3ED3A

Crystal structure of the yeast dithiol/disulfide oxidoreductase mpd1p
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
280
structure length
267
Chain Sequence
HNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKISAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVLFSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQRQSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Protein disulfide-isomerase MPD1
publication title Yeast Mpd1p reveals the structural diversity of the protein disulfide isomerase family
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 82
structure length 267
sequence length 280
chains with identical sequence B
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ed3A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ed3A02
1XXUA 4PQHA 5AIVA 2WGRA 1Z3EA 5ECQB 2IMDA 2K9FA 3HJOA 1WOUA 3KMNA 4TN8A 3LWAA 3D21A 3GH9A 4HI7A 2LJAA 3K8NA 2CAIA 5DBQA 4WR5A 2O89A 3FZAA 3A2VA 3RAZA 1FVJA 3LORA 2CX3A 3IA1A 3P90A 2Z9SA 4G9HA 3L0HA 4Q5QA 2VUPA 1E6BA 1PMTA 3EE2A 3DEXA 2IFQB 4BVYA 1GWCA 1PA3A 2WDUA 4XS1A 2FD3A 2K6VA 4L5LA 2O8VB 4IHUA 1TU8A 2C80A 1VF4A 2N5AA 3GX0A 4WXTA 4I6XA 5H5QA 3VLNA 5DAKA 3F0IA 1FO5A 3W6GA 2E7PA 2B5EA 2C4JA 3VWUA 2KLXA 3HZ8A 4X43A 4TOPA 3HHVA 1M0UA 2AAWA 1CQHA 4PQIA 2L4QA 2R5GA 3KTLA 1H75A 4IJ3A 1Z9HA 1A2MA 5CRGA 4J2FA 1O7UA 1IYHA 5LD0A 3QPMA 1GUHA 1K0CA 4J57E 5AGYA 3U5RE 4DSSA 1K0NA 3RHBA 3WT1A 3J7Yk 2GTUA 4N30A 5JCGA 4GF0A 2VCQA 1EP7A 3HVSA 2VIMA 2VD1A 4ID0A 4MJCA 2GVPA 2IWTA 1SJ6A 1Z5YE 4HUAA 3HD5A 1PX6A 4EXJA 2ZUPA 2L5OA 1TK5B 4DEJA 2YV7A 3GIXA 3ED3A 5D93A 1ERTA 4AJ8A 2CX4A 4MA9A 1GUKA 2MMOA 2GSTA 3DMLA 3VPTA 5ECSA 1ERUA 1UA5A 2LRTA 3EC3A 5GAND 3KTBA 3EINA 4XHMA 1SKWB 1YEPA 3W8SA 1ZCPA 1XOAA 3HJPA 1MD4A 1ZOFA 2NTOA 2FGXA 2IMFA 4GTUA 2E2GA 1MDJA 3ZYWA 1W4VA 2BJXA 1ZMAA 1A0FA 2IPAA 5AIXA 2YJHA 3GKXA 4G10A 1TK0B 4N11A 4GSSA 4F0CA 3GH6A 2PVOC 4ZB8A 4EO3A 3FK8A 3VWXA 3WGDA 2R4VA 5D9WA 3U6VA 4XCSA 4PUAA 1OKTA 3ERWA 1AUCA 3ME8A 1UC7A 2DMMA 2DJ1A 2F3MA 3P2AA 3F3QA 1TKDB 1BG5A 1EOGA 1Q4JA 4D73A 2D2ZA 1O81A 1ACVA 1SD9A 3BCKA 1VRSD 4YQUA 2V2GA 3C8EA 2WFCA 1GNWA 3EMPA 1R5PA 2HZFA 4EC0A 2HNLA 4EDYA 3P8WA 1NM3A 4AF2A 2P31A 19GSA 2IN3A 2QGVA 4ECCA 5HFIA 2H66A 3TCOA 3LEFA 2FA4A 4K2DA 3UEMA 2J23A 1FOVA 4DVCA 2GSRA 4BA7A 1MDIA 3UL3A 1Z6NA 2LEGA 1ZYEA 2HYXA 4LL1B 4BPYA 3D4MA 3O76A 5CO3A 4OMVA 1RK4A 1X9SB 5IM9A 1THXA 2OE0A 1YKAA 2L57A 2IL3A 1XWKA 1JZDA 2IMIA 1YF1A 3F4SA 1O8WA 4KDXA 5EPFA 2DC5A 4MJBA 2V6KA 3OR5A 1TJDA 3RPNA 3PH9A 4OCEA 2C0FA 5G5EA 3IOSA 3Q18A 3FZ5A 2N5BA 1XVWA 2YWNA 2VCTA 3D22A 2YCDA 4GLTA 2VM1A 3QCPA 3FRCA 1PN9A 3GSSA 1R4WA 1XW5A 2H70A 4Q5FA 4I97A 4CHSA 2GS3A 5ELAA 4TRXA 4OO5A 1SYRA 4JZQA 2HRNA 1G7OA 2FWFA 3KJYA 1C72A 1QK8A 3UBLA 2H1AA 1PL1A 4GCIA 1TK8B 2VOCA 5FWGA 4OFNA 4G2EA 1OVNA 1GP1A 5D9TA 4MPGA 2KP1A 2C0GA 3VWWA 4F0BA 1JHBA 5CRDA 4FO5A 5B8BA 3EURA 1XIYA 1TTZA 4NWYA 1TP9A 3WD6A 5DJLA 4WBJA 1TDIA 2PBJA 5IO0A 3ZRDA 4TW5A 3S9FA 3D0ZA 2KHPA 5F8BA 2H01A 2TIRA 1KTEA 5GAPD 4ZIJA 4KDYA 1EZKA 1BEDA 1MD3A 1TOFA 22GSA 3HCZA 3IE3A 5IO2A 3M3MA 1LJRA 1DSBA 3MDKA 1SL0B 3KXOA 1EOHA 4O5RA 2YWMA 2C3NA 3WGXA 2IMEA 3G7JA 1XWCA 4WEYA 2B1LA 4NMUA 2K8VA 4BVXA 1A23A 1QUWA 1R26A 2HI7A 3DWVA 3BD2A 3P7XA 4ZB9A 3ISOA 3LYKA 4TVEA 4MF5A 3FZ4A 4NHZA 3VK9A 4CDOA 2JZTA 2OKAA 3ZMKA 4AJ7A 3E3EA 3CXGA 1GLQA 4QQ7A 1GSQA 4V1Ag 3HXSA 4WKWA 3FHKA 3UVTA 2M80A 1HQOA 3VWVA 5J5NA 4I5QA 5CNWA 4ECBA 4N0ZA 3H8QA 5LNKe 2G2QA 4KH7A 2V32A 3UAPA 3KMOA 6GSVA 2TRXA 4WF4A 2LQQA 4POBA 1VF1A 2FCHA 3APSA 4L5OA 2CA8A 2I1UA 3GRXA 3Q6OA 1EGRA 2C1YA 1TW9A 4MMMA 3E9JB 1PKWA 4HOJA 5JCUA 3M1GA 2L59A 1H4OA 2I81A 2IJYA 3ERGA 3GMFA 4ZBAA 1WP0A 3LJRA 3VI5A 2GT5A 7GSSA 2FWGA 5ECNB 2RM5A 2X99A 4P3YB 4GQFA 1WIKA 2FHEA 4JR6A 1GSUA 4EE0A 3DKSA 1G6WA 4MZBA 2JADA 4XTSA 1FAAA 1OAZA 3I6AA 3KCMA 2DJJA 4FH8A 1BYEA 1ABAA 1AXDA 4KSOA 1K0AA 2HT9A 2ZCTA 2C8UA 2WS2A 4TR3A 1YQ1A 1BX9A 5GSTA 5IMCA 1SYXA 2PWJA 2YOIA 1F2EA 3KM6A 3J7Yb 3GUSA 4X1UA 2O85A 3QDNA 3KH9A 3CBUA 3TJGA 1XW6A 4HDEA 1Z6MA 3IAS2 1UN2A 3UVHA 1B9XC 2JZSA 3TJJA 3FY7A 4G19A 4J56E 1M99A 3CTFA 2HXKA 2YN1A 5G5FA 2J9HA 2C0EA 4Q5RA 3L9UA 4NHWA 1BAYA 1MEKA 1THOA 3DGQA 1BJXA 5ECIB 5A4UA 4JU5A 1M9BA 1AIUA 2H30A 4POKA 5D73A 5KEJA 4WETA 4PQ1A 4ZBBA 5D8IA 1V9WA 4LMVA 4NPBA 3IR4A 3F4RA 5H5SA 4QL7A 1B4PA 1J9BA 2YANA 4MZCA 3ZFBA 4IKHA 5DJMA 2LSTA 4MLYA 2DIYA 3I43A 2WB9A 1HD2A 4FIWA 3SWLA 3F63A 4RI7A 4H86A 4TXOB 6GSSA 2HE3A 1TU7A 4KAEA 1NSWA 3C71A 2P0GA 3LYPA 2RLIA 3N5OA 1GSSA 2GQLA 3I9V2 2H76A 3TRXA 2H0IA 4K7IA 5JWRB 4IP1A 5HFGA 3LQ7A 2CVKA 1X9MB 1CQGA 4K7OA 4POLA 4MZWA 2GSQA 4MH2A 5B6MA 1T8EB 2B1KA 1S3DA 3RHCA 2GSSA 3MNGA 3TOUA 1YJ6A 3A3TA 5IMAA 3UIWA 3TJFA 1K0BA 2H1GA 4PURA 2P5RA 3BBYA 1WWJA 3BJ5A 3FW2A 3APOA 5JWQB 4MP4A 5IMVA 2ES7A 3RBTA 4NAXA 3EU4A 2H73A 4XS4B 2FWHA 2KP2A 1TRVA 3US3A 4MJAA 2YWOA 5DVBA 4ISDA 3ZL5A 1ZGNA 3UMAA 3GA4A 2MMNA 5CP1A 3TKRA 2VCZA 4AGSA 2VD0A 2MBSA 3TKPA 1GTIA 1OC8A 2H6YA 3TRPA 4JRRA 1QFNA 2R37A 4GSNA 3V1WA 3GKMA 4EDZA 2MMAA 2HZEB 1U6TA 2FUG2 1T3BA 1O8XA 3EU3A 4KW6A 1VF2A 2GQKA 3PGTA 5G31A 4IVFA 1F3BA 2VCXA 4WBRD 1B48A 3TKSA 2HRFA 3O6TA 5ID2B 1VF3A 1YZXA 1SENA 4JBBA 4HZ4A 1V98A 3QMXA 6GSXA 4K1FA 5EVOA 4KDUA 1SL2B 4OO4A 2ZNMA 4IGJA 1WJKA 2AHEA 2NDOA 5J3RA 2CVDA 3EVIA 2LNTA 2I9HA 4L0UA 5ECKB 5F07A 5DQYA 5FT3A 4IP6A 4F2IA 3CSJA 5ECMB 3NIVA 2N5FA 2M72A 1K3OA 2FWEA 3QAWA 2JACA 2FLSA 4V2LA 1JZOA 5KN2A 1AQVA 3ERFA 4HZ2A 4GRFA 4LLRA 4BL7A 1TRUA 2DJ2A 1IYIA 3EWLA 1ZYQB 2XHFA 4TXVA 2PUKC 2DJ3A 3GFKA 4ECIA 2QSIA 3F6FA 2HSHA 4KUNA 2GZZA 1HNCA 3VI7A 3H4KA 1AQXA 2LRCA 5ECHB 2L5LA 3ZIJA 4GWRA 2IMKA 4WF5A 2LRNA 3FYGA 2K18A 1O85A 2H0HA 2C3QA 2JL4A 4PXOA 1XWGA 2OADA 4IBPA 4PGTA 3HZ4A 1EV9A 4EUYA 3GN3A 3BCIA 4HEA2 3IXRA 1M2BA 4XS6A 5CRWA 4MDCA 3ZMLA 1GH2A 16GSA 1AC1A 1ERVA 3F9UA 3L4NA 1FB0A 2GZYA 5J4UA 3KIJA 4XRAA 5ECRB 3HDCA 2KOKA 4L8EA 4K0NA 3D6IA 2X64A 5DAKB 5IMFA 1LBKA 1T7PB 5AN1A 2MBTA 2H75A 1SD8A 1DBYA 1TI3A 1B9YC 2G0FA 4KCAA 5B8AA 2YZUA 3TKQA 3GURA 4IJIA 2IFQA 1M2AA 1A24A 4TKYA 3GKNA 2GZPA 2RUEA 2CV4A 1XOBA 3WT2A 2YV9A 2R3XA 4OFTA 4TXOA 1XZOA 5A4WA 4DSSB 2RUFA 3GKKA 4KNDA 3GL5A 5IMDA 2X8CA 6GSWA 1OKDA 2V41A 4OD7A 2WRTA 2H1DA 1SU9A 1LU4A 1NHYA 4KE3A 2WZ9A 1U3IA 4Z7XA 3GV1A 2CAQA 4OCFA 5ENUA 2V1MA 9GSSA 2EIQA 4PUFC 2LV3A 2DIZA 11GSA 1ERWA 3EYTA 4X0XA 2XPEA 1PSQA 3ZZXA 2DJKA 1RW1A 4LMWA 3AY8A 6GSYA 2LQOA 4XIHA 4K8MA 3ZIVA 4MK3A 4Q5NA 3APQA 4RQXA 3IBHA 2PU9C 1GNEA 2JU5A 1G0TA 2PGTA 3L78A 3C7MA 1Z7PA 2OE1A 1JLWA 4MF7A 1ON4A 2GQMA 1EP8A 1GL8A 4MPFA 1FW1A 1YKCA 3A5WA 4LA1A 1T00A 2L6DA 5J41A 3VPQA 2FA8A 1N8JA 2YNXA 3GX8A 5GSSA 3M9JA 4KA0A 3R2QA 2R2JA 1N2AA 8GSSA 2JSZA 2ON5A 17GSA 3UBKA 3KH7A 1GSYA 3L9VA 2X8HA 4D73B 2B3SA 2HZEA 3QFAC 1DUGA 3DIEA 5DALB 3LSZA 3RDWA 3TUEA 1WE0A 1Y6EA 1R5AA 2GDRA 5ID2A 4E8HA 1FG4A 1O73A 4MABA 1KBNA 1XWAA 1GSDA 3QOUA 3QFBC 3GTUB 2CQ9A 2CZ2A 3QR6A 2VLTA 4QL9A 3WYWA 2ALBA 1K0OA 3HJMA 1PRXA 2MZCA 3M8NA 3ZLPA 5D9VA 5G2ZA 3HVXA 3ZFLA 4MH3A 1X0RA 4HQSA 1B4QA 20GSA 12GSA 4TR1B 5ECOB 2WCIA 4BWSA 1FVKA 1X5DA 18GSA 2LS5A 4N10A 1O6JA 2AUVA 5A4VA 2DLXA 5G1KA 4ZILA 4V2MA 4MJEA 4PNGA 1UVZA 1EV4A 1WPIA 2H72A 3GL3A 3TDGA 4KGIA 1OC9B 3KP9A 1VGLA 4NV2A 4EF0A 1TXXA 4PX1A 3TKSC 5IMZA 3HKRA 3IHQA 2CT6A 2YPMA 3TGZA 14GSA 3G7IA 5EL8A 5INYA 3L9SA 3IV4A 3F6DA 5GZZB 2VL2A 5E59A 5HR0A 1V2AA 3G9BA 1GRXA 2PERA 2YJ7A 4DSQA 4YH2A 4V1Ap 1OYJA 4RUVA 1V57A 2DMLA 2C3TA 3W8JA 2L4CA 1XWBA 4N0VA 5DCHA 4V2NA 2H6XA 4YAVA 1GUMA 3D4TA 2ON7A 4ZL8A 3E0UA 1ML6A 1JZWA 4CW9A 2DSAA 2JZRA 5D9XA 5G1LA 2PVQA 3ZVJA 1EGOA 4YQVA 5CRHA 4HU9A 1XCCA 1M9AA 3GNJA 4ILFA 2B5XA 1GTAA 4TR4A 3UOMA 4OFMA 2NBSA 3C73A 3MSZA 3M9KA 1V40A 1A2JA 3N9JA 2JSYA 3LG6A 3Q19A 1V58A 1EEMA 5IIZA 3NZNA 2K8SA 2H19A 2XBIA 2OE3A 2MYGA 1HNAA 1K0MA 2NVLA 1NW2A 10GSA 3TJKA 4JEDA 5AISA 5IPHA 3DRNA 1Q98A 4HQZA 4KB3A 4PNFA 1K3LA 2DJ0A 2OBIA 4POMA 1DE2A 4I2TA 4I2UA 5CREA 1EWXA 2O87A 2CZ3A 2E2MA 5IOWA 2H1BA 4K9ZA 4HJMA 3JCML 3QD9A 3IC4A 2XC2A 3CSIA 1OC3A 3A2XA 3DYRA 4ZXGA 4ZL9A 1SK1A 1XW9A 5HR3A 5CYYA 4MF6A 1KNGA 1T1VA 3UJ1A 2QKEA 3H93A 4K7NA 1PGTA 4EVMA 1X5EA 1HYUA 6GSTA 3DVXA 4E8EA 1I9DA 4JR4A 5ECLB 4GSTA 1U3AA 1T4ZA 3KZQA 4O7HA 2YWIA 2YZHA 3MAKA 4ZB6A 1S3CA 2A2SA 3H79A 2AJQB 3ME7A 1PKZA 4IW9A 2H8LA 4RI6A 1ZZYA 3F4TA 3KP8A 2QC7A 1SJIA 5ECPB 1TI1A 2B5YA 5JWOB 3GHAA 2VLVA 2RIIA 3KEBA 2O7KA 2E0QA 5G30A 3LFLA 2OA7A 3O3TA 1SL1B 3TKSE 2AYTA 1FB6A 1W89A 1JZRA 5KN3A 1GLPA 2PN8A 3DVWA 5DALA 1SKSB 3CTGA 5FHIA 1BQ7A 4F82A 2C0DA 3TRQA 3IPZA 3TB2A 1GULA 5C04A 1F3AA 2TRCP 5CAXA 3CYNA 3TJBA 1XFLA 4F03A 1KEBA 3GTUA 2VCVA 1DE1A 4KX4A 4RQRA 5J9CA 5HQPA 3DD3A 3IDVA 2F9SA 4K0GA 3IK9A 1SKRB 2A4VA 5B7CA 3H1NA 5DDLA 1XVQA 2GLRA 5L71A 1QXHA 1AQWA 3KGKA 4XRDA 1PX7A 13GSA 3KD0A 1MDKA 4KSMA 1OE7A 3A2WA 3FZ9A 4TR1A 3QAVA 4KCEA 2OJLA 1WMJA 1M7TA 2GT6A 4F9ZA 2P5QA 4FYBA 4ML1A 2PPTA 2PMTA 3PINA 4IN0A 2B6MA 2WULA 2IIYA 4ULXA 6GSUA 2I3YA 1B8XA 5KN0A 1U87A 1XPVA 1F6MC 1WRYA 1MTCA 1URMA 1K0DA 4IS0A 1OC9A 1J0FA 3EMXA 4EKZA 5J9BA 1A2LA 2EIRA 1NHOA 1X5CA 2H71A 1AAZA 3CSHA 5ABRA 3WGEA 1PL2A 3HA9A 2R6KA 1USBA 3ZVJD 2YP6A 4WR4A 2HLSA 3FEUA 3CRUA 4K6XA 1GSEA 3FR6A 1QQ2A 4BWQA 5E4WA 3RPPA 4GQCA 2FNOA 3UARA 2BMXA 1G7EA 2LUSA 3C1SA 1TRSA 2VCWA 4YQMA 2CVBA 3M0FA 3FKFA 2NPBA 5JCWA 4OWYA 3G7YA 4NXIA 4I8BA 2KUCA 2HSYA 3SBCA 2M46A 1F9MA 2VL3A 2VLUA 1I5GA 5F05A 4DSRA 5C00A 2LJRA 1U88A 1R7HA 1SK0A 1JFUA 4FYCA 3GSTA 2LTKA 2B7JA 5IPGA 2MMZA 3Q74A 3ZREA 4O32A 4HU7A 4O92A 3IK7A 4AJ6A 1A8LA 4JE1A 4EL1A 2F8FA 1A8YA 1ST9A 1GSFA 1M2DA 5KN1A 3D5JA 1GTUA 3LXTA 1YF0A 4YAPA 1YDKA 2AB6A 2VL2C 5COHA 1X9WB 2REMA 2L6CA 2FY6A 1RQMA 4GXZA 2F51A 1JLVA 4ZBDA 5DQSA 1YEXA 2WJUA 4L0WA 3DXBA 4XS4A 4HS1A 1PD21 4FYUA 3LGCA 1AW9A 2LNSA 1ILOA 3I69A 2HFDA 5HR1A 3TOTA 3QAGA 2OBKA 2VM2A 2DBCA 2GGTA 2H0GA 1Y25A 3BOAA 3HYPA 5D96A 2XBQA 4IQAA 4HJ2A 1SK2A 3ZTLA 3LXZA 2X8GA 1ZL9A 2VAFA 2V6OA 2OACA 5DCGA 5F0GA 5B6NA 3CRTA 3PR8A 1K3YA 2RM6A 5EY6A 1SJZA 4NV5A 3C1RA 5HFKA 1YY7A 3MWHA 5H5RA 4ML6A 2A2RA 2F8AA 3HVVA 4ZL7A 3HY2A 4ACSA 1A0RP 1QMVA 3NOFA 5IOXA 1PQNA 1E2YA 2VO4A 1OE8A 4TR0A 2H6ZA 3ZITA 4ECJA 3GYKA 1Z7RA 1HNBA 2AV4A 3FR9A 4LL4B 3IRAA 5HR2A 1J08A 1TRWA 5A5KA 2H74A 1F37A 1GTBA 1XBSA 2I4AA 2LKUA 2VL9A 2EIOA 1S3AA 1QGVA 2EC4A 1G6YA 1EEJA 2B7KA 3VFIA 3FR3A 3F8UA 4IELA 1T4YA 2BTOT 3IAM2 2XPDA 3F3RA 5F06A 3VURA 5ELGA 4IQ1A 4MCUA 5IQYA 5LCZA 3CMIA 2LJKA 1FHEA
