ3 A;  5GZZ B;  3DKS A;  2WRT A;  1SD9 A;  2ON7 A;  1PX6 A;  2H76 A;  1A8L A;  3IAS 2;  1MD4 A;  4ZL8 A;  5G5E A;  2I4A A;  1K0C A;  3ZML A;  1DSB A;  2YJH A;  2BJX A;  5IOW A;  5FT3 A;  1SU9 A;  3VI5 A;  5C00 A;  3CBU A;  3ZIV A;  1OE8 A;  4POB A;  3WYW A;  5F0G A;  1W4V A;  3EYT A;  3DEX A;  3FHK A;  3ZIT A;  2JZS A;  1BG5 A;  3IDV A;  3F4S A;  3H4K A;  2LV3 A;  3FR3 A;  1G7O A;  4HQS A;  1LJR A;  2VL3 A;  3D5J A;  4G9H A;  4ZBD A;  4KUN A;  2XPE A;  4BWQ A;  3M9K A;  3A2V A;  4OCF A;  4L0U A;  4K9Z A;  3RHB A;  22GS A;  1F37 A;  1SL1 B;  4EXJ A;  4CHS A;  1A2J A;  3EUR A;  2PVO C;  4ZBB A;  4RUV A;  5ECK B;  3GUR A;  2EIQ A;  4K0G A;  3TKP A;  2VM2 A;  4EF0 A;  3E9J B;  1GNW A;  3APO A;  5E59 A;  3TOU A;  2WUL A;  2H0I A;  5ELA A;  1V98 A;  2C0G A;  4OCE A;  3GX0 A;  1R5A A;  5A4V A;  3FK8 A;  1XBS A;  1HQO A;  3GUS A;  1X9S B;  4WXT A;  1PX7 A;  1AUC A;  4NV5 A;  1T4Z A;  4IP6 A;  3F4R A;  4YQV A;  2CQ9 A;  3KMN A;  5F8B A;  4ID0 A;  2LJR A;  2P0G A;  1NSW A;  5F05 A;  4TOP A;  2TRX A;  4ZL9 A;  3UJ1 A;  3DIE A;  1FW1 A;  4BVY A;  2WZ9 A;  5DJL A;  1FVJ A;  3FZ9 A;  3MAK A;  4YH2 A;  5AIV A;  1A8Y A;  2R4V A;  1TRS A;  4EE0 A;  3BD2 A;  3F3R A;  5LD0 A;  2O85 A;  2GTU A;  1Z7R A;  1Q4J A;  1GSY A;  2FY6 A;  3FZA A;  5ECO B;  4DSS A;  1WRY A;  1X5D A;  2K8S A;  4X1U A;  17GS A;  2ALB A;  5KN0 A;  4IW9 A;  4AJ6 A;  3KMO A;  3WGD A;  3IBH A;  1TK0 B;  2IMD A;  4K2D A;  3W8J A;  3HD5 A;  3H8Q A;  2QGV A;  1RK4 A;  3TRQ A;  2K9F A;  3IR4 A;  2FUG 2;  4MA9 A;  3G9B A;  5G31 A;  2G2Q A;  3HYP A;  4MH2 A;  3TRX A;  4HI7 A;  4J2F A;  4ZB9 A;  1VF1 A;  5DCH A;  1K0O A;  1GTB A;  2H75 A;  2IPA A;  1R7H A;  2V41 A;  5AN1 A;  4ECJ A;  2VD0 A;  2DJJ A;  2R2J A;  3LYP A;  5COH A;  3RDW A;  1R5P A;  5CRE A;  2DIZ A;  3V1W A;  2FWE A;  4K7N A;  3EMP A;  3GHA A;  2H0G A;  3TGZ A;  5ECL B;  5ECI B;  2DJ0 A;  1GSE A;  3I69 A;  5HR2 A;  3LOR A;  3H1N A;  4NHW A;  5IIZ A;  2OAC A;  4NXI A;  4EO3 A;  4KSO A;  3KXO A;  1N8J A;  4MAB A;  1K3Y A;  4ZBA A;  5HFI A;  4AGS A;  1OC9 B;  3C71 A;  2HNL A;  5AIS A;  1M2A A;  1TKD B;  1LU4 A;  5GST A;  1PKZ A;  1PKW A;  1YEX A;  1M2B A;  1A24 A;  1THX A;  4MZB A;  2GZY A;  4GF0 A;  2A2S A;  3E3E A;  4GQC A;  5D96 A;  4GQF A;  5CO3 A;  5ECR B;  1R4W A;  1AIU A;  2H1A A;  2L6D A;  1F3A A;  1B8X A;  1O8W A;  2HFD A;  2LTK A;  4HJ2 A;  1X9M B;  5G1K A;  5ID2 A;  3DGQ A;  2GSS A;  3TJG A;  3G7J A;  3QDN A;  2EIR A;  3Q6O A;  2VO4 A;  3L4N A;  4ZIJ A;  3N5O A;  3UBL A;  4XIH A;  20GS A;  5F06 A;  1GWC A;  2FWH A;  2GQK A;  2OE1 A;  2AYT A;  4HU9 A;  1SL0 B;  1N2A A;  1YF1 A;  1FAA A;  5IMC A;  4N11 A;  2PBJ A;  5JWR B;  2R6K A;  4XHM A;  2HYX A;  4Q5F A;  3IXR A;  2H6Y A;  10GS A;  2B1K A;  2H0H A;  1QXH A;  5AGY A;  2YV7 A;  1XZO A;  3GKN A;  2I81 A;  2VLT A;  5HR1 A;  3H79 A;  2LNS A;  2ON5 A;  5ECM B;  1OC8 A;  2GSQ A;  2KUC A;  5H5R A;  2C1Y A;  2H01 A;  2HRF A;  3HA9 A;  2O89 A;  3CSJ A;  1EOH A;  3CRU A;  1M99 A;  1K0M A;  2DJK A;  2VLU A;  1EOG A;  2H1B A;  3Q18 A;  5ECN B;  1WIK A;  4GLT A;  5FWG A;  4OMV A;  4K6X A;  4KDU A;  3UEM A;  18GS A;  1HYU A;  3BOA A;  1XPV A;  3WT1 A;  4N10 A;  1F9M A;  2R3X A;  4OFM A;  1LBK A;  3LXZ A;  4CDO A;  2YV9 A;  3US3 A;  4J56 E;  4OO4 A;  4KW6 A;  1TXX A;  3GMF A;  5CRD A;  4D73 A;  2VOC A;  4CW9 A;  3UVT A;  2X64 A;  4AJ8 A;  2VL9 A;  3KH7 A;  2OA7 A;  1GL8 A;  4GSS A;  4EL1 A;  4MP4 A;  3U6V A;  1GSQ A;  2JL4 A;  12GS A;  1XW5 A;  1QGV A;  4MJC A;  4TW5 A;  5DQS A;  4F82 A;  1TW9 A;  4PQH A;  3UMA A;  3C73 A;  1VF3 A;  3P90 A;  3ZVJ A;  4Q5R A;  2MMN A;  3KCM A;  2IMF A;  3TKS E;  2J23 A;  2IFQ A;  3U5R E;  5DQY A;  2MZC A;  2F8A A;  2QKE A;  4LA1 A;  3QR6 A;  3KTB A;  1GTU A;  3LFL A;  1TI1 A;  4JZQ A;  3CXG A;  2PWJ A;  3CRT A;  2GS3 A;  3GYK A;  3UOM A;  1EGR A;  3LQ7 A;  5IMV A;  3IK9 A;  3HHV A;  1GLP A;  2WDU A;  2PGT A;  13GS A;  2YP6 A;  2YAN A;  4FYU A;  2NPB A;  5IO0 A;  1O73 A;  1UVZ A;  6GSY A;  3VWX A;  1C72 A;  3TKS C;  3QAV A;  1TDI A;  2C80 A;  2C3Q A;  1X5C A;  1OKT A;  3KD0 A;  3A2W A;  1DE2 A;  4DSQ A;  1ZZY A;  1GSD A;  2FGX A;  2OBI A;  1H75 A;  3ZVJ D;  1SD8 A;  4EKZ A;  2C0F A;  3ZFL A;  5GAN D;  4D73 B;  3I9V 2;  2X8C A;  4KAE A;  3F6D A;  2H6X A;  3HDC A;  4FYB A;  5D93 A;  1PA3 A;  1YKC A;  4OWY A;  3EVI A;  4KE3 A;  2AUV A;  