2BJXA

Protein disulfide isomerase
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Electron transport
molecule keywords PROTEIN (PROTEIN DISULFIDE ISOMERASE)
publication title The structure in solution of the b domain of protein disulfide isomerase.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 110
sequence length 110
ec nomenclature ec 5.3.4.1: Protein disulfide-isomerase.
pdb deposition date 1999-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2bjxA00
2MBTA 1MTCA 3APQA 2F3MA 4DEJA 1GH2A 2IN3A 2HLSA 4GCIA 3ERGA 1FG4A 2BJXA 5IIZA 3F9UA 5DCHA 3VI5A 1SD8A 1K0NA 2L6DA 3QAWA 4GSSA 2ZNMA 4ZBDA 5DALA 5G1KA 3IHQA 3GL5A 3MNGA 4O32A 1JLWA 5E4WA 1X0RA 4KB3A 2JL4A 1K0DA 2I81A 2GSRA 2DJ3A 7GSSA 2EIOA 2C0FA 1H75A 1OC9A 4XCSA 3UVTA 4PQHA 4NWYA 2OKAA 1J08A 4K7NA 3RAZA 1XWGA 3M9KA 1TI1A 1TU8A 3TOUA 4OMVA 1WPIA 1YZXA 5ECMB 4OFTA 3IXRA 5ABRA 2YWNA 2A2RA 1V98A 1F3BA 2PGTA 1X9SB 17GSA 1GP1A 4XS6A 1EWXA 3GH9A 2YWOA 5DAKA 4EUYA 5DQYA 2H70A 1YEXA 2VCXA 3DYRA 4CW9A 2E2GA 2OBKA 3CYNA 3HXSA 5J3RA 8GSSA 4GQFA 3IOSA 2RLIA 2XPDA 3GN3A 4IS0A 1ZYEA 5DALB 5IO2A 2PVQA 4MPFA 1UA5A 4KA0A 2LQOA 3IC4A 5CRGA 3M9JA 4WF4A 5B8AA 3KMOA 4MPGA 4EDYA 2KOKA 2CVBA 2IMKA 2R6KA 3FR9A 2GT6A 3P7XA 3F8UA 4KNDA 1UVZA 3ISOA 1G7OA 3EU3A 1NHYA 1OC9B 3F4RA 4JU5A 4RI7A 1GTAA 5CYYA 1GSQA 3LYKA 3ZFBA 2HI7A 1SJ6A 2JZSA 2X8GA 3LG6A 3FYGA 3M1GA 2VL2A 2ON7A 2IJYA 3P8WA 1B4PA 1Z6MA 1AQWA 3PGTA 2F51A 3UBKA 3IR4A 3TJGA 2JACA 1OYJA 3HYPA 1X5DA 5DAKB 1G6WA 5INYA 2JSZA 2IWTA 1QUWA 3J7Yk 2IIYA 3KXOA 1XBSA 1GUMA 3UOMA 1IYIA 2P31A 1BEDA 2OJLA 2YWMA 5ELAA 1AUCA 1M2DA 5D9XA 4WBRD 1XZOA 3TDGA 3VPTA 2XPEA 2HT9A 3KGKA 5LCZA 1CQGA 5C04A 3APOA 4HS1A 5IPGA 3M8NA 3GKMA 4MF5A 1OC8A 1PX6A 4YAVA 5CRHA 2VCVA 3TOTA 4KDYA 3NOFA 4KUNA 3K8NA 1YKAA 3U5RE 1PL1A 2GDRA 2B3SA 5IM9A 4Z7XA 3BCIA 5H5RA 5IOXA 1Y25A 2VO4A 3DVWA 2YOIA 3GURA 2D2ZA 4HZ4A 5DVBA 3N9JA 1T8EB 2B5EA 4LLRA 4NHZA 4OCEA 4ZIJA 5COHA 3S9FA 5F8BA 4KX4A 1X5CA 1ILOA 2GQMA 5D9WA 3RDWA 1N2AA 1O8XA 4IBPA 3NZNA 4TR0A 5CO3A 1GULA 2AYTA 2H6YA 5B8BA 3GRXA 3TCOA 2YANA 6GSVA 4TKYA 1HQOA 1XW6A 4CDOA 3TRQA 5HFGA 2N5BA 4JR4A 4ECBA 3VWVA 2LJRA 1SJZA 2FWFA 2VD0A 3GFKA 3GKKA 1BYEA 4ZB8A 3PINA 2PBJA 1SD9A 1Y6EA 1A0RP 3FZ4A 4RUVA 1A24A 3LYPA 4PUFC 5GAPD 2P5QA 1VF2A 4POLA 3JCML 1AAZA 3BJ5A 3KTBA 1E6BA 2WRTA 4N10A 4F2IA 3FZAA 3TKSC 5JWRB 3VLNA 4FYUA 3G7IA 3VI7A 3HHVA 2ZCTA 3GHAA 3DGQA 1NSWA 1UN2A 2VLTA 3LSZA 1U3IA 2JSYA 5JWOB 2NVLA 4XRAA 5G30A 4YAPA 3QCPA 3DD3A 1Z6NA 3WGXA 4GSNA 2O87A 4J2FA 3UARA 3HJPA 2E7PA 1GUKA 5GZZB 2H73A 2VL9A 3Q6OA 4O5RA 3QMXA 4BA7A 3I43A 1TU7A 4PQIA 4LL4B 3QAVA 2LJAA 4I5QA 1TOFA 3P90A 1HD2A 1K3LA 1PL2A 4TXOA 3HVVA 22GSA 1HNCA 1A2MA 3KEBA 5LNKe 5B6NA 5HFIA 1EP8A 3TKSE 3DXBA 1K3YA 4ZL9A 3J7Yb 1YY7A 1ERVA 2L4QA 1WWJA 3KZQA 4J57E 16GSA 4POKA 1GSYA 4PGTA 2LQQA 1QQ2A 3ZZXA 1GRXA 3A3TA 1G7EA 3GX8A 3GV1A 3KH9A 4YQMA 1ON4A 2V41A 2AB6A 4K6XA 2B5XA 4PQ1A 5J9BA 4HU9A 1O8WA 4HQSA 14GSA 4I97A 3Q74A 4ML6A 3UJ1A 4RI6A 4H86A 1JHBA 2GZZA 4EC0A 2IFQB 4HQZA 2R37A 2VUPA 1R7HA 1U88A 1X9MB 1TW9A 4G19A 4D73A 4TXOB 1XW5A 4L0WA 3WT2A 2X64A 4JBBA 4KE3A 2LEGA 1USBA 1K0MA 3ZYWA 4L0UA 2R3XA 1DSBA 1ABAA 1PA3A 5EY6A 4DSQA 4NPBA 4PUAA 2Z9SA 2FLSA 1RQMA 1TP9A 3FZ9A 2DBCA 1G0TA 2CAQA 2CVKA 4HZ2A 3G9BA 3I9V2 1PKWA 1XVWA 3DMLA 2NBSA 1A8LA 1TRUA 4BWSA 4TOPA 2AAWA 1TKDB 1GSUA 5A4VA 1IYHA 2VLVA 3D4TA 1AW9A 1NM3A 2O85A 3HJOA 4ECJA 4KCAA 3IV4A 5J41A 1SK0A 2GLRA 2MMOA 2EIQA 4KGIA 5D9TA 1EP7A 1E2YA 5IQYA 2C0EA 1VF3A 3DWVA 1G6YA 1XWBA 3L4NA 3DRNA 1U3AA 3HCZA 4L8EA 5ID2B 5DQSA 4GQCA 3TJJA 3KP9A 2XC2A 5H5SA 2YV7A 2LSTA 1XOBA 5IMZA 2FHEA 2GSQA 1QGVA 4JE1A 1ZL9A 3UEMA 3FR6A 4EVMA 3CRTA 12GSA 3VURA 3A2XA 3F6DA 2CZ2A 4YH2A 2H76A 1X5EA 3O3TA 1S3AA 2WFCA 1ERTA 5IOWA 2FWEA 4V2MA 3EURA 1M0UA 3O6TA 5AGYA 2GSTA 1MD4A 4EE0A 4NHWA 2NPBA 2WDUA 1SL1B 5D93A 1F9MA 2H1DA 3HA9A 1K0CA 5H5QA 4IHUA 4ZBBA 1A0FA 4OFMA 2EC4A 3CSHA 5FHIA 2N5AA 1VF1A 1BAYA 1O81A 1ZYQB 1O7UA 4FYBA 2K9FA 2L4CA 5IPHA 3QD9A 2LRTA 5F05A 2K6VA 2LTKA 4E8EA 2WZ9A 2IMEA 1YJ6A 1K3OA 1VF4A 13GSA 2FCHA 3ZREA 4N30A 3GMFA 1AIUA 3TJFA 2I3YA 3H8QA 4J56E 2YZUA 4PURA 3TUEA 2TRCP 3QOUA 3ZRDA 2P5RA 5G5FA 6GSXA 5HQPA 1Q98A 2R4VA 3IAS2 3AY8A 1FOVA 3EINA 3VPQA 1GSEA 5CRWA 3EYTA 4IELA 2VIMA 3MAKA 1GLPA 2I9HA 1SYXA 2FY6A 4DSSB 18GSA 1EEJA 3KCMA 2C3TA 3KMNA 3EE2A 4BWQA 1ERWA 2DIZA 3GSSA 4I8BA 3HVSA 1V40A 2YJ7A 3A2VA 3LEFA 1YF0A 3D5JA 3TKQA 1B9XC 3IAM2 2OE0A 1ACVA 1FVKA 1AXDA 4ZILA 2LS5A 2DJ0A 5ECHB 2MMZA 4IQAA 2C3NA 2XBIA 3F3QA 4MA9A 3A2WA 2PUKC 1XOAA 3M0FA 1ML6A 1TXXA 3FKFA 2ES7A 1QMVA 4G10A 4BL7A 3V1WA 3APSA 3G7YA 2YP6A 1ZGNA 5HR2A 2M80A 3ZTLA 3EWLA 5ECIB 4MZCA 4P3YB 2IMDA 1ZOFA 3EVIA 2CV4A 3UVHA 3W6GA 4K0NA 4HOJA 1TRSA 3GYKA 2LNSA 1OKDA 3E9JB 5GAND 3TB2A 4GLTA 5G31A 2QC7A 1J9BA 2VL3A 5KN3A 4I6XA 3LFLA 3VWWA 4GWRA 4IGJA 2DLXA 4IP6A 2LRNA 3KP8A 5IMCA 2XHFA 4OCFA 3P2AA 1W89A 4NV5A 3UBLA 1MDJA 2A2SA 1Z7RA 3IK7A 2ON5A 3RPNA 2L6CA 3D21A 1PMTA 2B1KA 2CT6A 3F0IA 1XWAA 4TRXA 2GQKA 4N0VA 4TXVA 3UMAA 2O8VB 2DJ2A 2HZFA 2GT5A 3GNJA 4V1Ag 3ERWA 3F4SA 1WJKA 4GSTA 4XHMA 2H1GA 4EKZA 1OAZA 1TK8B 2QSIA 3HJMA 2BMXA 4ML1A 3C1RA 1SL2B 1JFUA 3PR8A 2OE3A 1GSDA 1QFNA 1TI3A 4POBA 2H1BA 5D96A 6GSSA 1B9YC 1LBKA 1V57A 1SKSB 4HJMA 1U6TA 1XWCA 4NXIA 3GKNA 1FB6A 2IMIA 3ZVJD 2I4AA 5FWGA 2M72A 2CQ9A 4WKWA 1MDKA 1KEBA 2CZ3A 2J9HA 1TK5B 1OKTA 4EDZA 2GTUA 2PN8A 4TR1A 5HR1A 4V2LA 4KDXA 2O7KA 2V1MA 1BX9A 2GVPA 4KDUA 1S3CA 4F9ZA 2G2QA 4FYCA 4ULXA 1TK0B 1YEPA 1SKRB 1R4WA 3MSZA 5D73A 4K2DA 3GH6A 3CSJA 2H8LA 4MJCA 2PVOC 2AV4A 3RPPA 2JU5A 3R2QA 2H6ZA 1AC1A 1M99A 2WULA 2R2JA 3KTLA 3PH9A 3E0UA 2OA7A 2IFQA 2WB9A 4V2NA 2C4JA 1MDIA 3I6AA 2H75A 1B48A 3TJBA 3ME7A 1T4ZA 4TR3A 2FA8A 5DJMA 3UL3A 4F82A 4MCUA 1DE1A 3WGEA 1KNGA 1SJIA 1BQ7A 1WOUA 4TR1B 4GXZA 3CRUA 4L5LA 6GSWA 4TW5A 3I69A 5JCUA 2VL2C 5CNWA 3WYWA 1THOA 2IL3A 2YCDA 4LMWA 2WGRA 1V58A 4WEYA 3H1NA 1WMJA 1GWCA 1XCCA 3CXGA 4I2UA 4K1FA 3Q18A 2KP2A 2GQLA 2F9SA 4PX1A 1B8XA 5A4WA 1KTEA 3US3A 3ZIVA 4Q5RA 4XIHA 4ACSA 4LL1B 20GSA 4Q5QA 2H0GA 5DDLA 2E2MA 4POMA 1Z5YE 4RQXA 1XW9A 3QFAC 2XBQA 1GTIA 4XS4B 4ZL7A 2H01A 1TJDA 4X0XA 3LWAA 4I2TA 1SK1A 4K0GA 4N11A 3BBYA 2FGXA 3D22A 4LA1A 3C7MA 5DJLA 2M46A 3W8SA 5J5NA 2J23A 5ID2A 1GLQA 4HEA2 3GX0A 5IMDA 4EO3A 2L57A 2FWGA 3FHKA 1M2AA 2P0GA 4Q5FA 1H4OA 2RIIA 4IVFA 2KP1A 4TR4A 4FH8A 3SWLA 1PSQA 1S3DA 4LMVA 1MD3A 4QQ7A 2DC5A 1Z3EA 3EC3A 2RM6A 1WRYA 5EPFA 3TRPA 5HR3A 4G9HA 1XWKA 2LKUA 2OBIA 4DVCA 4MDCA 4IP1A 4EXJA 4IJIA 2B5YA 2GSSA 4MP4A 2VOCA 4BVXA 1XVQA 1EV9A 5D9VA 3EMPA 4XS1A 4ZL8A 4PNGA 4ILFA 4HUAA 2HNLA 3VWUA 1B4QA 3QFBC 1ZCPA 1T00A 1GL8A 3L9VA 1GTBA 2HSYA 2KLXA 4KAEA 1GNEA 2FD3A 1WIKA 4ECIA 4ID0A 2REMA 5CREA 2WCIA 3TJKA 1UC7A 5JCWA 1Q4JA 2H6XA 11GSA 2VCWA 4ECCA 2MBSA 1HNBA 1V2AA 1OC3A 3ZMKA 2H1AA 2B6MA 2C8UA 2YWIA 2ALBA 5JCGA 2L5LA 5ECOB 2OACA 1PQNA 2DJJA 3H93A 5E59A 1WE0A 1C72A 4EL1A 6GSYA 1GNWA 2FWHA 2JZTA 2CA8A 5EL8A 1R5AA 1U87A 3ZLPA 2BTOT 3HDCA 4Q5NA 1FHEA 2GZYA 2HXKA 3GIXA 4DSSA 3HY2A 4TVEA 3HD5A 3NIVA 5HFKA 1JZRA 4MJBA 4HJ2A 3L78A 3TRXA 4HU7A 1M9BA 3D0ZA 5A5KA 2VAFA 3LORA 4ZB9A 4MH3A 4GRFA 1DUGA 1QXHA 5GSTA 1QK8A 3C71A 2LNTA 1EEMA 4NV2A 1PKZA 1RK4A 1JZOA 2PMTA 3BOAA 1FO5A 5ECKB 3C73A 3C8EA 1EGOA 1T1VA 5G1LA 3LXZA 1ERUA 5JWQB 3KM6A 3E3EA 1R26A 1JZDA 3ERFA 4FO5A 3GTUB 3TKSA 4K7IA 1Z7PA 5L71A 2LV3A 4MJEA 4MABA 1M9AA 3IPZA 4O92A 4K7OA 1OE8A 3FR3A 2YZHA 5KN0A 1PN9A 2H30A 1PX7A 2JADA 1VRSD 5DBQA 2HFDA 1EOHA 5ECPB 4F0CA 3DKSA 1YF1A 1MEKA 1XFLA 2B7JA 2C1YA 1VGLA 3FRCA 6GSUA 1TRWA 3EU4A 3IK9A 1HNAA 4KW6A 4EF0A 1N8JA 3F6FA 2JZRA 5CRDA 3WD6A 2KHPA 3IA1A 1PD21 3W8JA 2VD1A 2QGVA 3HZ8A 4KSMA 2PWJA 2MZCA 3TKPA 6GSTA 4PNFA 4X1UA 1AQXA 1GSFA 3HKRA 1T7PB 3CBUA 2AJQB 1XIYA 2MMNA 3KD0A 4PXOA 2YN1A 2C80A 2GGTA 2FUG2 5ELGA 2QKEA 3F4TA 2YNXA 3ZITA 4MF7A 5AIVA 4KH7A 4MZBA 3N5OA 2RUFA 3QDNA 1V9WA 1FVJA 3IRAA 2LRCA 4XRDA 2OE1A 3IBHA 2K18A 4MH2A 1SK2A 2B7KA 2HRNA 1TDIA 4WR5A 5AISA 2VM2A 2C0GA 3QR6A 4O7HA 3VK9A 3M3MA 2VCZA 1K0BA 2H0HA 3ZL5A 1XPVA 4OO5A 3F3RA 4GTUA 1JLVA 5F07A 4OD7A 3ZVJA 4QL9A 1X9WB 3L0HA 4TN8A 2H71A 4BVYA 2LJKA 4V1Ap 1T4YA 3QAGA 4K9ZA 2IMFA 4G2EA 3KH7A 1BJXA 1I5GA 4ISDA 5ENUA 4MMMA 3HZ4A 1YDKA 1K0AA 3DEXA 1BG5A 1SL0B 3ZIJA 3LQ7A 4F0BA 4JZQA 1ZMAA 4YQUA 3FK8A 4RQRA 2PPTA 1ZZYA 4AJ7A 5ECNB 3F63A 3ME8A 5IO0A 3LJRA 2EIRA 2WJUA 4NMUA 2O89A 2ZUPA 5B7CA 4IJ3A 2VCTA 3KJYA 5AN1A 3D4MA 2DJKA 2MMAA 3ED3A 4HI7A 5LD0A 3IDVA 2MYGA 2OADA 1F37A 4WF5A 4XTSA 3KIJA 2CVDA 3QPMA 2C0DA 2H66A 1XXUA 1A2JA 4OWYA 3IE3A 1NHOA 3CTFA 1EZKA 5C00A 4AF2A 1LJRA 1NW2A 3ZFLA 5ECRB 2G0FA 3RHBA 1O85A 2V2GA 2PU9C 2CX3A 4IQ1A 4CHSA 2X8CA 2E0QA 2L59A 2YV9A 2GZPA 2H0IA 2TRXA 1WP0A 3BCKA 5A4UA 3WGDA 1A8YA 4HDEA 1A2LA 1PGTA 2AHEA 3SBCA 5KN2A 1OVNA 3H4KA 1YKCA 2F8FA 4WXTA 1M7TA 3MWHA 1OE7A 3H79A 1EGRA 2X99A 2C3QA 2F8AA 5D8IA 5IMFA 4DSRA 1F6MC 4QL7A 1T3BA 3WT1A 3LXTA 4JRRA 5IMAA 3TKRA 1GTUA 2HZEA 4XS4A 2H74A 1GSSA 3TGZA 5ECQB 4GF0A 4X43A 4MLYA 4IKHA 1SYRA 1A23A 2H72A 2YJHA 3FEUA 5FT3A 5KEJA 1FAAA 3FY7A 2NTOA 1CQHA 3OR5A 2V6OA 2WS2A 19GSA 3CTGA 4NAXA 2GS3A 1JZWA 2HSHA 1F3AA 3FZ5A 2N5FA 4MZWA 1YQ1A 3FW2A 2A4VA 4FIWA 4OFNA 4K8MA 2K8SA 2HYXA 4MJAA 1R5PA 2DSAA 3Q19A 5B6MA 5ECLB 5GSSA 1PRXA 2CX4A 1SENA 9GSSA 5IMVA 3O76A 2HRFA 3UIWA 5EVOA 4IN0A 2NDOA 3GKXA 1THXA 2RM5A 3U6VA 2FNOA 2RUEA 5AIXA 2DMLA 5CP1A 2HZEB 4ZBAA 1FB0A 4AJ8A 5HR0A 1Z9HA 2H19A 3GA4A 1DE2A 3CSIA 2YPMA 4N0ZA 1ST9A 3VWXA 3RBTA 1O6JA 3RHCA 4MK3A 1HYUA 2V6KA 3G7JA 5DCGA 3GSTA 2R5GA 1W4VA 4IW9A 4WETA 4JR6A 3EMXA 1LU4A 2DIYA 2VM1A 1K0OA 2CAIA 4E8HA 10GSA 5F06A 3HVXA 2B1LA 3ZMLA 1TRVA 4ZB6A 2TIRA 3UAPA 1I9DA 3L9SA 5ECSA 4WBJA 3L9UA 2IPAA 3MDKA 3LGCA 1RW1A 1M2BA 3DVXA 2FA4A 4ZXGA 1GUHA 1FW1A 3DIEA 1DBYA 5G5EA 2V32A 5J4UA 4AJ6A 4AGSA 2L5OA 4OO4A 2AUVA 3D6IA 1J0FA 3VFIA 1KBNA 2VLUA 1SKWB 4L5OA 1EOGA 1F2EA 4WR4A 1TTZA 3BD2A 3GUSA 1EV4A 3GL3A 2PERA 5KN1A 2K8VA 1AQVA 1URMA 4F03A 2LUSA 2X8HA 4KCEA 3C1SA 4D73B 2I1UA 2DJ1A 2DMMA 1O73A 2HE3A 4BPYA 4KSOA 3CMIA 5CAXA 5J9CA 2VCQA 3A5WA 5G2ZA 5F0GA 3GTUA 2KUCA 1SU9A 4YQVA 4JEDA 4MF6A