chains in the Genus database with same CATH superfamily
1XXUA 4PQHA 5AIVA 2WGRA 1Z3EA 5ECQB 2IMDA 2K9FA 3HJOA 1WOUA 3KMNA 4HSCX 4TN8A 3LWAA 3D21A 3GH9A 4HI7A 2LJAA 3K8NA 2CAIA 5DBQA 3FMWA 4A5PA 4WR5A 2O89A 3FZAA 3A2VA 3RAZA 1FVJA 3LORA 2CX3A 3IA1A 3P90A 2Z9SA 4G9HA 3L0HA 4Q5QA 4O5UA 2VUPA 1E6BA 1PMTA 3EE2A 3DEXA 2IFQB 4BVYA 1GWCA 1PA3A 2WDUA 4XS1A 2FD3A 2K6VA 4L5LA 2O8VB 4IHUA 1TU8A 2C80A 1VF4A 4MNNA 2N5AA 2UZ8A 3GX0A 4I6XA 4WXTA 5H5QA 3VLNA 5DAKA 3F0IA 1FO5A 3W6GA 2E7PA 2B5EA 2C4JA 3VWUA 2KLXA 3HZ8A 4X43A 4TOPA 3HHVA 1M0UA 2AAWA 1CQHA 4PQIA 2L4QA 2R5GA 3KTLA 1H75A 4IJ3A 1Z9HA 1A2MA 5CRGA 4J2FA 1O7UA 1IYHA 5LD0A 3QPMA 1GUHA 1K0CA 4J57E 5AGYA 3U5RE 4DSSA 1K0NA 3RHBA 3WT1A 3J7Yk 2GTUA 4N30A 5JCGA 4GF0A 2VCQA 1EP7A 3HVSA 2VIMA 2VD1A 4ID0A 4MJCA 2GVPA 2IWTA 1SJ6A 1Z5YE 4HUAA 3HD5A 1PX6A 4EXJA 2HRAA 2ZUPA 2L5OA 1TK5B 4DEJA 2YV7A 3GIXA 3ED3A 5D93A 1ERTA 4AJ8A 2CX4A 4MA9A 1GUKA 2MMOA 2GSTA 3DMLA 3VPTA 5ECSA 1ERUA 1UA5A 2LRTA 3EC3A 5GAND 3KTBA 3EINA 4XHMA 1SKWB 1YEPA 3W8SA 1ZCPA 1XOAA 3HJPA 1MD4A 1ZOFA 2NTOA 2FGXA 2IMFA 4GTUA 2E2GA 1MDJA 3ZYWA 1W4VA 2BJXA 1ZMAA 1A0FA 2IPAA 5AIXA 2YJHA 3GKXA 4G10A 1TK0B 1PFOA 4N11A 4GSSA 4F0CA 3GH6A 2PVOC 4ZB8A 4EO3A 3FK8A 3VWXA 3WGDA 2R4VA 5D9WA 3U6VA 4XCSA 4PUAA 1OKTA 3ERWA 1AUCA 3ME8A 1UC7A 2DMMA 2DJ1A 2F3MA 3P2AA 3F3QA 1TKDB 4Z2RA 1BG5A 1EOGA 1Q4JA 4D73A 2D2ZA 1O81A 1ACVA 1SD9A 3BCKA 1VRSD 4YQUA 2V2GA 3C8EA 2WFCA 1GNWA 3EMPA 1R5PA 2HZFA 4EC0A 2HNLA 4EDYA 3P8WA 1NM3A 4AF2A 2P31A 19GSA 2IN3A 2QGVA 4ECCA 5HFIA 2H66A 3TCOA 3LEFA 2FA4A 4K2DA 3UEMA 2J23A 1FOVA 4DVCA 2GSRA 4BA7A 1MDIA 3UL3A 1Z6NA 5KOWA 2LEGA 1ZYEA 2HYXA 4LL1B 4BPYA 3D4MA 3O76A 5CO3A 4OMVA 1RK4A 1X9SB 5IM9A 1THXA 2OE0A 1YKAA 2L57A 2IL3A 1XWKA 1JZDA 2IMIA 3MIXA 1YF1A 3F4SA 1O8WA 4KDXA 5EPFA 2DC5A 4MJBA 2V6KA 3OR5A 1TJDA 3RPNA 3PH9A 4OCEA 2C0FA 5G5EA 3IOSA 3Q18A 3FZ5A 2N5BA 1XVWA 2YWNA 2VCTA 3D22A 2A4HA 2YCDA 3IHGA 4GLTA 2VM1A 3QCPA 3FRCA 4K5RA 1PN9A 3GSSA 1R4WA 1XW5A 2H70A 4Q5FA 4I97A 4CHSA 2GS3A 5ELAA 4TRXA 4OO5A 1SYRA 4JZQA 2HRNA 1G7OA 2FWFA 3KJYA 1C72A 1QK8A 3UBLA 2H1AA 1PL1A 4GCIA 1TK8B 2VOCA 5FWGA 4OFNA 4G2EA 1OVNA 1GP1A 5D9TA 4MPGA 2KP1A 2C0GA 3VWWA 4F0BA 1JHBA 5CRDA 4FO5A 5B8BA 3EURA 1XIYA 1TTZA 4NWYA 1TP9A 3WD6A 5DJLA 4WBJA 1TDIA 2PBJA 5IO0A 4EIQA 3ZRDA 4TW5A 3S9FA 3D0ZA 2KHPA 5F8BA 2H01A 2TIRA 1KTEA 5GAPD 4ZIJA 4KDYA 1EZKA 4YKGA 1BEDA 1MD3A 1TOFA 22GSA 3HCZA 3IE3A 1M3IA 5IO2A 3M3MA 1LJRA 1DSBA 3MDKA 1SL0B 3KXOA 1EOHA 4O5RA 2YWMA 2C3NA 3WGXA 2IMEA 3G7JA 1XWCA 4WEYA 2B1LA 4NMUA 5KOXA 2K8VA 4BVXA 1A23A 1QUWA 1R26A 2HI7A 3DWVA 3BD2A 3P7XA 4ZB9A 3ISOA 3LYKA 4TVEA 4MF5A 3FZ4A 4NHZA 3VK9A 4CDOA 2JZTA 2OKAA 3ZMKA 4AJ7A 3E3EA 3CXGA 1GLQA 4QQ7A 1GSQA 4V1Ag 3HXSA 4WKWA 3FHKA 3UVTA 2M80A 1HQOA 3VWVA 5J5NA 4I5QA 5CNWA 4ECBA 4N0ZA 3H8QA 5LNKe 2G2QA 4KH7A 2V32A 3UAPA 3KMOA 6GSVA 2TRXA 4WF4A 2LQQA 4POBA 1VF1A 2FCHA 3APSA 4L5OA 2CA8A 2I1UA 3GRXA 3Q6OA 1EGRA 2C1YA 1TW9A 4MMMA 3E9JB 1PKWA 4HOJA 5JCUA 3M1GA 2L59A 1H4OA 2I81A 2IJYA 3ERGA 3GMFA 4ZBAA 1WP0A 3LJRA 3VI5A 2GT5A 7GSSA 2FWGA 5ECNB 2RM5A 2X99A 4P3YB 4GQFA 1WIKA 2FHEA 4JR6A 1GSUA 4EE0A 3DKSA 1G6WA 4MZBA 2JADA 4XTSA 1FAAA 1OAZA 3I6AA 3KCMA 2DJJA 4FH8A 1BYEA 1ABAA 1AXDA 4KSOA 1K0AA 2HT9A 2ZCTA 2C8UA 2WS2A 4TR3A 1YQ1A 1BX9A 5GSTA 5IMCA 1SYXA 2PWJA 2YOIA 1F2EA 3KM6A 4EIPA 3J7Yb 3GUSA 4X1UA 2O85A 3QDNA 3KH9A 3CBUA 3TJGA 1XW6A 4HDEA 1Z6MA 3IAS2 1UN2A 3UVHA 1B9XC 2JZSA 3TJJA 3FY7A 4G19A 4J56E 4K2XA 1M99A 3CTFA 2HXKA 2YN1A 5G5FA 2J9HA 2C0EA 4Q5RA 3L9UA 4NHWA 1BAYA 1MEKA 1THOA 3DGQA 1BJXA 5ECIB 5A4UA 4JU5A 1M9BA 1AIUA 2H30A 4POKA 5D73A 5KEJA 4WETA 4PQ1A 4ZBBA 5D8IA 1V9WA 4LMVA 4NPBA 3IR4A 3F4RA 5H5SA 4QL7A 1B4PA 1J9BA 2YANA 4MZCA 3ZFBA 4IKHA 2DKIA 5DJMA 2LSTA 4MLYA 2DIYA 3I43A 2WB9A 1HD2A 4FIWA 3SWLA 3F63A 4RI7A 4H86A 4TXOB 6GSSA 2HE3A 1TU7A 4KAEA 1NSWA 3C71A 2P0GA 3LYPA 2RLIA 3N5OA 1GSSA 2GQLA 3I9V2 2H76A 3TRXA 2H0IA 4K7IA 5JWRB 3LW9A 4IP1A 5HFGA 3LQ7A 2CVKA 1X9MB 1CQGA 4K7OA 4POLA 4MZWA 2GSQA 4MH2A 5B6MA 1T8EB 2B1KA 1S3DA 3RHCA 2GSSA 3MNGA 3TOUA 4O5QA 1YJ6A 3A3TA 5IMAA 3UIWA 3TJFA 1K0BA 2H1GA 4PURA 2P5RA 3BBYA 1WWJA 3BJ5A 3FW2A 3APOA 2DKHA 5JWQB 4MP4A 5IMVA 2ES7A 1PN0A 2A2PA 3RBTA 4NAXA 3EU4A 5BMUA 2H73A 4XS4B 2FWHA 2KP2A 1TRVA 3US3A 4MJAA 2YWOA 5DVBA 4ISDA 3ZL5A 1ZGNA 3UMAA 4G0LA 1ZYNA 4CY6A 3GA4A 4BIKA 2MMNA 5CP1A 3TKRA 2VCZA 4AGSA 2VD0A 2MBSA 3TKPA 1GTIA 1OC8A 2H6YA 3TRPA 4JRRA 1QFNA 2R37A 4GSNA 3V1WA 3GKMA 4EDZA 2MMAA 2HZEB 1U6TA 2FUG2 1T3BA 1O8XA 3EU3A 4KW6A 1VF2A 2GQKA 3PGTA 5G31A 4IVFA 1F3BA 2VCXA 4WBRD 1B48A 3TKSA 2HRFA 3O6TA 4KF9A 5ID2B 1VF3A 1YZXA 1SENA 4JBBA 4HZ4A 1V98A 3QMXA 6GSXA 4K1FA 5EVOA 4KDUA 1SL2B 4OO4A 2ZNMA 4IGJA 1WJKA 2AHEA 2NDOA 5J3RA 2CVDA 3EVIA 2LNTA 2I9HA 4L0UA 5ECKB 5F07A 5DQYA 5FT3A 4IP6A 4F2IA 3CSJA 5ECMB 3NIVA 2N5FA 2M72A 1K3OA 2FWEA 3QAWA 1ZYPA 2JACA 2FLSA 4V2LA 1JZOA 5KN2A 1AQVA 3ERFA 4HZ2A 4GRFA 4LLRA 4BL7A 1TRUA 2DJ2A 1IYIA 3EWLA 1ZYQB 2XHFA 4TXVA 2PUKC 2DJ3A 3GFKA 4ECIA 2QSIA 3F6FA 2HSHA 4KUNA 2GZZA 1HNCA 3VI7A 3H4KA 1AQXA 2LRCA 5ECHB 2L5LA 3ZIJA 4GWRA 2IMKA 4WF5A 2LRNA 3FYGA 2K18A 1O85A 2H0HA 2C3QA 2JL4A 4PXOA 1XWGA 2OADA 4IBPA 4PGTA 3HZ4A 1EV9A 4EUYA 3GN3A 3BCIA 4HEA2 3IXRA 1M2BA 4XS6A 5CRWA 4BVYB 4MDCA 3ZMLA 1GH2A 16GSA 1AC1A 1ERVA 3F9UA 3L4NA 1FB0A 2GZYA 5J4UA 4G0KA 3KIJA 4XRAA 5ECRB 3HDCA 2KOKA 4L8EA 4USSA 4K0NA 3D6IA 2X64A 5DAKB 5IMFA 1LBKA 1T7PB 5AN1A 2MBTA 2H75A 1SD8A 1DBYA 1TI3A 1XG8A 1B9YC 2G0FA 4KCAA 5B8AA 2YZUA 3TKQA 3GURA 4IJIA 2IFQA 1M2AA 1A24A 4TKYA 3GKNA 2GZPA 2RUEA 2CV4A 1XOBA 3WT2A 2YV9A 2R3XA 4OFTA 4TXOA 1XZOA 5A4WA 4DSSB 2RUFA 3GKKA 4KNDA 3GL5A 5IMDA 2X8CA 6GSWA 1OKDA 2V41A 4OD7A 2WRTA 2H1DA 4X4JA 1SU9A 1LU4A 1NHYA 4KE3A 2WZ9A 1U3IA 4Z7XA 3GV1A 2CAQA 4OCFA 5ENUA 2V1MA 9GSSA 2EIQA 4PUFC 2LV3A 2DIZA 11GSA 1ERWA 3EYTA 4X0XA 2XPEA 1PSQA 3ZZXA 2DJKA 1RW1A 4LMWA 3AY8A 6GSYA 1S3RA 2LQOA 4XIHA 4K8MA 3PPUA 4MK3A 4Q5NA 3ZIVA 3APQA 4RQXA 2HSMA 3IBHA 2PU9C 1GNEA 2JU5A 1G0TA 4PTSA 2PGTA 3L78A 3C7MA 1Z7PA 2OE1A 1JLWA 1M3JA 4MF7A 1ON4A 2GQMA 1EP8A 1GL8A 4MPFA 1FW1A 1YKCA 3A5WA 4LA1A 1T00A 2L6DA 5J41A 3VPQA 2FA8A 4Z2UA 1N8JA 2YNXA 3GX8A 5GSSA 3M9JA 4KA0A 3R2QA 2R2JA 1N2AA 8GSSA 2JSZA 2ON5A 17GSA 3UBKA 3KH7A 1GSYA 3L9VA 2X8HA 4D73B 2B3SA 2HZEA 3QFAC 1DUGA 3DIEA 5DALB 3LSZA 3RDWA 3CQFA 3TUEA 1WE0A 1Y6EA 1R5AA 2GDRA 5ID2A 4E8HA 1FG4A 1O73A 2R0GA 4MABA 1KBNA 1XWAA 1GSDA 3QOUA 3QFBC 3GTUB 2CQ9A 2CZ2A 3QR6A 2VLTA 4QL9A 3WYWA 2ALBA 2R0CA 1K0OA 3HJMA 1PRXA 2MZCA 3M8NA 3ZLPA 5D9VA 5G2ZA 3HVXA 3ZFLA 4MH3A 1X0RA 4HQSA 1B4QA 20GSA 12GSA 4TR1B 5ECOB 2WCIA 4BWSA 1FVKA 1X5DA 18GSA 2LS5A 4N10A 1O6JA 2AUVA 5A4VA 2DLXA 5G1KA 4ZILA 4V2MA 4MJEA 4PNGA 1UVZA 1EV4A 1WPIA 2H72A 3GL3A 3TDGA 4ICYA 4KGIA 1OC9B 3KP9A 1VGLA 4NV2A 2R0PA 4EF0A 1TXXA 4PX1A 3TKSC 5IMZA 3HKRA 3IHQA 2CT6A 2YPMA 3TGZA 14GSA 3G7IA 5EL8A 5INYA 3L9SA 3IV4A 3F6DA 5GZZB 2VL2A 5E59A 5HR0A 1V2AA 3G9BA 1GRXA 2PERA 2YJ7A 4DSQA 4YH2A 4V1Ap 1OYJA 4RUVA 1V57A 2DMLA 2C3TA 3W8JA 2L4CA 1XWBA 4N0VA 5DCHA 4V2NA 2H6XA 4YAVA 1GUMA 3D4TA 2ON7A 4ZL8A 3E0UA 1ML6A 1JZWA 4CW9A 2DSAA 2JZRA 5D9XA 5G1LA 2PVQA 3ZVJA 1EGOA 4YQVA 5CRHA 4HU9A 1XCCA 1M9AA 3GNJA 4ILFA 2B5XA 1GTAA 4TR4A 3UOMA 4OFMA 2NBSA 3C73A 3MSZA 3M9KA 1V40A 1A2JA 3N9JA 2JSYA 3LG6A 3Q19A 1V58A 1EEMA 5IIZA 3NZNA 2K8SA 2H19A 2XBIA 2OE3A 2MYGA 1HNAA 1K0MA 2NVLA 1NW2A 10GSA 3TJKA 4JEDA 5AISA 5IPHA 3DRNA 1Q98A 4BVXB 4HQZA 4KB3A 4PNFA 1K3LA 2DJ0A 2OBIA 4POMA 1DE2A 4I2TA 4I2UA 5CREA 1EWXA 2O87A 2CZ3A 2E2MA 5IOWA 2H1BA 3A5IA 4K9ZA 4HJMA 3JCML 3QD9A 3IC4A 2XC2A 3CSIA 1OC3A 4YKFA 3A2XA 3DYRA 4ZXGA 3IC8A 4ZL9A 1SK1A 1XW9A 5HR3A 1FOHA 5CYYA 4MF6A 1KNGA 1T1VA 3UJ1A 2QKEA 3H93A 4K7NA 1PGTA 4EVMA 1X5EA 1HYUA 6GSTA 3DVXA 4E8EA 1I9DA 4JR4A 5ECLB 4GSTA 1U3AA 1T4ZA 3KZQA 4O7HA 2YWIA 2YZHA 3MAKA 4ZB6A 1S3CA 2A2SA 3H79A 2AJQB 3ME7A 1PKZA 4IW9A 2H8LA 4RI6A 1ZZYA 3F4TA 3KP8A 2QC7A 1SJIA 5ECPB 1TI1A 2B5YA 5JWOB 3GHAA 2VLVA 2RIIA 3KEBA 2O7KA 2E0QA 5G30A 3LFLA 2OA7A 3O3TA 1SL1B 3TKSE 2AYTA 1FB6A 1W89A 1JZRA 4Z2TA 5KN3A 1GLPA 2PN8A 3DVWA 5DALA 1SKSB 3CTGA 5FHIA 1BQ7A 4F82A 2C0DA 3TRQA 3IPZA 3TB2A 1GULA 5C04A 1F3AA 2TRCP 5CAXA 3CYNA 3TJBA 1XFLA 4F03A 1KEBA 3GTUA 2VCVA 1DE1A 4KX4A 4RQRA 5J9CA 5HQPA 3DD3A 3IDVA 2F9SA 4K0GA 3IK9A 1SKRB 2A4VA 5B7CA 3H1NA 5DDLA 1XVQA 2GLRA 5L71A 1QXHA 1AQWA 3KGKA 4XRDA 1PX7A 13GSA 3KD0A 1MDKA 4K5SA 