3KJY A;  2JAC A;  2A2R A;  1BX9 A;  1MTC A;  3D4M A;  1M9B A;  4MJA A;  1YF0 A;  1ST9 A;  3NOF A;  2IFQ B;  1EGO A;  1WOU A;  1U3I A;  3QPM A;  4O92 A;  1O81 A;  6GSV A;  4RI6 A;  1QUW A;  4JR4 A;  1GH2 A;  5ENU A;  2AB6 A;  3FR9 A;  5A4U A;  4XS1 A;  3FYG A;  4XRD A;  3FEU A;  4KX4 A;  2HT9 A;  4MZW A;  3D0Z A;  2FD3 A;  4HQZ A;  2M80 A;  5IQY A;  3EC3 A;  1WJK A;  3KTL A;  3VWU A;  3J7Y b;  3M8N A;  2LRC A;  5GAP D;  1YEP A;  2GDR A;  1SYR A;  4RI7 A;  1EV9 A;  2AAW A;  4N0Z A;  1HNC A;  3LGC A;  4POL A;  1M2D A;  1K3O A;  6GSW A;  4G2E A;  3IA1 A;  1B9X C;  3ISO A;  3GTU A;  3G7Y A;  1AC1 A;  3EE2 A;  3G7I A;  3TDG A;  2E2G A;  2FLS A;  4TR4 A;  2LEG A;  4NPB A;  3I43 A;  3Q19 A;  4WEY A;  2K6V A;  3RBT A;  3L9S A;  3PIN A;  2FWF A;  3BCK A;  3QAG A;  1JLW A;  2F3M A;  3ME8 A;  5ABR A;  1W89 A;  2XBQ A;  2CVK A;  2VCV A;  5J4U A; 
#chains in the Genus database with same CATH topology
 1KBN A;  1XG8 A;  1ZL9 A;  2RM5 A;  1ERW A;  1X9W B;  3LW9 A;  2CAQ A;  3HVN A;  3ZIJ A;  2YJ7 A;  3L9U A;  3ERG A;  1TRV A;  3BJ5 A;  3HVS A;  2L5O A;  2FA8 A;  1AXD A;  4ECC A;  2JAD A;  2B6M A;  4NMU A;  3KIJ A;  4O7H A;  5LNK e;  2VL2 C;  1S3C A;  4FYC A;  2F9S A;  2CAI A;  5FHI A;  4LLR A;  3IRA A;  4G0K A;  5H5S A;  3J7Y k;  1ZYE A;  1EWX A;  1XWB A;  4PQI A;  3ERW A;  1SEN A;  3N9J A;  2YWM A;  4ILF A;  3P8W A;  3QD9 A;  2ZNM A;  2YWO A;  1OC9 A;  3C7M A;  2LRN A;  2GLR A;  1M0U A;  3GTU B;  4PGT A;  3ZRD A;  4ZL7 A;  2NBS A;  2A4H A;  2EIO A;  2N5B A;  1PN9 A;  4K5S A;  1BYE A;  2VM1 A;  3LG6 A;  1ML6 A;  5F07 A;  4Z2U A;  3GNJ A;  1T8E B;  1V57 A;  4MPF A;  1MD3 A;  3HJM A;  3M3M A;  5CRH A;  4NWY A;  1M7T A;  3MDK A;  4F0B A;  2O8V B;  4ECB A;  5IMA A;  2HSH A;  1YJ6 A;  4EC0 A;  1AQV A;  4MJB A;  2R5G A;  3KM6 A;  1K0D A;  4IJ3 A;  4PTS A;  4ECI A;  1XWK A;  3HZ4 A;  3FZ5 A;  1GP1 A;  2LKU A;  1FOV A;  3LYK A;  1Z7P A;  3IV4 A;  1SL2 B;  2GGT A;  3SWL A;  3TB2 A;  1ERV A;  2RLI A;  5LCZ A;  2DJ2 A;  1Z3E A;  4F2I A;  1A0F A;  3TRP A;  3IHQ A;  1O8X A;  1PD2 1;  3GSS A;  1SKS B;  2DLX A;  4MF5 A;  4ULX A;  3QFA C;  5H5Q A;  1GUM A;  1TK5 B;  1ILO A;  2P31 A;  2C4J A;  1G0T A;  3CYN A;  4ML6 A;  5G2Z A;  3TOT A;  1URM A;  5L71 A;  2REM A;  2IWT A;  2GZP A;  3UVH A;  3GKM A;  5D9T A;  2HI7 A;  1BAY A;  2AJQ B;  4ZIL A;  1WMJ A;  1FOH A;  4FH8 A;  5J41 A;  3FMW A;  3RPP A;  2MYG A;  1T3B A;  1WWJ A;  4YKG A;  4QL9 A;  3F9U A;  4WKW A;  3ME7 A;  3F0I A;  1GSU A;  2L57 A;  2HSM A;  2YWN A;  2OE0 A;  3DWV A;  1MDK A;  1O85 A;  3DD3 A;  4LMW A;  1GSF A;  1J0F A;  4MJE A;  1HNA A;  4WBJ A;  3KGK A;  1Z6M A;  4TR0 A;  2P5Q A;  4A5P A;  3EU3 A;  1PFO A;  4X4J A;  5DAK B;  2PPT A;  3KEB A;  1XW6 A;  1F6M C;  1U6T A;  3W8S A;  4F03 A;  2C0D A;  1QFN A;  1KNG A;  4KB3 A;  3HY2 A;  1YY7 A;  6GSX A;  1TK8 B;  2LJK A;  1AAZ A;  3A5W A;  1ON4 A;  4N0V A;  4LMV A;  1AQW A;  4TRX A;  2CVB A;  4GST A;  2AV4 A;  2X4A A;  3TKQ A;  4JU5 A;  4HOJ A;  4KCA A;  4YKF A;  5ECH B;  5J9C A;  2X8H A;  2PMT A;  2H1D A;  2L4C A;  4MF6 A;  2NVL A;  2R37 A;  2TIR A;  4KDY A;  5KOX A;  8GSS A;  1XWA A;  1TOF A;  3QCP A;  3W6G A;  1TJD A;  2CX3 A;  2YOI A;  2V1M A;  4EDY A;  3BCI A;  4DSR A;  3VWW A;  1GNE A;  4Z7X A;  4NAX A;  3KH9 A;  3C8E A;  4HDE A;  1QMV A;  3IAM 2;  4I8B A;  1WE0 A;  3ZFB A;  3ZTL A;  4J57 E;  5CYY A;  2WFC A;  3Q74 A;  4WR5 A;  5G5F A;  1Z5Y E;  3TKS A;  2JZR A;  5D9V A;  2HE3 A;  1GLQ A;  4IEL A;  2YWI A;  5B8A A;  1XOB A;  3ZYW A;  2WCI A;  2CZ2 A;  4K8M A;  4OFT A;  3CMI A;  4Q5Q A;  4HSC X;  3EU4 A;  3GKX A;  3GST A;  5DAL B;  2MBS A;  1G6W A;  1NHO A;  4H86 A;  4IBP A;  2GQM A;  3HZ8 A;  2H74 A;  4V1A p;  2IME A;  1MDI A;  4GCI A;  4JRR A;  4IN0 A;  5IM9 A;  2A4V A;  3TJF A;  1OAZ A;  1T00 A;  5HR3 A;  2E2M A;  1DUG A;  5D9X A;  2O7K A;  4HUA A;  2HXK A;  4RQX A;  4MH3 A;  5D9W A;  4HS1 A;  1UA5 A;  1QK8 A;  2E0Q A;  4POM A;  4EDZ A;  4ML1 A;  1BQ7 A;  5B8B A;  2C3T A;  2YZU A;  1RQM A;  2HLS A;  1DBY A;  4PXO A;  3FR6 A;  2CV4 A;  3GN3 A;  3MWH A;  2H71 A;  4I2T A;  2R0G A;  1EP8 A;  4V2M A;  3NIV A;  1JZW A;  1IYI A;  4G10 A;  4OFN A;  1I9D A;  1JZO A;  1OYJ A;  4NHZ A;  4CY6 A;  2V2G A;  1G6Y A;  1UN2 A;  4MZC A;  3D4T A;  3GX8 A;  3UAP A;  3SBC A;  2J9H A;  2P5R A;  3O76 A;  3TJB A;  4PNF A;  4LL4 B;  3QOU A;  4YQU A;  2VUP