chains in the Genus database with same CATH superfamily
2MBTA 1MTCA 3APQA 2F3MA 4DEJA 1GH2A 2IN3A 2HLSA 4GCIA 4ICYA 3ERGA 1FG4A 2BJXA 5IIZA 3F9UA 5DCHA 3VI5A 1SD8A 1K0NA 2L6DA 3QAWA 4GSSA 2ZNMA 4ZBDA 5DALA 5G1KA 3IHQA 3GL5A 3MNGA 4O32A 1JLWA 5E4WA 1X0RA 4KB3A 2JL4A 1K0DA 2I81A 2GSRA 2DJ3A 7GSSA 2EIOA 2C0FA 1H75A 1OC9A 4XCSA 3UVTA 4X4JA 4PQHA 4NWYA 2OKAA 1J08A 4K7NA 3RAZA 1XWGA 3M9KA 1TI1A 1TU8A 3TOUA 4OMVA 1WPIA 1YZXA 5ECMB 4OFTA 3IXRA 5ABRA 2YWNA 2A2RA 1V98A 1F3BA 2PGTA 1X9SB 17GSA 1GP1A 4XS6A 4USSA 1EWXA 3GH9A 2YWOA 5DAKA 4EUYA 5DQYA 2H70A 1YEXA 2VCXA 3DYRA 4CW9A 2E2GA 2OBKA 3CYNA 3HXSA 5J3RA 8GSSA 4GQFA 3IOSA 2RLIA 2XPDA 3GN3A 4IS0A 1ZYEA 5DALB 5IO2A 2PVQA 4MPFA 1UA5A 4KA0A 5CRGA 2LQOA 3IC4A 2HRKA 3M9JA 4WF4A 5B8AA 3KMOA 4MPGA 4EDYA 2KOKA 2CVBA 2IMKA 2R6KA 3FR9A 2GT6A 3P7XA 3F8UA 4KNDA 1UVZA 3ISOA 1G7OA 3EU3A 1NHYA 1OC9B 3F4RA 4JU5A 4RI7A 1GTAA 5CYYA 1GSQA 3LYKA 3ZFBA 2HI7A 4K2XA 1SJ6A 2JZSA 2X8GA 3LG6A 3FYGA 3M1GA 2VL2A 2ON7A 4YKFA 2IJYA 3P8WA 1B4PA 1Z6MA 1AQWA 3PGTA 2F51A 3UBKA 3IR4A 3TJGA 2JACA 1OYJA 3HVNA 3HYPA 1X5DA 5DAKB 1G6WA 5INYA 2JSZA 2IWTA 1QUWA 3J7Yk 2IIYA 3KXOA 1XBSA 1GUMA 3UOMA 1IYIA 2P31A 1BEDA 2OJLA 2YWMA 5ELAA 1AUCA 1M2DA 5D9XA 4WBRD 1XZOA 3TDGA 3VPTA 2XPEA 2HT9A 3KGKA 5LCZA 1CQGA 5C04A 3APOA 4HS1A 5IPGA 3M8NA 3GKMA 4MF5A 1OC8A 1PX6A 4YAVA 5CRHA 2VCVA 3TOTA 4KDYA 3NOFA 4KUNA 3K8NA 1YKAA 1ZYPA 3U5RE 1PL1A 2GDRA 2B3SA 5IM9A 4Z7XA 3BCIA 5H5RA 5IOXA 1Y25A 2VO4A 3DVWA 2YOIA 3GURA 2D2ZA 4HZ4A 5DVBA 3N9JA 1T8EB 2B5EA 4LLRA 4NHZA 4OCEA 4ZIJA 5COHA 3S9FA 5F8BA 4KX4A 1X5CA 1ILOA 2GQMA 5D9WA 3RDWA 1N2AA 1O8XA 4IBPA 3NZNA 4TR0A 5CO3A 1GULA 2AYTA 2H6YA 5B8BA 3GRXA 3TCOA 2YANA 6GSVA 4TKYA 1HQOA 1XW6A 4CDOA 3TRQA 5HFGA 2N5BA 4JR4A 4ECBA 3VWVA 2LJRA 1SJZA 2FWFA 2VD0A 3GFKA 3GKKA 1BYEA 4ZB8A 3PINA 2PBJA 1SD9A 1Y6EA 1A0RP 3FZ4A 4RUVA 1A24A 3LYPA 4PUFC 5GAPD 2P5QA 4O5QA 1VF2A 1XG8A 4POLA 3JCML 1AAZA 3BJ5A 3KTBA 1E6BA 2WRTA 4N10A 4F2IA 3FZAA 3TKSC 5JWRB 3VLNA 4FYUA 3G7IA 3VI7A 3HHVA 2ZCTA 3GHAA 3DGQA 1NSWA 1UN2A 2VLTA 3LSZA 1U3IA 2JSYA 5BRTA 5JWOB 2NVLA 4XRAA 5G30A 4YAPA 3QCPA 2R0PA 3DD3A 1Z6NA 3WGXA 4GSNA 4J2FA 2O87A 3UARA 3HJPA 2E7PA 1GUKA 5GZZB 2H73A 2VL9A 3Q6OA 4O5RA 3QMXA 4BA7A 3I43A 1TU7A 4PQIA 4LL4B 3QAVA 2LJAA 4I5QA 1TOFA 3P90A 1HD2A 1K3LA 1PL2A 4TXOA 3HVVA 22GSA 1HNCA 1A2MA 3KEBA 5LNKe 5B6NA 5HFIA 1EP8A 3TKSE 3DXBA 1K3YA 4ZL9A 3J7Yb 1YY7A 1ERVA 2L4QA 1WWJA 3KZQA 4J57E 16GSA 4POKA 1GSYA 4PGTA 2LQQA 1QQ2A 3ZZXA 4A5PA 1GRXA 3A3TA 1G7EA 3GX8A 3GV1A 3KH9A 4YQMA 1ON4A 2V41A 2AB6A 4K6XA 2B5XA 4PQ1A 5J9BA 4HU9A 1O8WA 4HQSA 14GSA 4I97A 3Q74A 4ML6A 3UJ1A 4RI6A 4H86A 1JHBA 2GZZA 4EC0A 2IFQB 4HQZA 2R37A 2VUPA 1R7HA 1U88A 1X9MB 1TW9A 4G19A 4D73A 2HSMA 4TXOB 1XW5A 5KOWA 4L0WA 3WT2A 2X64A 4JBBA 4KE3A 2LEGA 1USBA 1K0MA 3ZYWA 4L0UA 2R3XA 1DSBA 1ABAA 1PA3A 5EY6A 4DSQA 4NPBA 4PUAA 2Z9SA 2FLSA 1RQMA 1TP9A 3FZ9A 2DBCA 1G0TA 2CAQA 2CVKA 4HZ2A 3G9BA 3I9V2 1PKWA 4Z2RA 1XVWA 3DMLA 2NBSA 1A8LA 1TRUA 4BWSA 4TOPA 2AAWA 1TKDB 1GSUA 5A4VA 1IYHA 2VLVA 3D4TA 1AW9A 1NM3A 2O85A 3HJOA 4ECJA 4KCAA 3IV4A 5J41A 1SK0A 2GLRA 2MMOA 2EIQA 4KGIA 5D9TA 1EP7A 1E2YA 5IQYA 2C0EA 1VF3A 3DWVA 1G6YA 1XWBA 3L4NA 3DRNA 1U3AA 3HCZA 4L8EA 5ID2B 3MYDA 5DQSA 4GQCA 3TJJA 3KP9A 2XC2A 5H5SA 2YV7A 2LSTA 1XOBA 5IMZA 2FHEA 4O5UA 2GSQA 1QGVA 4JE1A 1ZL9A 3UEMA 3FR6A 4EVMA 5BMUA 3CRTA 12GSA 4EIPA 3VURA 3A2XA 3F6DA 2CZ2A 4YH2A 2H76A 1X5EA 3O3TA 1S3AA 2WFCA 1ERTA 5IOWA 2FWEA 4V2MA 1FOHA 3EURA 1M0UA 3O6TA 5AGYA 2GSTA 1MD4A 4EE0A 4NHWA 2NPBA 2WDUA 1SL1B 5D93A 1F9MA 2H1DA 3HA9A 1K0CA 5H5QA 4IHUA 4ZBBA 1A0FA 2R0CA 3A5IA 2EC4A 3CSHA 4OFMA 3MIXA 5FHIA 2N5AA 1VF1A 1BAYA 1O81A 1ZYQB 1O7UA 4FYBA 2K9FA 2L4CA 5IPHA 3QD9A 2LRTA 5F05A 2K6VA 2LTKA 4E8EA 2WZ9A 2IMEA 1YJ6A 1K3OA 1VF4A 13GSA 2FCHA 3ZREA 4N30A 3GMFA 1AIUA 3TJFA 2I3YA 3H8QA 4J56E 2YZUA 2X49A 4PURA 3TUEA 2TRCP 3QOUA 3ZRDA 2P5RA 5G5FA 6GSXA 5HQPA 4Z2TA 1Q98A 2R4VA 3IAS2 3AY8A 1FOVA 3EINA 3VPQA 1GSEA 5CRWA 3EYTA 4IELA 2VIMA 3MAKA 1GLPA 2HRAA 2I9HA 1SYXA 2FY6A 2UZ8A 4DSSB 18GSA 1EEJA 3KCMA 2C3TA 3KMNA 3EE2A 4Z2UA 4BWQA 1ERWA 2DIZA 3GSSA 4I8BA 3HVSA 1V40A 2YJ7A 3A2VA 3LEFA 1YF0A 3D5JA 3TKQA 4FQUA 1B9XC 3IAM2 2OE0A 1ACVA 1FVKA 1AXDA 4ZILA 2LS5A 2DJ0A 5ECHB 2MMZA 1PN0A 4IQAA 2C3NA 2XBIA 3F3QA 4MA9A 3A2WA 2PUKC 1XOAA 3M0FA 1ML6A 1TXXA 3FKFA 2ES7A 1PFOA 1QMVA 4G10A 4BL7A 3V1WA 3IC8A 3APSA 3G7YA 2YP6A 1ZGNA 5HR2A 2A2PA 2M80A 3ZTLA 4HSCX 3EWLA 5ECIB 4MZCA 4P3YB 2IMDA 1ZOFA 3EVIA 2CV4A 3UVHA 3W6GA 4K0NA 4HOJA 1TRSA 3GYKA 2LNSA 1OKDA 3E9JB 5GAND 3TB2A 4GLTA 5G31A 2QC7A 1J9BA 2VL3A 5KN3A 4I6XA 3LFLA 3VWWA 4GWRA 4IGJA 2DLXA 4IP6A 2LRNA 3KP8A 5IMCA 2XHFA 4OCFA 3P2AA 1W89A 4NV5A 3UBLA 1MDJA 2A2SA 1Z7RA 3IK7A 2ON5A 3RPNA 2L6CA 3D21A 1PMTA 2B1KA 2CT6A 3F0IA 1XWAA 4TRXA 4BL7B 2GQKA 4N0VA 4TXVA 3UMAA 2O8VB 2DJ2A 2HZFA 2GT5A 3GNJA 4V1Ag 3ERWA 3F4SA 1WJKA 4GSTA 4XHMA 2H1GA 4EKZA 1OAZA 1TK8B 2QSIA 3HJMA 2BMXA 4ML1A 3C1RA 1SL2B 1JFUA 3PR8A 2OE3A 1GSDA 1QFNA 1TI3A 4POBA 2H1BA 5D96A 6GSSA 1B9YC 1LBKA 1V57A 1SKSB 4HJMA 1U6TA 1XWCA 4NXIA 3GKNA 1FB6A 2IMIA 3ZVJD 2I4AA 5FWGA 2M72A 2CQ9A 4WKWA 4BVYB 1MDKA 1KEBA 2CZ3A 2J9HA 1TK5B 1OKTA 4EDZA 2GTUA 2PN8A 4TR1A 5HR1A 4V2LA 4KDXA 2O7KA 2V1MA 1BX9A 2GVPA 4KDUA 1S3CA 4F9ZA 2G2QA 4FYCA 4ULXA 1TK0B 1YEPA 1SKRB 1R4WA 3MSZA 5D73A 4K2DA 2R0GA 3GH6A 3CSJA 2H8LA 4MJCA 2PVOC 2AV4A 3R3EA 3RPPA 2JU5A 3R2QA 2H6ZA 1AC1A 1M99A 2WULA 2R2JA 3KTLA 3PH9A 3E0UA 2OA7A 2IFQA 2WB9A 4V2NA 2C4JA 1MDIA 4YKGA 3I6AA 2H75A 1B48A 3TJBA 3ME7A 1T4ZA 4TR3A 2FA8A 5DJMA 3UL3A 4F82A 4MCUA 1DE1A 3WGEA 1KNGA 1SJIA 1BQ7A 1WOUA 4TR1B 4GXZA 3CRUA 4L5LA 6GSWA 4TW5A 3I69A 5JCUA 2VL2C 5CNWA 3WYWA 1THOA 2IL3A 2YCDA 4LMWA 2WGRA 1V58A 4WEYA 3H1NA 1WMJA 1GWCA 1XCCA 3CXGA 4I2UA 4K1FA 3Q18A 2KP2A 2GQLA 2F9SA 4PX1A 1B8XA 5A4WA 1KTEA 3US3A 3ZIVA 4Q5RA 4XIHA 4ACSA 4LL1B 20GSA 4Q5QA 2H0GA 5DDLA 2E2MA 4K5SA 4POMA 1Z5YE 4RQXA 4EIQA 1XW9A 3QFAC 2XBQA 4G0LA 1GTIA 4XS4B 4ZL7A 2H01A 1TJDA 4X0XA 3LWAA 4I2TA 1SK1A 4K0GA 4N11A 3BBYA 2FGXA 2QA1A 3D22A 4LA1A 3C7MA 5DJLA 2M46A 3W8SA 5J5NA 2J23A 4G0KA 5ID2A 1GLQA 4HEA2 3GX0A 5IMDA 4EO3A 1ZYNA 2L57A 2FWGA 3FHKA 2A4HA 1M2AA 2P0GA 4Q5FA 1H4OA 2RIIA 4IVFA 2KP1A 4TR4A 4FH8A 3SWLA 1PSQA 1S3DA 4LMVA 1MD3A 4QQ7A 2DC5A 1Z3EA 3EC3A 2RM6A 1WRYA 5EPFA 3TRPA 5HR3A 4G9HA 1XWKA 2LKUA 2OBIA 4DVCA 4MDCA 4IP1A 4EXJA 4IJIA 2B5YA 2GSSA 4MP4A 2VOCA 4BVXA 1XVQA 1EV9A 3LW9A 5D9VA 2DKIA 3EMPA 4XS1A 4ZL8A 4PNGA 4ILFA 4HUAA 2HNLA 3VWUA 1B4QA 3QFBC 1ZCPA 1T00A 1GL8A 3L9VA 1GTBA 2HSYA 2KLXA 4KAEA 1GNEA 2FD3A 1WIKA 4ECIA 4ID0A 2REMA 5CREA 2WCIA 3TJKA 1UC7A 5JCWA 3EPTA 1Q4JA 2H6XA 11GSA 2VCWA 4ECCA 2MBSA 1HNBA 1V2AA 1OC3A 3ZMKA 2H1AA 2B6MA 2C8UA 2YWIA 2ALBA 5JCGA 2L5LA 5ECOB 2X4AA 2OACA 1PQNA 2DJJA 3H93A 5E59A 1WE0A 1C72A 4EL1A 6GSYA 1GNWA 2FWHA 2JZTA 4BVXB 2CA8A 5EL8A 1R5AA 1U87A 3ZLPA 2BTOT 3HDCA 4Q5NA 1FHEA 2GZYA 2HXKA 3GIXA 4DSSA 3HY2A 4TVEA 3HD5A 3NIVA 5HFKA 1JZRA 4MJBA 4HJ2A 3L78A 3TRXA 4HU7A 1M9BA 3D0ZA 5A5KA 2VAFA 2QA2A 3LORA 4ZB9A 4MH3A 4GRFA 1DUGA 1QXHA 5GSTA 1QK8A 3C71A 2LNTA 1EEMA 4NV2A 1PKZA 1RK4A 1JZOA 2PMTA 3BOAA 1FO5A 5ECKB 3C73A 3C8EA 5KOXA 1T1VA 1EGOA 5G1LA 3LXZA 1ERUA 5JWQB 3KM6A 3E3EA 1R26A 1JZDA 3ERFA 4FO5A 3GTUB 3TKSA 4K7IA 1Z7PA 5L71A 2LV3A 4MJEA 4MABA 1M9AA 3IPZA 4O92A 4K7OA 1OE8A 3FR3A 2YZHA 5KN0A 1PN9A 2H30A 1PX7A 2JADA 1VRSD 5DBQA 2HFDA 1EOHA 5ECPB 1M3JA 4F0CA 3DKSA 1YF1A 1MEKA 1XFLA 2B7JA 2C1YA 1VGLA 3FRCA 6GSUA 3PPUA 1TRWA 3EU4A 3IK9A 1HNAA 4KW6A 4EF0A 1N8JA 3F6FA 2JZRA 5CRDA 3WD6A 2KHPA 3IA1A 1PD21 3W8JA 2VD1A 2QGVA 3HZ8A 4KSMA 2PWJA 2MZCA 3TKPA 6GSTA 4PNFA 4G0IA 4X1UA 1AQXA 1GSFA 3HKRA 1T7PB 3CBUA 2AJQB 1XIYA 2MMNA 3KD0A 4PXOA 2YN1A 2C80A 2GGTA 2FUG2 5ELGA 2QKEA 3F4TA 2YNXA 3ZITA 4MF7A 5AIVA 4KH7A 4MZBA 3N5OA 2RUFA 3QDNA 1V9WA 4PTSA 1FVJA 3IRAA 2LRCA 4XRDA 2OE1A 3IBHA 2K18A 4MH2A 1SK2A 2B7KA 2HRNA 1TDIA 4WR5A 5AISA 2VM2A 2C0GA 3QR6A 4O7HA 3VK9A 3M3MA 2VCZA 1K0BA 2H0HA 3ZL5A 1XPVA 4OO5A 3F3RA 4GTUA 1JLVA 5F07A 4OD7A 3ZVJA 4QL9A 1X9WB 3L0HA 4TN8A 2H71A 4BVYA 2LJKA 4V1Ap 1T4YA 3QAGA 4K9ZA 2IMFA 4G2EA 3KH7A 1BJXA 1I5GA 4ISDA 5ENUA 4MMMA 3HZ4A 1YDKA 1K0AA 3DEXA 1BG5A 1SL0B 3ZIJA 3LQ7A 4F0BA 4JZQA 1ZMAA 4YQUA 3FK8A 4RQRA 2PPTA 1ZZYA 4AJ7A 5ECNB 3F63A 3ME8A 5IO0A 3LJRA 2EIRA 2WJUA 4NMUA 2O89A 2ZUPA 5B7CA 4IJ3A 2VCTA 3KJYA 5AN1A 3D4MA 2DJKA 2MMAA 3ED3A 4HI7A 5LD0A 3IDVA 2MYGA 2OADA 1F37A 4WF5A 4XTSA 3KIJA 2CVDA 3QPMA 2C0DA 2H66A 1XXUA 1A2JA 4OWYA 3IE3A 1NHOA 3CTFA 1EZKA 5C00A 4AF2A 1LJRA 1NW2A 3ZFLA 5ECRB 2G0FA 3RHBA 1O85A 2V2GA 2PU9C 2CX3A 4IQ1A 4CHSA 2X8CA 2E0QA 2L59A 2YV9A 2GZPA 2H0IA 