3R3EA 4KSMA 1OE7A 3A2WA 3FZ9A 4TR1A 3QAVA 4KCEA 2OJLA 1WMJA 1M7TA 2GT6A 3HVNA 2P5QA 4F9ZA 4FYBA 4ML1A 2PPTA 2PMTA 3PINA 4IN0A 2B6MA 2WULA 2IIYA 4ULXA 6GSUA 2I3YA 1B8XA 5KN0A 1U87A 1XPVA 1F6MC 1WRYA 1MTCA 1URMA 1K0DA 2X4AA 2QA2A 4IS0A 1OC9A 1J0FA 3EMXA 4EKZA 5J9BA 1A2LA 2EIRA 3MYDA 1NHOA 1X5CA 2H71A 1AAZA 3CSHA 5ABRA 3WGEA 1PL2A 3HA9A 2R6KA 1USBA 3ZVJD 2YP6A 4WR4A 2HLSA 3FEUA 3CRUA 4K6XA 1GSEA 3FR6A 1QQ2A 4BWQA 5E4WA 3RPPA 4GQCA 2FNOA 3UARA 2BMXA 1G7EA 2LUSA 3C1SA 1TRSA 2VCWA 4YQMA 2CVBA 3M0FA 3FKFA 2NPBA 5JCWA 4OWYA 3G7YA 4NXIA 4I8BA 2KUCA 2HSYA 3SBCA 2M46A 1F9MA 2VL3A 2VLUA 1I5GA 5F05A 4DSRA 5C00A 2LJRA 1U88A 1R7HA 1SK0A 1JFUA 4FYCA 3GSTA 2LTKA 2B7JA 5IPGA 2MMZA 4CY8A 3Q74A 3ZREA 4O32A 4HU7A 4O92A 3IK7A 4AJ6A 1A8LA 4JE1A 4EL1A 2F8FA 1A8YA 1ST9A 1GSFA 1M2DA 5KN1A 3D5JA 1GTUA 3LXTA 1YF0A 4YAPA 1YDKA 2AB6A 2VL2C 5COHA 1X9WB 2REMA 2L6CA 2FY6A 1RQMA 4GXZA 2F51A 1JLVA 4ZBDA 5DQSA 1YEXA 2WJUA 4L0WA 3DXBA 4XS4A 4HS1A 1PD21 4FYUA 2HRKA 3LGCA 1AW9A 2LNSA 1ILOA 3I69A 4FQUA 2HFDA 5HR1A 3TOTA 3QAGA 2OBKA 2VM2A 2DBCA 2GGTA 2H0GA 1Y25A 3BOAA 2QA1A 3HYPA 5D96A 2XBQA 4IQAA 4HJ2A 1SK2A 3ZTLA 3LXZA 2X8GA 5BRTA 1ZL9A 2VAFA 2V6OA 2OACA 5DCGA 5F0GA 5B6NA 3CRTA 3PR8A 1K3YA 2RM6A 5EY6A 1SJZA 4NV5A 3C1RA 5HFKA 1YY7A 3MWHA 5H5RA 4ML6A 2A2RA 2F8AA 3HVVA 4ZL7A 3HY2A 4ACSA 1A0RP 1QMVA 3NOFA 5IOXA 4BL7B 1PQNA 1E2YA 4G0IA 2VO4A 1OE8A 4TR0A 2H6ZA 3ZITA 4ECJA 3GYKA 1Z7RA 1HNBA 2AV4A 3FR9A 4LL4B 3IRAA 5HR2A 1J08A 1TRWA 5A5KA 2H74A 1F37A 1GTBA 1XBSA 2I4AA 2LKUA 2VL9A 2X49A 2EIOA 1S3AA 1QGVA 2EC4A 1G6YA 1EEJA 2B7KA 3VFIA 3FR3A 3F8UA 4IELA 1T4YA 2BTOT 3IAM2 2XPDA 3F3RA 5F06A 3VURA 5ELGA 3EPTA 4IQ1A 4MCUA 5IQYA 5LCZA 3CMIA 2LJKA 1FHEA
chains in the Genus database with same CATH topology
1XXUA 4PQHA 5AIVA 2WGRA 1Z3EA 5ECQB 2IMDA 2K9FA 3HJOA 1WOUA 3KMNA 4TN8A 3LWAA 3D21A 3GH9A 4HI7A 2LJAA 3K8NA 2CAIA 5DBQA 3FMWA 4A5PA 4WR5A 2O89A 3FZAA 3A2VA 3RAZA 1FVJA 3LORA 2CX3A 3IA1A 3P90A 2Z9SA 4G9HA 3L0HA 4Q5QA 4O5UA 2VUPA 1E6BA 1PMTA 3EE2A 3DEXA 2IFQB 4BVYA 1GWCA 1PA3A 2WDUA 4XS1A 2FD3A 2K6VA 4L5LA 2O8VB 4IHUA 1TU8A 2C80A 1VF4A 4MNNA 2N5AA 2UZ8A 3GX0A 4I6XA 4WXTA 5H5QA 3VLNA 5DAKA 3F0IA 1FO5A 3W6GA 2E7PA 2B5EA 2C4JA 3VWUA 2KLXA 3HZ8A 4X43A 4TOPA 3HHVA 1M0UA 2AAWA 1CQHA 4PQIA 2L4QA 2R5GA 3KTLA 1H75A 4IJ3A 1Z9HA 1A2MA 5CRGA 4J2FA 1O7UA 1IYHA 5LD0A 3QPMA 1GUHA 1K0CA 4J57E 5AGYA 3U5RE 4DSSA 1K0NA 3RHBA 3WT1A 3J7Yk 2GTUA 4N30A 5JCGA 4GF0A 2VCQA 1EP7A 3HVSA 2VIMA 2VD1A 4ID0A 4MJCA 2GVPA 2IWTA 1SJ6A 1Z5YE 4HUAA 3HD5A 1PX6A 4EXJA 2HRAA 2ZUPA 2L5OA 1TK5B 4DEJA 2YV7A 3GIXA 3ED3A 5D93A 1ERTA 4AJ8A 2CX4A 4MA9A 1GUKA 2MMOA 2GSTA 3DMLA 3VPTA 5ECSA 1ERUA 1UA5A 2LRTA 3EC3A 5GAND 3KTBA 3EINA 4XHMA 1SKWB 1YEPA 3W8SA 1ZCPA 1XOAA 3HJPA 1MD4A 1ZOFA 2NTOA 2FGXA 2IMFA 4GTUA 2E2GA 1MDJA 3ZYWA 1W4VA 2BJXA 1ZMAA 1A0FA 2IPAA 5AIXA 2YJHA 3GKXA 4G10A 1TK0B 4N11A 4GSSA 4F0CA 3GH6A 2PVOC 4ZB8A 4EO3A 3FK8A 3VWXA 3WGDA 2R4VA 5D9WA 3U6VA 4XCSA 4PUAA 1OKTA 3ERWA 1AUCA 3ME8A 1UC7A 2DMMA 2DJ1A 2F3MA 3P2AA 3F3QA 1TKDB 4Z2RA 1BG5A 1EOGA 1Q4JA 4D73A 2D2ZA 1O81A 1ACVA 1SD9A 3BCKA 1VRSD 4YQUA 2V2GA 3C8EA 2WFCA 1GNWA 3EMPA 1R5PA 2HZFA 4EC0A 2HNLA 4EDYA 3P8WA 1NM3A 4AF2A 2P31A 19GSA 2IN3A 2QGVA 4ECCA 5HFIA 2H66A 3TCOA 3LEFA 2FA4A 4K2DA 3UEMA 2J23A 1FOVA 4DVCA 2GSRA 4BA7A 1MDIA 3UL3A 1Z6NA 5KOWA 2LEGA 1ZYEA 2HYXA 4LL1B 4BPYA 3D4MA 3O76A 5CO3A 4OMVA 1RK4A 1X9SB 5IM9A 1THXA 2OE0A 1YKAA 2L57A 2IL3A 1XWKA 1JZDA 2IMIA 3MIXA 1YF1A 3F4SA 1O8WA 4KDXA 5EPFA 2DC5A 4MJBA 2V6KA 3OR5A 1TJDA 3RPNA 3PH9A 4OCEA 2C0FA 5G5EA 3IOSA 3Q18A 3FZ5A 2N5BA 1XVWA 2YWNA 2VCTA 3D22A 2A4HA 2YCDA 3IHGA 4GLTA 2VM1A 3QCPA 3FRCA 4K5RA 1PN9A 3GSSA 1R4WA 1XW5A 2H70A 4Q5FA 4I97A 4CHSA 2GS3A 5ELAA 4TRXA 4OO5A 1SYRA 4JZQA 2HRNA 1G7OA 2FWFA 3KJYA 1C72A 1QK8A 3UBLA 2H1AA 1PL1A 4GCIA 1TK8B 2VOCA 5FWGA 4OFNA 4G2EA 1OVNA 1GP1A 5D9TA 4MPGA 2KP1A 2C0GA 3VWWA 4F0BA 1JHBA 5CRDA 4FO5A 5B8BA 3EURA 1XIYA 1TTZA 4NWYA 1TP9A 3WD6A 5DJLA 4WBJA 1TDIA 2PBJA 5IO0A 4EIQA 3ZRDA 4TW5A 3S9FA 3D0ZA 2KHPA 5F8BA 2H01A 2TIRA 1KTEA 5GAPD 4ZIJA 4KDYA 1EZKA 4YKGA 1BEDA 1MD3A 1TOFA 22GSA 3HCZA 3IE3A 5IO2A 3M3MA 1LJRA 1DSBA 3MDKA 1SL0B 3KXOA 1EOHA 4O5RA 2YWMA 2C3NA 3WGXA 2IMEA 3G7JA 1XWCA 4WEYA 2B1LA 4NMUA 5KOXA 2K8VA 4BVXA 1A23A 1QUWA 1R26A 2HI7A 3DWVA 3BD2A 3P7XA 4ZB9A 3ISOA 3LYKA 4TVEA 4MF5A 3FZ4A 4NHZA 3VK9A 4CDOA 2JZTA 2OKAA 3ZMKA 4AJ7A 3E3EA 3CXGA 1GLQA 4QQ7A 1GSQA 4V1Ag 3HXSA 4WKWA 3FHKA 3UVTA 2M80A 1HQOA 3VWVA 5J5NA 4I5QA 5CNWA 4ECBA 4N0ZA 3H8QA 5LNKe 2G2QA 4KH7A 2V32A 3UAPA 3KMOA 6GSVA 2TRXA 4WF4A 2LQQA 4POBA 1VF1A 2FCHA 3APSA 4L5OA 2CA8A 2I1UA 3GRXA 3Q6OA 1EGRA 2C1YA 1TW9A 4MMMA 3E9JB 1PKWA 4HOJA 5JCUA 3M1GA 2L59A 1H4OA 2I81A 2IJYA 3ERGA 3GMFA 4ZBAA 1WP0A 3LJRA 3VI5A 2GT5A 7GSSA 2FWGA 5ECNB 2RM5A 2X99A 4P3YB 4GQFA 1WIKA 2FHEA 4JR6A 1GSUA 4EE0A 3DKSA 1G6WA 4MZBA 2JADA 4XTSA 1FAAA 1OAZA 3I6AA 3KCMA 2DJJA 4FH8A 1BYEA 1ABAA 1AXDA 4KSOA 1K0AA 2HT9A 2ZCTA 2C8UA 2WS2A 4TR3A 1YQ1A 1BX9A 5GSTA 5IMCA 1SYXA 2PWJA 2YOIA 1F2EA 3KM6A 4EIPA 3J7Yb 3GUSA 4X1UA 2O85A 3QDNA 3KH9A 3CBUA 3TJGA 1XW6A 4HDEA 1Z6MA 3IAS2 1UN2A 3UVHA 1B9XC 2JZSA 3TJJA 3FY7A 4G19A 4J56E 4K2XA 1M99A 3CTFA 2HXKA 2YN1A 5G5FA 2J9HA 2C0EA 4Q5RA 3L9UA 4NHWA 1BAYA 1MEKA 1THOA 3DGQA 1BJXA 5ECIB 5A4UA 4JU5A 1M9BA 1AIUA 2H30A 4POKA 5D73A 5KEJA 4WETA 4PQ1A 4ZBBA 5D8IA 1V9WA 4LMVA 4NPBA 3IR4A 3F4RA 5H5SA 4QL7A 1B4PA 1J9BA 2YANA 4MZCA 3ZFBA 4IKHA 2DKIA 5DJMA 2LSTA 4MLYA 2DIYA 3I43A 2WB9A 1HD2A 4FIWA 3SWLA 3F63A 4RI7A 4H86A 4TXOB 6GSSA 2HE3A 1TU7A 4KAEA 1NSWA 3C71A 2P0GA 3LYPA 2RLIA 3N5OA 1GSSA 2GQLA 3I9V2 2H76A 3TRXA 2H0IA 4K7IA 5JWRB 3LW9A 4IP1A 5HFGA 3LQ7A 2CVKA 1X9MB 1CQGA 4K7OA 4POLA 4MZWA 2GSQA 4MH2A 5B6MA 1T8EB 2B1KA 1S3DA 3RHCA 2GSSA 3MNGA 3TOUA 4O5QA 1YJ6A 3A3TA 5IMAA 3UIWA 3TJFA 1K0BA 2H1GA 4PURA 2P5RA 3BBYA 1WWJA 3BJ5A 3FW2A 3APOA 2DKHA 5JWQB 4MP4A 5IMVA 2ES7A 1PN0A 2A2PA 3RBTA 4NAXA 3EU4A 5BMUA 2H73A 4XS4B 2FWHA 2KP2A 1TRVA 3US3A 4MJAA 2YWOA 5DVBA 4ISDA 3ZL5A 1ZGNA 3UMAA 4G0LA 1ZYNA 4CY6A 3GA4A 2MMNA 5CP1A 3TKRA 2VCZA 4AGSA 2VD0A 2MBSA 3TKPA 1GTIA 1OC8A 2H6YA 3TRPA 4JRRA 1QFNA 2R37A 4GSNA 3V1WA 3GKMA 4EDZA 2MMAA 2HZEB 1U6TA 2FUG2 1T3BA 1O8XA 3EU3A 4KW6A 1VF2A 2GQKA 3PGTA 5G31A 4IVFA 1F3BA 2VCXA 4WBRD 1B48A 3TKSA 2HRFA 3O6TA 4KF9A 5ID2B 1VF3A 1YZXA 1SENA 4JBBA 4HZ4A 1V98A 3QMXA 6GSXA 4K1FA 5EVOA 4KDUA 1SL2B 4OO4A 2ZNMA 4IGJA 1WJKA 2AHEA 2NDOA 5J3RA 2CVDA 3EVIA 2LNTA 2I9HA 4L0UA 5ECKB 5F07A 5DQYA 5FT3A 4IP6A 4F2IA 3CSJA 5ECMB 3NIVA 2N5FA 2M72A 1K3OA 2FWEA 3QAWA 1ZYPA 2JACA 2FLSA 4V2LA 1JZOA 5KN2A 1AQVA 3ERFA 4HZ2A 4GRFA 4LLRA 4BL7A 1TRUA 2DJ2A 1IYIA 3EWLA 1ZYQB 2XHFA 4TXVA 2PUKC 2DJ3A 3GFKA 4ECIA 2QSIA 3F6FA 2HSHA 4KUNA 2GZZA 1HNCA 3VI7A 3H4KA 1AQXA 2LRCA 5ECHB 2L5LA 3ZIJA 4GWRA 2IMKA 4WF5A 2LRNA 3FYGA 2K18A 1O85A 2H0HA 2C3QA 2JL4A 4PXOA 1XWGA 2OADA 4IBPA 4PGTA 3HZ4A 1EV9A 4EUYA 3GN3A 3BCIA 4HEA2 3IXRA 1M2BA 4XS6A 5CRWA 4BVYB 4MDCA 3ZMLA 1GH2A 16GSA 1AC1A 1ERVA 3F9UA 3L4NA 1FB0A 2GZYA 5J4UA 4G0KA 3KIJA 4XRAA 5ECRB 3HDCA 2KOKA 4L8EA 4USSA 4K0NA 3D6IA 2X64A 5DAKB 5IMFA 1LBKA 1T7PB 5AN1A 2MBTA 2H75A 1SD8A 1DBYA 1TI3A 1B9YC 2G0FA 4KCAA 5B8AA 2YZUA 3TKQA 3GURA 4IJIA 2IFQA 1M2AA 1A24A 4TKYA 3GKNA 2GZPA 2RUEA 2CV4A 1XOBA 3WT2A 2YV9A 2R3XA 4OFTA 4TXOA 1XZOA 5A4WA 4DSSB 2RUFA 3GKKA 4KNDA 3GL5A 5IMDA 2X8CA 6GSWA 1OKDA 2V41A 4OD7A 2WRTA 2H1DA 4X4JA 1SU9A 1LU4A 1NHYA 4KE3A 2WZ9A 1U3IA 4Z7XA 3GV1A 2CAQA 4OCFA 5ENUA 2V1MA 9GSSA 2EIQA 4PUFC 2LV3A 2DIZA 11GSA 1ERWA 3EYTA 4X0XA 2XPEA 1PSQA 3ZZXA 2DJKA 1RW1A 4LMWA 3AY8A 6GSYA 2LQOA 4XIHA 4K8MA 3PPUA 4MK3A 4Q5NA 3ZIVA 3APQA 4RQXA 2HSMA 3IBHA 2PU9C 1GNEA 2JU5A 1G0TA 4PTSA 2PGTA 3L78A 3C7MA 1Z7PA 2OE1A 1JLWA 4MF7A 1ON4A 2GQMA 1EP8A 1GL8A 4MPFA 1FW1A 1YKCA 3A5WA 4LA1A 1T00A 2L6DA 5J41A 3VPQA 2FA8A 4Z2UA 1N8JA 2YNXA 3GX8A 5GSSA 3M9JA 4KA0A 3R2QA 2R2JA 1N2AA 8GSSA 2JSZA 2ON5A 17GSA 3UBKA 3KH7A 1GSYA 3L9VA 2X8HA 4D73B 2B3SA 2HZEA 3QFAC 1DUGA 3DIEA 5DALB 3LSZA 3RDWA 3TUEA 1WE0A 1Y6EA 1R5AA 2GDRA 5ID2A 4E8HA 1FG4A 1O73A 2R0GA 4MABA 1KBNA 1XWAA 1GSDA 3QOUA 3QFBC 3GTUB 2CQ9A 2CZ2A 3QR6A 2VLTA 4QL9A 3WYWA 2ALBA 2R0CA 1K0OA 3HJMA 1PRXA 2MZCA 3M8NA 3ZLPA 5D9VA 5G2ZA 3HVXA 3ZFLA 4MH3A 1X0RA 4HQSA 1B4QA 20GSA 12GSA 4TR1B 5ECOB 2WCIA 4BWSA 1FVKA 1X5DA 18GSA 2LS5A 4N10A 1O6JA 2AUVA 5A4VA 2DLXA 5G1KA 4ZILA 4V2MA 4MJEA 4PNGA 1UVZA 1EV4A 1WPIA 2H72A 3GL3A 3TDGA 4ICYA 4KGIA 1OC9B 3KP9A 1VGLA 4NV2A 2R0PA 4EF0A 1TXXA 4PX1A 3TKSC 5IMZA 3HKRA 3IHQA 2CT6A 2YPMA 3TGZA 14GSA 3G7IA 5EL8A 5INYA 3L9SA 3IV4A 3F6DA 5GZZB 2VL2A 5E59A 5HR0A 1V2AA 3G9BA 1GRXA 2PERA 2YJ7A 4DSQA 4YH2A 4V1Ap 1OYJA 4RUVA 1V57A 2DMLA 2C3TA 3W8JA 2L4CA 1XWBA 4N0VA 5DCHA 4V2NA 2H6XA 4YAVA 1GUMA 3D4TA 2ON7A 4ZL8A 3E0UA 1ML6A 1JZWA 4CW9A 2DSAA 2JZRA 5D9XA 5G1LA 2PVQA 3ZVJA 1EGOA 4YQVA 5CRHA 4HU9A 1XCCA 1M9AA 3GNJA 4ILFA 2B5XA 1GTAA 4TR4A 3UOMA 4OFMA 2NBSA 3C73A 3MSZA 3M9KA 1V40A 1A2JA 3N9JA 2JSYA 3LG6A 3Q19A 1V58A 1EEMA 5IIZA 3NZNA 2K8SA 2H19A 2XBIA 2OE3A 2MYGA 1HNAA 1K0MA 2NVLA 1NW2A 10GSA 3TJKA 4JEDA 5AISA 5IPHA 3DRNA 1Q98A 4BVXB 4HQZA 4KB3A 4PNFA 1K3LA 2DJ0A 2OBIA 4POMA 1DE2A 4I2TA 4I2UA 5CREA 1EWXA 2O87A 2CZ3A 2E2MA 5IOWA 2H1BA 3A5IA 4K9ZA 4HJMA 3JCML 3QD9A 3IC4A 2XC2A 3CSIA 1OC3A 4YKFA 3A2XA 3DYRA 4ZXGA 3IC8A 4ZL9A 1SK1A 1XW9A 5HR3A 1FOHA 5CYYA 4MF6A 1KNGA 1T1VA 3UJ1A 2QKEA 3H93A 4K7NA 1PGTA 4EVMA 1X5EA 1HYUA 6GSTA 3DVXA 