A;  1Q98 A;  4TXV A;  4E8E A;  2HZF A;  2CA8 A;  2M72 A;  4WF4 A;  2DKI A;  1JZD A;  5A4W A;  3BBY A;  1CQG A;  3EMX A;  3M0F A;  6GSU A;  1SJZ A;  1GUL A;  5HQP A;  2GT6 A;  3GA4 A;  1FB0 A;  3F4T A;  2KHP A;  1XVW A;  1E6B A;  3TJJ A;  1F2E A;  4PQ1 A;  2FNO A;  1FHE A;  2WS2 A;  4G19 A;  3UAR A;  3PR8 A;  5IMF A;  3CTG A;  2TRC P;  3RPN A;  1EZK A;  2B5Y A;  3VK9 A;  4DVC A;  5GSS A;  3L0H A;  1X5E A;  3LEF A;  5B7C A;  3E0U A;  1K0B A;  2OE3 A;  1XW9 A;  5KN3 A;  2VCW A;  1ACV A;  1OKD A;  2VL2 A;  2F51 A;  2H66 A;  2VCQ A;  1SYX A;  2LS5 A;  3HVX A;  1THO A;  5BMU A;  1VF2 A;  1ZOF A;  4CY8 A;  1SKR B;  2B7J A;  4OD7 A;  4HEA 2;  4JR6 A;  2KP2 A;  4MNN A;  5HR0 A;  6GSS A;  2FWG A;  4TR3 A;  3VWV A;  1ZYP A;  2OKA A;  3DML A;  3A3T A;  4MPG A;  1ZGN A;  2B1L A;  1VGL A;  3CSH A;  1TTZ A;  5JCG A;  2GVP A;  1QQ2 A;  4IKH A;  2GST A;  4TN8 A;  2MBT A;  1PRX A;  1SK1 A;  3PH9 A;  4QQ7 A;  5G1L A;  3CTF A;  1V40 A;  5IPG A;  1V2A A;  2PUK C;  1A0R P;  4ZXG A;  2LNT A;  3D21 A;  2H73 A;  4F9Z A;  1A23 A;  4HJM A;  3EIN A;  2PN8 A;  2M46 A;  4GXZ A;  4IP1 A;  4GRF A;  3WT2 A;  2YPM A;  1B4Q A;  2RM6 A;  2C3N A;  4YAV A;  1EP7 A;  2GZZ A;  1R26 A;  3JCM L;  1AW9 A;  2B5X A;  5J5N A;  3LXT A;  5HFG A;  5AIX A;  1SKW B;  2JSZ A;  5KN2 A;  1EV4 A;  4I2U A;  4JBB A;  4XRA A;  2LQQ A;  5J9B A;  2YNX A;  4PUR A;  5DBQ A;  1IYH A;  5CAX A;  2DSA A;  4FIW A;  1MDJ A;  5CRW A;  3MSZ A;  5B6M A;  1JZR A;  1S3D A;  1T4Y A;  1BJX A;  4ACS A;  1FB6 A;  4X43 A;  2H6Z A;  3D6I A;  5DCG A;  4P3Y B;  5DJM A;  5DVB A;  2GSR A;  1T7P B;  2NDO A;  2WGR A;  3P2A A;  3TKR A;  4USS A;  3VPT A;  2B7K A;  2O87 A;  2RUE A;  4BA7 A;  4KSM A;  2L4Q A;  4PNG A;  2VLV A;  11GS A;  4LL1 B;  4Q5N A;  3O6T A;  4BVX A;  4WF5 A;  1HNB A;  2H8L A;  1NW2 A;  4EUY A;  1K0A A;  3L78 A;  1T1V A;  1EEJ A;  3C1R A;  1E2Y A;  2DKH A;  1VRS D;  5B6N A;  3UL3 A;  4TVE A;  1O6J A;  2LRT A;  4XTS A;  2QC7 A;  4MCU A;  2V32 A;  3DRN A;  3OR5 A;  2HZE A;  2I3Y A;  1SK2 A;  4O32 A;  2N5A A;  1OVN A;  5G30 A;  1YZX A;  2HSY A;  2GQL A;  2CX4 A;  2VCX A;  4IGJ A;  2YCD A;  2DIY A;  1J08 A;  3AY8 A;  5JCU A;  5CNW A;  4K1F A;  5DAK A;  4V2N A;  4K7O A;  2WB9 A;  1GUH A;  2GT5 A;  1GTA A;  1SJ6 A;  1CQH A;  2DJ3 A;  2VCZ A;  2BTO T;  4IJI A;  1Y6E A;  3VI7 A;  3F8U A;  3ZZX A;  5KEJ A;  3GL5 A;  4JED A;  2QSI A;  4GTU A;  5C04 A;  3ZRE A;  7GSS A;  3FZ4 A;  4JE1 A;  3HCZ A;  4BPY A;  1S3R A;  3CSI A;  1UC7 A;  1MEK A;  3APS A;  5IMZ A;  5E4W A;  3KP9 A;  2K18 A;  4V1A g;  5CRG A;  4N30 A;  1U87 A;  4G0I A;  4V2L A;  4YQM A;  2MMO A;  1M9A A;  4X0X A;  1O7U A;  2B3S A;  4QL7 A;  4BVY B;  5D73 A;  3QAW A;  2H19 A;  1GTI A;  2ZCT A;  2XHF A;  1JLV A;  4L5L A;  1X0R A;  3IPZ A;  3WD6 A;  3GH9 A;  4BVX B;  5IO2 A;  2CT6 A;  2LJA A;  2RUF A;  2HRK A;  2JZT A;  5J3R A;  3ZMK A;  2JSY A;  2I1U A;  5JCW A;  3KP8 A;  3L9V A;  4HZ4 A;  4TKY A;  1XFL A;  2DMM A;  2XPD A;  3HKR A;  3ZLP A;  1ERT A;  1B9Y C;  14GS A;  1TRU A;  2C8U A;  2FA4 A;  2PER A;  5DDL A;  3RAZ A;  4NV2 A;  1A2M A;  2HRN A;  2VD1 A;  3QFB C;  4AJ7 A;  4DSS B;  3DVX A;  2LUS A;  1JHB A;  4TR1 A;  4IVF A;  2HZE B;  2VIM A;  4PUA A;  3HJP A;  2KP1 A;  1TI3 A;  1VF4 A;  5DAL A;  2XBI A;  3R2Q A;  1BED A;  2D2Z A;  3HXS A;  2LST A;  9GSS A;  4PUF C;  5JWO B;  3IE3 A;  3QMX A;  4IQA A;  1GSS A;  2JU5 A;  6GST A;  3M9J A;  1K0N A;  3FY7 A;  1G7E A;  3D22 A;  1AQX A;  5EY6 A;  3TJK A;  1DE1 A;  5IOX A;  3GRX A;  2N5F A;  3GKK A;  4WBR D;  2XC2 A;  1F3B A;  1PGT A;  5HFK A;  3IK7 A;  3F63 A;  4MK3 A;  3UBK A;  2IN3 A;  4KH7 A;  3GV1 A;  3WGX A;  2YN1 A;  2IL3 A;  3IC8 A;  4RQR A;  4K0N A;  1Z6N A;  2V6O A;  1GRX A;  1V9W A;  5KN1 A;  2IMI A;  1PMT A;  1ZCP A;  4XS4 A;  4XS6 A;  3R3E A;  4KND A;  2IIY A;  4L0W A;  3VPQ A;  2AHE A;  3IOS A;  3M1G A;  2K8V A;  1S3A A;  1FVK A;  4K7I A;  4O5U A;  1YDK A;  2ZUP A;  4KDX A;  4ZB8 A;  4TXO A;  1KTE A;  3GL3 A;  2OBK A;  2X8G A;  1TP9 A;  4FO5 A;  1J9B A;  3KZQ A;  2NTO A;  4MF7 A;  4KA0 A;  1U3A A;  1K3L A;  3DXB A;  1JFU A;  1NM3 A;  4HU7 A;  4TR1 B;  2H1G A;  2I9H A;  3LWA A;  1OE7 A;  2IMK A;  1XVQ A;  1XWG A;  5ID2 B;  3FKF A;  3TCO A;  2EC4 A;  3I6A A;  4YAP A;  3UIW A;  4HZ2 A;  1ZMA A;  2CVD A;  2KLX A;  4KCE A;  2VCT A;  2OJL A;  4I5Q A;  3DYR A;  1OC3 A;  4L5O A;  