2TRXA 1WP0A 3BCKA 5A4UA 3WGDA 1A8YA 4KF9A 4HDEA 1A2LA 1PGTA 2AHEA 3SBCA 5KN2A 1OVNA 3H4KA 1YKCA 2F8FA 4WXTA 4CY6A 1M7TA 3MWHA 1OE7A 3H79A 1EGRA 2X99A 2C3QA 2F8AA 5D8IA 5IMFA 4DSRA 1F6MC 4QL7A 1T3BA 3WT1A 3LXTA 4JRRA 5IMAA 3TKRA 1GTUA 2HZEA 4XS4A 2H74A 1GSSA 3TGZA 5ECQB 4GF0A 4X43A 4MLYA 4IKHA 1SYRA 1A23A 2H72A 2YJHA 3FEUA 5FT3A 4CY8A 1FAAA 5KEJA 3FY7A 2NTOA 1CQHA 3OR5A 2V6OA 2WS2A 19GSA 3CTGA 4NAXA 2GS3A 1JZWA 2HSHA 1F3AA 1M3IA 3FZ5A 2N5FA 4MZWA 1YQ1A 3FW2A 2A4VA 4FIWA 4OFNA 4K8MA 2K8SA 2HYXA 4MJAA 4K5RA 1R5PA 2DSAA 3Q19A 3CQFA 5ECLB 5B6MA 5GSSA 1PRXA 2CX4A 1SENA 9GSSA 5IMVA 3O76A 2HRFA 3UIWA 5EVOA 3FMWA 4IN0A 2NDOA 4MNNA 3GKXA 1THXA 2RM5A 3U6VA 2FNOA 2RUEA 5AIXA 2DMLA 5CP1A 2HZEB 4ZBAA 1FB0A 4AJ8A 5HR0A 1Z9HA 2H19A 3GA4A 1DE2A 3CSIA 2YPMA 4N0ZA 1ST9A 3VWXA 3RBTA 1O6JA 3RHCA 4MK3A 1HYUA 2V6KA 3G7JA 5DCGA 3GSTA 2R5GA 1W4VA 4IW9A 4WETA 4JR6A 3EMXA 1LU4A 2DIYA 2VM1A 1K0OA 2CAIA 4E8HA 10GSA 5F06A 3HVXA 2B1LA 3ZMLA 1TRVA 4ZB6A 2TIRA 3UAPA 1I9DA 3L9SA 5ECSA 4WBJA 3L9UA 2IPAA 3MDKA 3LGCA 1RW1A 1M2BA 3DVXA 2FA4A 4ZXGA 1GUHA 1FW1A 3DIEA 1DBYA 5G5EA 2V32A 5J4UA 4AJ6A 4AGSA 2L5OA 4OO4A 2AUVA 2DKHA 3D6IA 1J0FA 3VFIA 1KBNA 2VLUA 1S3RA 1SKWB 4L5OA 1EOGA 1F2EA 4WR4A 1TTZA 3BD2A 3GUSA 1EV4A 3GL3A 2PERA 5KN1A 2K8VA 1AQVA 1URMA 4F03A 2LUSA 2X8HA 4KCEA 3C1SA 4D73B 2I1UA 2DJ1A 2DMMA 1O73A 2HE3A 4BPYA 4KSOA 3CMIA 4BIKA 5CAXA 5J9CA 2VCQA 3A5WA 5G2ZA 5F0GA 3GTUA 2KUCA 1SU9A 4YQVA 4JEDA 4MF6A 3IHGA
chains in the Genus database with same CATH topology
2MBTA 1MTCA 3APQA 2F3MA 4DEJA 1GH2A 2IN3A 2HLSA 4GCIA 4ICYA 3ERGA 1FG4A 2BJXA 5IIZA 3F9UA 5DCHA 3VI5A 1SD8A 1K0NA 2L6DA 3QAWA 4GSSA 2ZNMA 4ZBDA 5DALA 5G1KA 3IHQA 3GL5A 3MNGA 4O32A 1JLWA 5E4WA 1X0RA 4KB3A 2JL4A 1K0DA 2I81A 2GSRA 2DJ3A 7GSSA 2EIOA 2C0FA 1H75A 1OC9A 4XCSA 3UVTA 4X4JA 4PQHA 4NWYA 2OKAA 1J08A 4K7NA 3RAZA 1XWGA 3M9KA 1TI1A 1TU8A 3TOUA 4OMVA 1WPIA 1YZXA 5ECMB 4OFTA 3IXRA 5ABRA 2YWNA 2A2RA 1V98A 1F3BA 2PGTA 1X9SB 17GSA 1GP1A 4XS6A 4USSA 1EWXA 3GH9A 2YWOA 5DAKA 4EUYA 5DQYA 2H70A 1YEXA 2VCXA 3DYRA 4CW9A 2E2GA 2OBKA 3CYNA 3HXSA 5J3RA 8GSSA 4GQFA 3IOSA 2RLIA 2XPDA 3GN3A 4IS0A 1ZYEA 5DALB 5IO2A 2PVQA 4MPFA 1UA5A 4KA0A 5CRGA 2LQOA 3IC4A 2HRKA 3M9JA 4WF4A 5B8AA 3KMOA 4MPGA 4EDYA 2KOKA 2CVBA 2IMKA 2R6KA 3FR9A 2GT6A 3P7XA 3F8UA 4KNDA 1UVZA 3ISOA 1G7OA 3EU3A 1NHYA 1OC9B 3F4RA 4JU5A 4RI7A 1GTAA 5CYYA 1GSQA 3LYKA 3ZFBA 2HI7A 4K2XA 1SJ6A 2JZSA 2X8GA 3LG6A 3FYGA 3M1GA 2VL2A 2ON7A 4YKFA 2IJYA 3P8WA 1B4PA 1Z6MA 1AQWA 3PGTA 2F51A 3UBKA 3IR4A 3TJGA 2JACA 1OYJA 3HYPA 1X5DA 5DAKB 1G6WA 5INYA 2JSZA 2IWTA 1QUWA 3J7Yk 2IIYA 3KXOA 1XBSA 1GUMA 3UOMA 1IYIA 2P31A 1BEDA 2OJLA 2YWMA 5ELAA 1AUCA 1M2DA 5D9XA 4WBRD 1XZOA 3TDGA 3VPTA 2XPEA 2HT9A 3KGKA 5LCZA 1CQGA 5C04A 3APOA 4HS1A 5IPGA 3M8NA 3GKMA 4MF5A 1OC8A 1PX6A 4YAVA 5CRHA 2VCVA 3TOTA 4KDYA 3NOFA 4KUNA 3K8NA 1YKAA 1ZYPA 3U5RE 1PL1A 2GDRA 2B3SA 5IM9A 4Z7XA 3BCIA 5H5RA 5IOXA 1Y25A 2VO4A 3DVWA 2YOIA 3GURA 2D2ZA 4HZ4A 5DVBA 3N9JA 1T8EB 2B5EA 4LLRA 4NHZA 4OCEA 4ZIJA 5COHA 3S9FA 5F8BA 4KX4A 1X5CA 1ILOA 2GQMA 5D9WA 3RDWA 1N2AA 1O8XA 4IBPA 3NZNA 4TR0A 5CO3A 1GULA 2AYTA 2H6YA 5B8BA 3GRXA 3TCOA 2YANA 6GSVA 4TKYA 1HQOA 1XW6A 4CDOA 3TRQA 5HFGA 2N5BA 4JR4A 4ECBA 3VWVA 2LJRA 1SJZA 2FWFA 2VD0A 3GFKA 3GKKA 1BYEA 4ZB8A 3PINA 2PBJA 1SD9A 1Y6EA 1A0RP 3FZ4A 4RUVA 1A24A 3LYPA 4PUFC 5GAPD 2P5QA 1VF2A 4O5QA 4POLA 3JCML 1AAZA 3BJ5A 3KTBA 1E6BA 2WRTA 4N10A 4F2IA 3FZAA 3TKSC 5JWRB 3VLNA 4FYUA 3G7IA 3VI7A 3HHVA 2ZCTA 3GHAA 3DGQA 1NSWA 1UN2A 2VLTA 3LSZA 1U3IA 2JSYA 5BRTA 5JWOB 2NVLA 4XRAA 5G30A 4YAPA 3QCPA 2R0PA 3DD3A 1Z6NA 3WGXA 4GSNA 4J2FA 2O87A 3UARA 3HJPA 2E7PA 1GUKA 5GZZB 2H73A 2VL9A 3Q6OA 4O5RA 3QMXA 4BA7A 3I43A 1TU7A 4PQIA 4LL4B 3QAVA 2LJAA 4I5QA 1TOFA 3P90A 1HD2A 1K3LA 1PL2A 4TXOA 3HVVA 22GSA 1HNCA 1A2MA 3KEBA 5LNKe 5B6NA 5HFIA 1EP8A 3TKSE 3DXBA 1K3YA 4ZL9A 3J7Yb 1YY7A 1ERVA 2L4QA 1WWJA 3KZQA 4J57E 16GSA 4POKA 1GSYA 4PGTA 2LQQA 1QQ2A 3ZZXA 4A5PA 1GRXA 3A3TA 1G7EA 3GX8A 3GV1A 3KH9A 4YQMA 1ON4A 2V41A 2AB6A 4K6XA 2B5XA 4PQ1A 5J9BA 4HU9A 1O8WA 4HQSA 14GSA 4I97A 3Q74A 4ML6A 3UJ1A 4RI6A 4H86A 1JHBA 2GZZA 4EC0A 2IFQB 4HQZA 2R37A 2VUPA 1R7HA 1U88A 1X9MB 1TW9A 4G19A 4D73A 2HSMA 4TXOB 1XW5A 5KOWA 4L0WA 3WT2A 2X64A 4JBBA 4KE3A 2LEGA 1USBA 1K0MA 3ZYWA 4L0UA 2R3XA 1DSBA 1ABAA 1PA3A 5EY6A 4DSQA 4NPBA 4PUAA 2Z9SA 2FLSA 1RQMA 1TP9A 3FZ9A 2DBCA 1G0TA 2CAQA 2CVKA 4HZ2A 3G9BA 3I9V2 1PKWA 4Z2RA 1XVWA 3DMLA 2NBSA 1A8LA 1TRUA 4BWSA 4TOPA 2AAWA 1TKDB 1GSUA 5A4VA 1IYHA 2VLVA 3D4TA 1AW9A 1NM3A 2O85A 3HJOA 4ECJA 4KCAA 3IV4A 5J41A 1SK0A 2GLRA 2MMOA 2EIQA 4KGIA 5D9TA 1EP7A 1E2YA 5IQYA 2C0EA 1VF3A 3DWVA 1G6YA 1XWBA 3L4NA 3DRNA 1U3AA 3HCZA 4L8EA 5ID2B 3MYDA 5DQSA 4GQCA 3TJJA 3KP9A 2XC2A 5H5SA 2YV7A 2LSTA 1XOBA 5IMZA 2FHEA 4O5UA 2GSQA 1QGVA 4JE1A 1ZL9A 3UEMA 3FR6A 4EVMA 5BMUA 3CRTA 12GSA 4EIPA 3VURA 3A2XA 3F6DA 2CZ2A 4YH2A 2H76A 1X5EA 3O3TA 1S3AA 2WFCA 1ERTA 5IOWA 2FWEA 4V2MA 1FOHA 3EURA 1M0UA 3O6TA 5AGYA 2GSTA 1MD4A 4EE0A 4NHWA 2NPBA 2WDUA 1SL1B 5D93A 1F9MA 2H1DA 3HA9A 1K0CA 5H5QA 4IHUA 4ZBBA 1A0FA 2R0CA 3A5IA 2EC4A 3CSHA 4OFMA 3MIXA 5FHIA 2N5AA 1VF1A 1BAYA 1O81A 1ZYQB 1O7UA 4FYBA 2K9FA 2L4CA 5IPHA 3QD9A 2LRTA 5F05A 2K6VA 2LTKA 4E8EA 2WZ9A 2IMEA 1YJ6A 1K3OA 1VF4A 13GSA 2FCHA 3ZREA 4N30A 3GMFA 1AIUA 3TJFA 2I3YA 3H8QA 4J56E 2YZUA 2X49A 4PURA 3TUEA 2TRCP 3QOUA 3ZRDA 2P5RA 5G5FA 6GSXA 5HQPA 4Z2TA 1Q98A 2R4VA 3IAS2 3AY8A 1FOVA 3EINA 3VPQA 1GSEA 5CRWA 3EYTA 4IELA 2VIMA 3MAKA 1GLPA 2HRAA 2I9HA 1SYXA 2FY6A 2UZ8A 4DSSB 18GSA 1EEJA 3KCMA 2C3TA 3KMNA 3EE2A 4Z2UA 4BWQA 1ERWA 2DIZA 3GSSA 4I8BA 3HVSA 1V40A 2YJ7A 3A2VA 3LEFA 1YF0A 3D5JA 3TKQA 4FQUA 1B9XC 3IAM2 2OE0A 1ACVA 1FVKA 1AXDA 4ZILA 2LS5A 2DJ0A 5ECHB 2MMZA 1PN0A 4IQAA 2C3NA 2XBIA 3F3QA 4MA9A 3A2WA 2PUKC 1XOAA 3M0FA 1ML6A 1TXXA 3FKFA 2ES7A 1QMVA 4G10A 4BL7A 3V1WA 3IC8A 3APSA 3G7YA 2YP6A 1ZGNA 5HR2A 2A2PA 2M80A 3ZTLA 3EWLA 5ECIB 4MZCA 4P3YB 2IMDA 1ZOFA 3EVIA 2CV4A 3UVHA 3W6GA 4K0NA 4HOJA 1TRSA 3GYKA 2LNSA 1OKDA 3E9JB 5GAND 3TB2A 4GLTA 5G31A 2QC7A 1J9BA 2VL3A 5KN3A 4I6XA 3LFLA 3VWWA 4GWRA 4IGJA 2DLXA 4IP6A 2LRNA 3KP8A 5IMCA 2XHFA 4OCFA 3P2AA 1W89A 4NV5A 3UBLA 1MDJA 2A2SA 1Z7RA 3IK7A 2ON5A 3RPNA 2L6CA 3D21A 1PMTA 2B1KA 2CT6A 3F0IA 1XWAA 4TRXA 4BL7B 2GQKA 4N0VA 4TXVA 3UMAA 2O8VB 2DJ2A 2HZFA 2GT5A 3GNJA 4V1Ag 3ERWA 3F4SA 1WJKA 4GSTA 4XHMA 2H1GA 4EKZA 1OAZA 1TK8B 2QSIA 3HJMA 2BMXA 4ML1A 3C1RA 1SL2B 1JFUA 3PR8A 2OE3A 1GSDA 1QFNA 1TI3A 4POBA 2H1BA 5D96A 6GSSA 1B9YC 1LBKA 1V57A 1SKSB 4HJMA 1U6TA 1XWCA 4NXIA 3GKNA 1FB6A 2IMIA 3ZVJD 2I4AA 5FWGA 2M72A 2CQ9A 4WKWA 4BVYB 1MDKA 1KEBA 2CZ3A 2J9HA 1TK5B 1OKTA 4EDZA 2GTUA 2PN8A 4TR1A 5HR1A 4V2LA 4KDXA 2O7KA 2V1MA 1BX9A 2GVPA 4KDUA 1S3CA 4F9ZA 2G2QA 4FYCA 4ULXA 1TK0B 1YEPA 1SKRB 1R4WA 3MSZA 5D73A 4K2DA 2R0GA 3GH6A 3CSJA 2H8LA 4MJCA 2PVOC 2AV4A 3R3EA 3RPPA 2JU5A 3R2QA 2H6ZA 1AC1A 1M99A 2WULA 2R2JA 3KTLA 3PH9A 3E0UA 2OA7A 2IFQA 2WB9A 4V2NA 2C4JA 1MDIA 4YKGA 3I6AA 2H75A 1B48A 3TJBA 3ME7A 1T4ZA 4TR3A 2FA8A 5DJMA 3UL3A 4F82A 4MCUA 1DE1A 3WGEA 1KNGA 1SJIA 1BQ7A 1WOUA 4TR1B 4GXZA 3CRUA 4L5LA 6GSWA 4TW5A 3I69A 5JCUA 2VL2C 5CNWA 3WYWA 1THOA 2IL3A 2YCDA 4LMWA 2WGRA 1V58A 4WEYA 3H1NA 1WMJA 1GWCA 1XCCA 3CXGA 4I2UA 4K1FA 3Q18A 2KP2A 2GQLA 2F9SA 4PX1A 1B8XA 5A4WA 1KTEA 3US3A 3ZIVA 4Q5RA 4XIHA 4ACSA 4LL1B 20GSA 4Q5QA 2H0GA 5DDLA 2E2MA 4K5SA 4POMA 1Z5YE 4RQXA 4EIQA 1XW9A 3QFAC 2XBQA 4G0LA 1GTIA 4XS4B 4ZL7A 2H01A 1TJDA 4X0XA 3LWAA 4I2TA 1SK1A 4K0GA 4N11A 3BBYA 2FGXA 2QA1A 3D22A 4LA1A 3C7MA 5DJLA 2M46A 3W8SA 5J5NA 2J23A 4G0KA 5ID2A 1GLQA 4HEA2 3GX0A 5IMDA 4EO3A 1ZYNA 2L57A 2FWGA 3FHKA 2A4HA 1M2AA 2P0GA 4Q5FA 1H4OA 2RIIA 4IVFA 2KP1A 4TR4A 4FH8A 3SWLA 1PSQA 1S3DA 4LMVA 1MD3A 4QQ7A 2DC5A 1Z3EA 3EC3A 2RM6A 1WRYA 5EPFA 3TRPA 5HR3A 4G9HA 1XWKA 2LKUA 2OBIA 4DVCA 4MDCA 4IP1A 4EXJA 4IJIA 2B5YA 2GSSA 4MP4A 2VOCA 4BVXA 1XVQA 1EV9A 3LW9A 5D9VA 2DKIA 3EMPA 4XS1A 4ZL8A 4PNGA 4ILFA 4HUAA 2HNLA 3VWUA 1B4QA 3QFBC 1ZCPA 1T00A 1GL8A 3L9VA 1GTBA 2HSYA 2KLXA 4KAEA 1GNEA 2FD3A 1WIKA 4ECIA 4ID0A 2REMA 5CREA 2WCIA 3TJKA 1UC7A 5JCWA 3EPTA 1Q4JA 2H6XA 11GSA 2VCWA 4ECCA 2MBSA 1HNBA 1V2AA 1OC3A 3ZMKA 2H1AA 2B6MA 2C8UA 2YWIA 2ALBA 5JCGA 2L5LA 5ECOB 2X4AA 2OACA 1PQNA 2DJJA 3H93A 5E59A 1WE0A 1C72A 4EL1A 6GSYA 1GNWA 2FWHA 2JZTA 4BVXB 2CA8A 5EL8A 1R5AA 1U87A 3ZLPA 2BTOT 3HDCA 4Q5NA 1FHEA 2GZYA 2HXKA 3GIXA 4DSSA 3HY2A 4TVEA 3HD5A 3NIVA 5HFKA 1JZRA 4MJBA 4HJ2A 3L78A 3TRXA 4HU7A 1M9BA 3D0ZA 5A5KA 2VAFA 2QA2A 3LORA 4ZB9A 4MH3A 4GRFA 1DUGA 1QXHA 5GSTA 1QK8A 3C71A 2LNTA 1EEMA 4NV2A 1PKZA 1RK4A 1JZOA 2PMTA 3BOAA 1FO5A 5ECKB 3C73A 3C8EA 5KOXA 1T1VA 1EGOA 5G1LA 3LXZA 1ERUA 5JWQB 3KM6A 3E3EA 1R26A 1JZDA 3ERFA 4FO5A 3GTUB 3TKSA 4K7IA 1Z7PA 5L71A 2LV3A 4MJEA 4MABA 1M9AA 3IPZA 4O92A 4K7OA 1OE8A 3FR3A 2YZHA 5KN0A 1PN9A 2H30A 1PX7A 2JADA 1VRSD 5DBQA 2HFDA 1EOHA 5ECPB 4F0CA 3DKSA 1YF1A 1MEKA 1XFLA 2B7JA 2C1YA 1VGLA 3FRCA 6GSUA 3PPUA 1TRWA 3EU4A 3IK9A 1HNAA 4KW6A 4EF0A 1N8JA 3F6FA 2JZRA 5CRDA 3WD6A 2KHPA 3IA1A 1PD21 3W8JA 2VD1A 2QGVA 3HZ8A 4KSMA 2PWJA 2MZCA 3TKPA 6GSTA 4PNFA 4G0IA 4X1UA 1AQXA 1GSFA 3HKRA 1T7PB 3CBUA 2AJQB 1XIYA 2MMNA 3KD0A 4PXOA 2YN1A 2C80A 2GGTA 2FUG2 5ELGA 2QKEA 3F4TA 2YNXA 3ZITA 4MF7A 5AIVA 4KH7A 4MZBA 3N5OA 2RUFA 3QDNA 1V9WA 4PTSA 1FVJA 3IRAA 2LRCA 4XRDA 2OE1A 3IBHA 2K18A 4MH2A 1SK2A 2B7KA 2HRNA 1TDIA 4WR5A 5AISA 2VM2A 2C0GA 3QR6A 