4E8EA 1I9DA 4JR4A 5ECLB 4GSTA 1U3AA 1T4ZA 3KZQA 4O7HA 2YWIA 2YZHA 3MAKA 4ZB6A 1S3CA 2A2SA 3H79A 2AJQB 3ME7A 1PKZA 4IW9A 2H8LA 4RI6A 1ZZYA 3F4TA 3KP8A 2QC7A 1SJIA 5ECPB 1TI1A 2B5YA 5JWOB 3GHAA 2VLVA 2RIIA 3KEBA 2O7KA 2E0QA 5G30A 3LFLA 2OA7A 3O3TA 1SL1B 3TKSE 2AYTA 1FB6A 1W89A 1JZRA 4Z2TA 5KN3A 1GLPA 2PN8A 3DVWA 5DALA 1SKSB 3CTGA 5FHIA 1BQ7A 4F82A 2C0DA 3TRQA 3IPZA 3TB2A 1GULA 5C04A 1F3AA 2TRCP 5CAXA 3CYNA 3TJBA 1XFLA 4F03A 1KEBA 3GTUA 2VCVA 1DE1A 4KX4A 4RQRA 5J9CA 5HQPA 3DD3A 3IDVA 2F9SA 4K0GA 3IK9A 1SKRB 2A4VA 5B7CA 3H1NA 5DDLA 1XVQA 2GLRA 5L71A 1QXHA 1AQWA 3KGKA 4XRDA 1PX7A 13GSA 3KD0A 1MDKA 4K5SA 3R3EA 4KSMA 1OE7A 3A2WA 3FZ9A 4TR1A 3QAVA 4KCEA 2OJLA 1WMJA 1M7TA 2GT6A 4F9ZA 2P5QA 4FYBA 4ML1A 2PPTA 2PMTA 3PINA 4IN0A 2B6MA 2WULA 2IIYA 4ULXA 6GSUA 2I3YA 1B8XA 5KN0A 1U87A 1XPVA 1F6MC 1WRYA 1MTCA 1URMA 1K0DA 2X4AA 2QA2A 4IS0A 1OC9A 1J0FA 3EMXA 4EKZA 5J9BA 1A2LA 2EIRA 3MYDA 1NHOA 1X5CA 2H71A 1AAZA 3CSHA 5ABRA 3WGEA 1PL2A 3HA9A 2R6KA 1USBA 3ZVJD 2YP6A 4WR4A 2HLSA 3FEUA 3CRUA 4K6XA 1GSEA 3FR6A 1QQ2A 4BWQA 5E4WA 3RPPA 4GQCA 2FNOA 3UARA 2BMXA 1G7EA 2LUSA 3C1SA 1TRSA 2VCWA 4YQMA 2CVBA 3M0FA 3FKFA 2NPBA 5JCWA 4OWYA 3G7YA 4NXIA 4I8BA 2KUCA 2HSYA 3SBCA 2M46A 1F9MA 2VL3A 2VLUA 1I5GA 5F05A 4DSRA 5C00A 2LJRA 1U88A 1R7HA 1SK0A 1JFUA 4FYCA 3GSTA 2LTKA 2B7JA 5IPGA 2MMZA 4CY8A 3Q74A 3ZREA 4O32A 4HU7A 4O92A 3IK7A 4AJ6A 1A8LA 4JE1A 4EL1A 2F8FA 1A8YA 1ST9A 1GSFA 1M2DA 5KN1A 3D5JA 1GTUA 3LXTA 1YF0A 4YAPA 1YDKA 2AB6A 2VL2C 5COHA 1X9WB 2REMA 2L6CA 2FY6A 1RQMA 4GXZA 2F51A 1JLVA 4ZBDA 5DQSA 1YEXA 2WJUA 4L0WA 3DXBA 4XS4A 4HS1A 1PD21 4FYUA 2HRKA 3LGCA 1AW9A 2LNSA 1ILOA 3I69A 4FQUA 2HFDA 5HR1A 3TOTA 3QAGA 2OBKA 2VM2A 2DBCA 2GGTA 2H0GA 1Y25A 3BOAA 2QA1A 3HYPA 5D96A 2XBQA 4IQAA 4HJ2A 1SK2A 3ZTLA 3LXZA 2X8GA 5BRTA 1ZL9A 2VAFA 2V6OA 2OACA 5DCGA 5F0GA 5B6NA 3CRTA 3PR8A 1K3YA 2RM6A 5EY6A 1SJZA 4NV5A 3C1RA 5HFKA 1YY7A 3MWHA 5H5RA 4ML6A 2A2RA 2F8AA 3HVVA 4ZL7A 3HY2A 4ACSA 1A0RP 1QMVA 3NOFA 5IOXA 4BL7B 1PQNA 1E2YA 4G0IA 2VO4A 1OE8A 4TR0A 2H6ZA 3ZITA 4ECJA 3GYKA 1Z7RA 1HNBA 2AV4A 3FR9A 4LL4B 3IRAA 5HR2A 1J08A 1TRWA 5A5KA 2H74A 1F37A 1GTBA 1XBSA 2I4AA 2LKUA 2VL9A 2X49A 2EIOA 1S3AA 1QGVA 2EC4A 1G6YA 1EEJA 2B7KA 3VFIA 3FR3A 3F8UA 4IELA 1T4YA 2BTOT 3IAM2 2XPDA 3F3RA 5F06A 3VURA 5ELGA 3EPTA 4IQ1A 4MCUA 5IQYA 5LCZA 3CMIA 2LJKA 1FHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXU A;  4PQH A;  5AIV A;  2WGR A;  1Z3E A;  5ECQ B;  2IMD A;  2K9F A;  3HJO A;  1WOU A;  3KMN A;  4TN8 A;  3LWA A;  3D21 A;  3GH9 A;  4HI7 A;  2LJA A;  3K8N A;  2CAI A;  5DBQ A;  4WR5 A;  2O89 A;  3FZA A;  3A2V A;  3RAZ A;  1FVJ A;  3LOR A;  2CX3 A;  3IA1 A;  3P90 A;  2Z9S A;  4G9H A;  3L0H A;  4Q5Q A;  2VUP A;  1E6B A;  1PMT A;  3EE2 A;  3DEX A;  2IFQ B;  4BVY A;  1GWC A;  1PA3 A;  2WDU A;  4XS1 A;  2FD3 A;  2K6V A;  4L5L A;  2O8V B;  4IHU A;  1TU8 A;  2C80 A;  1VF4 A;  2N5A A;  3GX0 A;  4WXT A;  4I6X A;  5H5Q A;  3VLN A;  5DAK A;  3F0I A;  1FO5 A;  3W6G A;  2E7P A;  2B5E A;  2C4J A;  3VWU A;  2KLX A;  3HZ8 A;  4X43 A;  4TOP A;  3HHV A;  1M0U A;  2AAW A;  1CQH A;  4PQI A;  2L4Q A;  2R5G A;  3KTL A;  1H75 A;  4IJ3 A;  1Z9H A;  1A2M A;  5CRG A;  4J2F A;  1O7U A;  1IYH A;  5LD0 A;  3QPM A;  1GUH A;  1K0C A;  4J57 E;  5AGY A;  3U5R E;  4DSS A;  1K0N A;  3RHB A;  3WT1 A;  3J7Y k;  2GTU A;  4N30 A;  5JCG A;  4GF0 A;  2VCQ A;  1EP7 A;  3HVS A;  2VIM A;  2VD1 A;  4ID0 A;  4MJC A;  2GVP A;  2IWT A;  1SJ6 A;  1Z5Y E;  4HUA A;  3HD5 A;  1PX6 A;  4EXJ A;  2ZUP A;  2L5O A;  1TK5 B;  4DEJ A;  2YV7 A;  3GIX A;  3ED3 A;  5D93 A;  1ERT A;  4AJ8 A;  2CX4 A;  4MA9 A;  1GUK A;  2MMO A;  2GST A;  3DML A;  3VPT A;  5ECS A;  1ERU A;  1UA5 A;  2LRT A;  3EC3 A;  5GAN D;  3KTB A;  3EIN A;  4XHM A;  1SKW B;  1YEP A;  3W8S A;  1ZCP A;  1XOA A;  3HJP A;  1MD4 A;  1ZOF A;  2NTO A;  2FGX A;  2IMF A;  4GTU A;  2E2G A;  1MDJ A;  3ZYW A;  1W4V A;  2BJX A;  1ZMA A;  1A0F A;  2IPA A;  5AIX A;  2YJH A;  3GKX A;  4G10 A;  1TK0 B;  4N11 A;  4GSS A;  4F0C A;  3GH6 A;  2PVO C;  4ZB8 A;  4EO3 A;  3FK8 A;  3VWX A;  3WGD A;  2R4V A;  5D9W A;  3U6V A;  4XCS A;  4PUA A;  1OKT A;  3ERW A;  1AUC A;  3ME8 A;  1UC7 A;  2DMM A;  2DJ1 A;  2F3M A;  3P2A A;  3F3Q A;  1TKD B;  1BG5 A;  1EOG A;  1Q4J A;  4D73 A;  2D2Z A;  1O81 A;  1ACV A;  1SD9 A;  3BCK A;  1VRS D;  4YQU A;  2V2G A;  3C8E A;  2WFC A;  1GNW A;  3EMP A;  1R5P A;  2HZF A;  4EC0 A;  2HNL A;  4EDY A;  3P8W A;  1NM3 A;  4AF2 A;  2P31 A;  19GS A;  2IN3 A;  2QGV A;  4ECC A;  5HFI A;  2H66 A;  3TCO A;  3LEF A;  2FA4 A;  4K2D A;  3UEM A;  2J23 A;  1FOV A;  4DVC A;  2GSR A;  4BA7 A;  1MDI A;  3UL3 A;  1Z6N A;  2LEG A;  1ZYE A;  2HYX A;  4LL1 B;  4BPY A;  3D4M A;  3O76 A;  5CO3 A;  4OMV A;  1RK4 A;  1X9S B;  5IM9 A;  1THX A;  2OE0 A;  1YKA A;  2L57 A;  2IL3 A;  1XWK A;  1JZD A;  2IMI A;  1YF1 A;  3F4S A;  1O8W A;  4KDX A;  5EPF A;  2DC5 A;  4MJB A;  2V6K A;  3OR5 A;  1TJD A;  3RPN A;  3PH9 A;  4OCE A;  2C0F A;  5G5E A;  3IOS A;  3Q18 A;  3FZ5 A;  2N5B A;  1XVW A;  2YWN A;  2VCT A;  3D22 A;  2YCD A;  4GLT A;  2VM1 A;  3QCP A;  3FRC A;  1PN9 A;  3GSS A;  1R4W A;  1XW5 A;  2H70 A;  4Q5F A;  4I97 A;  4CHS A;  2GS3 A;  5ELA A;  4TRX A;  4OO5 A;  1SYR A;  4JZQ A;  2HRN A;  1G7O A;  2FWF A;  3KJY A;  1C72 A;  1QK8 A;  3UBL A;  2H1A A;  1PL1 A;  4GCI A;  1TK8 B;  2VOC A;  5FWG A;  4OFN A;  4G2E A;  1OVN A;  1GP1 A;  5D9T A;  4MPG A;  2KP1 A;  2C0G A;  3VWW A;  4F0B A;  1JHB A;  5CRD A;  4FO5 A;  5B8B A;  3EUR A;  1XIY A;  1TTZ A;  4NWY A;  1TP9 A;  3WD6 A;  5DJL A;  4WBJ A;  1TDI A;  2PBJ A;  5IO0 A;  3ZRD A;  4TW5 A;  3S9F A;  3D0Z A;  2KHP A;  5F8B A;  2H01 A;  2TIR A;  1KTE A;  5GAP D;  4ZIJ A;  4KDY A;  1EZK A;  1BED A;  1MD3 A;  1TOF A;  22GS A;  3HCZ A;  3IE3 A;  5IO2 A;  3M3M A;  1LJR A;  1DSB A;  3MDK A;  1SL0 B;  3KXO A;  1EOH A;  4O5R A;  2YWM A;  2C3N A;  3WGX A;  2IME A;  3G7J A;  1XWC A;  4WEY A;  2B1L A;  4NMU A;  2K8V A;  4BVX A;  1A23 A;  1QUW A;  1R26 A;  2HI7 A;  3DWV A;  3BD2 A;  3P7X A;  4ZB9 A;  3ISO A;  3LYK A;  4TVE A;  4MF5 A;  3FZ4 A;  4NHZ A;  3VK9 A;  4CDO A;  2JZT A;  2OKA A;  3ZMK A;  4AJ7 A;  3E3E A;  3CXG A;  1GLQ A;  4QQ7 A;  1GSQ A;  4V1A g;  3HXS A;  4WKW A;  3FHK A;  3UVT A;  2M80 A;  1HQO A;  3VWV A;  5J5N A;  4I5Q A;  5CNW A;  4ECB A;  4N0Z A;  3H8Q A;  5LNK e;  2G2Q A;  4KH7 A;  2V32 A;  3UAP A;  3KMO A;  6GSV A;  2TRX A;  4WF4 A;  2LQQ A;  4POB A;  1VF1 A;  2FCH A;  3APS A;  4L5O A;  2CA8 A;  2I1U A;  3GRX A;  3Q6O A;  1EGR A;  2C1Y A;  1TW9 A;  4MMM A;  3E9J B;  1PKW A;  4HOJ A;  5JCU A;  3M1G A;  2L59 A;  1H4O A;  2I81 A;  2IJY A;  3ERG A;  3GMF A;  4ZBA A;  1WP0 A;  3LJR A;  3VI5 A;  2GT5 A;  7GSS A;  2FWG A;  5ECN B;  2RM5 A;  2X99 A;  4P3Y B;  4GQF A;  1WIK A;  2FHE A;  4JR6 A;  1GSU A;  4EE0 A;  3DKS A;  1G6W A;  4MZB A;  2JAD A;  4XTS A;  1FAA A;  1OAZ A;  3I6A A;  3KCM A;  2DJJ A;  4FH8 A;  1BYE A;  1ABA A;  1AXD A;  4KSO A;  1K0A A;  2HT9 A;  2ZCT A;  2C8U A;  2WS2 A;  4TR3 A;  1YQ1 A;  1BX9 A;  5GST A;  5IMC A;  1SYX A;  2PWJ A;  2YOI A;  1F2E A;  3KM6 A;  3J7Y b;  3GUS A;  4X1U A;  2O85 A;  3QDN A;  3KH9 A;  3CBU A;  3TJG A;  1XW6 A;  4HDE A;  1Z6M A;  3IAS 2;  1UN2 A;  3UVH A;  1B9X C;  2JZS A;  3TJJ A;  3FY7 A;  4G19 A;  4J56 E;  1M99 A;  3CTF A;  2HXK A;  2YN1 A;  5G5F A;  2J9H A;  2C0E A;  4Q5R A;  3L9U A;  4NHW A;  1BAY A;  1MEK A;  1THO A;  3DGQ A;  1BJX A;  5ECI B;  5A4U A;  4JU5 A;  1M9B A;  1AIU A;  2H30 A;  4POK A;  5D73 A;  5KEJ A;  4WET A;  4PQ1 A;  4ZBB A;  5D8I A;  1V9W A;  4LMV A;  4NPB A;  3IR4 A;  3F4R A;  5H5S A;  4QL7 A;  1B4P A;  1J9B A;  2YAN A;  4MZC A;  3ZFB A;  4IKH A;  5DJM A;  2LST A;  4MLY A;  2DIY A;  3I43 A;  2WB9 A;  1HD2 A;  4FIW A;  3SWL A;  3F63 A;  4RI7 A;  4H86 A;  4TXO B;  6GSS A;  2HE3 A;  1TU7 A;  4KAE A;  1NSW A;  3C71 A;  2P0G A;  3LYP A;  2RLI A;  3N5O A;  1GSS A;  2GQL A;  3I9V 2;  2H76 A;  3TRX A;  2H0I A;  4K7I A;  5JWR B;  4IP1 A;  5HFG A;  3LQ7 A;  2CVK A;  1X9M B;  1CQG A;  4K7O A;  4POL A;  4MZW A;  2GSQ A;  4MH2 A;  5B6M A;  1T8E B;  2B1K A;  1S3D A;  3RHC A;  2GSS A;  3MNG A;  3TOU A;  1YJ6 A;  3A3T A;  5IMA A;  3UIW A;  3TJF A;  1K0B A;  2H1G A;  4PUR A;  2P5R A;  3BBY A;  1WWJ A;  3BJ5 A;  3FW2 A;  3APO A;  5JWQ B;  4MP4 A;  5IMV A;  2ES7 A;  3RBT A;  4NAX A;  3EU4 A;  2H73 A;  4XS4 B;  2FWH A;  2KP2 A;  1TRV A;  3US3 A;  4MJA A;  2YWO A;  5DVB A;  4ISD A;  3ZL5 A;  1ZGN A;  3UMA A;  3GA4 A;  2MMN A;  5CP1 A;  3TKR A;  2VCZ A;  4AGS A;  2VD0 A;  2MBS A;  3TKP A;  1GTI A;  1OC8 A;  2H6Y A;  3TRP A;  4JRR A;  1QFN A;  2R37 A;  4GSN A;  3V1W A;  3GKM A;  4EDZ A;  2MMA A;  2HZE B;  1U6T A;  2FUG 2;  1T3B A;  1O8X A;  3EU3 A;  4KW6 A;  1VF2 A;  2GQK A;  3PGT A;  5G31 A;  4IVF A;  1F3B A;  2VCX A;  4WBR D;  1B48 A;  3TKS A;  2HRF A;  3O6T A;  5ID2 B;  1VF3 A;  1YZX A;  1SEN A;  4JBB A;  4HZ4 A;  1V98 A;  3QMX A;  6GSX A;  4K1F A;  5EVO A;  4KDU A;  1SL2 B;  4OO4 A;  2ZNM A;  4IGJ A;  1WJK A;  2AHE A;  2NDO A;  5J3R A;  2CVD A;  3EVI A;  2LNT A;  2I9H A;  4L0U A;  5ECK B;  5F07 A;  5DQY A;  5FT3 A;  4IP6 A;  4F2I A;  3CSJ A;  5ECM B;  3NIV A;  2N5F A;  2M72 A;  1K3O A;  2FWE A;  3QAW A;  2JAC A;  2FLS A;  4V2L A;  1JZO A;  5KN2 A;  1AQV A;  3ERF A;  4HZ2 A;  4GRF A;  4LLR A;  4BL7 