4IHU A;  2BMX A;  4MLY A;  3EWL A;  1V58 A;  1PL1 A;  2C0E A;  2YZH A;  3C1S A;  2OAD A;  3P7X A;  19GS A;  1FO5 A;  3WGE A;  4GSN A;  1XWC A;  4MMM A;  1EEM A;  2H72 A;  4MDC A;  5JWQ B;  2PVQ A;  3GFK A;  3F3Q A;  1A2L A;  4OO5 A;  1PSQ A;  1ABA A;  1I5G A;  5A5K A;  2E7P A;  2KOK A;  3MNG A;  3A2X A;  3ERF A;  4WET A;  2V6K A;  2L6C A;  1YQ1 A;  1XOA A;  4BWS A;  1WP0 A;  4DEJ A;  4EVM A;  4AF2 A;  2DJ1 A;  2MMA A;  3ED3 A;  4XS4 B;  5ECS A;  1HD2 A;  1B4P A;  4O5R A;  4PX1 A;  5EPF A;  1SJI A;  1TU7 A;  4L8E A;  4TXO B;  3LJR A;  4I6X A;  1XXU A;  3PPU A;  1FG4 A;  1ERU A;  2ES7 A;  3HVV A;  1H4O A;  2G0F A;  1WPI A;  4KGI A;  3TUE A;  16GS A;  2H30 A;  2X99 A;  2FHE A;  2WJU A;  3FRC A;  3LSZ A;  2Z9S A;  3IC4 A;  1YKA A;  5IMD A;  1TU8 A;  3APQ A;  3GIX A;  1TRW A;  4BL7 A;  4FQU A;  2L59 A;  4WR4 A;  2L5L A;  5D8I A;  2B5E A;  1NHY A;  3DVW A;  2DC5 A;  3GH6 A;  4XCS A;  2UZ8 A;  3PGT A;  3K8N A;  1Z9H A;  2IJY A;  5CP1 A;  4ISD A;  1PL2 A;  3VLN A;  1XCC A;  5ELG A;  3F6F A;  3VUR A;  5EL8 A;  1RW1 A;  1USB A;  5ECQ B;  4F0C A;  2DML A;  3RHC A;  2RII A;  4POK A;  4GWR A;  3ZL5 A;  5IPH A;  4IS0 A;  3IHG A;  4IQ1 A;  3VFI A;  1GUK A;  3FW2 A;  1ZYQ B;  3O3T A;  5INY A;  2VAF A;  2PU9 C;  3HJO A;  4ZB6 A;  1SK0 A;  2F8F A;  1B48 A;  4E8H A;  5EVO A;  3H93 A;  2DBC A;  2MMZ A;  2H70 A;  1XIY A;  1Y25 A;  3S9F A;  5ECP B;  4I97 A;  2FCH A;  1U88 A;  1KEB A;  1PQN A;  3NZN A;  2LQO A;  2CZ3 A;  5GZZ B;  3DKS A;  2WRT A;  1SD9 A;  2ON7 A;  1PX6 A;  2H76 A;  1A8L A;  3IAS 2;  1MD4 A;  4ZL8 A;  5G5E A;  2I4A A;  1K0C A;  3ZML A;  1DSB A;  2YJH A;  2BJX A;  4BL7 B;  5IOW A;  5FT3 A;  1SU9 A;  3VI5 A;  5C00 A;  3CBU A;  3ZIV A;  1OE8 A;  4POB A;  3WYW A;  5F0G A;  1W4V A;  3EYT A;  3DEX A;  3FHK A;  3ZIT A;  2JZS A;  1BG5 A;  3IDV A;  3F4S A;  3H4K A;  2LV3 A;  3FR3 A;  1G7O A;  4HQS A;  1LJR A;  2VL3 A;  3D5J A;  4G9H A;  4ZBD A;  4KUN A;  2XPE A;  4BWQ A;  3CQF A;  3M9K A;  3A2V A;  4OCF A;  4L0U A;  4K9Z A;  3RHB A;  22GS A;  1F37 A;  1SL1 B;  4EXJ A;  4CHS A;  1A2J A;  3EUR A;  2PVO C;  4ZBB A;  4RUV A;  5ECK B;  3GUR A;  3MIX A;  2EIQ A;  4K0G A;  3TKP A;  2VM2 A;  4EF0 A;  3E9J B;  1GNW A;  3APO A;  5E59 A;  3TOU A;  2WUL A;  2H0I A;  5ELA A;  1V98 A;  2C0G A;  4OCE A;  3GX0 A;  1R5A A;  5A4V A;  3FK8 A;  1XBS A;  1HQO A;  3GUS A;  1X9S B;  4WXT A;  1PX7 A;  1AUC A;  4NV5 A;  1T4Z A;  4IP6 A;  3F4R A;  4YQV A;  2CQ9 A;  3KMN A;  3MYD A;  5F8B A;  4ID0 A;  2LJR A;  2P0G A;  5BRT A;  1NSW A;  5F05 A;  4TOP A;  2TRX A;  4ZL9 A;  3UJ1 A;  3DIE A;  1FW1 A;  4BVY A;  2WZ9 A;  5DJL A;  1FVJ A;  3FZ9 A;  3MAK A;  4YH2 A;  5AIV A;  1A8Y A;  2R4V A;  1TRS A;  4EE0 A;  3BD2 A;  3F3R A;  5LD0 A;  2O85 A;  2GTU A;  1Z7R A;  1Q4J A;  1GSY A;  2FY6 A;  3FZA A;  5ECO B;  4DSS A;  1WRY A;  1X5D A;  2K8S A;  4X1U A;  17GS A;  2ALB A;  5KN0 A;  4IW9 A;  4AJ6 A;  3KMO A;  3WGD A;  3IBH A;  1TK0 B;  2IMD A;  4K2D A;  3W8J A;  3HD5 A;  3H8Q A;  2QGV A;  1RK4 A;  3TRQ A;  2K9F A;  3IR4 A;  2FUG 2;  4MA9 A;  3G9B A;  1M3J A;  4KF9 A;  4K5R A;  5G31 A;  2G2Q A;  3HYP A;  4MH2 A;  3TRX A;  4HI7 A;  4J2F A;  4ZB9 A;  1VF1 A;  5DCH A;  2HRA A;  1K0O A;  1GTB A;  2H75 A;  2IPA A;  1R7H A;  2V41 A;  5AN1 A;  4ECJ A;  2VD0 A;  2DJJ A;  2R2J A;  3LYP A;  5COH A;  3RDW A;  1R5P A;  5CRE A;  2DIZ A;  3V1W A;  4Z2T A;  2FWE A;  1PN0 A;  4K7N A;  3EMP A;  3GHA A;  2H0G A;  3TGZ A;  5ECL B;  2QA1 A;  5ECI B;  2DJ0 A;  1GSE A;  3I69 A;  5HR2 A;  3LOR A;  1M3I A;  3H1N A;  4NHW A;  4K2X A;  5IIZ A;  2OAC A;  4NXI A;  4EO3 A;  4KSO A;  3KXO A;  5KOW A;  1N8J A;  4MAB A;  1K3Y A;  4ZBA A;  5HFI A;  4AGS A;  1OC9 B;  3C71 A;  2HNL A;  5AIS A;  1M2A A;  1TKD B;  1LU4 A;  5GST A;  1PKZ A;  1PKW A;  1YEX A;  1M2B A;  1A24 A;  1THX A;  4MZB A;  2GZY A;  4GF0 A;  2A2S A;  3E3E A;  4GQC A;  5D96 A;  4GQF A;  5CO3 A;  5ECR B;  1R4W A;  1AIU A;  2H1A A;  2L6D A;  1F3A A;  1B8X A;  1O8W A;  2HFD A;  2LTK A;  4HJ2 A;  1X9M B;  5G1K A;  5ID2 A;  3DGQ A;  2GSS A;  3TJG A;  3G7J A;  3QDN A;  2EIR A;  3Q6O A;  2VO4 A;  3L4N A;  2X49 A;  4ZIJ A;  3N5O A;  3UBL A;  4XIH A;  20GS A;  5F06 A;  1GWC A;  2FWH A;  2GQK A;  2OE1 A;  2AYT A;  4HU9 A;  1SL0 B;  2A2P A;  1N2A A;  1YF1 A;  1FAA A;  5IMC A;  4N11 A;  2PBJ A;  5JWR B;  2R6K A;  4XHM A;  2HYX A;  4Q5F A;  3IXR