4O7HA 3VK9A 3M3MA 2VCZA 1K0BA 2H0HA 3ZL5A 1XPVA 4OO5A 3F3RA 4GTUA 1JLVA 5F07A 4OD7A 3ZVJA 4QL9A 1X9WB 3L0HA 4TN8A 2H71A 4BVYA 2LJKA 4V1Ap 1T4YA 3QAGA 4K9ZA 2IMFA 4G2EA 3KH7A 1BJXA 1I5GA 4ISDA 5ENUA 4MMMA 3HZ4A 1YDKA 1K0AA 3DEXA 1BG5A 1SL0B 3ZIJA 3LQ7A 4F0BA 4JZQA 1ZMAA 4YQUA 3FK8A 4RQRA 2PPTA 1ZZYA 4AJ7A 5ECNB 3F63A 3ME8A 5IO0A 3LJRA 2EIRA 2WJUA 4NMUA 2O89A 2ZUPA 5B7CA 4IJ3A 2VCTA 3KJYA 5AN1A 3D4MA 2DJKA 2MMAA 3ED3A 4HI7A 5LD0A 3IDVA 2MYGA 2OADA 1F37A 4WF5A 4XTSA 3KIJA 2CVDA 3QPMA 2C0DA 2H66A 1XXUA 1A2JA 4OWYA 3IE3A 1NHOA 3CTFA 1EZKA 5C00A 4AF2A 1LJRA 1NW2A 3ZFLA 5ECRB 2G0FA 3RHBA 1O85A 2V2GA 2PU9C 2CX3A 4IQ1A 4CHSA 2X8CA 2E0QA 2L59A 2YV9A 2GZPA 2H0IA 2TRXA 1WP0A 3BCKA 5A4UA 3WGDA 1A8YA 4KF9A 4HDEA 1A2LA 1PGTA 2AHEA 3SBCA 5KN2A 1OVNA 3H4KA 1YKCA 2F8FA 4WXTA 4CY6A 1M7TA 3MWHA 1OE7A 3H79A 1EGRA 2X99A 2C3QA 2F8AA 5D8IA 5IMFA 4DSRA 1F6MC 4QL7A 1T3BA 3WT1A 3LXTA 4JRRA 5IMAA 3TKRA 1GTUA 2HZEA 4XS4A 2H74A 1GSSA 3TGZA 5ECQB 4GF0A 4X43A 4MLYA 4IKHA 1SYRA 1A23A 2H72A 2YJHA 3FEUA 5FT3A 4CY8A 1FAAA 5KEJA 3FY7A 2NTOA 1CQHA 3OR5A 2V6OA 2WS2A 19GSA 3CTGA 4NAXA 2GS3A 1JZWA 2HSHA 1F3AA 3FZ5A 2N5FA 4MZWA 1YQ1A 3FW2A 2A4VA 4FIWA 4OFNA 4K8MA 2K8SA 2HYXA 4MJAA 4K5RA 1R5PA 2DSAA 3Q19A 5B6MA 5ECLB 5GSSA 1PRXA 2CX4A 1SENA 9GSSA 5IMVA 3O76A 2HRFA 3UIWA 5EVOA 3FMWA 4IN0A 2NDOA 4MNNA 3GKXA 1THXA 2RM5A 3U6VA 2FNOA 2RUEA 5AIXA 2DMLA 5CP1A 2HZEB 4ZBAA 1FB0A 4AJ8A 5HR0A 1Z9HA 2H19A 3GA4A 1DE2A 3CSIA 2YPMA 4N0ZA 1ST9A 3VWXA 3RBTA 1O6JA 3RHCA 4MK3A 1HYUA 2V6KA 3G7JA 5DCGA 3GSTA 2R5GA 1W4VA 4IW9A 4WETA 4JR6A 3EMXA 1LU4A 2DIYA 2VM1A 1K0OA 2CAIA 4E8HA 10GSA 5F06A 3HVXA 2B1LA 3ZMLA 1TRVA 4ZB6A 2TIRA 3UAPA 1I9DA 3L9SA 5ECSA 4WBJA 3L9UA 2IPAA 3MDKA 3LGCA 1RW1A 1M2BA 3DVXA 2FA4A 4ZXGA 1GUHA 1FW1A 3DIEA 1DBYA 5G5EA 2V32A 5J4UA 4AJ6A 4AGSA 2L5OA 4OO4A 2AUVA 2DKHA 3D6IA 1J0FA 3VFIA 1KBNA 2VLUA 1SKWB 4L5OA 1EOGA 1F2EA 4WR4A 1TTZA 3BD2A 3GUSA 1EV4A 3GL3A 2PERA 5KN1A 2K8VA 1AQVA 1URMA 4F03A 2LUSA 2X8HA 4KCEA 3C1SA 4D73B 2I1UA 2DJ1A 2DMMA 1O73A 2HE3A 4BPYA 4KSOA 3CMIA 5CAXA 5J9CA 2VCQA 3A5WA 5G2ZA 5F0GA 3GTUA 2KUCA 1SU9A 4YQVA 4JEDA 4MF6A 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBT A;  1MTC A;  3APQ A;  2F3M A;  4DEJ A;  1GH2 A;  2IN3 A;  2HLS A;  4GCI A;  3ERG A;  1FG4 A;  2BJX A;  5IIZ A;  3F9U A;  5DCH A;  3VI5 A;  1SD8 A;  1K0N A;  2L6D A;  3QAW A;  4GSS A;  2ZNM A;  4ZBD A;  5DAL A;  5G1K A;  3IHQ A;  3GL5 A;  3MNG A;  4O32 A;  1JLW A;  5E4W A;  1X0R A;  4KB3 A;  2JL4 A;  1K0D A;  2I81 A;  2GSR A;  2DJ3 A;  7GSS A;  2EIO A;  2C0F A;  1H75 A;  1OC9 A;  4XCS A;  3UVT A;  4PQH A;  4NWY A;  2OKA A;  1J08 A;  4K7N A;  3RAZ A;  1XWG A;  3M9K A;  1TI1 A;  1TU8 A;  3TOU A;  4OMV A;  1WPI A;  1YZX A;  5ECM B;  4OFT A;  3IXR A;  5ABR A;  2YWN A;  2A2R A;  1V98 A;  1F3B A;  2PGT A;  1X9S B;  17GS A;  1GP1 A;  4XS6 A;  1EWX A;  3GH9 A;  2YWO A;  5DAK A;  4EUY A;  5DQY A;  2H70 A;  1YEX A;  2VCX A;  3DYR A;  4CW9 A;  2E2G A;  2OBK A;  3CYN A;  3HXS A;  5J3R A;  8GSS A;  4GQF A;  3IOS A;  2RLI A;  2XPD A;  3GN3 A;  4IS0 A;  1ZYE A;  5DAL B;  5IO2 A;  2PVQ A;  4MPF A;  1UA5 A;  4KA0 A;  2LQO A;  3IC4 A;  5CRG A;  3M9J A;  4WF4 A;  5B8A A;  3KMO A;  4MPG A;  4EDY A;  2KOK A;  2CVB A;  2IMK A;  2R6K A;  3FR9 A;  2GT6 A;  3P7X A;  3F8U A;  4KND A;  1UVZ A;  3ISO A;  1G7O A;  3EU3 A;  1NHY A;  1OC9 B;  3F4R A;  4JU5 A;  4RI7 A;  1GTA A;  5CYY A;  1GSQ A;  3LYK A;  3ZFB A;  2HI7 A;  1SJ6 A;  2JZS A;  2X8G A;  3LG6 A;  3FYG A;  3M1G A;  2VL2 A;  2ON7 A;  2IJY A;  3P8W A;  1B4P A;  1Z6M A;  1AQW A;  3PGT A;  2F51 A;  3UBK A;  3IR4 A;  3TJG A;  2JAC A;  1OYJ A;  3HYP A;  1X5D A;  5DAK B;  1G6W A;  5INY A;  2JSZ A;  2IWT A;  1QUW A;  3J7Y k;  2IIY A;  3KXO A;  1XBS A;  1GUM A;  3UOM A;  1IYI A;  2P31 A;  1BED A;  2OJL A;  2YWM A;  5ELA A;  1AUC A;  1M2D A;  5D9X A;  4WBR D;  1XZO A;  3TDG A;  3VPT A;  2XPE A;  2HT9 A;  3KGK A;  5LCZ A;  1CQG A;  5C04 A;  3APO A;  4HS1 A;  5IPG A;  3M8N A;  3GKM A;  4MF5 A;  1OC8 A;  1PX6 A;  4YAV A;  5CRH A;  2VCV A;  3TOT A;  4KDY A;  3NOF A;  4KUN A;  3K8N A;  1YKA A;  3U5R E;  1PL1 A;  2GDR A;  2B3S A;  5IM9 A;  4Z7X A;  3BCI A;  5H5R A;  5IOX A;  1Y25 A;  2VO4 A;  3DVW A;  2YOI A;  3GUR A;  2D2Z A;  4HZ4 A;  5DVB A;  3N9J A;  1T8E B;  2B5E A;  4LLR A;  4NHZ A;  4OCE A;  4ZIJ A;  5COH A;  3S9F A;  5F8B A;  4KX4 A;  1X5C A;  1ILO A;  2GQM A;  5D9W A;  3RDW A;  1N2A A;  1O8X A;  4IBP A;  3NZN A;  4TR0 A;  5CO3 A;  1GUL A;  2AYT A;  2H6Y A;  5B8B A;  3GRX A;  3TCO A;  2YAN A;  6GSV A;  4TKY A;  1HQO A;  1XW6 A;  4CDO A;  3TRQ A;  5HFG A;  2N5B A;  4JR4 A;  4ECB A;  3VWV A;  2LJR A;  1SJZ A;  2FWF A;  2VD0 A;  3GFK A;  3GKK A;  1BYE A;  4ZB8 A;  3PIN A;  2PBJ A;  1SD9 A;  1Y6E A;  1A0R P;  3FZ4 A;  4RUV A;  1A24 A;  3LYP A;  4PUF C;  5GAP D;  2P5Q A;  1VF2 A;  4POL A;  3JCM L;  1AAZ A;  3BJ5 A;  3KTB A;  1E6B A;  2WRT A;  4N10 A;  4F2I A;  3FZA A;  3TKS C;  5JWR B;  3VLN A;  4FYU A;  3G7I A;  3VI7 A;  3HHV A;  2ZCT A;  3GHA A;  3DGQ A;  1NSW A;  1UN2 A;  2VLT A;  3LSZ A;  1U3I A;  2JSY A;  5JWO B;  2NVL A;  4XRA A;  5G30 A;  4YAP A;  3QCP A;  3DD3 A;  1Z6N A;  3WGX A;  4GSN A;  2O87 A;  4J2F A;  3UAR A;  3HJP A;  2E7P A;  1GUK A;  5GZZ B;  2H73 A;  2VL9 A;  3Q6O A;  4O5R A;  3QMX A;  4BA7 A;  3I43 A;  1TU7 A;  4PQI A;  4LL4 B;  3QAV A;  2LJA A;  4I5Q A;  1TOF A;  3P90 A;  1HD2 A;  1K3L A;  1PL2 A;  4TXO A;  3HVV A;  22GS A;  1HNC A;  1A2M A;  3KEB A;  5LNK e;  5B6N A;  5HFI A;  1EP8 A;  3TKS E;  3DXB A;  1K3Y A;  4ZL9 A;  3J7Y b;  1YY7 A;  1ERV A;  2L4Q A;  1WWJ A;  3KZQ A;  4J57 E;  16GS A;  4POK A;  1GSY A;  4PGT A;  2LQQ A;  1QQ2 A;  3ZZX A;  1GRX A;  3A3T A;  1G7E A;  3GX8 A;  3GV1 A;  3KH9 A;  4YQM A;  1ON4 A;  2V41 A;  2AB6 A;  4K6X A;  2B5X A;  4PQ1 A;  5J9B A;  4HU9 A;  1O8W A;  4HQS A;  14GS A;  4I97 A;  3Q74 A;  4ML6 A;  3UJ1 A;  4RI6 A;  4H86 A;  1JHB A;  2GZZ A;  4EC0 A;  2IFQ B;  4HQZ A;  2R37 A;  2VUP A;  1R7H A;  1U88 A;  1X9M B;  1TW9 A;  4G19 A;  4D73 A;  4TXO B;  1XW5 A;  4L0W A;  3WT2 A;  2X64 A;  4JBB A;  4KE3 A;  2LEG A;  1USB A;  1K0M A;  3ZYW A;  4L0U A;  2R3X A;  1DSB A;  1ABA A;  1PA3 A;  5EY6 A;  4DSQ A;  4NPB A;  4PUA A;  2Z9S A;  2FLS A;  1RQM A;  1TP9 A;  3FZ9 A;  2DBC A;  1G0T A;  2CAQ A;  2CVK A;  4HZ2 A;  3G9B A;  3I9V 2;  1PKW A;  1XVW A;  3DML A;  2NBS A;  1A8L A;  1TRU A;  4BWS A;  4TOP A;  2AAW A;  1TKD B;  1GSU A;  5A4V A;  1IYH A;  2VLV A;  3D4T A;  1AW9 A;  1NM3 A;  2O85 A;  3HJO A;  4ECJ A;  4KCA A;  3IV4 A;  5J41 A;  1SK0 A;  2GLR A;  2MMO A;  2EIQ A;  4KGI A;  5D9T A;  1EP7 A;  1E2Y A;  5IQY A;  2C0E A;  1VF3 A;  3DWV A;  1G6Y A;  1XWB A;  3L4N A;  3DRN A;  1U3A A;  3HCZ A;  4L8E A;  5ID2 B;  5DQS A;  4GQC A;  3TJJ A;  3KP9 A;  2XC2 A;  5H5S A;  2YV7 A;  2LST A;  1XOB A;  5IMZ A;  2FHE A;  2GSQ A;  1QGV A;  4JE1 A;  1ZL9 A;  3UEM A;  3FR6 A;  4EVM A;  3CRT A;  12GS A;  3VUR A;  3A2X A;  3F6D A;  2CZ2 A;  4YH2 A;  2H76 A;  1X5E A;  3O3T A;  1S3A A;  2WFC A;  1ERT A;  5IOW A;  2FWE A;  4V2M A;  3EUR A;  1M0U A;  3O6T A;  5AGY A;  2GST A;  1MD4 A;  4EE0 A;  4NHW A;  2NPB A;  2WDU A;  1SL1 B;  5D93 A;  1F9M A;  2H1D A;  3HA9 A;  1K0C A;  5H5Q A;  4IHU A;  4ZBB A;  1A0F A;  4OFM A;  2EC4 A;  3CSH A;  5FHI A;  2N5A A;  1VF1 A;  1BAY A;  1O81 A;  1ZYQ B;  1O7U A;  4FYB A;  2K9F A;  2L4C A;  5IPH A;  3QD9 A;  2LRT A;  5F05 A;  2K6V A;  2LTK A;  4E8E A;  2WZ9 A;  2IME A;  1YJ6 A;  1K3O A;  1VF4 A;  13GS A;  2FCH A;  3ZRE A;  4N30 A;  3GMF A;  1AIU A;  3TJF A;  2I3Y A;  3H8Q A;  4J56 E;  2YZU A;  4PUR A;  3TUE A;  2TRC P;  3QOU A;  3ZRD A;  2P5R A;  5G5F A;  6GSX A;  5HQP A;  1Q98 A;  2R4V A;  3IAS 2;  3AY8 A;  1FOV A;  3EIN A;  3VPQ A;  1GSE A;  5CRW A;  3EYT A;  4IEL A;  2VIM A;  3MAK A;  1GLP A;  2I9H A;  1SYX A;  2FY6 A;  4DSS B;  18GS A;  1EEJ A;  3KCM A;  2C3T A;  3KMN A;  3EE2 A;  4BWQ A;  1ERW A;  2DIZ A;  3GSS A;  4I8B A;  3HVS A;  1V40 A;  2YJ7 A;  3A2V A;  3LEF A;  1YF0 A;  3D5J A;  3TKQ A;  1B9X C;  3IAM 2;  2OE0 A;  1ACV A;  1FVK A;  1AXD A;  4ZIL A;  2LS5 A;  2DJ0 A;  5ECH B;  2MMZ A;  4IQA A;  2C3N A;  2XBI A;  3F3Q A;  4MA9 A;  3A2W A;  2PUK C;  1XOA A;  3M0F A;  1ML6 A;  1TXX A;  3FKF A;  2ES7 A;  1QMV A;  4G10 A;  4BL7 A;  3V1W A;  3APS A;  3G7Y A;  2YP6 A;  1ZGN A;  5HR2 A;  2M80 A;  3ZTL A;  3EWL A;  5ECI B;  4MZC A;  4P3Y B;  2IMD A;  1ZOF A;  3EVI A;  2CV4 A;  3UVH A;  3W6G A;  4K0N A;  4HOJ A;  1TRS A;  3GYK A;  2LNS A;  1OKD A;  3E9J B;  5GAN D;  3TB2 A;  4GLT A;  5G31 A;  2QC7 A;  1J9B A;  2VL3 A;  5KN3 A;  4I6X A;  3LFL A;  3VWW A;  4GWR A;  4IGJ A;  2DLX A;  4IP6 A;  2LRN A;  3KP8 A;  5IMC A;  2XHF A;  4OCF A;  3P2A A;  1W89 A;  4NV5 A;  3UBL A;  1MDJ A;  2A2S A;  1Z7R A;  3IK7 A;  2ON5 A;  3RPN A;  2L6C A;  3D21 A;  1PMT A;  2B1K A;  2CT6 A;  3F0I A;  1XWA A;  4TRX A;  2GQK A;  4N0V A;  4TXV A;  3UMA A;  2O8V B;  2DJ2 A;  2HZF A;  2GT5 A;  3GNJ A;  4V1A g;  3ERW A;  3F4S A;  1WJK A;  4GST A;  4XHM A;  2H1G A;  4EKZ A;  1OAZ A;  1TK8 B;  2QSI A;  3HJM A;  2BMX A;  4ML1 A;  3C1R A;  1SL2 B;  1JFU A;  3PR8 A;  2OE3 A;  1GSD A;  1QFN A;  1TI3 A;  4POB A;  2H1B A;  5D96 A;  6GSS A;  1B9Y C;  1LBK A;  1V57 A;  1SKS B;  4HJM