A;  1TRU A;  2DJ2 A;  1IYI A;  3EWL A;  1ZYQ B;  2XHF A;  4TXV A;  2PUK C;  2DJ3 A;  3GFK A;  4ECI A;  2QSI A;  3F6F A;  2HSH A;  4KUN A;  2GZZ A;  1HNC A;  3VI7 A;  3H4K A;  1AQX A;  2LRC A;  5ECH B;  2L5L A;  3ZIJ A;  4GWR A;  2IMK A;  4WF5 A;  2LRN A;  3FYG A;  2K18 A;  1O85 A;  2H0H A;  2C3Q A;  2JL4 A;  4PXO A;  1XWG A;  2OAD A;  4IBP A;  4PGT A;  3HZ4 A;  1EV9 A;  4EUY A;  3GN3 A;  3BCI A;  4HEA 2;  3IXR A;  1M2B A;  4XS6 A;  5CRW A;  4MDC A;  3ZML A;  1GH2 A;  16GS A;  1AC1 A;  1ERV A;  3F9U A;  3L4N A;  1FB0 A;  2GZY A;  5J4U A;  3KIJ A;  4XRA A;  5ECR B;  3HDC A;  2KOK A;  4L8E A;  4K0N A;  3D6I A;  2X64 A;  5DAK B;  5IMF A;  1LBK A;  1T7P B;  5AN1 A;  2MBT A;  2H75 A;  1SD8 A;  1DBY A;  1TI3 A;  1B9Y C;  2G0F A;  4KCA A;  5B8A A;  2YZU A;  3TKQ A;  3GUR A;  4IJI A;  2IFQ A;  1M2A A;  1A24 A;  4TKY A;  3GKN A;  2GZP A;  2RUE A;  2CV4 A;  1XOB A;  3WT2 A;  2YV9 A;  2R3X A;  4OFT A;  4TXO A;  1XZO A;  5A4W A;  4DSS B;  2RUF A;  3GKK A;  4KND A;  3GL5 A;  5IMD A;  2X8C A;  6GSW A;  1OKD A;  2V41 A;  4OD7 A;  2WRT A;  2H1D A;  1SU9 A;  1LU4 A;  1NHY A;  4KE3 A;  2WZ9 A;  1U3I A;  4Z7X A;  3GV1 A;  2CAQ A;  4OCF A;  5ENU A;  2V1M A;  9GSS A;  2EIQ A;  4PUF C;  2LV3 A;  2DIZ A;  11GS A;  1ERW A;  3EYT A;  4X0X A;  2XPE A;  1PSQ A;  3ZZX A;  2DJK A;  1RW1 A;  4LMW A;  3AY8 A;  6GSY A;  2LQO A;  4XIH A;  4K8M A;  3ZIV A;  4MK3 A;  4Q5N A;  3APQ A;  4RQX A;  3IBH A;  2PU9 C;  1GNE A;  2JU5 A;  1G0T A;  2PGT A;  3L78 A;  3C7M A;  1Z7P A;  2OE1 A;  1JLW A;  4MF7 A;  1ON4 A;  2GQM A;  1EP8 A;  1GL8 A;  4MPF A;  1FW1 A;  1YKC A;  3A5W A;  4LA1 A;  1T00 A;  2L6D A;  5J41 A;  3VPQ A;  2FA8 A;  1N8J A;  2YNX A;  3GX8 A;  5GSS A;  3M9J A;  4KA0 A;  3R2Q A;  2R2J A;  1N2A A;  8GSS A;  2JSZ A;  2ON5 A;  17GS A;  3UBK A;  3KH7 A;  1GSY A;  3L9V A;  2X8H A;  4D73 B;  2B3S A;  2HZE A;  3QFA C;  1DUG A;  3DIE A;  5DAL B;  3LSZ A;  3RDW A;  3TUE A;  1WE0 A;  1Y6E A;  1R5A A;  2GDR A;  5ID2 A;  4E8H A;  1FG4 A;  1O73 A;  4MAB A;  1KBN A;  1XWA A;  1GSD A;  3QOU A;  3QFB C;  3GTU B;  2CQ9 A;  2CZ2 A;  3QR6 A;  2VLT A;  4QL9 A;  3WYW A;  2ALB A;  1K0O A;  3HJM A;  1PRX A;  2MZC A;  3M8N A;  3ZLP A;  5D9V A;  5G2Z A;  3HVX A;  3ZFL A;  4MH3 A;  1X0R A;  4HQS A;  1B4Q A;  20GS A;  12GS A;  4TR1 B;  5ECO B;  2WCI A;  4BWS A;  1FVK A;  1X5D A;  18GS A;  2LS5 A;  4N10 A;  1O6J A;  2AUV A;  5A4V A;  2DLX A;  5G1K A;  4ZIL A;  4V2M A;  4MJE A;  4PNG A;  1UVZ A;  1EV4 A;  1WPI A;  2H72 A;  3GL3 A;  3TDG A;  4KGI A;  1OC9 B;  3KP9 A;  1VGL A;  4NV2 A;  4EF0 A;  1TXX A;  4PX1 A;  3TKS C;  5IMZ A;  3HKR A;  3IHQ A;  2CT6 A;  2YPM A;  3TGZ A;  14GS A;  3G7I A;  5EL8 A;  5INY A;  3L9S A;  3IV4 A;  3F6D A;  5GZZ B;  2VL2 A;  5E59 A;  5HR0 A;  1V2A A;  3G9B A;  1GRX A;  2PER A;  2YJ7 A;  4DSQ A;  4YH2 A;  4V1A p;  1OYJ A;  4RUV A;  1V57 A;  2DML A;  2C3T A;  3W8J A;  2L4C A;  1XWB A;  4N0V A;  5DCH A;  4V2N A;  2H6X A;  4YAV A;  1GUM A;  3D4T A;  2ON7 A;  4ZL8 A;  3E0U A;  1ML6 A;  1JZW A;  4CW9 A;  2DSA A;  2JZR A;  5D9X A;  5G1L A;  2PVQ A;  3ZVJ A;  1EGO A;  4YQV A;  5CRH A;  4HU9 A;  1XCC A;  1M9A A;  3GNJ A;  4ILF A;  2B5X A;  1GTA A;  4TR4 A;  3UOM A;  4OFM A;  2NBS A;  3C73 A;  3MSZ A;  3M9K A;  1V40 A;  1A2J A;  3N9J A;  2JSY A;  3LG6 A;  3Q19 A;  1V58 A;  1EEM A;  5IIZ A;  3NZN A;  2K8S A;  2H19 A;  2XBI A;  2OE3 A;  2MYG A;  1HNA A;  1K0M A;  2NVL A;  1NW2 A;  10GS A;  3TJK A;  4JED A;  5AIS A;  5IPH A;  3DRN A;  1Q98 A;  4HQZ A;  4KB3 A;  4PNF A;  1K3L A;  2DJ0 A;  2OBI A;  4POM A;  1DE2 A;  4I2T A;  4I2U A;  5CRE A;  1EWX A;  2O87 A;  2CZ3 A;  2E2M A;  5IOW A;  2H1B A;  4K9Z A;  4HJM A;  3JCM L;  3QD9 A;  3IC4 A;  2XC2 A;  3CSI A;  1OC3 A;  3A2X A;  3DYR A;  4ZXG A;  4ZL9 A;  1SK1 A;  1XW9 A;  5HR3 A;  5CYY A;  4MF6 A;  1KNG A;  1T1V A;  3UJ1 A;  2QKE A;  3H93 A;  4K7N A;  1PGT A;  4EVM A;  1X5E A;  1HYU A;  6GST A;  3DVX A;  4E8E A;  1I9D A;  4JR4 A;  5ECL B;  4GST A;  1U3A A;  1T4Z A;  3KZQ A;  4O7H A;  2YWI A;  2YZH A;  3MAK A;  4ZB6 A;  1S3C A;  2A2S A;  3H79 A;  2AJQ B;  3ME7 A;  1PKZ A;  4IW9 A;  2H8L A;  4RI6 A;  1ZZY A;  3F4T A;  3KP8 A;  2QC7 A;  1SJI A;  5ECP B;  1TI1 A;  2B5Y A;  5JWO B;  3GHA A;  2VLV A;  2RII A;  3KEB A;  2O7K A;  2E0Q A;  5G30 A;  3LFL A;  2OA7 A;  3O3T A;  1SL1 B;  3TKS E;  2AYT A;  1FB6 A;  1W89 A;  1JZR A;  5KN3 A;  1GLP A;  2PN8 A;  3DVW A;  5DAL A;  1SKS B;  3CTG A;  5FHI A;  1BQ7 A;  4F82 A;  2C0D A;  3TRQ A;  3IPZ A;  3TB2 A;  1GUL A;  5C04 A;  1F3A A;  2TRC P;  5CAX A;  3CYN A;  3TJB A;  1XFL A;  4F03 A;  1KEB A;  3GTU A;  2VCV A;  1DE1 A;  4KX4 A;  4RQR A;  5J9C A;  5HQP A;  3DD3 A;  3IDV A;  2F9S A;  4K0G A;  3IK9 A;  1SKR B;  2A4V A;  5B7C A;  3H1N A;  5DDL A;  1XVQ A;  2GLR A;  5L71 A;  1QXH A;  1AQW A;  3KGK A;  4XRD A;  1PX7 A;  13GS A;  3KD0 A;  1MDK A;  4KSM A;  1OE7 A;  3A2W A;  3FZ9 A;  4TR1 A;  3QAV A;  4KCE A;  2OJL A;  1WMJ A;  1M7T A;  2GT6 A;  4F9Z A;  2P5Q A;  4FYB A;  4ML1 A;  2PPT A;  2PMT A;  3PIN A;  4IN0 A;  2B6M A;  2WUL A;  2IIY A;  4ULX A;  6GSU A;  2I3Y A;  1B8X A;  5KN0 A;  1U87 A;  1XPV A;  1F6M C;  1WRY A;  1MTC A;  1URM A;  1K0D A;  4IS0 A;  1OC9 A;  1J0F A;  3EMX A;  4EKZ A;  5J9B A;  1A2L A;  2EIR A;  1NHO A;  1X5C A;  2H71 A;  1AAZ A;  3CSH A;  5ABR A;  3WGE A;  1PL2 A;  3HA9 A;  2R6K A;  1USB A;  3ZVJ D;  2YP6 A;  4WR4 A;  2HLS A;  3FEU A;  3CRU A;  4K6X A;  1GSE A;  3FR6 A;  1QQ2 A;  4BWQ A;  5E4W A;  3RPP A;  4GQC A;  2FNO A;  3UAR A;  2BMX A;  1G7E A;  2LUS A;  3C1S A;  1TRS A;  2VCW A;  4YQM A;  2CVB A;  3M0F A;  3FKF A;  2NPB A;  5JCW A;  4OWY A;  3G7Y A;  4NXI A;  4I8B A;  2KUC A;  2HSY A;  3SBC A;  2M46 A;  1F9M A;  2VL3 A;  2VLU A;  1I5G A;  5F05 A;  4DSR A;  5C00 A;  2LJR A;  1U88 A;  1R7H A;  1SK0 A;  1JFU A;  4FYC A;  3GST A;  2LTK A;  2B7J A;  5IPG A;  2MMZ A;  3Q74 A;  3ZRE A;  4O32 A;  4HU7 A;  4O92 A;  3IK7 A;  4AJ6 A;  1A8L A;  4JE1 A;  4EL1 A;  2F8F A;  1A8Y A;  1ST9 A;  1GSF A;  1M2D A;  5KN1 A;  3D5J A;  1GTU A;  3LXT A;  1YF0 A;  4YAP A;  1YDK A;  2AB6 A;  2VL2 C;  5COH A;  1X9W B;  2REM A;  2L6C A;  2FY6 A;  1RQM A;  4GXZ A;  2F51 A;  1JLV A;  4ZBD A;  5DQS A;  1YEX A;  2WJU A;  4L0W A;  3DXB A;  4XS4 A;  4HS1 A;  1PD2 1;  4FYU A;  3LGC A;  1AW9 A;  2LNS A;  1ILO A;  3I69 A;  2HFD A;  5HR1 A;  3TOT A;  3QAG A;  2OBK A;  2VM2 A;  2DBC A;  2GGT A;  2H0G A;  1Y25 A;  3BOA A;  3HYP A;  5D96 A;  2XBQ A;  4IQA A;  4HJ2 A;  1SK2 A;  3ZTL A;  3LXZ A;  2X8G A;  1ZL9 A;  2VAF A;  2V6O A;  2OAC A;  5DCG A;  5F0G A;  5B6N A;  3CRT A;  3PR8 A;  1K3Y A;  2RM6 A;  5EY6 A;  1SJZ A;  4NV5 A;  3C1R A;  5HFK A;  1YY7 A;  3MWH A;  5H5R A;  4ML6 A;  2A2R A;  2F8A A;  3HVV A;  4ZL7 A;  3HY2 A;  4ACS A;  1A0R P;  1QMV A;  3NOF A;  5IOX A;  1PQN A;  1E2Y A;  2VO4 A;  1OE8 A;  4TR0 A;  2H6Z A;  3ZIT A;  4ECJ A;  3GYK A;  1Z7R A;  1HNB A;  2AV4 A;  3FR9 A;  4LL4 B;  3IRA A;  5HR2 A;  1J08 A;  1TRW A;  5A5K A;  2H74 A;  1F37 A;  1GTB A;  1XBS A;  2I4A A;  2LKU A;  2VL9 A;  2EIO A;  1S3A A;  1QGV A;  2EC4 A;  1G6Y A;  1EEJ A;  2B7K A;  3VFI A;  3FR3 A;  3F8U A;  4IEL A;  1T4Y A;  2BTO T;  3IAM 2;  2XPD A;  3F3R A;  5F06 A;  3VUR A;  5ELG A;  4IQ1 A;  4MCU A;  5IQY A;  5LCZ A;  3CMI A;  2LJK A;  1FHE A; 
#chains in the Genus database with same CATH topology
 1XXU A;  4PQH A;  5AIV A;  2WGR A;  1Z3E A;  5ECQ B;  2IMD A;  2K9F A;  3HJO A;  1WOU A;  3KMN A;  4HSC X;  4TN8 A;  3LWA A;  3D21 A;  3GH9 A;  4HI7 A;  2LJA A;  3K8N A;  2CAI A;  5DBQ A;  3FMW A;  4A5P A;  4WR5 A;  2O89 A;  3FZA A;  3A2V A;  3RAZ A;  1FVJ A;  3LOR A;  2CX3 A;  3IA1 A;  3P90 A;  2Z9S A;  4G9H A;  3L0H A;  4Q5Q A;  4O5U A;  2VUP A;  1E6B A;  1PMT A;  3EE2 A;  3DEX A;  2IFQ B;  4BVY A;  1GWC A;  1PA3 A;  2WDU A;  4XS1 A;  2FD3 A;  2K6V A;  4L5L A;  2O8V B;  4IHU A;  1TU8 A;  2C80 A;  1VF4 A;  4MNN A;  2N5A A;  2UZ8 A;  3GX0 A;  4I6X A;  4WXT A;  5H5Q A;  3VLN A;  5DAK A;  3F0I A;  1FO5 A;  3W6G A;  2E7P A;  2B5E A;  2C4J A;  3VWU A;  2KLX A;  3HZ8 A;  4X43 A;  4TOP A;  3HHV A;  1M0U A;  2AAW A;  1CQH A;  4PQI A;  2L4Q A;  2R5G A;  3KTL A;  1H75 A;  4IJ3 A;  1Z9H A;  1A2M A;  5CRG A;  4J2F A;  1O7U A;  1IYH A;  5LD0 A;  3QPM A;  1GUH A;  1K0C A;  4J57 E;  5AGY A;  3U5R E;  4DSS A;  1K0N A;  3RHB A;  3WT1 A;  3J7Y k;  2GTU A;  4N30 A;  5JCG A;  4GF0 A;  2VCQ A;  1EP7 A;  3HVS A;  2VIM A;  2VD1 A;  4ID0 A;  4MJC A;  2GVP A;  2IWT A;  1SJ6 A;  1Z5Y E;  4HUA A;  3HD5 A;  1PX6 A;  4EXJ A;  2HRA A;  2ZUP A;  2L5O A;  1TK5 B;  4DEJ A;  2YV7 A;  3GIX A;  3ED3 A;  5D93 A;  1ERT A;  4AJ8 A;  2CX4 A;  4MA9 A;  1GUK A;  2MMO A;  2GST A;  3DML A;  3VPT A;  5ECS A;  1ERU A;  1UA5 A;  2LRT A;  3EC3 A;  5GAN D;  3KTB A;  3EIN A;  4XHM A;  1SKW B;  1YEP A;  3W8S A;  1ZCP A;  1XOA A;  3HJP A;  1MD4 A;  1ZOF A;  2NTO A;  2FGX A;  2IMF A;  4GTU A;  2E2G A;  1MDJ A;  3ZYW A;  1W4V A;  2BJX A;  1ZMA A;  1A0F A;  2IPA A;  5AIX A;  2YJH A;  3GKX A;  4G10 A;  1TK0 B;  1PFO A;  4N11 A;  4GSS A;  4F0C A;  3GH6 A;  2PVO C;  4ZB8 A;  4EO3 A;  3FK8 A;  3VWX A;  3WGD A;  2R4V A;  5D9W A;  3U6V A;  4XCS A;  4PUA A;  1OKT A;  3ERW A;  1AUC A;  3ME8 A;  1UC7 A;  2DMM A;  2DJ1 A;  2F3M A;  3P2A A;  3F3Q A;  1TKD B;  4Z2R