A;  2H6Y A;  10GS A;  2B1K A;  2H0H A;  1QXH A;  5AGY A;  2YV7 A;  1XZO A;  3GKN A;  2I81 A;  2VLT A;  5HR1 A;  3H79 A;  2LNS A;  2ON5 A;  5ECM B;  1OC8 A;  2GSQ A;  2KUC A;  5H5R A;  2C1Y A;  2H01 A;  2HRF A;  3HA9 A;  2O89 A;  3CSJ A;  1EOH A;  3CRU A;  1M99 A;  1K0M A;  2DJK A;  2VLU A;  1EOG A;  2H1B A;  3Q18 A;  5ECN B;  1WIK A;  4GLT A;  5FWG A;  4OMV A;  4K6X A;  4KDU A;  3UEM A;  18GS A;  1HYU A;  3BOA A;  1XPV A;  3WT1 A;  4N10 A;  1F9M A;  2R3X A;  4BIK A;  4OFM A;  1LBK A;  3LXZ A;  4CDO A;  2YV9 A;  3US3 A;  4J56 E;  4OO4 A;  4KW6 A;  1TXX A;  3GMF A;  5CRD A;  4D73 A;  2VOC A;  4CW9 A;  3UVT A;  2X64 A;  4AJ8 A;  2VL9 A;  3KH7 A;  2OA7 A;  1GL8 A;  4GSS A;  4EL1 A;  4MP4 A;  3U6V A;  1GSQ A;  2JL4 A;  12GS A;  1XW5 A;  1QGV A;  4MJC A;  4EIP A;  4TW5 A;  5DQS A;  4F82 A;  1TW9 A;  4PQH A;  4EIQ A;  3UMA A;  3C73 A;  1VF3 A;  3P90 A;  3ZVJ A;  4Q5R A;  2MMN A;  3KCM A;  2IMF A;  3TKS E;  4ICY A;  2J23 A;  2IFQ A;  3U5R E;  5DQY A;  2MZC A;  2F8A A;  2QKE A;  2R0P A;  4LA1 A;  3QR6 A;  3KTB A;  1GTU A;  3LFL A;  1TI1 A;  4JZQ A;  3CXG A;  2PWJ A;  3CRT A;  2GS3 A;  3GYK A;  3UOM A;  1EGR A;  3LQ7 A;  5IMV A;  3IK9 A;  3HHV A;  1GLP A;  2WDU A;  2PGT A;  13GS A;  2YP6 A;  2YAN A;  4FYU A;  2NPB A;  5IO0 A;  2QA2 A;  1O73 A;  1UVZ A;  6GSY A;  3VWX A;  1C72 A;  3TKS C;  3EPT A;  3QAV A;  1TDI A;  2C80 A;  2C3Q A;  1X5C A;  1OKT A;  3KD0 A;  3A2W A;  1DE2 A;  4DSQ A;  1ZZY A;  1GSD A;  2FGX A;  2OBI A;  1H75 A;  3ZVJ D;  1SD8 A;  4EKZ A;  2C0F A;  4Z2R A;  3ZFL A;  5GAN D;  4D73 B;  3I9V 2;  2X8C A;  4KAE A;  3F6D A;  2H6X A;  3HDC A;  4FYB A;  5D93 A;  1PA3 A;  1YKC A;  4OWY A;  3EVI A;  4KE3 A;  2AUV A;  3KJY A;  2JAC A;  2A2R A;  1BX9 A;  1MTC A;  3D4M A;  1M9B A;  4MJA A;  1YF0 A;  1ST9 A;  3NOF A;  2IFQ B;  1EGO A;  1WOU A;  1U3I A;  3QPM A;  4O92 A;  1O81 A;  6GSV A;  4RI6 A;  1QUW A;  4JR4 A;  1GH2 A;  5ENU A;  2AB6 A;  3FR9 A;  5A4U A;  4XS1 A;  3FYG A;  4XRD A;  3FEU A;  4KX4 A;  2HT9 A;  4MZW A;  4O5Q A;  3D0Z A;  2FD3 A;  4HQZ A;  2M80 A;  5IQY A;  3EC3 A;  1WJK A;  3KTL A;  3VWU A;  3J7Y b;  3M8N A;  2LRC A;  5GAP D;  1YEP A;  2GDR A;  1SYR A;  4RI7 A;  1EV9 A;  2AAW A;  4N0Z A;  1HNC A;  3LGC A;  4POL A;  2R0C A;  1ZYN A;  1M2D A;  1K3O A;  6GSW A;  4G2E A;  3IA1 A;  1B9X C;  3ISO A;  3GTU A;  3G7Y A;  4G0L A;  1AC1 A;  3EE2 A;  3G7I A;  3TDG A;  2E2G A;  2FLS A;  4TR4 A;  2LEG A;  4NPB A;  3I43 A;  3Q19 A;  4WEY A;  2K6V A;  3RBT A;  3L9S A;  3PIN A;  3A5I A;  2FWF A;  3BCK A;  3QAG A;  1JLW A;  2F3M A;  3ME8 A;  5ABR A;  1W89 A;  2XBQ A;  2CVK A;  2VCV A;  5J4U A; 
#chains in the Genus database with same CATH homology
 1KBN A;  1ZL9 A;  2RM5 A;  1ERW A;  1X9W B;  3LW9 A;  2CAQ A;  3ZIJ A;  2YJ7 A;  3L9U A;  3ERG A;  1TRV A;  3BJ5 A;  3HVS A;  2L5O A;  2FA8 A;  1AXD A;  4ECC A;  2JAD A;  2B6M A;  4NMU A;  3KIJ A;  4O7H A;  5LNK e;  2VL2 C;  1S3C A;  4FYC A;  2F9S A;  2CAI A;  5FHI A;  4LLR A;  3IRA A;  4G0K A;  5H5S A;  3J7Y k;  1ZYE A;  1EWX A;  1XWB A;  4PQI A;  3ERW A;  1SEN A;  3N9J A;  2YWM A;  4ILF A;  3P8W A;  3QD9 A;  2ZNM A;  2YWO A;  1OC9 A;  3C7M A;  2LRN A;  2GLR A;  1M0U A;  3GTU B;  4PGT A;  3ZRD A;  4ZL7 A;  2NBS A;  2A4H A;  2EIO A;  2N5B A;  1PN9 A;  4K5S A;  1BYE A;  2VM1 A;  3LG6 A;  1ML6 A;  5F07 A;  4Z2U A;  3GNJ A;  1T8E B;  1V57 A;  4MPF A;  1MD3 A;  3HJM A;  3M3M A;  5CRH A;  4NWY A;  1M7T A;  3MDK A;  4F0B A;  2O8V B;  4ECB A;  5IMA A;  2HSH A;  1YJ6 A;  4EC0 A;  1AQV A;  4MJB A;  2R5G A;  3KM6 A;  1K0D A;  4IJ3 A;  4PTS A;  4ECI A;  1XWK A;  3HZ4 A;  3FZ5 A;  1GP1 A;  2LKU A;  1FOV A;  3LYK A;  1Z7P A;  3IV4 A;  1SL2 B;  2GGT A;  3SWL A;  3TB2 A;  1ERV A;  2RLI A;  5LCZ A;  2DJ2 A;  1Z3E A;  4F2I A;  1A0F A;  3TRP A;  3IHQ A;  1O8X A;  1PD2 1;  3GSS A;  1SKS B;  2DLX A;  4MF5 A;  4ULX A;  3QFA C;  5H5Q A;  1GUM A;  1TK5 B;  1ILO A;  2P31 A;  2C4J A;  1G0T A;  3CYN A;  4ML6 A;  5G2Z A;  3TOT A;  1URM A;  5L71 A;  2REM A;  2IWT A;  2GZP A;  3UVH A;  3GKM A;  5D9T A;  2HI7 A;  1BAY A;  2AJQ B;  4ZIL A;  1WMJ A;  1FOH A;  4FH8 A;  5J41 A;  3FMW A;  3RPP A;  2MYG A;  1T3B A;  1WWJ A;  4YKG A;  4QL9 A;  3F9U A;  4WKW A;  3ME7 A;  3F0I A;  1GSU A;  2L57 A;  2HSM A;  2YWN A;  2OE0 A;  3DWV A;  1MDK A;  1O85 A;  3DD3 A;  4LMW A;  1GSF A;  1J0F A;  4MJE A;  1HNA A;  4WBJ A;  