A;  1U6T A;  1XWC A;  4NXI A;  3GKN A;  1FB6 A;  2IMI A;  3ZVJ D;  2I4A A;  5FWG A;  2M72 A;  2CQ9 A;  4WKW A;  1MDK A;  1KEB A;  2CZ3 A;  2J9H A;  1TK5 B;  1OKT A;  4EDZ A;  2GTU A;  2PN8 A;  4TR1 A;  5HR1 A;  4V2L A;  4KDX A;  2O7K A;  2V1M A;  1BX9 A;  2GVP A;  4KDU A;  1S3C A;  4F9Z A;  2G2Q A;  4FYC A;  4ULX A;  1TK0 B;  1YEP A;  1SKR B;  1R4W A;  3MSZ A;  5D73 A;  4K2D A;  3GH6 A;  3CSJ A;  2H8L A;  4MJC A;  2PVO C;  2AV4 A;  3RPP A;  2JU5 A;  3R2Q A;  2H6Z A;  1AC1 A;  1M99 A;  2WUL A;  2R2J A;  3KTL A;  3PH9 A;  3E0U A;  2OA7 A;  2IFQ A;  2WB9 A;  4V2N A;  2C4J A;  1MDI A;  3I6A A;  2H75 A;  1B48 A;  3TJB A;  3ME7 A;  1T4Z A;  4TR3 A;  2FA8 A;  5DJM A;  3UL3 A;  4F82 A;  4MCU A;  1DE1 A;  3WGE A;  1KNG A;  1SJI A;  1BQ7 A;  1WOU A;  4TR1 B;  4GXZ A;  3CRU A;  4L5L A;  6GSW A;  4TW5 A;  3I69 A;  5JCU A;  2VL2 C;  5CNW A;  3WYW A;  1THO A;  2IL3 A;  2YCD A;  4LMW A;  2WGR A;  1V58 A;  4WEY A;  3H1N A;  1WMJ A;  1GWC A;  1XCC A;  3CXG A;  4I2U A;  4K1F A;  3Q18 A;  2KP2 A;  2GQL A;  2F9S A;  4PX1 A;  1B8X A;  5A4W A;  1KTE A;  3US3 A;  3ZIV A;  4Q5R A;  4XIH A;  4ACS A;  4LL1 B;  20GS A;  4Q5Q A;  2H0G A;  5DDL A;  2E2M A;  4POM A;  1Z5Y E;  4RQX A;  1XW9 A;  3QFA C;  2XBQ A;  1GTI A;  4XS4 B;  4ZL7 A;  2H01 A;  1TJD A;  4X0X A;  3LWA A;  4I2T A;  1SK1 A;  4K0G A;  4N11 A;  3BBY A;  2FGX A;  3D22 A;  4LA1 A;  3C7M A;  5DJL A;  2M46 A;  3W8S A;  5J5N A;  2J23 A;  5ID2 A;  1GLQ A;  4HEA 2;  3GX0 A;  5IMD A;  4EO3 A;  2L57 A;  2FWG A;  3FHK A;  1M2A A;  2P0G A;  4Q5F A;  1H4O A;  2RII A;  4IVF A;  2KP1 A;  4TR4 A;  4FH8 A;  3SWL A;  1PSQ A;  1S3D A;  4LMV A;  1MD3 A;  4QQ7 A;  2DC5 A;  1Z3E A;  3EC3 A;  2RM6 A;  1WRY A;  5EPF A;  3TRP A;  5HR3 A;  4G9H A;  1XWK A;  2LKU A;  2OBI A;  4DVC A;  4MDC A;  4IP1 A;  4EXJ A;  4IJI A;  2B5Y A;  2GSS A;  4MP4 A;  2VOC A;  4BVX A;  1XVQ A;  1EV9 A;  5D9V A;  3EMP A;  4XS1 A;  4ZL8 A;  4PNG A;  4ILF A;  4HUA A;  2HNL A;  3VWU A;  1B4Q A;  3QFB C;  1ZCP A;  1T00 A;  1GL8 A;  3L9V A;  1GTB A;  2HSY A;  2KLX A;  4KAE A;  1GNE A;  2FD3 A;  1WIK A;  4ECI A;  4ID0 A;  2REM A;  5CRE A;  2WCI A;  3TJK A;  1UC7 A;  5JCW A;  1Q4J A;  2H6X A;  11GS A;  2VCW A;  4ECC A;  2MBS A;  1HNB A;  1V2A A;  1OC3 A;  3ZMK A;  2H1A A;  2B6M A;  2C8U A;  2YWI A;  2ALB A;  5JCG A;  2L5L A;  5ECO B;  2OAC A;  1PQN A;  2DJJ A;  3H93 A;  5E59 A;  1WE0 A;  1C72 A;  4EL1 A;  6GSY A;  1GNW A;  2FWH A;  2JZT A;  2CA8 A;  5EL8 A;  1R5A A;  1U87 A;  3ZLP A;  2BTO T;  3HDC A;  4Q5N A;  1FHE A;  2GZY A;  2HXK A;  3GIX A;  4DSS A;  3HY2 A;  4TVE A;  3HD5 A;  3NIV A;  5HFK A;  1JZR A;  4MJB A;  4HJ2 A;  3L78 A;  3TRX A;  4HU7 A;  1M9B A;  3D0Z A;  5A5K A;  2VAF A;  3LOR A;  4ZB9 A;  4MH3 A;  4GRF A;  1DUG A;  1QXH A;  5GST A;  1QK8 A;  3C71 A;  2LNT A;  1EEM A;  4NV2 A;  1PKZ A;  1RK4 A;  1JZO A;  2PMT A;  3BOA A;  1FO5 A;  5ECK B;  3C73 A;  3C8E A;  1EGO A;  1T1V A;  5G1L A;  3LXZ A;  1ERU A;  5JWQ B;  3KM6 A;  3E3E A;  1R26 A;  1JZD A;  3ERF A;  4FO5 A;  3GTU B;  3TKS A;  4K7I A;  1Z7P A;  5L71 A;  2LV3 A;  4MJE A;  4MAB A;  1M9A A;  3IPZ A;  4O92 A;  4K7O A;  1OE8 A;  3FR3 A;  2YZH A;  5KN0 A;  1PN9 A;  2H30 A;  1PX7 A;  2JAD A;  1VRS D;  5DBQ A;  2HFD A;  1EOH A;  5ECP B;  4F0C A;  3DKS A;  1YF1 A;  1MEK A;  1XFL A;  2B7J A;  2C1Y A;  1VGL A;  3FRC A;  6GSU A;  1TRW A;  3EU4 A;  3IK9 A;  1HNA A;  4KW6 A;  4EF0 A;  1N8J A;  3F6F A;  2JZR A;  5CRD A;  3WD6 A;  2KHP A;  3IA1 A;  1PD2 1;  3W8J A;  2VD1 A;  2QGV A;  3HZ8 A;  4KSM A;  2PWJ A;  2MZC A;  3TKP A;  6GST A;  4PNF A;  4X1U A;  1AQX A;  1GSF A;  3HKR A;  1T7P B;  3CBU A;  2AJQ B;  1XIY A;  2MMN A;  3KD0 A;  4PXO A;  2YN1 A;  2C80 A;  2GGT A;  2FUG 2;  5ELG A;  2QKE A;  3F4T A;  2YNX A;  3ZIT A;  4MF7 A;  5AIV A;  4KH7 A;  4MZB A;  3N5O A;  2RUF A;  3QDN A;  1V9W A;  1FVJ A;  3IRA A;  2LRC A;  4XRD A;  2OE1 A;  3IBH A;  2K18 A;  4MH2 A;  1SK2 A;  2B7K A;  2HRN A;  1TDI A;  4WR5 A;  5AIS A;  2VM2 A;  2C0G A;  3QR6 A;  4O7H A;  3VK9 A;  3M3M A;  2VCZ A;  1K0B A;  2H0H A;  3ZL5 A;  1XPV A;  4OO5 A;  3F3R A;  4GTU A;  1JLV A;  5F07 A;  4OD7 A;  3ZVJ A;  4QL9 A;  1X9W B;  3L0H A;  4TN8 A;  2H71 A;  4BVY A;  2LJK A;  4V1A p;  1T4Y A;  3QAG A;  4K9Z A;  2IMF A;  4G2E A;  3KH7 A;  1BJX A;  1I5G A;  4ISD A;  5ENU A;  4MMM A;  3HZ4 A;  1YDK A;  1K0A A;  3DEX A;  1BG5 A;  1SL0 B;  3ZIJ A;  3LQ7 A;  4F0B A;  4JZQ A;  1ZMA A;  4YQU A;  3FK8 A;  4RQR A;  2PPT A;  1ZZY A;  4AJ7 A;  5ECN B;  3F63 A;  3ME8 A;  5IO0 A;  3LJR A;  2EIR A;  2WJU A;  4NMU A;  2O89 A;  2ZUP A;  5B7C A;  4IJ3 A;  2VCT A;  3KJY A;  5AN1 A;  3D4M A;  2DJK A;  2MMA A;  3ED3 A;  4HI7 A;  5LD0 A;  3IDV A;  2MYG A;  2OAD A;  1F37 A;  4WF5 A;  4XTS A;  3KIJ A;  2CVD A;  3QPM A;  2C0D A;  2H66 A;  1XXU A;  1A2J A;  4OWY A;  3IE3 A;  1NHO A;  3CTF A;  1EZK A;  5C00 A;  4AF2 A;  1LJR A;  1NW2 A;  3ZFL A;  5ECR B;  2G0F A;  3RHB A;  1O85 A;  2V2G A;  2PU9 C;  2CX3 A;  4IQ1 A;  4CHS A;  2X8C A;  2E0Q A;  2L59 A;  2YV9 A;  2GZP A;  2H0I A;  2TRX A;  1WP0 A;  3BCK A;  5A4U A;  3WGD A;  1A8Y A;  4HDE A;  1A2L A;  1PGT A;  2AHE A;  3SBC A;  5KN2 A;  1OVN A;  3H4K A;  1YKC A;  2F8F A;  4WXT A;  1M7T A;  3MWH A;  1OE7 A;  3H79 A;  1EGR A;  2X99 A;  2C3Q A;  2F8A A;  5D8I A;  5IMF A;  4DSR A;  1F6M C;  4QL7 A;  1T3B A;  3WT1 A;  3LXT A;  4JRR A;  5IMA A;  3TKR A;  1GTU A;  2HZE A;  4XS4 A;  2H74 A;  1GSS A;  3TGZ A;  5ECQ B;  4GF0 A;  4X43 A;  4MLY A;  4IKH A;  1SYR A;  1A23 A;  2H72 A;  2YJH A;  3FEU A;  5FT3 A;  5KEJ A;  1FAA A;  3FY7 A;  2NTO A;  1CQH A;  3OR5 A;  2V6O A;  2WS2 A;  19GS A;  3CTG A;  4NAX A;  2GS3 A;  1JZW A;  2HSH A;  1F3A A;  3FZ5 A;  2N5F A;  4MZW A;  1YQ1 A;  3FW2 A;  2A4V A;  4FIW A;  4OFN A;  4K8M A;  2K8S A;  2HYX A;  4MJA A;  1R5P A;  2DSA A;  3Q19 A;  5B6M A;  5ECL B;  5GSS A;  1PRX A;  2CX4 A;  1SEN A;  9GSS A;  5IMV A;  3O76 A;  2HRF A;  3UIW A;  5EVO A;  4IN0 A;  2NDO A;  3GKX A;  1THX A;  2RM5 A;  3U6V A;  2FNO A;  2RUE A;  5AIX A;  2DML A;  5CP1 A;  2HZE B;  4ZBA A;  1FB0 A;  4AJ8 A;  5HR0 A;  1Z9H A;  2H19 A;  3GA4 A;  1DE2 A;  3CSI A;  2YPM A;  4N0Z A;  1ST9 A;  3VWX A;  3RBT A;  1O6J A;  3RHC A;  4MK3 A;  1HYU A;  2V6K A;  3G7J A;  5DCG A;  3GST A;  2R5G A;  1W4V A;  4IW9 A;  4WET A;  4JR6 A;  3EMX A;  1LU4 A;  2DIY A;  2VM1 A;  1K0O A;  2CAI A;  4E8H A;  10GS A;  5F06 A;  3HVX A;  2B1L A;  3ZML A;  1TRV A;  4ZB6 A;  2TIR A;  3UAP A;  1I9D A;  3L9S A;  5ECS A;  4WBJ A;  3L9U A;  2IPA A;  3MDK A;  3LGC A;  1RW1 A;  1M2B A;  3DVX A;  2FA4 A;  4ZXG A;  1GUH A;  1FW1 A;  3DIE A;  1DBY A;  5G5E A;  2V32 A;  5J4U A;  4AJ6 A;  4AGS A;  2L5O A;  4OO4 A;  2AUV A;  3D6I A;  1J0F A;  3VFI A;  1KBN A;  2VLU A;  1SKW B;  4L5O A;  1EOG A;  1F2E A;  4WR4 A;  1TTZ A;  3BD2 A;  3GUS A;  1EV4 A;  3GL3 A;  2PER A;  5KN1 A;  2K8V A;  1AQV A;  1URM A;  4F03 A;  2LUS A;  2X8H A;  4KCE A;  3C1S A;  4D73 B;  2I1U A;  2DJ1 A;  2DMM A;  1O73 A;  2HE3 A;  4BPY A;  4KSO A;  3CMI A;  5CAX A;  5J9C A;  2VCQ A;  3A5W A;  5G2Z A;  5F0G A;  3GTU A;  2KUC A;  1SU9 A;  4YQV A;  4JED A;  4MF6 A; 
#chains in the Genus database with same CATH topology
 2MBT A;  1MTC A;  3APQ A;  2F3M A;  4DEJ A;  1GH2 A;  2IN3 A;  2HLS A;  4GCI A;  4ICY A;  3ERG A;  1FG4 A;  2BJX A;  5IIZ A;  3F9U A;  5DCH A;  3VI5 A;  1SD8 A;  1K0N A;  2L6D A;  3QAW A;  4GSS A;  2ZNM A;  4ZBD A;  5DAL A;  5G1K A;  3IHQ A;  3GL5 A;  3MNG A;  4O32 A;  1JLW A;  5E4W A;  1X0R A;  4KB3 A;  2JL4 A;  1K0D A;  2I81 A;  2GSR A;  2DJ3 A;  7GSS A;  2EIO A;  2C0F A;  1H75 A;  1OC9 A;  4XCS A;  3UVT A;  4X4J A;  4PQH A;  4NWY A;  2OKA A;  1J08 A;  4K7N A;  3RAZ A;  1XWG A;  3M9K A;  1TI1 A;  1TU8 A;  3TOU A;  4OMV A;  1WPI A;  1YZX A;  5ECM B;  4OFT A;  3IXR A;  5ABR A;  2YWN A;  2A2R A;  1V98 A;  1F3B A;  2PGT A;  1X9S B;  17GS A;  1GP1 A;  4XS6 A;  4USS A;  1EWX A;  3GH9 A;  2YWO A;  5DAK A;  4EUY A;  5DQY A;  2H70 A;  1YEX A;  2VCX A;  3DYR A;  4CW9 A;  2E2G A;  2OBK A;  3CYN A;  3HXS A;  5J3R A;  8GSS A;  4GQF A;  3IOS A;  2RLI A;  2XPD A;  3GN3 A;  4IS0 A;  1ZYE A;  5DAL B;  5IO2 A;  2PVQ A;  4MPF A;  1UA5 A;  4KA0 A;  5CRG A;  2LQO A;  3IC4 A;  2HRK A;  3M9J A;  4WF4 A;  5B8A A;  3KMO A;  4MPG A;  4EDY A;  2KOK A;  2CVB A;  2IMK A;  2R6K A;  3FR9 A;  2GT6 A;  3P7X A;  3F8U A;  4KND A;  1UVZ A;  3ISO A;  1G7O A;  3EU3 A;  1NHY A;  1OC9 B;  3F4R A;  4JU5 A;  4RI7 A;  1GTA A;  5CYY A;  1GSQ A;  3LYK A;  3ZFB A;  2HI7 A;  4K2X A;  1SJ6 A;  2JZS A;  2X8G A;  3LG6 A;  3FYG A;  3M1G A;  2VL2 A;  2ON7 A;  4YKF A;  2IJY A;  3P8W A;  1B4P A;  1Z6M A;  1AQW A;  3PGT A;  2F51 A;  3UBK A;  3IR4 A;  3TJG A;  2JAC A;  1OYJ A;  3HVN A;  3HYP A;  1X5D A;  5DAK B;  1G6W A;  5INY A;  2JSZ A;  2IWT A;  1QUW A;  3J7Y k;  2IIY A;  3KXO A;  1XBS A;  1GUM A;  3UOM A;  1IYI A;  2P31 A;  1BED A;  2OJL A;  2YWM A;  5ELA A;  1AUC A;  1M2D A;  5D9X A;  4WBR D;  1XZO A;  3TDG A;  3VPT A;  2XPE A;  2HT9 A;  3KGK A;  5LCZ A;  1CQG A;  5C04 A;  3APO A;  4HS1 A;  5IPG A;  3M8N A;  3GKM A;  4MF5 A;  1OC8 A;  1PX6 A;  4YAV A;  5CRH A;  2VCV A;  3TOT A;  4KDY A;  3NOF A;  4KUN A;  3K8N A;  1YKA A;  1ZYP A;  3U5R E;  1PL1 A;  2GDR A;  