A;  1BG5 A;  1EOG A;  1Q4J A;  4D73 A;  2D2Z A;  1O81 A;  1ACV A;  1SD9 A;  3BCK A;  1VRS D;  4YQU A;  2V2G A;  3C8E A;  2WFC A;  1GNW A;  3EMP A;  1R5P A;  2HZF A;  4EC0 A;  2HNL A;  4EDY A;  3P8W A;  1NM3 A;  4AF2 A;  2P31 A;  19GS A;  2IN3 A;  2QGV A;  4ECC A;  5HFI A;  2H66 A;  3TCO A;  3LEF A;  2FA4 A;  4K2D A;  3UEM A;  2J23 A;  1FOV A;  4DVC A;  2GSR A;  4BA7 A;  1MDI A;  3UL3 A;  1Z6N A;  5KOW A;  2LEG A;  1ZYE A;  2HYX A;  4LL1 B;  4BPY A;  3D4M A;  3O76 A;  5CO3 A;  4OMV A;  1RK4 A;  1X9S B;  5IM9 A;  1THX A;  2OE0 A;  1YKA A;  2L57 A;  2IL3 A;  1XWK A;  1JZD A;  2IMI A;  3MIX A;  1YF1 A;  3F4S A;  1O8W A;  4KDX A;  5EPF A;  2DC5 A;  4MJB A;  2V6K A;  3OR5 A;  1TJD A;  3RPN A;  3PH9 A;  4OCE A;  2C0F A;  5G5E A;  3IOS A;  3Q18 A;  3FZ5 A;  2N5B A;  1XVW A;  2YWN A;  2VCT A;  3D22 A;  2A4H A;  2YCD A;  3IHG A;  4GLT A;  2VM1 A;  3QCP A;  3FRC A;  4K5R A;  1PN9 A;  3GSS A;  1R4W A;  1XW5 A;  2H70 A;  4Q5F A;  4I97 A;  4CHS A;  2GS3 A;  5ELA A;  4TRX A;  4OO5 A;  1SYR A;  4JZQ A;  2HRN A;  1G7O A;  2FWF A;  3KJY A;  1C72 A;  1QK8 A;  3UBL A;  2H1A A;  1PL1 A;  4GCI A;  1TK8 B;  2VOC A;  5FWG A;  4OFN A;  4G2E A;  1OVN A;  1GP1 A;  5D9T A;  4MPG A;  2KP1 A;  2C0G A;  3VWW A;  4F0B A;  1JHB A;  5CRD A;  4FO5 A;  5B8B A;  3EUR A;  1XIY A;  1TTZ A;  4NWY A;  1TP9 A;  3WD6 A;  5DJL A;  4WBJ A;  1TDI A;  2PBJ A;  5IO0 A;  4EIQ A;  3ZRD A;  4TW5 A;  3S9F A;  3D0Z A;  2KHP A;  5F8B A;  2H01 A;  2TIR A;  1KTE A;  5GAP D;  4ZIJ A;  4KDY A;  1EZK A;  4YKG A;  1BED A;  1MD3 A;  1TOF A;  22GS A;  3HCZ A;  3IE3 A;  1M3I A;  5IO2 A;  3M3M A;  1LJR A;  1DSB A;  3MDK A;  1SL0 B;  3KXO A;  1EOH A;  4O5R A;  2YWM A;  2C3N A;  3WGX A;  2IME A;  3G7J A;  1XWC A;  4WEY A;  2B1L A;  4NMU A;  5KOX A;  2K8V A;  4BVX A;  1A23 A;  1QUW A;  1R26 A;  2HI7 A;  3DWV A;  3BD2 A;  3P7X A;  4ZB9 A;  3ISO A;  3LYK A;  4TVE A;  4MF5 A;  3FZ4 A;  4NHZ A;  3VK9 A;  4CDO A;  2JZT A;  2OKA A;  3ZMK A;  4AJ7 A;  3E3E A;  3CXG A;  1GLQ A;  4QQ7 A;  1GSQ A;  4V1A g;  3HXS A;  4WKW A;  3FHK A;  3UVT A;  2M80 A;  1HQO A;  3VWV A;  5J5N A;  4I5Q A;  5CNW A;  4ECB A;  4N0Z A;  3H8Q A;  5LNK e;  2G2Q A;  4KH7 A;  2V32 A;  3UAP A;  3KMO A;  6GSV A;  2TRX A;  4WF4 A;  2LQQ A;  4POB A;  1VF1 A;  2FCH A;  3APS A;  4L5O A;  2CA8 A;  2I1U A;  3GRX A;  3Q6O A;  1EGR A;  2C1Y A;  1TW9 A;  4MMM A;  3E9J B;  1PKW A;  4HOJ A;  5JCU A;  3M1G A;  2L59 A;  1H4O A;  2I81 A;  2IJY A;  3ERG A;  3GMF A;  4ZBA A;  1WP0 A;  3LJR A;  3VI5 A;  2GT5 A;  7GSS A;  2FWG A;  5ECN B;  2RM5 A;  2X99 A;  4P3Y B;  4GQF A;  1WIK A;  2FHE A;  4JR6 A;  1GSU A;  4EE0 A;  3DKS A;  1G6W A;  4MZB A;  2JAD A;  4XTS A;  1FAA A;  1OAZ A;  3I6A A;  3KCM A;  2DJJ A;  4FH8 A;  1BYE A;  1ABA A;  1AXD A;  4KSO A;  1K0A A;  2HT9 A;  2ZCT A;  2C8U A;  2WS2 A;  4TR3 A;  1YQ1 A;  1BX9 A;  5GST A;  5IMC A;  1SYX A;  2PWJ A;  2YOI A;  1F2E A;  3KM6 A;  4EIP A;  3J7Y b;  3GUS A;  4X1U A;  2O85 A;  3QDN A;  3KH9 A;  3CBU A;  3TJG A;  1XW6 A;  4HDE A;  1Z6M A;  3IAS 2;  1UN2 A;  3UVH A;  1B9X C;  2JZS A;  3TJJ A;  3FY7 A;  4G19 A;  4J56 E;  4K2X A;  1M99 A;  3CTF A;  2HXK A;  2YN1 A;  5G5F A;  2J9H A;  2C0E A;  4Q5R A;  3L9U A;  4NHW A;  1BAY A;  1MEK A;  1THO A;  3DGQ A;  1BJX A;  5ECI B;  5A4U A;  4JU5 A;  1M9B A;  1AIU A;  2H30 A;  4POK A;  5D73 A;  5KEJ A;  4WET A;  4PQ1 A;  4ZBB A;  5D8I A;  1V9W A;  4LMV A;  4NPB A;  3IR4 A;  3F4R A;  5H5S A;  4QL7 A;  1B4P A;  1J9B A;  2YAN A;  4MZC A;  3ZFB A;  4IKH A;  2DKI A;  5DJM A;  2LST A;  4MLY A;  2DIY A;  3I43 A;  2WB9 A;  1HD2 A;  4FIW A;  3SWL A;  3F63 A;  4RI7 A;  4H86 A;  4TXO B;  6GSS A;  2HE3 A;  1TU7 A;  4KAE A;  1NSW A;  3C71 A;  2P0G A;  3LYP A;  2RLI A;  3N5O A;  1GSS A;  2GQL A;  3I9V 2;  2H76 A;  3TRX A;  2H0I A;  4K7I A;  5JWR B;  3LW9 A;  4IP1 A;  5HFG A;  3LQ7 A;  2CVK A;  1X9M B;  1CQG A;  4K7O A;  4POL A;  4MZW A;  2GSQ A;  4MH2 A;  5B6M A;  1T8E B;  2B1K A;  1S3D A;  3RHC A;  2GSS A;  3MNG A;  3TOU A;  4O5Q A;  1YJ6 A;  3A3T A;  5IMA A;  3UIW A;  3TJF A;  1K0B A;  2H1G A;  4PUR A;  2P5R A;  3BBY A;  1WWJ A;  3BJ5 A;  3FW2 A;  3APO A;  2DKH A;  5JWQ B;  4MP4 A;  5IMV A;  2ES7 A;  1PN0 A;  2A2P A;  3RBT A;  4NAX A;  3EU4 A;  5BMU A;  2H73 A;  4XS4 B;  2FWH A;  2KP2 A;  1TRV A;  3US3 A;  4MJA A;  2YWO A;  5DVB A;  4ISD A;  3ZL5 A;  1ZGN A;  3UMA A;  4G0L A;  1ZYN A;  4CY6 A;  3GA4 A;  4BIK A;  2MMN A;  5CP1 A;  3TKR A;  2VCZ A;  4AGS A;  2VD0 A;  2MBS A;  3TKP A;  1GTI A;  1OC8 A;  2H6Y A;  3TRP A;  4JRR A;  1QFN A;  2R37 A;  4GSN A;  3V1W A;  3GKM A;  4EDZ A;  2MMA A;  2HZE B;  1U6T A;  2FUG 2;  1T3B A;  1O8X A;  3EU3 A;  4KW6 A;  1VF2 A;  2GQK A;  3PGT A;  5G31 A;  4IVF A;  1F3B A;  2VCX A;  4WBR D;  1B48 A;  3TKS A;  2HRF A;  3O6T A;  4KF9 A;  5ID2 B;  1VF3 A;  1YZX A;  1SEN A;  4JBB A;  4HZ4 A;  1V98 A;  3QMX A;  6GSX A;  4K1F A;  5EVO A;  4KDU A;  1SL2 B;  4OO4 A;  2ZNM A;  4IGJ A;  1WJK A;  2AHE A;  2NDO A;  5J3R A;  2CVD A;  3EVI A;  2LNT A;  2I9H A;  4L0U A;  5ECK B;  5F07 A;  5DQY A;  5FT3 A;  4IP6 A;  4F2I A;  3CSJ A;  5ECM B;  3NIV A;  2N5F A;  2M72 A;  1K3O A;  2FWE A;  3QAW A;  1ZYP A;  2JAC A;  2FLS A;  4V2L A;  1JZO A;  5KN2 A;  1AQV A;  3ERF A;  4HZ2 A;  4GRF A;  4LLR A;  4BL7 A;  1TRU A;  2DJ2 A;  1IYI A;  3EWL A;  1ZYQ B;  2XHF A;  4TXV A;  2PUK C;  2DJ3 A;  3GFK A;  4ECI A;  2QSI A;  3F6F A;  2HSH A;  4KUN A;  2GZZ A;  1HNC A;  3VI7 A;  3H4K A;  1AQX A;  2LRC A;  5ECH B;  2L5L A;  3ZIJ A;  4GWR A;  2IMK A;  4WF5 A;  2LRN A;  3FYG A;  2K18 A;  1O85 A;  2H0H A;  2C3Q A;  2JL4 A;  4PXO A;  1XWG A;  2OAD A;  4IBP A;  4PGT A;  3HZ4 A;  1EV9 A;  4EUY A;  3GN3 A;  3BCI A;  4HEA 2;  3IXR A;  1M2B A;  4XS6 A;  5CRW A;  4BVY B;  4MDC A;  3ZML A;  1GH2 A;  16GS A;  1AC1 A;  1ERV A;  3F9U A;  3L4N A;  1FB0 A;  2GZY A;  5J4U A;  4G0K A;  3KIJ A;  4XRA A;  5ECR B;  3HDC A;  2KOK A;  4L8E A;  4USS A;  4K0N A;  3D6I A;  2X64 A;  5DAK B;  5IMF A;  1LBK A;  1T7P B;  5AN1 A;  2MBT A;  2H75 A;  1SD8 A;  1DBY A;  1TI3 A;  1XG8 A;  1B9Y C;  2G0F A;  4KCA A;  5B8A A;  2YZU A;  3TKQ A;  3GUR A;  4IJI A;  2IFQ A;  1M2A A;  1A24 A;  4TKY A;  3GKN A;  2GZP A;  2RUE A;  2CV4 A;  1XOB A;  3WT2 A;  2YV9 A;  2R3X A;  4OFT A;  4TXO A;  1XZO A;  5A4W A;  4DSS B;  2RUF A;  3GKK A;  4KND A;  3GL5 A;  5IMD A;  2X8C A;  6GSW A;  1OKD A;  2V41 A;  4OD7 A;  2WRT A;  2H1D A;  4X4J A;  1SU9 A;  1LU4 A;  1NHY A;  4KE3 A;  2WZ9 A;  1U3I A;  4Z7X A;  3GV1 A;  2CAQ A;  4OCF A;  5ENU A;  2V1M A;  9GSS A;  2EIQ A;  4PUF C;  2LV3 A;  2DIZ A;  11GS A;  1ERW A;  3EYT A;  4X0X A;  2XPE A;  1PSQ A;  3ZZX A;  2DJK A;  1RW1 A;  4LMW A;  3AY8 A;  6GSY A;  1S3R A;  2LQO A;  4XIH A;  4K8M A;  3PPU A;  4MK3 A;  4Q5N A;  3ZIV A;  3APQ A;  4RQX A;  2HSM A;  3IBH A;  2PU9 C;  1GNE A;  2JU5 A;  1G0T A;  4PTS A;  2PGT A;  3L78 A;  3C7M A;  1Z7P A;  2OE1 A;  1JLW A;  1M3J A;  4MF7 A;  1ON4 A;  2GQM A;  1EP8 A;  1GL8 A;  4MPF A;  1FW1 A;  1YKC A;  3A5W A;  4LA1 A;  1T00 A;  2L6D A;  5J41 A;  3VPQ A;  2FA8 A;  4Z2U A;  1N8J A;  2YNX A;  3GX8 A;  5GSS A;  3M9J A;  4KA0 A;  3R2Q A;  2R2J A;  1N2A A;  8GSS A;  2JSZ A;  2ON5 A;  17GS A;  3UBK A;  3KH7 A;  1GSY A;  3L9V A;  2X8H A;  4D73 B;  2B3S A;  2HZE A;  3QFA C;  1DUG A;  3DIE A;  5DAL B;  3LSZ A;  3RDW A;  3CQF A;  3TUE A;  1WE0 A;  1Y6E A;  1R5A A;  2GDR A;  5ID2 A;  4E8H A;  1FG4 A;  1O73 A;  2R0G A;  4MAB A;  1KBN A;  1XWA A;  1GSD A;  3QOU A;  3QFB C;  3GTU B;  2CQ9 A;  2CZ2 A;  3QR6 A;  2VLT A;  4QL9 A;  3WYW A;  2ALB A;  2R0C A;  1K0O A;  3HJM A;  1PRX A;  2MZC A;  3M8N A;  3ZLP A;  5D9V A;  5G2Z A;  3HVX A;  3ZFL A;  4MH3 A;  1X0R A;  4HQS A;  1B4Q A;  20GS A;  12GS A;  4TR1 B;  5ECO B;  2WCI A;  4BWS A;  1FVK A;  1X5D A;  18GS A;  2LS5 A;  4N10 A;  1O6J A;  2AUV A;  5A4V A;  2DLX A;  5G1K A;  4ZIL A;  4V2M A;  4MJE A;  4PNG A;  1UVZ A;  1EV4 A;  1WPI A;  2H72 A;  3GL3 A;  3TDG A;  4ICY A;  4KGI A;  1OC9 B;  3KP9 A;  1VGL A;  4NV2 A;  2R0P A;  4EF0 A;  1TXX A;  4PX1 A;  3TKS C;  5IMZ A;  3HKR A;  3IHQ A;  2CT6 A;  2YPM A;  3TGZ A;  14GS A;  3G7I A;  5EL8 A;  5INY A;  3L9S A;  3IV4 A;  3F6D A;  5GZZ B;  2VL2 A;  5E59 A;  5HR0 A;  1V2A A;  3G9B A;  1GRX A;  2PER A;  2YJ7 A;  4DSQ A;  4YH2 A;  4V1A p;  1OYJ A;  4RUV A;  1V57 A;  2DML A;  2C3T A;  3W8J A;  2L4C A;  1XWB A;  4N0V A;  5DCH A;  4V2N A;  2H6X A;  4YAV A;  1GUM A;  3D4T A;  2ON7 A;  4ZL8 A;  3E0U A;  1ML6 A;  1JZW A;  4CW9 A;  2DSA A;  2JZR A;  5D9X A;  5G1L A;  2PVQ A;  3ZVJ A;  1EGO A;  4YQV A;  5CRH A;  4HU9 A;  1XCC A;  1M9A A;  3GNJ A;  4ILF A;  2B5X A;  1GTA A;  4TR4 A;  3UOM A;  4OFM A;  2NBS A;  3C73 A;  3MSZ A;  3M9K A;  1V40 A;  1A2J A;  3N9J A;  2JSY A;  3LG6 A;  3Q19 A;  1V58 A;  1EEM A;  5IIZ A;  3NZN A;  2K8S A;  2H19 A;  2XBI A;  2OE3 A;  2MYG A;  1HNA A;  1K0M A;  2NVL A;  1NW2 A;  10GS A;  3TJK A;  4JED A;  5AIS A;  5IPH A;  3DRN A;  1Q98 A;  4BVX B;  4HQZ A;  4KB3 A;  4PNF A;  1K3L A;  2DJ0 A;  2OBI A;  4POM A;  1DE2 A;  4I2T A;  4I2U A;  5CRE A;  1EWX A;  2O87 A;  2CZ3 A;  2E2M A;  5IOW A;  2H1B A;  3A5I A;  4K9Z A;  4HJM A;  3JCM L;  3QD9 A;  3IC4 A;  2XC2 A;  3CSI A;  1OC3 A;  4YKF A;  3A2X A;  3DYR A;  4ZXG A;  3IC8 A;  4ZL9 A;  1SK1 