3KGK A;  1Z6M A;  4TR0 A;  2P5Q A;  4A5P A;  3EU3 A;  4X4J A;  5DAK B;  2PPT A;  3KEB A;  1XW6 A;  1F6M C;  1U6T A;  3W8S A;  4F03 A;  2C0D A;  1QFN A;  1KNG A;  4KB3 A;  3HY2 A;  1YY7 A;  6GSX A;  1TK8 B;  2LJK A;  1AAZ A;  3A5W A;  1ON4 A;  4N0V A;  4LMV A;  1AQW A;  4TRX A;  2CVB A;  4GST A;  2AV4 A;  2X4A A;  3TKQ A;  4JU5 A;  4HOJ A;  4KCA A;  4YKF A;  5ECH B;  5J9C A;  2X8H A;  2PMT A;  2H1D A;  2L4C A;  4MF6 A;  2NVL A;  2R37 A;  2TIR A;  4KDY A;  5KOX A;  8GSS A;  1XWA A;  1TOF A;  3QCP A;  3W6G A;  1TJD A;  2CX3 A;  2YOI A;  2V1M A;  4EDY A;  3BCI A;  4DSR A;  3VWW A;  1GNE A;  4Z7X A;  4NAX A;  3KH9 A;  3C8E A;  4HDE A;  1QMV A;  3IAM 2;  4I8B A;  1WE0 A;  3ZFB A;  3ZTL A;  4J57 E;  5CYY A;  2WFC A;  3Q74 A;  4WR5 A;  5G5F A;  1Z5Y E;  3TKS A;  2JZR A;  5D9V A;  2HE3 A;  1GLQ A;  4IEL A;  2YWI A;  5B8A A;  1XOB A;  3ZYW A;  2WCI A;  2CZ2 A;  4K8M A;  4OFT A;  3CMI A;  4Q5Q A;  3EU4 A;  3GKX A;  3GST A;  5DAL B;  2MBS A;  1G6W A;  1NHO A;  4H86 A;  4IBP A;  2GQM A;  3HZ8 A;  2H74 A;  4V1A p;  2IME A;  1MDI A;  4GCI A;  4JRR A;  4IN0 A;  5IM9 A;  2A4V A;  3TJF A;  1OAZ A;  1T00 A;  5HR3 A;  2E2M A;  1DUG A;  5D9X A;  2O7K A;  4HUA A;  2HXK A;  4RQX A;  4MH3 A;  5D9W A;  4HS1 A;  1UA5 A;  1QK8 A;  2E0Q A;  4POM A;  4EDZ A;  4ML1 A;  1BQ7 A;  5B8B A;  2C3T A;  2YZU A;  1RQM A;  2HLS A;  1DBY A;  4PXO A;  3FR6 A;  2CV4 A;  3GN3 A;  3MWH A;  2H71 A;  4I2T A;  2R0G A;  1EP8 A;  4V2M A;  3NIV A;  1JZW A;  1IYI A;  4G10 A;  4OFN A;  1I9D A;  1JZO A;  1OYJ A;  4NHZ A;  4CY6 A;  2V2G A;  1G6Y A;  1UN2 A;  4MZC A;  3D4T A;  3GX8 A;  3UAP A;  3SBC A;  2J9H A;  2P5R A;  3O76 A;  3TJB A;  4PNF A;  4LL4 B;  3QOU A;  4YQU A;  2VUP A;  1Q98 A;  4TXV A;  4E8E A;  2HZF A;  2CA8 A;  2M72 A;  4WF4 A;  2DKI A;  1JZD A;  5A4W A;  3BBY A;  1CQG A;  3EMX A;  3M0F A;  6GSU A;  1SJZ A;  1GUL A;  5HQP A;  2GT6 A;  3GA4 A;  1FB0 A;  3F4T A;  2KHP A;  1XVW A;  1E6B A;  3TJJ A;  1F2E A;  4PQ1 A;  2FNO A;  1FHE A;  2WS2 A;  4G19 A;  3UAR A;  3PR8 A;  5IMF A;  3CTG A;  2TRC P;  3RPN A;  1EZK A;  2B5Y A;  3VK9 A;  4DVC A;  5GSS A;  3L0H A;  1X5E A;  3LEF A;  5B7C A;  3E0U A;  1K0B A;  2OE3 A;  1XW9 A;  5KN3 A;  2VCW A;  1ACV A;  1OKD A;  2VL2 A;  2F51 A;  2H66 A;  2VCQ A;  1SYX A;  2LS5 A;  3HVX A;  1THO A;  5BMU A;  1VF2 A;  1ZOF A;  4CY8 A;  1SKR B;  2B7J A;  4OD7 A;  4HEA 2;  4JR6 A;  2KP2 A;  4MNN A;  5HR0 A;  6GSS A;  2FWG A;  4TR3 A;  3VWV A;  1ZYP A;  2OKA A;  3DML A;  3A3T A;  4MPG A;  1ZGN A;  2B1L A;  1VGL A;  3CSH A;  1TTZ A;  5JCG A;  2GVP A;  1QQ2 A;  4IKH A;  2GST A;  4TN8 A;  2MBT A;  1PRX A;  1SK1 A;  3PH9 A;  4QQ7 A;  5G1L A;  3CTF A;  1V40 A;  5IPG A;  1V2A A;  2PUK C;  1A0R P;  4ZXG A;  2LNT A;  3D21 A;  2H73 A;  4F9Z A;  1A23 A;  4HJM A;  3EIN A;  2PN8 A;  2M46 A;  4GXZ A;  4IP1 A;  4GRF A;  3WT2 A;  2YPM A;  1B4Q A;  2RM6 A;  2C3N A;  4YAV A;  1EP7 A;  2GZZ A;  1R26 A;  3JCM L;  1AW9 A;  2B5X A;  5J5N A;  3LXT A;  5HFG A;  5AIX A;  1SKW B;  2JSZ A;  5KN2 A;  1EV4 A;  4I2U A;  4JBB A;  4XRA A;  2LQQ A;  5J9B A;  2YNX A;  4PUR A;  5DBQ A;  1IYH A;  5CAX A;  2DSA A;  4FIW A;  1MDJ A;  5CRW A;  3MSZ A;  5B6M A;  1JZR A;  1S3D A;  1T4Y A;  1BJX A;  4ACS A;  1FB6 A;  4X43 A;  2H6Z A;  3D6I A;  5DCG A;  4P3Y B;  5DJM A;  5DVB A;  2GSR A;  1T7P B;  2NDO A;  2WGR A;  3P2A A;  3TKR A;  4USS A;  3VPT A;  2B7K A;  2O87 A;  2RUE A;  4BA7 A;  4KSM A;  2L4Q A;  4PNG A;  2VLV A;  11GS A;  4LL1 B;  4Q5N A;  3O6T A;  4BVX A;  4WF5 A;  1HNB A;  2H8L A;  1NW2 A;  4EUY A;  1K0A A;  3L78 A;  1T1V A;  1EEJ A;  3C1R A;  1E2Y A;  2DKH A;  1VRS D;  5B6N A;  3UL3 A;  4TVE A;  1O6J A;  2LRT A;  4XTS A;  2QC7 A;  4MCU A;  2V32 A;  3DRN A;  3OR5 A;  2HZE A;  2I3Y A;  1SK2 A;  4O32 A;  2N5A A;  1OVN A;  5G30 A;  1YZX A;  2HSY A;  2GQL A;  2CX4 A;  2VCX A;  4IGJ A;  2YCD A;  2DIY A;  1J08 A;  3AY8 A;  5JCU A;  5CNW A;  4K1F A;  5DAK A;  4V2N A;  4K7O A;  2WB9 A;  1GUH A;  2GT5 A;  1GTA A;  1SJ6 A;  1CQH A;  2DJ3 A;  2VCZ A;  2BTO T;  4IJI A;  1Y6E A;  3VI7 A;  3F8U A;  3ZZX A;  5KEJ A;  3GL5 A;  4JED A;  2QSI A;  4GTU A;  5C04 A;  3ZRE A;  7GSS A;  3FZ4 A;  4JE1 A;  3HCZ A;  4BPY A;  3CSI A;  1UC7 A;  1MEK A;  3APS A;  5IMZ A;  5E4W A;  3KP9 A;  2K18 A;  4V1A g;  5CRG A;  4N30 A;  1U87 A;  4G0I A;  4V2L A;  4YQM A;  2MMO A;  1M9A A;  4X0X A;  1O7U