2B3S A;  5IM9 A;  4Z7X A;  3BCI A;  5H5R A;  5IOX A;  1Y25 A;  2VO4 A;  3DVW A;  2YOI A;  3GUR A;  2D2Z A;  4HZ4 A;  5DVB A;  3N9J A;  1T8E B;  2B5E A;  4LLR A;  4NHZ A;  4OCE A;  4ZIJ A;  5COH A;  3S9F A;  5F8B A;  4KX4 A;  1X5C A;  1ILO A;  2GQM A;  5D9W A;  3RDW A;  1N2A A;  1O8X A;  4IBP A;  3NZN A;  4TR0 A;  5CO3 A;  1GUL A;  2AYT A;  2H6Y A;  5B8B A;  3GRX A;  3TCO A;  2YAN A;  6GSV A;  4TKY A;  1HQO A;  1XW6 A;  4CDO A;  3TRQ A;  5HFG A;  2N5B A;  4JR4 A;  4ECB A;  3VWV A;  2LJR A;  1SJZ A;  2FWF A;  2VD0 A;  3GFK A;  3GKK A;  1BYE A;  4ZB8 A;  3PIN A;  2PBJ A;  1SD9 A;  1Y6E A;  1A0R P;  3FZ4 A;  4RUV A;  1A24 A;  3LYP A;  4PUF C;  5GAP D;  2P5Q A;  4O5Q A;  1VF2 A;  1XG8 A;  4POL A;  3JCM L;  1AAZ A;  3BJ5 A;  3KTB A;  1E6B A;  2WRT A;  4N10 A;  4F2I A;  3FZA A;  3TKS C;  5JWR B;  3VLN A;  4FYU A;  3G7I A;  3VI7 A;  3HHV A;  2ZCT A;  3GHA A;  3DGQ A;  1NSW A;  1UN2 A;  2VLT A;  3LSZ A;  1U3I A;  2JSY A;  5BRT A;  5JWO B;  2NVL A;  4XRA A;  5G30 A;  4YAP A;  3QCP A;  2R0P A;  3DD3 A;  1Z6N A;  3WGX A;  4GSN A;  4J2F A;  2O87 A;  3UAR A;  3HJP A;  2E7P A;  1GUK A;  5GZZ B;  2H73 A;  2VL9 A;  3Q6O A;  4O5R A;  3QMX A;  4BA7 A;  3I43 A;  1TU7 A;  4PQI A;  4LL4 B;  3QAV A;  2LJA A;  4I5Q A;  1TOF A;  3P90 A;  1HD2 A;  1K3L A;  1PL2 A;  4TXO A;  3HVV A;  22GS A;  1HNC A;  1A2M A;  3KEB A;  5LNK e;  5B6N A;  5HFI A;  1EP8 A;  3TKS E;  3DXB A;  1K3Y A;  4ZL9 A;  3J7Y b;  1YY7 A;  1ERV A;  2L4Q A;  1WWJ A;  3KZQ A;  4J57 E;  16GS A;  4POK A;  1GSY A;  4PGT A;  2LQQ A;  1QQ2 A;  3ZZX A;  4A5P A;  1GRX A;  3A3T A;  1G7E A;  3GX8 A;  3GV1 A;  3KH9 A;  4YQM A;  1ON4 A;  2V41 A;  2AB6 A;  4K6X A;  2B5X A;  4PQ1 A;  5J9B A;  4HU9 A;  1O8W A;  4HQS A;  14GS A;  4I97 A;  3Q74 A;  4ML6 A;  3UJ1 A;  4RI6 A;  4H86 A;  1JHB A;  2GZZ A;  4EC0 A;  2IFQ B;  4HQZ A;  2R37 A;  2VUP A;  1R7H A;  1U88 A;  1X9M B;  1TW9 A;  4G19 A;  4D73 A;  2HSM A;  4TXO B;  1XW5 A;  5KOW A;  4L0W A;  3WT2 A;  2X64 A;  4JBB A;  4KE3 A;  2LEG A;  1USB A;  1K0M A;  3ZYW A;  4L0U A;  2R3X A;  1DSB A;  1ABA A;  1PA3 A;  5EY6 A;  4DSQ A;  4NPB A;  4PUA A;  2Z9S A;  2FLS A;  1RQM A;  1TP9 A;  3FZ9 A;  2DBC A;  1G0T A;  2CAQ A;  2CVK A;  4HZ2 A;  3G9B A;  3I9V 2;  1PKW A;  4Z2R A;  1XVW A;  3DML A;  2NBS A;  1A8L A;  1TRU A;  4BWS A;  4TOP A;  2AAW A;  1TKD B;  1GSU A;  5A4V A;  1IYH A;  2VLV A;  3D4T A;  1AW9 A;  1NM3 A;  2O85 A;  3HJO A;  4ECJ A;  4KCA A;  3IV4 A;  5J41 A;  1SK0 A;  2GLR A;  2MMO A;  2EIQ A;  4KGI A;  5D9T A;  1EP7 A;  1E2Y A;  5IQY A;  2C0E A;  1VF3 A;  3DWV A;  1G6Y A;  1XWB A;  3L4N A;  3DRN A;  1U3A A;  3HCZ A;  4L8E A;  5ID2 B;  3MYD A;  5DQS A;  4GQC A;  3TJJ A;  3KP9 A;  2XC2 A;  5H5S A;  2YV7 A;  2LST A;  1XOB A;  5IMZ A;  2FHE A;  4O5U A;  2GSQ A;  1QGV A;  4JE1 A;  1ZL9 A;  3UEM A;  3FR6 A;  4EVM A;  5BMU A;  3CRT A;  12GS A;  4EIP A;  3VUR A;  3A2X A;  3F6D A;  2CZ2 A;  4YH2 A;  2H76 A;  1X5E A;  3O3T A;  1S3A A;  2WFC A;  1ERT A;  5IOW A;  2FWE A;  4V2M A;  1FOH A;  3EUR A;  1M0U A;  3O6T A;  5AGY A;  2GST A;  1MD4 A;  4EE0 A;  4NHW A;  2NPB A;  2WDU A;  1SL1 B;  5D93 A;  1F9M A;  2H1D A;  3HA9 A;  1K0C A;  5H5Q A;  4IHU A;  4ZBB A;  1A0F A;  2R0C A;  3A5I A;  2EC4 A;  3CSH A;  4OFM A;  3MIX A;  5FHI A;  2N5A A;  1VF1 A;  1BAY A;  1O81 A;  1ZYQ B;  1O7U A;  4FYB A;  2K9F A;  2L4C A;  5IPH A;  3QD9 A;  2LRT A;  5F05 A;  2K6V A;  2LTK A;  4E8E A;  2WZ9 A;  2IME A;  1YJ6 A;  1K3O A;  1VF4 A;  13GS A;  2FCH A;  3ZRE A;  4N30 A;  3GMF A;  1AIU A;  3TJF A;  2I3Y A;  3H8Q A;  4J56 E;  2YZU A;  2X49 A;  4PUR A;  3TUE A;  2TRC P;  3QOU A;  3ZRD A;  2P5R A;  5G5F A;  6GSX A;  5HQP A;  4Z2T A;  1Q98 A;  2R4V A;  3IAS 2;  3AY8 A;  1FOV A;  3EIN A;  3VPQ A;  1GSE A;  5CRW A;  3EYT A;  4IEL A;  2VIM A;  3MAK A;  1GLP A;  2HRA A;  2I9H A;  1SYX A;  2FY6 A;  2UZ8 A;  4DSS B;  18GS A;  1EEJ A;  3KCM A;  2C3T A;  3KMN A;  3EE2 A;  4Z2U A;  4BWQ A;  1ERW A;  2DIZ A;  3GSS A;  4I8B A;  3HVS A;  1V40 A;  2YJ7 A;  3A2V A;  3LEF A;  1YF0 A;  3D5J A;  3TKQ A;  4FQU A;  1B9X C;  3IAM 2;  2OE0 A;  1ACV A;  1FVK A;  1AXD A;  4ZIL A;  2LS5 A;  2DJ0 A;  5ECH B;  2MMZ A;  1PN0 A;  4IQA A;  2C3N A;  2XBI A;  3F3Q A;  4MA9 A;  3A2W A;  2PUK C;  1XOA A;  3M0F A;  1ML6 A;  1TXX A;  3FKF A;  2ES7 A;  1PFO A;  1QMV A;  4G10 A;  4BL7 A;  3V1W A;  3IC8 A;  3APS A;  3G7Y A;  2YP6 A;  1ZGN A;  5HR2 A;  2A2P A;  2M80 A;  3ZTL A;  4HSC X;  3EWL A;  5ECI B;  4MZC A;  4P3Y B;  2IMD A;  1ZOF A;  3EVI A;  2CV4 A;  3UVH A;  3W6G A;  4K0N A;  4HOJ A;  1TRS A;  3GYK A;  2LNS A;  1OKD A;  3E9J B;  5GAN D;  3TB2 A;  4GLT A;  5G31 A;  2QC7 A;  1J9B A;  2VL3 A;  5KN3 A;  4I6X A;  3LFL A;  3VWW A;  4GWR A;  4IGJ A;  2DLX A;  4IP6 A;  2LRN A;  3KP8 A;  5IMC A;  2XHF A;  4OCF A;  3P2A A;  1W89 A;  4NV5 A;  3UBL A;  1MDJ A;  2A2S A;  1Z7R A;  3IK7 A;  2ON5 A;  3RPN A;  2L6C A;  3D21 A;  1PMT A;  2B1K A;  2CT6 A;  3F0I A;  1XWA A;  4TRX A;  4BL7 B;  2GQK A;  4N0V A;  4TXV A;  3UMA A;  2O8V B;  2DJ2 A;  2HZF A;  2GT5 A;  3GNJ A;  4V1A g;  3ERW A;  3F4S A;  1WJK A;  4GST A;  4XHM A;  2H1G A;  4EKZ A;  1OAZ A;  1TK8 B;  2QSI A;  3HJM A;  2BMX A;  4ML1 A;  3C1R A;  1SL2 B;  1JFU A;  3PR8 A;  2OE3 A;  1GSD A;  1QFN A;  1TI3 A;  4POB A;  2H1B A;  5D96 A;  6GSS A;  1B9Y C;  1LBK A;  1V57 A;  1SKS B;  4HJM A;  1U6T A;  1XWC A;  4NXI A;  3GKN A;  1FB6 A;  2IMI A;  3ZVJ D;  2I4A A;  5FWG A;  2M72 A;  2CQ9 A;  4WKW A;  4BVY B;  1MDK A;  1KEB A;  2CZ3 A;  2J9H A;  1TK5 B;  1OKT A;  4EDZ A;  2GTU A;  2PN8 A;  4TR1 A;  5HR1 A;  4V2L A;  4KDX A;  2O7K A;  2V1M A;  1BX9 A;  2GVP A;  4KDU A;  1S3C A;  4F9Z A;  2G2Q A;  4FYC A;  4ULX A;  1TK0 B;  1YEP A;  1SKR B;  1R4W A;  3MSZ A;  5D73 A;  4K2D A;  2R0G A;  3GH6 A;  3CSJ A;  2H8L A;  4MJC A;  2PVO C;  2AV4 A;  3R3E A;  3RPP A;  2JU5 A;  3R2Q A;  2H6Z A;  1AC1 A;  1M99 A;  2WUL A;  2R2J A;  3KTL A;  3PH9 A;  3E0U A;  2OA7 A;  2IFQ A;  2WB9 A;  4V2N A;  2C4J A;  1MDI A;  4YKG A;  3I6A A;  2H75 A;  1B48 A;  3TJB A;  3ME7 A;  1T4Z A;  4TR3 A;  2FA8 A;  5DJM A;  3UL3 A;  4F82 A;  4MCU A;  1DE1 A;  3WGE A;  1KNG A;  1SJI A;  1BQ7 A;  1WOU A;  4TR1 B;  4GXZ A;  3CRU A;  4L5L A;  6GSW A;  4TW5 A;  3I69 A;  5JCU A;  2VL2 C;  5CNW A;  3WYW A;  1THO A;  2IL3 A;  2YCD A;  4LMW A;  2WGR A;  1V58 A;  4WEY A;  3H1N A;  1WMJ A;  1GWC A;  1XCC A;  3CXG A;  4I2U A;  4K1F A;  3Q18 A;  2KP2 A;  2GQL A;  2F9S A;  4PX1 A;  1B8X A;  5A4W A;  1KTE A;  3US3 A;  3ZIV A;  4Q5R A;  4XIH A;  4ACS A;  4LL1 B;  20GS A;  4Q5Q A;  2H0G A;  5DDL A;  2E2M A;  4K5S A;  4POM A;  1Z5Y E;  4RQX A;  4EIQ A;  1XW9 A;  3QFA C;  2XBQ A;  4G0L A;  1GTI A;  4XS4 B;  4ZL7 A;  2H01 A;  1TJD A;  4X0X A;  3LWA A;  4I2T A;  1SK1 A;  4K0G A;  4N11 A;  3BBY A;  2FGX A;  2QA1 A;  3D22 A;  4LA1 A;  3C7M A;  5DJL A;  2M46 A;  3W8S A;  5J5N A;  2J23 A;  4G0K A;  5ID2 A;  1GLQ A;  4HEA 2;  3GX0 A;  5IMD A;  4EO3 A;  1ZYN A;  2L57 A;  2FWG A;  3FHK A;  2A4H A;  1M2A A;  2P0G A;  4Q5F A;  1H4O A;  2RII A;  4IVF A;  2KP1 A;  4TR4 A;  4FH8 A;  3SWL A;  1PSQ A;  1S3D A;  4LMV A;  1MD3 A;  4QQ7 A;  2DC5 A;  1Z3E A;  3EC3 A;  2RM6 A;  1WRY A;  5EPF A;  3TRP A;  5HR3 A;  4G9H A;  1XWK A;  2LKU A;  2OBI A;  4DVC A;  4MDC A;  4IP1 A;  4EXJ A;  4IJI A;  2B5Y A;  2GSS A;  4MP4 A;  2VOC A;  4BVX A;  1XVQ A;  1EV9 A;  3LW9 A;  5D9V A;  2DKI A;  3EMP A;  4XS1 A;  4ZL8 A;  4PNG A;  4ILF A;  4HUA A;  2HNL A;  3VWU A;  1B4Q A;  3QFB C;  1ZCP A;  1T00 A;  1GL8 A;  3L9V A;  1GTB A;  2HSY A;  2KLX A;  4KAE A;  1GNE A;  2FD3 A;  1WIK A;  4ECI A;  4ID0 A;  2REM A;  5CRE A;  2WCI A;  3TJK A;  1UC7 A;  5JCW A;  3EPT A;  1Q4J A;  2H6X A;  11GS A;  2VCW A;  4ECC A;  2MBS A;  1HNB A;  1V2A A;  1OC3 A;  3ZMK A;  2H1A A;  2B6M A;  2C8U A;  2YWI A;  2ALB A;  5JCG A;  2L5L A;  5ECO B;  2X4A A;  2OAC A;  1PQN A;  2DJJ A;  3H93 A;  5E59 A;  1WE0 A;  1C72 A;  4EL1 A;  6GSY A;  1GNW A;  2FWH A;  2JZT A;  4BVX B;  2CA8 A;  5EL8 A;  1R5A A;  1U87 A;  3ZLP A;  2BTO T;  3HDC A;  4Q5N A;  1FHE A;  2GZY A;  2HXK A;  3GIX A;  4DSS A;  3HY2 A;  4TVE A;  3HD5 A;  3NIV A;  5HFK A;  1JZR A;  4MJB A;  4HJ2 A;  3L78 A;  3TRX A;  4HU7 A;  1M9B A;  3D0Z A;  5A5K A;  2VAF A;  2QA2 A;  3LOR A;  4ZB9 A;  4MH3 A;  4GRF A;  1DUG A;  1QXH A;  5GST A;  1QK8 A;  3C71 A;  2LNT A;  1EEM A;  4NV2 A;  1PKZ A;  1RK4 A;  1JZO A;  2PMT A;  3BOA A;  1FO5 A;  5ECK B;  3C73 A;  3C8E A;  5KOX A;  1T1V A;  1EGO A;  5G1L A;  3LXZ A;  1ERU A;  5JWQ B;  3KM6 A;  3E3E A;  1R26 A;  1JZD A;  3ERF A;  4FO5 A;  3GTU B;  3TKS A;  4K7I A;  1Z7P A;  5L71 A;  2LV3 A;  4MJE A;  4MAB A;  1M9A A;  3IPZ A;  4O92 A;  4K7O A;  1OE8 A;  3FR3 A;  2YZH A;  5KN0 A;  1PN9 A;  2H30 A;  1PX7 A;  2JAD A;  1VRS D;  5DBQ A;  2HFD A;  1EOH A;  5ECP B;  1M3J A;  4F0C A;  3DKS A;  1YF1 A;  1MEK A;  1XFL A;  2B7J A;  2C1Y A;  1VGL A;  3FRC A;  6GSU A;  3PPU A;  1TRW A;  3EU4 A;  3IK9 A;  1HNA A;  4KW6 A;  4EF0 A;  1N8J A;  3F6F A;  2JZR A;  5CRD A;  3WD6 A;  2KHP A;  3IA1 A;  1PD2 1;  3W8J A;  2VD1 A;  2QGV A;  3HZ8 A;  4KSM A;  2PWJ A;  2MZC A;  3TKP A;  6GST A;  4PNF A;  4G0I A;  4X1U A;  1AQX A;  1GSF A;  3HKR A;  1T7P B;  3CBU A;  2AJQ B;  1XIY