A;  1XW9 A;  5HR3 A;  1FOH A;  5CYY A;  4MF6 A;  1KNG A;  1T1V A;  3UJ1 A;  2QKE A;  3H93 A;  4K7N A;  1PGT A;  4EVM A;  1X5E A;  1HYU A;  6GST A;  3DVX A;  4E8E A;  1I9D A;  4JR4 A;  5ECL B;  4GST A;  1U3A A;  1T4Z A;  3KZQ A;  4O7H A;  2YWI A;  2YZH A;  3MAK A;  4ZB6 A;  1S3C A;  2A2S A;  3H79 A;  2AJQ B;  3ME7 A;  1PKZ A;  4IW9 A;  2H8L A;  4RI6 A;  1ZZY A;  3F4T A;  3KP8 A;  2QC7 A;  1SJI A;  5ECP B;  1TI1 A;  2B5Y A;  5JWO B;  3GHA A;  2VLV A;  2RII A;  3KEB A;  2O7K A;  2E0Q A;  5G30 A;  3LFL A;  2OA7 A;  3O3T A;  1SL1 B;  3TKS E;  2AYT A;  1FB6 A;  1W89 A;  1JZR A;  4Z2T A;  5KN3 A;  1GLP A;  2PN8 A;  3DVW A;  5DAL A;  1SKS B;  3CTG A;  5FHI A;  1BQ7 A;  4F82 A;  2C0D A;  3TRQ A;  3IPZ A;  3TB2 A;  1GUL A;  5C04 A;  1F3A A;  2TRC P;  5CAX A;  3CYN A;  3TJB A;  1XFL A;  4F03 A;  1KEB A;  3GTU A;  2VCV A;  1DE1 A;  4KX4 A;  4RQR A;  5J9C A;  5HQP A;  3DD3 A;  3IDV A;  2F9S A;  4K0G A;  3IK9 A;  1SKR B;  2A4V A;  5B7C A;  3H1N A;  5DDL A;  1XVQ A;  2GLR A;  5L71 A;  1QXH A;  1AQW A;  3KGK A;  4XRD A;  1PX7 A;  13GS A;  3KD0 A;  1MDK A;  4K5S A;  3R3E A;  4KSM A;  1OE7 A;  3A2W A;  3FZ9 A;  4TR1 A;  3QAV A;  4KCE A;  2OJL A;  1WMJ A;  1M7T A;  2GT6 A;  3HVN A;  2P5Q A;  4F9Z A;  4FYB A;  4ML1 A;  2PPT A;  2PMT A;  3PIN A;  4IN0 A;  2B6M A;  2WUL A;  2IIY A;  4ULX A;  6GSU A;  2I3Y A;  1B8X A;  5KN0 A;  1U87 A;  1XPV A;  1F6M C;  1WRY A;  1MTC A;  1URM A;  1K0D A;  2X4A A;  2QA2 A;  4IS0 A;  1OC9 A;  1J0F A;  3EMX A;  4EKZ A;  5J9B A;  1A2L A;  2EIR A;  3MYD A;  1NHO A;  1X5C A;  2H71 A;  1AAZ A;  3CSH A;  5ABR A;  3WGE A;  1PL2 A;  3HA9 A;  2R6K A;  1USB A;  3ZVJ D;  2YP6 A;  4WR4 A;  2HLS A;  3FEU A;  3CRU A;  4K6X A;  1GSE A;  3FR6 A;  1QQ2 A;  4BWQ A;  5E4W A;  3RPP A;  4GQC A;  2FNO A;  3UAR A;  2BMX A;  1G7E A;  2LUS A;  3C1S A;  1TRS A;  2VCW A;  4YQM A;  2CVB A;  3M0F A;  3FKF A;  2NPB A;  5JCW A;  4OWY A;  3G7Y A;  4NXI A;  4I8B A;  2KUC A;  2HSY A;  3SBC A;  2M46 A;  1F9M A;  2VL3 A;  2VLU A;  1I5G A;  5F05 A;  4DSR A;  5C00 A;  2LJR A;  1U88 A;  1R7H A;  1SK0 A;  1JFU A;  4FYC A;  3GST A;  2LTK A;  2B7J A;  5IPG A;  2MMZ A;  4CY8 A;  3Q74 A;  3ZRE A;  4O32 A;  4HU7 A;  4O92 A;  3IK7 A;  4AJ6 A;  1A8L A;  4JE1 A;  4EL1 A;  2F8F A;  1A8Y A;  1ST9 A;  1GSF A;  1M2D A;  5KN1 A;  3D5J A;  1GTU A;  3LXT A;  1YF0 A;  4YAP A;  1YDK A;  2AB6 A;  2VL2 C;  5COH A;  1X9W B;  2REM A;  2L6C A;  2FY6 A;  1RQM A;  4GXZ A;  2F51 A;  1JLV A;  4ZBD A;  5DQS A;  1YEX A;  2WJU A;  4L0W A;  3DXB A;  4XS4 A;  4HS1 A;  1PD2 1;  4FYU A;  2HRK A;  3LGC A;  1AW9 A;  2LNS A;  1ILO A;  3I69 A;  4FQU A;  2HFD A;  5HR1 A;  3TOT A;  3QAG A;  2OBK A;  2VM2 A;  2DBC A;  2GGT A;  2H0G A;  1Y25 A;  3BOA A;  2QA1 A;  3HYP A;  5D96 A;  2XBQ A;  4IQA A;  4HJ2 A;  1SK2 A;  3ZTL A;  3LXZ A;  2X8G A;  5BRT A;  1ZL9 A;  2VAF A;  2V6O A;  2OAC A;  5DCG A;  5F0G A;  5B6N A;  3CRT A;  3PR8 A;  1K3Y A;  2RM6 A;  5EY6 A;  1SJZ A;  4NV5 A;  3C1R A;  5HFK A;  1YY7 A;  3MWH A;  5H5R A;  4ML6 A;  2A2R A;  2F8A A;  3HVV A;  4ZL7 A;  3HY2 A;  4ACS A;  1A0R P;  1QMV A;  3NOF A;  5IOX A;  4BL7 B;  1PQN A;  1E2Y A;  4G0I A;  2VO4 A;  1OE8 A;  4TR0 A;  2H6Z A;  3ZIT A;  4ECJ A;  3GYK A;  1Z7R A;  1HNB A;  2AV4 A;  3FR9 A;  4LL4 B;  3IRA A;  5HR2 A;  1J08 A;  1TRW A;  5A5K A;  2H74 A;  1F37 A;  1GTB A;  1XBS A;  2I4A A;  2LKU A;  2VL9 A;  2X49 A;  2EIO A;  1S3A A;  1QGV A;  2EC4 A;  1G6Y A;  1EEJ A;  2B7K A;  3VFI A;  3FR3 A;  3F8U A;  4IEL A;  1T4Y A;  2BTO T;  3IAM 2;  2XPD A;  3F3R A;  5F06 A;  3VUR A;  5ELG A;  3EPT A;  4IQ1 A;  4MCU A;  5IQY A;  5LCZ A;  3CMI A;  2LJK A;  1FHE A; 
#chains in the Genus database with same CATH homology
 1XXU A;  4PQH A;  5AIV A;  2WGR A;  1Z3E A;  5ECQ B;  2IMD A;  2K9F A;  3HJO A;  1WOU A;  3KMN A;  4TN8 A;  3LWA A;  3D21 A;  3GH9 A;  4HI7 A;  2LJA A;  3K8N A;  2CAI A;  5DBQ A;  3FMW A;  4A5P A;  4WR5 A;  2O89 A;  3FZA A;  3A2V A;  3RAZ A;  1FVJ A;  3LOR A;  2CX3 A;  3IA1 A;  3P90 A;  2Z9S A;  4G9H A;  3L0H A;  4Q5Q A;  4O5U A;  2VUP A;  1E6B A;  1PMT A;  3EE2 A;  3DEX A;  2IFQ B;  4BVY A;  1GWC A;  1PA3 A;  2WDU A;  4XS1 A;  2FD3 A;  2K6V A;  4L5L A;  2O8V B;  4IHU A;  1TU8 A;  2C80 A;  1VF4 A;  4MNN A;  2N5A A;  2UZ8 A;  3GX0 A;  4I6X A;  4WXT A;  5H5Q A;  3VLN A;  5DAK A;  3F0I A;  1FO5 A;  3W6G A;  2E7P A;  2B5E A;  2C4J A;  3VWU A;  2KLX A;  3HZ8 A;  4X43 A;  4TOP A;  3HHV A;  1M0U A;  2AAW A;  1CQH A;  4PQI A;  2L4Q A;  2R5G A;  3KTL A;  1H75 A;  4IJ3 A;  1Z9H A;  1A2M A;  5CRG A;  4J2F A;  1O7U A;  1IYH A;  5LD0 A;  3QPM A;  1GUH A;  1K0C A;  4J57 E;  5AGY A;  3U5R E;  4DSS A;  1K0N A;  3RHB A;  3WT1 A;  3J7Y k;  2GTU A;  4N30 A;  5JCG A;  4GF0 A;  2VCQ A;  1EP7 A;  3HVS A;  2VIM A;  2VD1 A;  4ID0 A;  4MJC A;  2GVP A;  2IWT A;  1SJ6 A;  1Z5Y E;  4HUA A;  3HD5 A;  1PX6 A;  4EXJ A;  2HRA A;  2ZUP A;  2L5O A;  1TK5 B;  4DEJ A;  2YV7 A;  3GIX A;  3ED3 A;  5D93 A;  1ERT A;  4AJ8 A;  2CX4 A;  4MA9 A;  1GUK A;  2MMO A;  2GST A;  3DML A;  3VPT A;  5ECS A;  1ERU A;  1UA5 A;  2LRT A;  3EC3 A;  5GAN D;  3KTB A;  3EIN A;  4XHM A;  1SKW B;  1YEP A;  3W8S A;  1ZCP A;  1XOA A;  3HJP A;  1MD4 A;  1ZOF A;  2NTO A;  2FGX A;  2IMF A;  4GTU A;  2E2G A;  1MDJ A;  3ZYW A;  1W4V A;  2BJX A;  1ZMA A;  1A0F A;  2IPA A;  5AIX A;  2YJH A;  3GKX A;  4G10 A;  1TK0 B;  4N11 A;  4GSS A;  4F0C A;  3GH6 A;  2PVO C;  4ZB8 A;  4EO3 A;  3FK8 A;  3VWX A;  3WGD A;  2R4V A;  5D9W A;  3U6V A;  4XCS A;  4PUA A;  1OKT A;  3ERW A;  1AUC A;  3ME8 A;  1UC7 A;  2DMM A;  2DJ1 A;  2F3M A;  3P2A A;  3F3Q A;  1TKD B;  4Z2R A;  1BG5 A;  1EOG A;  1Q4J A;  4D73 A;  2D2Z A;  1O81 A;  1ACV A;  1SD9 A;  3BCK A;  1VRS D;  4YQU A;  2V2G A;  3C8E A;  2WFC A;  1GNW A;  3EMP A;  1R5P A;  2HZF A;  4EC0 A;  2HNL A;  4EDY A;  3P8W A;  1NM3 A;  4AF2 A;  2P31 A;  19GS A;  2IN3 A;  2QGV A;  4ECC A;  5HFI A;  2H66 A;  3TCO A;  3LEF A;  2FA4 A;  4K2D A;  3UEM A;  2J23 A;  1FOV A;  4DVC A;  2GSR A;  4BA7 A;  1MDI A;  3UL3 A;  1Z6N A;  5KOW A;  2LEG A;  1ZYE A;  2HYX A;  4LL1 B;  4BPY A;  3D4M A;  3O76 A;  5CO3 A;  4OMV A;  1RK4 A;  1X9S B;  5IM9 A;  1THX A;  2OE0 A;  1YKA A;  2L57 A;  2IL3 A;  1XWK A;  1JZD A;  2IMI A;  3MIX A;  1YF1 A;  3F4S A;  1O8W A;  4KDX A;  5EPF A;  2DC5 A;  4MJB A;  2V6K A;  3OR5 A;  1TJD A;  3RPN A;  3PH9 A;  4OCE A;  2C0F A;  5G5E A;  3IOS A;  3Q18 A;  3FZ5 A;  2N5B A;  1XVW A;  2YWN A;  2VCT A;  3D22 A;  2A4H A;  2YCD A;  3IHG A;  4GLT A;  2VM1 A;  3QCP A;  3FRC A;  4K5R A;  1PN9 A;  3GSS A;  1R4W A;  1XW5 A;  2H70 A;  4Q5F A;  4I97 A;  4CHS A;  2GS3 A;  5ELA A;  4TRX A;  4OO5 A;  1SYR A;  4JZQ A;  2HRN A;  1G7O A;  2FWF A;  3KJY A;  1C72 A;  1QK8 A;  3UBL A;  2H1A A;  1PL1 A;  4GCI A;  1TK8 B;  2VOC A;  5FWG A;  4OFN A;  4G2E A;  1OVN A;  1GP1 A;  5D9T A;  4MPG A;  2KP1 A;  2C0G A;  3VWW A;  4F0B A;  1JHB A;  5CRD A;  4FO5 A;  5B8B A;  3EUR A;  1XIY A;  1TTZ A;  4NWY A;  1TP9 A;  3WD6 A;  5DJL A;  4WBJ A;  1TDI A;  2PBJ A;  5IO0 A;  4EIQ A;  3ZRD A;  4TW5 A;  3S9F A;  3D0Z A;  2KHP A;  5F8B A;  2H01 A;  2TIR A;  1KTE A;  5GAP D;  4ZIJ A;  4KDY A;  1EZK A;  4YKG A;  1BED A;  1MD3 A;  1TOF A;  22GS A;  3HCZ A;  3IE3 A;  5IO2 A;  3M3M A;  1LJR A;  1DSB A;  3MDK A;  1SL0 B;  3KXO A;  1EOH A;  4O5R A;  2YWM A;  2C3N A;  3WGX A;  2IME A;  3G7J A;  1XWC A;  4WEY A;  2B1L A;  4NMU A;  5KOX A;  2K8V A;  4BVX A;  1A23 A;  1QUW A;  1R26 A;  2HI7 A;  3DWV A;  3BD2 A;  3P7X A;  4ZB9 A;  3ISO A;  3LYK A;  4TVE A;  4MF5 A;  3FZ4 A;  4NHZ A;  3VK9 A;  4CDO A;  2JZT A;  2OKA A;  3ZMK A;  4AJ7 A;  3E3E A;  3CXG A;  1GLQ A;  4QQ7 A;  1GSQ A;  4V1A g;  3HXS A;  4WKW A;  3FHK A;  3UVT A;  2M80 A;  1HQO A;  3VWV A;  5J5N A;  4I5Q A;  5CNW A;  4ECB A;  4N0Z A;  3H8Q A;  5LNK e;  2G2Q A;  4KH7 A;  2V32 A;  3UAP A;  3KMO A;  6GSV A;  2TRX A;  4WF4 A;  2LQQ A;  4POB A;  1VF1 A;  2FCH A;  3APS A;  4L5O A;  2CA8 A;  2I1U A;  3GRX A;  3Q6O A;  1EGR A;  2C1Y A;  1TW9 A;  4MMM A;  3E9J B;  1PKW A;  4HOJ A;  5JCU A;  3M1G A;  2L59 A;  1H4O A;  2I81 A;  2IJY A;  3ERG A;  3GMF A;  4ZBA A;  1WP0 A;  3LJR A;  3VI5 A;  2GT5 A;  7GSS A;  2FWG A;  5ECN B;  2RM5 A;  2X99 A;  4P3Y B;  4GQF A;  1WIK A;  2FHE A;  4JR6 A;  1GSU A;  4EE0 A;  3DKS A;  1G6W A;  4MZB A;  2JAD A;  4XTS A;  1FAA A;  1OAZ A;  3I6A A;  3KCM A;  2DJJ A;  4FH8 A;  1BYE A;  1ABA A;  1AXD A;  4KSO A;  1K0A A;  2HT9 A;  2ZCT A;  2C8U A;  2WS2 A;  4TR3 A;  1YQ1 A;  1BX9 A;  5GST A;  5IMC A;  1SYX A;  2PWJ A;  2YOI A;  1F2E A;  3KM6 A;  4EIP A;  3J7Y b;  3GUS A;  4X1U A;  2O85 A;  3QDN A;  3KH9 A;  3CBU A;  3TJG A;  1XW6 A;  4HDE A;  1Z6M A;  3IAS 2;  1UN2 A;  3UVH A;  1B9X C;  2JZS A;  3TJJ A;  3FY7 A;  4G19 A;  4J56 E;  4K2X A;  1M99 A;  3CTF A;  2HXK A;  2YN1 A;  5G5F A;  2J9H A;  2C0E A;  4Q5R A;  3L9U A;  4NHW A;  1BAY A;  1MEK A;  1THO A;  3DGQ A;  1BJX A;  5ECI B;  5A4U A;  4JU5 A;  1M9B A;  1AIU A;  2H30 A;  4POK A;  5D73 A;  5KEJ A;  4WET A;  4PQ1 A;  4ZBB A;  5D8I A;  1V9W A;  4LMV A;  4NPB A;  3IR4 A;  3F4R A;  5H5S A;  4QL7 A;  1B4P A;  1J9B A;  2YAN A;  4MZC A;  3ZFB A;  4IKH A;  2DKI A;  5DJM A;  2LST A;  4MLY A;  2DIY A;  3I43 A;  2WB9 A;  1HD2 A;  4FIW A;  3SWL A;  3F63 A;  4RI7 A;  4H86 A;  4TXO