A;  2B3S A;  4QL7 A;  4BVY B;  5D73 A;  3QAW A;  2H19 A;  1GTI A;  2ZCT A;  2XHF A;  1JLV A;  4L5L A;  1X0R A;  3IPZ A;  3WD6 A;  3GH9 A;  4BVX B;  5IO2 A;  2CT6 A;  2LJA A;  2RUF A;  2HRK A;  2JZT A;  5J3R A;  3ZMK A;  2JSY A;  2I1U A;  5JCW A;  3KP8 A;  3L9V A;  4HZ4 A;  4TKY A;  1XFL A;  2DMM A;  2XPD A;  3HKR A;  3ZLP A;  1ERT A;  1B9Y C;  14GS A;  1TRU A;  2C8U A;  2FA4 A;  2PER A;  5DDL A;  3RAZ A;  4NV2 A;  1A2M A;  2HRN A;  2VD1 A;  3QFB C;  4AJ7 A;  4DSS B;  3DVX A;  2LUS A;  1JHB A;  4TR1 A;  4IVF A;  2HZE B;  2VIM A;  4PUA A;  3HJP A;  2KP1 A;  1TI3 A;  1VF4 A;  5DAL A;  2XBI A;  3R2Q A;  1BED A;  2D2Z A;  3HXS A;  2LST A;  9GSS A;  4PUF C;  5JWO B;  3IE3 A;  3QMX A;  4IQA A;  1GSS A;  2JU5 A;  6GST A;  3M9J A;  1K0N A;  3FY7 A;  1G7E A;  3D22 A;  1AQX A;  5EY6 A;  3TJK A;  1DE1 A;  5IOX A;  3GRX A;  2N5F A;  3GKK A;  4WBR D;  2XC2 A;  1F3B A;  1PGT A;  5HFK A;  3IK7 A;  3F63 A;  4MK3 A;  3UBK A;  2IN3 A;  4KH7 A;  3GV1 A;  3WGX A;  2YN1 A;  2IL3 A;  3IC8 A;  4RQR A;  4K0N A;  1Z6N A;  2V6O A;  1GRX A;  1V9W A;  5KN1 A;  2IMI A;  1PMT A;  1ZCP A;  4XS4 A;  4XS6 A;  3R3E A;  4KND A;  2IIY A;  4L0W A;  3VPQ A;  2AHE A;  3IOS A;  3M1G A;  2K8V A;  1S3A A;  1FVK A;  4K7I A;  4O5U A;  1YDK A;  2ZUP A;  4KDX A;  4ZB8 A;  4TXO A;  1KTE A;  3GL3 A;  2OBK A;  2X8G A;  1TP9 A;  4FO5 A;  1J9B A;  3KZQ A;  2NTO A;  4MF7 A;  4KA0 A;  1U3A A;  1K3L A;  3DXB A;  1JFU A;  1NM3 A;  4HU7 A;  4TR1 B;  2H1G A;  2I9H A;  3LWA A;  1OE7 A;  2IMK A;  1XVQ A;  1XWG A;  5ID2 B;  3FKF A;  3TCO A;  2EC4 A;  3I6A A;  4YAP A;  3UIW A;  4HZ2 A;  1ZMA A;  2CVD A;  2KLX A;  4KCE A;  2VCT A;  2OJL A;  4I5Q A;  3DYR A;  1OC3 A;  4L5O A;  4IHU A;  2BMX A;  4MLY A;  3EWL A;  1V58 A;  1PL1 A;  2C0E A;  2YZH A;  3C1S A;  2OAD A;  3P7X A;  19GS A;  1FO5 A;  3WGE A;  4GSN A;  1XWC A;  4MMM A;  1EEM A;  2H72 A;  4MDC A;  5JWQ B;  2PVQ A;  3GFK A;  3F3Q A;  1A2L A;  4OO5 A;  1PSQ A;  1ABA A;  1I5G A;  5A5K A;  2E7P A;  2KOK A;  3MNG A;  3A2X A;  3ERF A;  4WET A;  2V6K A;  2L6C A;  1YQ1 A;  1XOA A;  4BWS A;  1WP0 A;  4DEJ A;  4EVM A;  4AF2 A;  2DJ1 A;  2MMA A;  3ED3 A;  4XS4 B;  5ECS A;  1HD2 A;  1B4P A;  4O5R A;  4PX1 A;  5EPF A;  1SJI A;  1TU7 A;  4L8E A;  4TXO B;  3LJR A;  4I6X A;  1XXU A;  3PPU A;  1FG4 A;  1ERU A;  2ES7 A;  3HVV A;  1H4O A;  2G0F A;  1WPI A;  4KGI A;  3TUE A;  16GS A;  2H30 A;  2X99 A;  2FHE A;  2WJU A;  3FRC A;  3LSZ A;  2Z9S A;  3IC4 A;  1YKA A;  5IMD A;  1TU8 A;  3APQ A;  3GIX A;  1TRW A;  4BL7 A;  4FQU A;  2L59 A;  4WR4 A;  2L5L A;  5D8I A;  2B5E A;  1NHY A;  3DVW A;  2DC5 A;  3GH6 A;  4XCS A;  2UZ8 A;  3PGT A;  3K8N A;  1Z9H A;  2IJY A;  5CP1 A;  4ISD A;  1PL2 A;  3VLN A;  1XCC A;  5ELG A;  3F6F A;  3VUR A;  5EL8 A;  1RW1 A;  1USB A;  5ECQ B;  4F0C A;  2DML A;  3RHC A;  2RII A;  4POK A;  4GWR A;  3ZL5 A;  5IPH A;  4IS0 A;  3IHG A;  4IQ1 A;  3VFI A;  1GUK A;  3FW2 A;  1ZYQ B;  3O3T A;  5INY A;  2VAF A;  2PU9 C;  3HJO A;  4ZB6 A;  1SK0 A;  2F8F A;  1B48 A;  4E8H A;  5EVO A;  3H93 A;  2DBC A;  2MMZ A;  2H70 A;  1XIY A;  1Y25 A;  3S9F A;  5ECP B;  4I97 A;  2FCH A;  1U88 A;  1KEB A;  1PQN A;  3NZN A;  2LQO A;  2CZ3 A;  5GZZ B;  3DKS A;  2WRT A;  1SD9 A;  2ON7 A;  1PX6 A;  2H76 A;  1A8L A;  3IAS 2;  1MD4 A;  4ZL8 A;  5G5E A;  2I4A A;  1K0C A;  3ZML A;  1DSB A;  2YJH A;  2BJX A;  4BL7 B;  5IOW A;  5FT3 A;  1SU9 A;  3VI5 A;  5C00 A;  3CBU A;  3ZIV A;  1OE8 A;  4POB A;  3WYW A;  5F0G A;  1W4V A;  3EYT A;  3DEX A;  3FHK A;  3ZIT A;  2JZS A;  1BG5 A;  3IDV A;  3F4S A;  3H4K A;  2LV3 A;  3FR3 A;  1G7O A;  4HQS A;  1LJR A;  2VL3 A;  3D5J A;  4G9H A;  4ZBD A;  4KUN A;  2XPE A;  4BWQ A;  3M9K A;  3A2V A;  4OCF A;  4L0U A;  4K9Z A;  3RHB A;  22GS A;  1F37 A;  1SL1 B;  4EXJ A;  4CHS A;  1A2J A;  3EUR A;  2PVO C;  4ZBB A;  4RUV A;  5ECK B;  3GUR A;  3MIX A;  2EIQ A;  4K0G A;  3TKP A;  2VM2 A;  4EF0 A;  3E9J B;  1GNW A;  3APO A;  5E59 A;  3TOU A;  2WUL A;  2H0I A;  5ELA A;  1V98 A;  2C0G A;  4OCE A;  3GX0 A;  1R5A A;  5A4V A;  3FK8 A;  1XBS A;  1HQO A;  3GUS A;  1X9S B;  4WXT A;  1PX7 A;  1AUC A;  4NV5 A;  1T4Z A;  4IP6 A;  3F4R A;  4YQV A;  2CQ9 A;  3KMN A;  3MYD A;  5F8B A;  4ID0 A;  2LJR A;  2P0G A;  5BRT A;  1NSW A;  5F05 A;  4TOP A;  2TRX A;  4ZL9 A;  3UJ1 A;  3DIE A;  1FW1 A;  4BVY A;  2WZ9 A;  5DJL A;  1FVJ A;  3FZ9 A;  3MAK A;  