A;  2MMN A;  3KD0 A;  4PXO A;  2YN1 A;  2C80 A;  2GGT A;  2FUG 2;  5ELG A;  2QKE A;  3F4T A;  2YNX A;  3ZIT A;  4MF7 A;  5AIV A;  4KH7 A;  4MZB A;  3N5O A;  2RUF A;  3QDN A;  1V9W A;  4PTS A;  1FVJ A;  3IRA A;  2LRC A;  4XRD A;  2OE1 A;  3IBH A;  2K18 A;  4MH2 A;  1SK2 A;  2B7K A;  2HRN A;  1TDI A;  4WR5 A;  5AIS A;  2VM2 A;  2C0G A;  3QR6 A;  4O7H A;  3VK9 A;  3M3M A;  2VCZ A;  1K0B A;  2H0H A;  3ZL5 A;  1XPV A;  4OO5 A;  3F3R A;  4GTU A;  1JLV A;  5F07 A;  4OD7 A;  3ZVJ A;  4QL9 A;  1X9W B;  3L0H A;  4TN8 A;  2H71 A;  4BVY A;  2LJK A;  4V1A p;  1T4Y A;  3QAG A;  4K9Z A;  2IMF A;  4G2E A;  3KH7 A;  1BJX A;  1I5G A;  4ISD A;  5ENU A;  4MMM A;  3HZ4 A;  1YDK A;  1K0A A;  3DEX A;  1BG5 A;  1SL0 B;  3ZIJ A;  3LQ7 A;  4F0B A;  4JZQ A;  1ZMA A;  4YQU A;  3FK8 A;  4RQR A;  2PPT A;  1ZZY A;  4AJ7 A;  5ECN B;  3F63 A;  3ME8 A;  5IO0 A;  3LJR A;  2EIR A;  2WJU A;  4NMU A;  2O89 A;  2ZUP A;  5B7C A;  4IJ3 A;  2VCT A;  3KJY A;  5AN1 A;  3D4M A;  2DJK A;  2MMA A;  3ED3 A;  4HI7 A;  5LD0 A;  3IDV A;  2MYG A;  2OAD A;  1F37 A;  4WF5 A;  4XTS A;  3KIJ A;  2CVD A;  3QPM A;  2C0D A;  2H66 A;  1XXU A;  1A2J A;  4OWY A;  3IE3 A;  1NHO A;  3CTF A;  1EZK A;  5C00 A;  4AF2 A;  1LJR A;  1NW2 A;  3ZFL A;  5ECR B;  2G0F A;  3RHB A;  1O85 A;  2V2G A;  2PU9 C;  2CX3 A;  4IQ1 A;  4CHS A;  2X8C A;  2E0Q A;  2L59 A;  2YV9 A;  2GZP A;  2H0I A;  2TRX A;  1WP0 A;  3BCK A;  5A4U A;  3WGD A;  1A8Y A;  4KF9 A;  4HDE A;  1A2L A;  1PGT A;  2AHE A;  3SBC A;  5KN2 A;  1OVN A;  3H4K A;  1YKC A;  2F8F A;  4WXT A;  4CY6 A;  1M7T A;  3MWH A;  1OE7 A;  3H79 A;  1EGR A;  2X99 A;  2C3Q A;  2F8A A;  5D8I A;  5IMF A;  4DSR A;  1F6M C;  4QL7 A;  1T3B A;  3WT1 A;  3LXT A;  4JRR A;  5IMA A;  3TKR A;  1GTU A;  2HZE A;  4XS4 A;  2H74 A;  1GSS A;  3TGZ A;  5ECQ B;  4GF0 A;  4X43 A;  4MLY A;  4IKH A;  1SYR A;  1A23 A;  2H72 A;  2YJH A;  3FEU A;  5FT3 A;  4CY8 A;  1FAA A;  5KEJ A;  3FY7 A;  2NTO A;  1CQH A;  3OR5 A;  2V6O A;  2WS2 A;  19GS A;  3CTG A;  4NAX A;  2GS3 A;  1JZW A;  2HSH A;  1F3A A;  1M3I A;  3FZ5 A;  2N5F A;  4MZW A;  1YQ1 A;  3FW2 A;  2A4V A;  4FIW A;  4OFN A;  4K8M A;  2K8S A;  2HYX A;  4MJA A;  4K5R A;  1R5P A;  2DSA A;  3Q19 A;  3CQF A;  5ECL B;  5B6M A;  5GSS A;  1PRX A;  2CX4 A;  1SEN A;  9GSS A;  5IMV A;  3O76 A;  2HRF A;  3UIW A;  5EVO A;  3FMW A;  4IN0 A;  2NDO A;  4MNN A;  3GKX A;  1THX A;  2RM5 A;  3U6V A;  2FNO A;  2RUE A;  5AIX A;  2DML A;  5CP1 A;  2HZE B;  4ZBA A;  1FB0 A;  4AJ8 A;  5HR0 A;  1Z9H A;  2H19 A;  3GA4 A;  1DE2 A;  3CSI A;  2YPM A;  4N0Z A;  1ST9 A;  3VWX A;  3RBT A;  1O6J A;  3RHC A;  4MK3 A;  1HYU A;  2V6K A;  3G7J A;  5DCG A;  3GST A;  2R5G A;  1W4V A;  4IW9 A;  4WET A;  4JR6 A;  3EMX A;  1LU4 A;  2DIY A;  2VM1 A;  1K0O A;  2CAI A;  4E8H A;  10GS A;  5F06 A;  3HVX A;  2B1L A;  3ZML A;  1TRV A;  4ZB6 A;  2TIR A;  3UAP A;  1I9D A;  3L9S A;  5ECS A;  4WBJ A;  3L9U A;  2IPA A;  3MDK A;  3LGC A;  1RW1 A;  1M2B A;  3DVX A;  2FA4 A;  4ZXG A;  1GUH A;  1FW1 A;  3DIE A;  1DBY A;  5G5E A;  2V32 A;  5J4U A;  4AJ6 A;  4AGS A;  2L5O A;  4OO4 A;  2AUV A;  2DKH A;  3D6I A;  1J0F A;  3VFI A;  1KBN A;  2VLU A;  1S3R A;  1SKW B;  4L5O A;  1EOG A;  1F2E A;  4WR4 A;  1TTZ A;  3BD2 A;  3GUS A;  1EV4 A;  3GL3 A;  2PER A;  5KN1 A;  2K8V A;  1AQV A;  1URM A;  4F03 A;  2LUS A;  2X8H A;  4KCE A;  3C1S A;  4D73 B;  2I1U A;  2DJ1 A;  2DMM A;  1O73 A;  2HE3 A;  4BPY A;  4KSO A;  3CMI A;  4BIK A;  5CAX A;  5J9C A;  2VCQ A;  3A5W A;  5G2Z A;  5F0G A;  3GTU A;  2KUC A;  1SU9 A;  4YQV A;  4JED A;  4MF6 A;  3IHG A; 
#chains in the Genus database with same CATH homology
 2MBT A;  1MTC A;  3APQ A;  2F3M A;  4DEJ A;  1GH2 A;  2IN3 A;  2HLS A;  4GCI A;  4ICY A;  3ERG A;  1FG4 A;  2BJX A;  5IIZ A;  3F9U A;  5DCH A;  3VI5 A;  1SD8 A;  1K0N A;  2L6D A;  3QAW A;  4GSS A;  2ZNM A;  4ZBD A;  5DAL A;  5G1K A;  3IHQ A;  3GL5 A;  3MNG A;  4O32 A;  1JLW A;  5E4W A;  1X0R A;  4KB3 A;  2JL4 A;  1K0D A;  2I81 A;  2GSR A;  2DJ3 A;  7GSS A;  2EIO A;  2C0F A;  1H75 A;  1OC9 A;  4XCS A;  3UVT A;  4X4J A;  4PQH A;  4NWY A;  2OKA A;  1J08 A;  4K7N A;  3RAZ A;  1XWG A;  3M9K A;  1TI1 A;  1TU8 A;  3TOU A;  4OMV A;  1WPI A;  1YZX A;  5ECM B;  4OFT A;  3IXR A;  5ABR A;  2YWN A;  2A2R A;  1V98 A;  1F3B A;  2PGT A;  1X9S B;  17GS A;  1GP1 A;  4XS6 A;  4USS A;  1EWX A;  3GH9 A;  2YWO A;  5DAK A;  4EUY A;  5DQY A;  2H70 A;  1YEX A;  2VCX A;  3DYR A;  4CW9 A;  2E2G A;  2OBK A;  3CYN A;  3HXS A;  5J3R A;  8GSS A;  4GQF A;  3IOS A;  2RLI A;  2XPD A;  3GN3 A;  4IS0 A;  1ZYE A;  5DAL B;  5IO2 A;  2PVQ A;  4MPF A;  1UA5 A;  4KA0 A;  5CRG A;  2LQO A;  3IC4 A;  2HRK A;  3M9J A;  4WF4 A;  5B8A A;  3KMO A;  4MPG A;  4EDY A;  2KOK A;  2CVB A;  2IMK A;  2R6K A;  3FR9 A;  2GT6 A;  3P7X A;  3F8U A;  4KND A;  1UVZ A;  3ISO A;  1G7O A;  3EU3 A;  1NHY A;  1OC9 B;  3F4R A;  4JU5 A;  4RI7 A;  1GTA A;  5CYY A;  1GSQ A;  3LYK A;  3ZFB A;  2HI7 A;  4K2X A;  1SJ6 A;  2JZS A;  2X8G A;  3LG6 A;  3FYG A;  3M1G A;  2VL2 A;  2ON7 A;  4YKF A;  2IJY A;  3P8W A;  1B4P A;  1Z6M A;  1AQW A;  3PGT A;  2F51 A;  3UBK A;  3IR4 A;  3TJG A;  2JAC A;  1OYJ A;  3HYP A;  1X5D A;  5DAK B;  1G6W A;  5INY A;  2JSZ A;  2IWT A;  1QUW A;  3J7Y k;  2IIY A;  3KXO A;  1XBS A;  1GUM A;  3UOM A;  1IYI A;  2P31 A;  1BED A;  2OJL A;  2YWM A;  5ELA A;  1AUC A;  1M2D A;  5D9X A;  4WBR D;  1XZO A;  3TDG A;  3VPT A;  2XPE A;  2HT9 A;  3KGK A;  5LCZ A;  1CQG A;  5C04 A;  3APO A;  4HS1 A;  5IPG A;  3M8N A;  3GKM A;  4MF5 A;  1OC8 A;  1PX6 A;  4YAV A;  5CRH A;  2VCV A;  3TOT A;  4KDY A;  3NOF A;  4KUN A;  3K8N A;  1YKA A;  1ZYP A;  3U5R E;  1PL1 A;  2GDR A;  2B3S A;  5IM9 A;  4Z7X A;  3BCI A;  5H5R A;  5IOX A;  1Y25 A;  2VO4 A;  3DVW A;  2YOI A;  3GUR A;  2D2Z A;  4HZ4 A;  5DVB A;  3N9J A;  1T8E B;  2B5E A;  4LLR A;  4NHZ A;  4OCE A;  4ZIJ A;  5COH A;  3S9F A;  5F8B A;  4KX4 A;  1X5C A;  1ILO A;  2GQM A;  5D9W A;  3RDW A;  1N2A A;  1O8X A;  4IBP A;  3NZN A;  4TR0 A;  5CO3 A;  1GUL A;  2AYT A;  2H6Y A;  5B8B A;  3GRX A;  3TCO A;  2YAN A;  6GSV A;  4TKY A;  1HQO A;  1XW6 A;  4CDO A;  3TRQ A;  5HFG A;  2N5B A;  4JR4 A;  4ECB A;  3VWV A;  2LJR A;  1SJZ A;  2FWF A;  2VD0 A;  3GFK A;  3GKK A;  1BYE A;  4ZB8 A;  3PIN A;  2PBJ A;  1SD9 A;  1Y6E A;  1A0R P;  3FZ4 A;  4RUV A;  1A24 A;  3LYP A;  4PUF C;  5GAP D;  2P5Q A;  1VF2 A;  4O5Q A;  4POL A;  3JCM L;  1AAZ A;  3BJ5 A;  3KTB A;  1E6B A;  2WRT A;  4N10 A;  4F2I A;  3FZA A;  3TKS C;  5JWR B;  3VLN A;  4FYU A;  3G7I A;  3VI7 A;  3HHV A;  2ZCT A;  3GHA A;  3DGQ A;  1NSW A;  1UN2 A;  2VLT A;  3LSZ A;  1U3I A;  2JSY A;  5BRT A;  5JWO B;  2NVL A;  4XRA A;  5G30 A;  4YAP A;  3QCP A;  2R0P A;  3DD3 A;  1Z6N A;  3WGX A;  4GSN A;  4J2F A;  2O87 A;  3UAR A;  3HJP A;  2E7P A;  1GUK A;  5GZZ B;  2H73 A;  2VL9 A;  3Q6O A;  4O5R A;  3QMX A;  4BA7 A;  3I43 A;  1TU7 A;  4PQI A;  4LL4 B;  3QAV A;  2LJA A;  4I5Q A;  1TOF A;  3P90 A;  1HD2 A;  1K3L A;  1PL2 A;  4TXO A;  3HVV A;  22GS A;  1HNC A;  1A2M A;  3KEB A;  5LNK e;  5B6N A;  5HFI A;  1EP8 A;  3TKS E;  3DXB A;  1K3Y A;  4ZL9 A;  3J7Y b;  1YY7 A;  1ERV A;  2L4Q A;  1WWJ A;  3KZQ A;  4J57 E;  16GS A;  4POK A;  1GSY A;  4PGT A;  2LQQ A;  1QQ2 A;  3ZZX A;  4A5P A;  1GRX A;  3A3T A;  1G7E A;  3GX8 A;  3GV1 A;  3KH9 A;  4YQM A;  1ON4 A;  2V41 A;  2AB6 A;  4K6X A;  2B5X A;  4PQ1 A;  5J9B A;  4HU9 A;  1O8W A;  4HQS A;  14GS A;  4I97 A;  3Q74 A;  4ML6 A;  3UJ1 A;  4RI6 A;  4H86 A;  1JHB A;  2GZZ A;  4EC0 A;  2IFQ B;  4HQZ A;  2R37 A;  2VUP A;  1R7H A;  1U88 A;  1X9M B;  1TW9 A;  4G19 A;  4D73 A;  2HSM A;  4TXO B;  1XW5 A;  5KOW A;  4L0W A;  3WT2 A;  2X64 A;  4JBB A;  4KE3 A;  2LEG A;  1USB A;  1K0M A;  3ZYW A;  4L0U A;  2R3X A;  1DSB A;  1ABA A;  1PA3 A;  5EY6 A;  4DSQ A;  4NPB A;  4PUA A;  2Z9S A;  2FLS A;  1RQM A;  1TP9 A;  3FZ9 A;  2DBC A;  1G0T A;  2CAQ A;  2CVK A;  4HZ2 A;  3G9B A;  3I9V 2;  1PKW A;  4Z2R A;  1XVW A;  3DML A;  2NBS A;  1A8L A;  1TRU A;  4BWS A;  4TOP A;  2AAW A;  1TKD B;  1GSU A;  5A4V A;  1IYH A;  2VLV A;  3D4T A;  1AW9 A;  1NM3 A;  2O85 A;  3HJO A;  4ECJ A;  4KCA A;  3IV4 A;  5J41 A;  1SK0 A;  2GLR A;  2MMO A;  2EIQ A;  4KGI A;  5D9T A;  1EP7 A;  1E2Y A;  5IQY A;  2C0E A;  1VF3 A;  3DWV A;  1G6Y A;  1XWB A;  3L4N A;  3DRN A;  1U3A A;  3HCZ A;  4L8E A;  5ID2 B;  3MYD A;  5DQS A;  4GQC A;  3TJJ A;  3KP9 A;  2XC2 A;  5H5S A;  2YV7 A;  2LST A;  1XOB A;  5IMZ A;  2FHE A;  4O5U A;  2GSQ A;  1QGV A;  4JE1 A;  1ZL9 A;  3UEM A;  3FR6 A;  4EVM A;  5BMU A;  3CRT A;  12GS A;  4EIP A;  3VUR A;  3A2X A;  3F6D A;  2CZ2 A;  4YH2 A;  2H76 A;  1X5E A;  3O3T A;  1S3A A;  2WFC A;  1ERT A;  5IOW A;  2FWE A;  4V2M A;  1FOH A;  3EUR A;  1M0U A;  3O6T A;  5AGY A;  2GST A;  1MD4 A;  4EE0 A;  4NHW A;  2NPB A;  2WDU A;  1SL1 B;  5D93 A;  1F9M A;  2H1D A;  3HA9 A;  1K0C A;  5H5Q A;  4IHU A;  4ZBB A;  1A0F A;  2R0C A;  3A5I A;  2EC4 A;  3CSH A;  4OFM A;  3MIX A;  5FHI A;  2N5A A;  1VF1 A;  1BAY A;  1O81 A;  1ZYQ B;  1O7U A;  4FYB A;  2K9F A;  2L4C A;  5IPH A;  3QD9 A;  2LRT A;  5F05 A;  2K6V A;  2LTK A;  4E8E A;  2WZ9 A;  2IME A;  1YJ6 A;  1K3O A;  1VF4 A;  13GS A;  2FCH A;  3ZRE A;  4N30 A;  3GMF A;  1AIU A;  3TJF A;  2I3Y A;  