B;  6GSS A;  2HE3 A;  1TU7 A;  4KAE A;  1NSW A;  3C71 A;  2P0G A;  3LYP A;  2RLI A;  3N5O A;  1GSS A;  2GQL A;  3I9V 2;  2H76 A;  3TRX A;  2H0I A;  4K7I A;  5JWR B;  3LW9 A;  4IP1 A;  5HFG A;  3LQ7 A;  2CVK A;  1X9M B;  1CQG A;  4K7O A;  4POL A;  4MZW A;  2GSQ A;  4MH2 A;  5B6M A;  1T8E B;  2B1K A;  1S3D A;  3RHC A;  2GSS A;  3MNG A;  3TOU A;  4O5Q A;  1YJ6 A;  3A3T A;  5IMA A;  3UIW A;  3TJF A;  1K0B A;  2H1G A;  4PUR A;  2P5R A;  3BBY A;  1WWJ A;  3BJ5 A;  3FW2 A;  3APO A;  2DKH A;  5JWQ B;  4MP4 A;  5IMV A;  2ES7 A;  1PN0 A;  2A2P A;  3RBT A;  4NAX A;  3EU4 A;  5BMU A;  2H73 A;  4XS4 B;  2FWH A;  2KP2 A;  1TRV A;  3US3 A;  4MJA A;  2YWO A;  5DVB A;  4ISD A;  3ZL5 A;  1ZGN A;  3UMA A;  4G0L A;  1ZYN A;  4CY6 A;  3GA4 A;  2MMN A;  5CP1 A;  3TKR A;  2VCZ A;  4AGS A;  2VD0 A;  2MBS A;  3TKP A;  1GTI A;  1OC8 A;  2H6Y A;  3TRP A;  4JRR A;  1QFN A;  2R37 A;  4GSN A;  3V1W A;  3GKM A;  4EDZ A;  2MMA A;  2HZE B;  1U6T A;  2FUG 2;  1T3B A;  1O8X A;  3EU3 A;  4KW6 A;  1VF2 A;  2GQK A;  3PGT A;  5G31 A;  4IVF A;  1F3B A;  2VCX A;  4WBR D;  1B48 A;  3TKS A;  2HRF A;  3O6T A;  4KF9 A;  5ID2 B;  1VF3 A;  1YZX A;  1SEN A;  4JBB A;  4HZ4 A;  1V98 A;  3QMX A;  6GSX A;  4K1F A;  5EVO A;  4KDU A;  1SL2 B;  4OO4 A;  2ZNM A;  4IGJ A;  1WJK A;  2AHE A;  2NDO A;  5J3R A;  2CVD A;  3EVI A;  2LNT A;  2I9H A;  4L0U A;  5ECK B;  5F07 A;  5DQY A;  5FT3 A;  4IP6 A;  4F2I A;  3CSJ A;  5ECM B;  3NIV A;  2N5F A;  2M72 A;  1K3O A;  2FWE A;  3QAW A;  1ZYP A;  2JAC A;  2FLS A;  4V2L A;  1JZO A;  5KN2 A;  1AQV A;  3ERF A;  4HZ2 A;  4GRF A;  4LLR A;  4BL7 A;  1TRU A;  2DJ2 A;  1IYI A;  3EWL A;  1ZYQ B;  2XHF A;  4TXV A;  2PUK C;  2DJ3 A;  3GFK A;  4ECI A;  2QSI A;  3F6F A;  2HSH A;  4KUN A;  2GZZ A;  1HNC A;  3VI7 A;  3H4K A;  1AQX A;  2LRC A;  5ECH B;  2L5L A;  3ZIJ A;  4GWR A;  2IMK A;  4WF5 A;  2LRN A;  3FYG A;  2K18 A;  1O85 A;  2H0H A;  2C3Q A;  2JL4 A;  4PXO A;  1XWG A;  2OAD A;  4IBP A;  4PGT A;  3HZ4 A;  1EV9 A;  4EUY A;  3GN3 A;  3BCI A;  4HEA 2;  3IXR A;  1M2B A;  4XS6 A;  5CRW A;  4BVY B;  4MDC A;  3ZML A;  1GH2 A;  16GS A;  1AC1 A;  1ERV A;  3F9U A;  3L4N A;  1FB0 A;  2GZY A;  5J4U A;  4G0K A;  3KIJ A;  4XRA A;  5ECR B;  3HDC A;  2KOK A;  4L8E A;  4USS A;  4K0N A;  3D6I A;  2X64 A;  5DAK B;  5IMF A;  1LBK A;  1T7P B;  5AN1 A;  2MBT A;  2H75 A;  1SD8 A;  1DBY A;  1TI3 A;  1B9Y C;  2G0F A;  4KCA A;  5B8A A;  2YZU A;  3TKQ A;  3GUR A;  4IJI A;  2IFQ A;  1M2A A;  1A24 A;  4TKY A;  3GKN A;  2GZP A;  2RUE A;  2CV4 A;  1XOB A;  3WT2 A;  2YV9 A;  2R3X A;  4OFT A;  4TXO A;  1XZO A;  5A4W A;  4DSS B;  2RUF A;  3GKK A;  4KND A;  3GL5 A;  5IMD A;  2X8C A;  6GSW A;  1OKD A;  2V41 A;  4OD7 A;  2WRT A;  2H1D A;  4X4J A;  1SU9 A;  1LU4 A;  1NHY A;  4KE3 A;  2WZ9 A;  1U3I A;  4Z7X A;  3GV1 A;  2CAQ A;  4OCF A;  5ENU A;  2V1M A;  9GSS A;  2EIQ A;  4PUF C;  2LV3 A;  2DIZ A;  11GS A;  1ERW A;  3EYT A;  4X0X A;  2XPE A;  1PSQ A;  3ZZX A;  2DJK A;  1RW1 A;  4LMW A;  3AY8 A;  6GSY A;  2LQO A;  4XIH A;  4K8M A;  3PPU A;  4MK3 A;  4Q5N A;  3ZIV A;  3APQ A;  4RQX A;  2HSM A;  3IBH A;  2PU9 C;  1GNE A;  2JU5 A;  1G0T A;  4PTS A;  2PGT A;  3L78 A;  3C7M A;  1Z7P A;  2OE1 A;  1JLW A;  4MF7 A;  1ON4 A;  2GQM A;  1EP8 A;  1GL8 A;  4MPF A;  1FW1 A;  1YKC A;  3A5W A;  4LA1 A;  1T00 A;  2L6D A;  5J41 A;  3VPQ A;  2FA8 A;  4Z2U A;  1N8J A;  2YNX A;  3GX8 A;  5GSS A;  3M9J A;  4KA0 A;  3R2Q A;  2R2J A;  1N2A A;  8GSS A;  2JSZ A;  2ON5 A;  17GS A;  3UBK A;  3KH7 A;  1GSY A;  3L9V A;  2X8H A;  4D73 B;  2B3S A;  2HZE A;  3QFA C;  1DUG A;  3DIE A;  5DAL B;  3LSZ A;  3RDW A;  3TUE A;  1WE0 A;  1Y6E A;  1R5A A;  2GDR A;  5ID2 A;  4E8H A;  1FG4 A;  1O73 A;  2R0G A;  4MAB A;  1KBN A;  1XWA A;  1GSD A;  3QOU A;  3QFB C;  3GTU B;  2CQ9 A;  2CZ2 A;  3QR6 A;  2VLT A;  4QL9 A;  3WYW A;  2ALB A;  2R0C A;  1K0O A;  3HJM A;  1PRX A;  2MZC A;  3M8N A;  3ZLP A;  5D9V A;  5G2Z A;  3HVX A;  3ZFL A;  4MH3 A;  1X0R A;  4HQS A;  1B4Q A;  20GS A;  12GS A;  4TR1 B;  5ECO B;  2WCI A;  4BWS A;  1FVK A;  1X5D A;  18GS A;  2LS5 A;  4N10 A;  1O6J A;  2AUV A;  5A4V A;  2DLX A;  5G1K A;  4ZIL A;  4V2M A;  4MJE A;  4PNG A;  1UVZ A;  1EV4 A;  1WPI A;  2H72 A;  3GL3 A;  3TDG A;  4ICY A;  4KGI A;  1OC9 B;  3KP9 A;  1VGL A;  4NV2 A;  2R0P A;  4EF0 A;  1TXX A;  4PX1 A;  3TKS C;  5IMZ A;  3HKR A;  3IHQ A;  2CT6 A;  2YPM A;  3TGZ A;  14GS A;  3G7I A;  5EL8 A;  5INY A;  3L9S A;  3IV4 A;  3F6D A;  5GZZ B;  2VL2 A;  5E59 A;  5HR0 A;  1V2A A;  3G9B A;  1GRX A;  2PER A;  2YJ7 A;  4DSQ A;  4YH2 A;  4V1A p;  1OYJ A;  4RUV A;  1V57 A;  2DML A;  2C3T A;  3W8J A;  2L4C A;  1XWB A;  4N0V A;  5DCH A;  4V2N A;  2H6X A;  4YAV A;  1GUM A;  3D4T A;  2ON7 A;  4ZL8 A;  3E0U A;  1ML6 A;  1JZW A;  4CW9 A;  2DSA A;  2JZR A;  5D9X A;  5G1L A;  2PVQ A;  3ZVJ A;  1EGO A;  4YQV A;  5CRH A;  4HU9 A;  1XCC A;  1M9A A;  3GNJ A;  4ILF A;  2B5X A;  1GTA A;  4TR4 A;  3UOM A;  4OFM A;  2NBS A;  3C73 A;  3MSZ A;  3M9K A;  1V40 A;  1A2J A;  3N9J A;  2JSY A;  3LG6 A;  3Q19 A;  1V58 A;  1EEM A;  5IIZ A;  3NZN A;  2K8S A;  2H19 A;  2XBI A;  2OE3 A;  2MYG A;  1HNA A;  1K0M A;  2NVL A;  1NW2 A;  10GS A;  3TJK A;  4JED A;  5AIS A;  5IPH A;  3DRN A;  1Q98 A;  4BVX B;  4HQZ A;  4KB3 A;  4PNF A;  1K3L A;  2DJ0 A;  2OBI A;  4POM A;  1DE2 A;  4I2T A;  4I2U A;  5CRE A;  1EWX A;  2O87 A;  2CZ3 A;  2E2M A;  5IOW A;  2H1B A;  3A5I A;  4K9Z A;  4HJM A;  3JCM L;  3QD9 A;  3IC4 A;  2XC2 A;  3CSI A;  1OC3 A;  4YKF A;  3A2X A;  3DYR A;  4ZXG A;  3IC8 A;  4ZL9 A;  1SK1 A;  1XW9 A;  5HR3 A;  1FOH A;  5CYY A;  4MF6 A;  1KNG A;  1T1V A;  3UJ1 A;  2QKE A;  3H93 A;  4K7N A;  1PGT A;  4EVM A;  1X5E A;  1HYU A;  6GST A;  3DVX A;  4E8E A;  1I9D A;  4JR4 A;  5ECL B;  4GST A;  1U3A A;  1T4Z A;  3KZQ A;  4O7H A;  2YWI A;  2YZH A;  3MAK A;  4ZB6 A;  1S3C A;  2A2S A;  3H79 A;  2AJQ B;  3ME7 A;  1PKZ A;  4IW9 A;  2H8L A;  4RI6 A;  1ZZY A;  3F4T A;  3KP8 A;  2QC7 A;  1SJI A;  5ECP B;  1TI1 A;  2B5Y A;  5JWO B;  3GHA A;  2VLV A;  2RII A;  3KEB A;  2O7K A;  2E0Q A;  5G30 A;  3LFL A;  2OA7 A;  3O3T A;  1SL1 B;  3TKS E;  2AYT A;  1FB6 A;  1W89 A;  1JZR A;  4Z2T A;  5KN3 A;  1GLP A;  2PN8 A;  3DVW A;  5DAL A;  1SKS B;  3CTG A;  5FHI A;  1BQ7 A;  4F82 A;  2C0D A;  3TRQ A;  3IPZ A;  3TB2 A;  1GUL A;  5C04 A;  1F3A A;  2TRC P;  5CAX A;  3CYN A;  3TJB A;  1XFL A;  4F03 A;  1KEB A;  3GTU A;  2VCV A;  1DE1 A;  4KX4 A;  4RQR A;  5J9C A;  5HQP A;  3DD3 A;  3IDV A;  2F9S A;  4K0G A;  3IK9 A;  1SKR B;  2A4V A;  5B7C A;  3H1N A;  5DDL A;  1XVQ A;  2GLR A;  5L71 A;  1QXH A;  1AQW A;  3KGK A;  4XRD A;  1PX7 A;  13GS A;  3KD0 A;  1MDK A;  4K5S A;  3R3E A;  4KSM A;  1OE7 A;  3A2W A;  3FZ9 A;  4TR1 A;  3QAV A;  4KCE A;  2OJL A;  1WMJ A;  1M7T A;  2GT6 A;  4F9Z A;  2P5Q A;  4FYB A;  4ML1 A;  2PPT A;  2PMT A;  3PIN A;  4IN0 A;  2B6M A;  2WUL A;  2IIY A;  4ULX A;  6GSU A;  2I3Y A;  1B8X A;  5KN0 A;  1U87 A;  1XPV A;  1F6M C;  1WRY A;  1MTC A;  1URM A;  1K0D A;  2X4A A;  2QA2 A;  4IS0 A;  1OC9 A;  1J0F A;  3EMX A;  4EKZ A;  5J9B A;  1A2L A;  2EIR A;  3MYD A;  1NHO A;  1X5C A;  2H71 A;  1AAZ A;  3CSH A;  5ABR A;  3WGE A;  1PL2 A;  3HA9 A;  2R6K A;  1USB A;  3ZVJ D;  2YP6 A;  4WR4 A;  2HLS A;  3FEU A;  3CRU A;  4K6X A;  1GSE A;  3FR6 A;  1QQ2 A;  4BWQ A;  5E4W A;  3RPP A;  4GQC A;  2FNO A;  3UAR A;  2BMX A;  1G7E A;  2LUS A;  3C1S A;  1TRS A;  2VCW A;  4YQM A;  2CVB A;  3M0F A;  3FKF A;  2NPB A;  5JCW A;  4OWY A;  3G7Y A;  4NXI A;  4I8B A;  2KUC A;  2HSY A;  3SBC A;  2M46 A;  1F9M A;  2VL3 A;  2VLU A;  1I5G A;  5F05 A;  4DSR A;  5C00 A;  2LJR A;  1U88 A;  1R7H A;  1SK0 A;  1JFU A;  4FYC A;  3GST A;  2LTK A;  2B7J A;  5IPG A;  2MMZ A;  4CY8 A;  3Q74 A;  3ZRE A;  4O32 A;  4HU7 A;  4O92 A;  3IK7 A;  4AJ6 A;  1A8L A;  4JE1 A;  4EL1 A;  2F8F A;  1A8Y A;  1ST9 A;  1GSF A;  1M2D A;  5KN1 A;  3D5J A;  1GTU A;  3LXT A;  1YF0 A;  4YAP A;  1YDK A;  2AB6 A;  2VL2 C;  5COH A;  1X9W B;  2REM A;  2L6C A;  2FY6 A;  1RQM A;  4GXZ A;  2F51 A;  1JLV A;  4ZBD A;  5DQS A;  1YEX A;  2WJU A;  4L0W A;  3DXB A;  4XS4 A;  4HS1 A;  1PD2 1;  4FYU A;  2HRK A;  3LGC A;  1AW9 A;  2LNS A;  1ILO A;  3I69 A;  4FQU A;  2HFD A;  5HR1 A;  3TOT A;  3QAG A;  2OBK A;  2VM2 A;  2DBC A;  2GGT A;  2H0G A;  1Y25 A;  3BOA A;  2QA1 A;  3HYP A;  5D96 A;  2XBQ A;  4IQA A;  4HJ2 A;  1SK2 A;  3ZTL A;  3LXZ A;  2X8G A;  5BRT A;  1ZL9 A;  2VAF A;  2V6O A;  2OAC A;  5DCG A;  5F0G A;  5B6N A;  3CRT A;  3PR8 A;  1K3Y A;  2RM6 A;  5EY6 A;  1SJZ A;  4NV5 A;  3C1R A;  5HFK A;  1YY7 A;  3MWH A;  5H5R A;  4ML6 A;  2A2R A;  2F8A A;  3HVV A;  4ZL7 A;  3HY2 A;  4ACS A;  1A0R P;  1QMV A;  3NOF A;  5IOX A;  4BL7 B;  1PQN A;  1E2Y A;  4G0I A;  2VO4 A;  1OE8 A;  4TR0 A;  2H6Z A;  3ZIT A;  4ECJ A;  3GYK A;  1Z7R A;  1HNB A;  2AV4 A;  3FR9 A;  4LL4 B;  3IRA A;  5HR2 A;  1J08 A;  1TRW A;  5A5K A;  2H74 A;  1F37 A;  1GTB A;  1XBS A;  2I4A A;  2LKU A;  2VL9 A;  2X49 A;  2EIO A;  1S3A A;  1QGV A;  2EC4 A;  1G6Y A;  1EEJ A;  2B7K A;  3VFI A;  3FR3 A;  3F8U A;  4IEL A;  1T4Y A;  2BTO T;  3IAM 2;  2XPD A;  3F3R A;  5F06 A;  3VUR A;  5ELG A;  3EPT A;  4IQ1 A;  4MCU A;  5IQY A;  5LCZ A;  3CMI A;  2LJK A;  1FHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...