4YH2 A;  5AIV A;  1A8Y A;  2R4V A;  1TRS A;  4EE0 A;  3BD2 A;  3F3R A;  5LD0 A;  2O85 A;  2GTU A;  1Z7R A;  1Q4J A;  1GSY A;  2FY6 A;  3FZA A;  5ECO B;  4DSS A;  1WRY A;  1X5D A;  2K8S A;  4X1U A;  17GS A;  2ALB A;  5KN0 A;  4IW9 A;  4AJ6 A;  3KMO A;  3WGD A;  3IBH A;  1TK0 B;  2IMD A;  4K2D A;  3W8J A;  3HD5 A;  3H8Q A;  2QGV A;  1RK4 A;  3TRQ A;  2K9F A;  3IR4 A;  2FUG 2;  4MA9 A;  3G9B A;  4KF9 A;  4K5R A;  5G31 A;  2G2Q A;  3HYP A;  4MH2 A;  3TRX A;  4HI7 A;  4J2F A;  4ZB9 A;  1VF1 A;  5DCH A;  2HRA A;  1K0O A;  1GTB A;  2H75 A;  2IPA A;  1R7H A;  2V41 A;  5AN1 A;  4ECJ A;  2VD0 A;  2DJJ A;  2R2J A;  3LYP A;  5COH A;  3RDW A;  1R5P A;  5CRE A;  2DIZ A;  3V1W A;  4Z2T A;  2FWE A;  1PN0 A;  4K7N A;  3EMP A;  3GHA A;  2H0G A;  3TGZ A;  5ECL B;  2QA1 A;  5ECI B;  2DJ0 A;  1GSE A;  3I69 A;  5HR2 A;  3LOR A;  3H1N A;  4NHW A;  4K2X A;  5IIZ A;  2OAC A;  4NXI A;  4EO3 A;  4KSO A;  3KXO A;  5KOW A;  1N8J A;  4MAB A;  1K3Y A;  4ZBA A;  5HFI A;  4AGS A;  1OC9 B;  3C71 A;  2HNL A;  5AIS A;  1M2A A;  1TKD B;  1LU4 A;  5GST A;  1PKZ A;  1PKW A;  1YEX A;  1M2B A;  1A24 A;  1THX A;  4MZB A;  2GZY A;  4GF0 A;  2A2S A;  3E3E A;  4GQC A;  5D96 A;  4GQF A;  5CO3 A;  5ECR B;  1R4W A;  1AIU A;  2H1A A;  2L6D A;  1F3A A;  1B8X A;  1O8W A;  2HFD A;  2LTK A;  4HJ2 A;  1X9M B;  5G1K A;  5ID2 A;  3DGQ A;  2GSS A;  3TJG A;  3G7J A;  3QDN A;  2EIR A;  3Q6O A;  2VO4 A;  3L4N A;  2X49 A;  4ZIJ A;  3N5O A;  3UBL A;  4XIH A;  20GS A;  5F06 A;  1GWC A;  2FWH A;  2GQK A;  2OE1 A;  2AYT A;  4HU9 A;  1SL0 B;  2A2P A;  1N2A A;  1YF1 A;  1FAA A;  5IMC A;  4N11 A;  2PBJ A;  5JWR B;  2R6K A;  4XHM A;  2HYX A;  4Q5F A;  3IXR A;  2H6Y A;  10GS A;  2B1K A;  2H0H A;  1QXH A;  5AGY A;  2YV7 A;  1XZO A;  3GKN A;  2I81 A;  2VLT A;  5HR1 A;  3H79 A;  2LNS A;  2ON5 A;  5ECM B;  1OC8 A;  2GSQ A;  2KUC A;  5H5R A;  2C1Y A;  2H01 A;  2HRF A;  3HA9 A;  2O89 A;  3CSJ A;  1EOH A;  3CRU A;  1M99 A;  1K0M A;  2DJK A;  2VLU A;  1EOG A;  2H1B A;  3Q18 A;  5ECN B;  1WIK A;  4GLT A;  5FWG A;  4OMV A;  4K6X A;  4KDU A;  3UEM A;  18GS A;  1HYU A;  3BOA A;  1XPV A;  3WT1 A;  4N10 A;  1F9M A;  2R3X A;  4OFM A;  1LBK A;  3LXZ A;  4CDO A;  2YV9 A;  3US3 A;  4J56 E;  4OO4 A;  4KW6 A;  1TXX A;  3GMF A;  5CRD A;  4D73 A;  2VOC A;  4CW9 A;  3UVT A;  2X64 A;  4AJ8 A;  2VL9 A;  3KH7 A;  2OA7 A;  1GL8 A;  4GSS A;  4EL1 A;  4MP4 A;  3U6V A;  1GSQ A;  2JL4 A;  12GS A;  1XW5 A;  1QGV A;  4MJC A;  4EIP A;  4TW5 A;  5DQS A;  4F82 A;  1TW9 A;  4PQH A;  4EIQ A;  3UMA A;  3C73 A;  1VF3 A;  3P90 A;  3ZVJ A;  4Q5R A;  2MMN A;  3KCM A;  2IMF A;  3TKS E;  4ICY A;  2J23 A;  2IFQ A;  3U5R E;  5DQY A;  2MZC A;  2F8A A;  2QKE A;  2R0P A;  4LA1 A;  3QR6 A;  3KTB A;  1GTU A;  3LFL A;  1TI1 A;  4JZQ A;  3CXG A;  2PWJ A;  3CRT A;  2GS3 A;  3GYK A;  3UOM A;  1EGR A;  3LQ7 A;  5IMV A;  3IK9 A;  3HHV A;  1GLP A;  2WDU A;  2PGT A;  13GS A;  2YP6 A;  2YAN A;  4FYU A;  2NPB A;  5IO0 A;  2QA2 A;  1O73 A;  1UVZ A;  6GSY A;  3VWX A;  1C72 A;  3TKS C;  3EPT A;  3QAV A;  1TDI A;  2C80 A;  2C3Q A;  1X5C A;  1OKT A;  3KD0 A;  3A2W A;  1DE2 A;  4DSQ A;  1ZZY A;  1GSD A;  2FGX A;  2OBI A;  1H75 A;  3ZVJ D;  1SD8 A;  4EKZ A;  2C0F A;  4Z2R A;  3ZFL A;  5GAN D;  4D73 B;  3I9V 2;  2X8C A;  4KAE A;  3F6D A;  2H6X A;  3HDC A;  4FYB A;  5D93 A;  1PA3 A;  1YKC A;  4OWY A;  3EVI A;  4KE3 A;  2AUV A;  3KJY A;  2JAC A;  2A2R A;  1BX9 A;  1MTC A;  3D4M A;  1M9B A;  4MJA A;  1YF0 A;  1ST9 A;  3NOF A;  2IFQ B;  1EGO A;  1WOU A;  1U3I A;  3QPM A;  4O92 A;  1O81 A;  6GSV A;  4RI6 A;  1QUW A;  4JR4 A;  1GH2 A;  5ENU A;  2AB6 A;  3FR9 A;  5A4U A;  4XS1 A;  3FYG A;  4XRD A;  3FEU A;  4KX4 A;  2HT9 A;  4MZW A;  4O5Q A;  3D0Z A;  2FD3 A;  4HQZ A;  2M80 A;  5IQY A;  3EC3 A;  1WJK A;  3KTL A;  3VWU A;  3J7Y b;  3M8N A;  2LRC A;  5GAP D;  1YEP A;  2GDR A;  1SYR A;  4RI7 A;  1EV9 A;  2AAW A;  4N0Z A;  1HNC A;  3LGC A;  4POL A;  2R0C A;  1ZYN A;  1M2D A;  1K3O A;  6GSW A;  4G2E A;  3IA1 A;  1B9X C;  3ISO A;  3GTU A;  3G7Y A;  4G0L A;  1AC1 A;  3EE2 A;  3G7I A;  3TDG A;  2E2G A;  2FLS A;  4TR4 A;  2LEG A;  4NPB A;  3I43 A;  3Q19 A;  4WEY A;  2K6V A;  3RBT A;  3L9S A;  3PIN A;  3A5I A;  2FWF A;  3BCK A;  3QAG A;  1JLW A;  2F3M A;  3ME8 A;  5ABR A;  1W89 A;  2XBQ A;  2CVK A;  2VCV A;  5J4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...