3H8Q A;  4J56 E;  2YZU A;  2X49 A;  4PUR A;  3TUE A;  2TRC P;  3QOU A;  3ZRD A;  2P5R A;  5G5F A;  6GSX A;  5HQP A;  4Z2T A;  1Q98 A;  2R4V A;  3IAS 2;  3AY8 A;  1FOV A;  3EIN A;  3VPQ A;  1GSE A;  5CRW A;  3EYT A;  4IEL A;  2VIM A;  3MAK A;  1GLP A;  2HRA A;  2I9H A;  1SYX A;  2FY6 A;  2UZ8 A;  4DSS B;  18GS A;  1EEJ A;  3KCM A;  2C3T A;  3KMN A;  3EE2 A;  4Z2U A;  4BWQ A;  1ERW A;  2DIZ A;  3GSS A;  4I8B A;  3HVS A;  1V40 A;  2YJ7 A;  3A2V A;  3LEF A;  1YF0 A;  3D5J A;  3TKQ A;  4FQU A;  1B9X C;  3IAM 2;  2OE0 A;  1ACV A;  1FVK A;  1AXD A;  4ZIL A;  2LS5 A;  2DJ0 A;  5ECH B;  2MMZ A;  1PN0 A;  4IQA A;  2C3N A;  2XBI A;  3F3Q A;  4MA9 A;  3A2W A;  2PUK C;  1XOA A;  3M0F A;  1ML6 A;  1TXX A;  3FKF A;  2ES7 A;  1QMV A;  4G10 A;  4BL7 A;  3V1W A;  3IC8 A;  3APS A;  3G7Y A;  2YP6 A;  1ZGN A;  5HR2 A;  2A2P A;  2M80 A;  3ZTL A;  3EWL A;  5ECI B;  4MZC A;  4P3Y B;  2IMD A;  1ZOF A;  3EVI A;  2CV4 A;  3UVH A;  3W6G A;  4K0N A;  4HOJ A;  1TRS A;  3GYK A;  2LNS A;  1OKD A;  3E9J B;  5GAN D;  3TB2 A;  4GLT A;  5G31 A;  2QC7 A;  1J9B A;  2VL3 A;  5KN3 A;  4I6X A;  3LFL A;  3VWW A;  4GWR A;  4IGJ A;  2DLX A;  4IP6 A;  2LRN A;  3KP8 A;  5IMC A;  2XHF A;  4OCF A;  3P2A A;  1W89 A;  4NV5 A;  3UBL A;  1MDJ A;  2A2S A;  1Z7R A;  3IK7 A;  2ON5 A;  3RPN A;  2L6C A;  3D21 A;  1PMT A;  2B1K A;  2CT6 A;  3F0I A;  1XWA A;  4TRX A;  4BL7 B;  2GQK A;  4N0V A;  4TXV A;  3UMA A;  2O8V B;  2DJ2 A;  2HZF A;  2GT5 A;  3GNJ A;  4V1A g;  3ERW A;  3F4S A;  1WJK A;  4GST A;  4XHM A;  2H1G A;  4EKZ A;  1OAZ A;  1TK8 B;  2QSI A;  3HJM A;  2BMX A;  4ML1 A;  3C1R A;  1SL2 B;  1JFU A;  3PR8 A;  2OE3 A;  1GSD A;  1QFN A;  1TI3 A;  4POB A;  2H1B A;  5D96 A;  6GSS A;  1B9Y C;  1LBK A;  1V57 A;  1SKS B;  4HJM A;  1U6T A;  1XWC A;  4NXI A;  3GKN A;  1FB6 A;  2IMI A;  3ZVJ D;  2I4A A;  5FWG A;  2M72 A;  2CQ9 A;  4WKW A;  4BVY B;  1MDK A;  1KEB A;  2CZ3 A;  2J9H A;  1TK5 B;  1OKT A;  4EDZ A;  2GTU A;  2PN8 A;  4TR1 A;  5HR1 A;  4V2L A;  4KDX A;  2O7K A;  2V1M A;  1BX9 A;  2GVP A;  4KDU A;  1S3C A;  4F9Z A;  2G2Q A;  4FYC A;  4ULX A;  1TK0 B;  1YEP A;  1SKR B;  1R4W A;  3MSZ A;  5D73 A;  4K2D A;  2R0G A;  3GH6 A;  3CSJ A;  2H8L A;  4MJC A;  2PVO C;  2AV4 A;  3R3E A;  3RPP A;  2JU5 A;  3R2Q A;  2H6Z A;  1AC1 A;  1M99 A;  2WUL A;  2R2J A;  3KTL A;  3PH9 A;  3E0U A;  2OA7 A;  2IFQ A;  2WB9 A;  4V2N A;  2C4J A;  1MDI A;  4YKG A;  3I6A A;  2H75 A;  1B48 A;  3TJB A;  3ME7 A;  1T4Z A;  4TR3 A;  2FA8 A;  5DJM A;  3UL3 A;  4F82 A;  4MCU A;  1DE1 A;  3WGE A;  1KNG A;  1SJI A;  1BQ7 A;  1WOU A;  4TR1 B;  4GXZ A;  3CRU A;  4L5L A;  6GSW A;  4TW5 A;  3I69 A;  5JCU A;  2VL2 C;  5CNW A;  3WYW A;  1THO A;  2IL3 A;  2YCD A;  4LMW A;  2WGR A;  1V58 A;  4WEY A;  3H1N A;  1WMJ A;  1GWC A;  1XCC A;  3CXG A;  4I2U A;  4K1F A;  3Q18 A;  2KP2 A;  2GQL A;  2F9S A;  4PX1 A;  1B8X A;  5A4W A;  1KTE A;  3US3 A;  3ZIV A;  4Q5R A;  4XIH A;  4ACS A;  4LL1 B;  20GS A;  4Q5Q A;  2H0G A;  5DDL A;  2E2M A;  4K5S A;  4POM A;  1Z5Y E;  4RQX A;  4EIQ A;  1XW9 A;  3QFA C;  2XBQ A;  4G0L A;  1GTI A;  4XS4 B;  4ZL7 A;  2H01 A;  1TJD A;  4X0X A;  3LWA A;  4I2T A;  1SK1 A;  4K0G A;  4N11 A;  3BBY A;  2FGX A;  2QA1 A;  3D22 A;  4LA1 A;  3C7M A;  5DJL A;  2M46 A;  3W8S A;  5J5N A;  2J23 A;  4G0K A;  5ID2 A;  1GLQ A;  4HEA 2;  3GX0 A;  5IMD A;  4EO3 A;  1ZYN A;  2L57 A;  2FWG A;  3FHK A;  2A4H A;  1M2A A;  2P0G A;  4Q5F A;  1H4O A;  2RII A;  4IVF A;  2KP1 A;  4TR4 A;  4FH8 A;  3SWL A;  1PSQ A;  1S3D A;  4LMV A;  1MD3 A;  4QQ7 A;  2DC5 A;  1Z3E A;  3EC3 A;  2RM6 A;  1WRY A;  5EPF A;  3TRP A;  5HR3 A;  4G9H A;  1XWK A;  2LKU A;  2OBI A;  4DVC A;  4MDC A;  4IP1 A;  4EXJ A;  4IJI A;  2B5Y A;  2GSS A;  4MP4 A;  2VOC A;  4BVX A;  1XVQ A;  1EV9 A;  3LW9 A;  5D9V A;  2DKI A;  3EMP A;  4XS1 A;  4ZL8 A;  4PNG A;  4ILF A;  4HUA A;  2HNL A;  3VWU A;  1B4Q A;  3QFB C;  1ZCP A;  1T00 A;  1GL8 A;  3L9V A;  1GTB A;  2HSY A;  2KLX A;  4KAE A;  1GNE A;  2FD3 A;  1WIK A;  4ECI A;  4ID0 A;  2REM A;  5CRE A;  2WCI A;  3TJK A;  1UC7 A;  5JCW A;  3EPT A;  1Q4J A;  2H6X A;  11GS A;  2VCW A;  4ECC A;  2MBS A;  1HNB A;  1V2A A;  1OC3 A;  3ZMK A;  2H1A A;  2B6M A;  2C8U A;  2YWI A;  2ALB A;  5JCG A;  2L5L A;  5ECO B;  2X4A A;  2OAC A;  1PQN A;  2DJJ A;  3H93 A;  5E59 A;  1WE0 A;  1C72 A;  4EL1 A;  6GSY A;  1GNW A;  2FWH A;  2JZT A;  4BVX B;  2CA8 A;  5EL8 A;  1R5A A;  1U87 A;  3ZLP A;  2BTO T;  3HDC A;  4Q5N A;  1FHE A;  2GZY A;  2HXK A;  3GIX A;  4DSS A;  3HY2 A;  4TVE A;  3HD5 A;  3NIV A;  5HFK A;  1JZR A;  4MJB A;  4HJ2 A;  3L78 A;  3TRX A;  4HU7 A;  1M9B A;  3D0Z A;  5A5K A;  2VAF A;  2QA2 A;  3LOR A;  4ZB9 A;  4MH3 A;  4GRF A;  1DUG A;  1QXH A;  5GST A;  1QK8 A;  3C71 A;  2LNT A;  1EEM A;  4NV2 A;  1PKZ A;  1RK4 A;  1JZO A;  2PMT A;  3BOA A;  1FO5 A;  5ECK B;  3C73 A;  3C8E A;  5KOX A;  1T1V A;  1EGO A;  5G1L A;  3LXZ A;  1ERU A;  5JWQ B;  3KM6 A;  3E3E A;  1R26 A;  1JZD A;  3ERF A;  4FO5 A;  3GTU B;  3TKS A;  4K7I A;  1Z7P A;  5L71 A;  2LV3 A;  4MJE A;  4MAB A;  1M9A A;  3IPZ A;  4O92 A;  4K7O A;  1OE8 A;  3FR3 A;  2YZH A;  5KN0 A;  1PN9 A;  2H30 A;  1PX7 A;  2JAD A;  1VRS D;  5DBQ A;  2HFD A;  1EOH A;  5ECP B;  4F0C A;  3DKS A;  1YF1 A;  1MEK A;  1XFL A;  2B7J A;  2C1Y A;  1VGL A;  3FRC A;  6GSU A;  3PPU A;  1TRW A;  3EU4 A;  3IK9 A;  1HNA A;  4KW6 A;  4EF0 A;  1N8J A;  3F6F A;  2JZR A;  5CRD A;  3WD6 A;  2KHP A;  3IA1 A;  1PD2 1;  3W8J A;  2VD1 A;  2QGV A;  3HZ8 A;  4KSM A;  2PWJ A;  2MZC A;  3TKP A;  6GST A;  4PNF A;  4G0I A;  4X1U A;  1AQX A;  1GSF A;  3HKR A;  1T7P B;  3CBU A;  2AJQ B;  1XIY A;  2MMN A;  3KD0 A;  4PXO A;  2YN1 A;  2C80 A;  2GGT A;  2FUG 2;  5ELG A;  2QKE A;  3F4T A;  2YNX A;  3ZIT A;  4MF7 A;  5AIV A;  4KH7 A;  4MZB A;  3N5O A;  2RUF A;  3QDN A;  1V9W A;  4PTS A;  1FVJ A;  3IRA A;  2LRC A;  4XRD A;  2OE1 A;  3IBH A;  2K18 A;  4MH2 A;  1SK2 A;  2B7K A;  2HRN A;  1TDI A;  4WR5 A;  5AIS A;  2VM2 A;  2C0G A;  3QR6 A;  4O7H A;  3VK9 A;  3M3M A;  2VCZ A;  1K0B A;  2H0H A;  3ZL5 A;  1XPV A;  4OO5 A;  3F3R A;  4GTU A;  1JLV A;  5F07 A;  4OD7 A;  3ZVJ A;  4QL9 A;  1X9W B;  3L0H A;  4TN8 A;  2H71 A;  4BVY A;  2LJK A;  4V1A p;  1T4Y A;  3QAG A;  4K9Z A;  2IMF A;  4G2E A;  3KH7 A;  1BJX A;  1I5G A;  4ISD A;  5ENU A;  4MMM A;  3HZ4 A;  1YDK A;  1K0A A;  3DEX A;  1BG5 A;  1SL0 B;  3ZIJ A;  3LQ7 A;  4F0B A;  4JZQ A;  1ZMA A;  4YQU A;  3FK8 A;  4RQR A;  2PPT A;  1ZZY A;  4AJ7 A;  5ECN B;  3F63 A;  3ME8 A;  5IO0 A;  3LJR A;  2EIR A;  2WJU A;  4NMU A;  2O89 A;  2ZUP A;  5B7C A;  4IJ3 A;  2VCT A;  3KJY A;  5AN1 A;  3D4M A;  2DJK A;  2MMA A;  3ED3 A;  4HI7 A;  5LD0 A;  3IDV A;  2MYG A;  2OAD A;  1F37 A;  4WF5 A;  4XTS A;  3KIJ A;  2CVD A;  3QPM A;  2C0D A;  2H66 A;  1XXU A;  1A2J A;  4OWY A;  3IE3 A;  1NHO A;  3CTF A;  1EZK A;  5C00 A;  4AF2 A;  1LJR A;  1NW2 A;  3ZFL A;  5ECR B;  2G0F A;  3RHB A;  1O85 A;  2V2G A;  2PU9 C;  2CX3 A;  4IQ1 A;  4CHS A;  2X8C A;  2E0Q A;  2L59 A;  2YV9 A;  2GZP A;  2H0I A;  2TRX A;  1WP0 A;  3BCK A;  5A4U A;  3WGD A;  1A8Y A;  4KF9 A;  4HDE A;  1A2L A;  1PGT A;  2AHE A;  3SBC A;  5KN2 A;  1OVN A;  3H4K A;  1YKC A;  2F8F A;  4WXT A;  4CY6 A;  1M7T A;  3MWH A;  1OE7 A;  3H79 A;  1EGR A;  2X99 A;  2C3Q A;  2F8A A;  5D8I A;  5IMF A;  4DSR A;  1F6M C;  4QL7 A;  1T3B A;  3WT1 A;  3LXT A;  4JRR A;  5IMA A;  3TKR A;  1GTU A;  2HZE A;  4XS4 A;  2H74 A;  1GSS A;  3TGZ A;  5ECQ B;  4GF0 A;  4X43 A;  4MLY A;  4IKH A;  1SYR A;  1A23 A;  2H72 A;  2YJH A;  3FEU A;  5FT3 A;  4CY8 A;  1FAA A;  5KEJ A;  3FY7 A;  2NTO A;  1CQH A;  3OR5 A;  2V6O A;  2WS2 A;  19GS A;  3CTG A;  4NAX A;  2GS3 A;  1JZW A;  2HSH A;  1F3A A;  3FZ5 A;  2N5F A;  4MZW A;  1YQ1 A;  3FW2 A;  2A4V A;  4FIW A;  4OFN A;  4K8M A;  2K8S A;  2HYX A;  4MJA A;  4K5R A;  1R5P A;  2DSA A;  3Q19 A;  5B6M A;  5ECL B;  5GSS A;  1PRX A;  2CX4 A;  1SEN A;  9GSS A;  5IMV A;  3O76 A;  2HRF A;  3UIW A;  5EVO A;  3FMW A;  4IN0 A;  2NDO A;  4MNN A;  3GKX A;  1THX A;  2RM5 A;  3U6V A;  2FNO A;  2RUE A;  5AIX A;  2DML A;  5CP1 A;  2HZE B;  4ZBA A;  1FB0 A;  4AJ8 A;  5HR0 A;  1Z9H A;  2H19 A;  3GA4 A;  1DE2 A;  3CSI A;  2YPM A;  4N0Z A;  1ST9 A;  3VWX A;  3RBT A;  1O6J A;  3RHC A;  4MK3 A;  1HYU A;  2V6K A;  3G7J A;  5DCG A;  3GST A;  2R5G A;  1W4V A;  4IW9 A;  4WET A;  4JR6 A;  3EMX A;  1LU4 A;  2DIY A;  2VM1 A;  1K0O A;  2CAI A;  4E8H A;  10GS A;  5F06 A;  3HVX A;  2B1L A;  3ZML A;  1TRV A;  4ZB6 A;  2TIR A;  3UAP A;  1I9D A;  3L9S A;  5ECS A;  4WBJ A;  3L9U A;  2IPA A;  3MDK A;  3LGC A;  1RW1 A;  1M2B A;  3DVX A;  2FA4 A;  4ZXG A;  1GUH A;  1FW1 A;  3DIE A;  1DBY A;  5G5E A;  2V32 A;  5J4U A;  4AJ6 A;  4AGS A;  2L5O A;  4OO4 A;  2AUV A;  2DKH A;  3D6I A;  1J0F A;  3VFI A;  1KBN A;  2VLU A;  1SKW B;  4L5O A;  1EOG A;  1F2E A;  4WR4 A;  1TTZ A;  3BD2 A;  3GUS A;  1EV4 A;  3GL3 A;  2PER A;  5KN1 A;  2K8V A;  1AQV A;  1URM A;  4F03 A;  2LUS A;  2X8H A;  4KCE A;  3C1S A;  4D73 B;  2I1U A;  2DJ1 A;  2DMM A;  1O73 A;  2HE3 A;  4BPY A;  4KSO A;  3CMI A;  5CAX A;  5J9C A;  2VCQ A;  3A5W A;  5G2Z A;  5F0G A;  3GTU A;  2KUC A;  1SU9 A;  4YQV A;  4JED A;  4MF6 A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...