1OKDA

Nmr-structure of tryparedoxin 1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
147
structure length
147
Chain Sequence
SGLDKYLPGIEKLRRGDGEVEVKSLAGKLVFFYFSASWCPPCRGFTPQLIEFYDKFHESKNFEVVFCTWDEEEDGFAGYFAKMPWLAVPFAQSEAVQKLSKHFNVESIPTLIGVDADSGDVVTTRARATLVKDPEGEQFPWKDAPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN 1
publication title NMR studies of the interaction of tryparedoxin with redox-inactive substrate homologues.
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 22
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2003-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1okdA00
1GH2A 3QD9A 3DIEA 1KEBA 3OR5A 2LNSA 1FHEA 1ON4A 3BCKA 3EWLA 4OD7A 2H30A 5HQPA 2M72A 4YAVA 4KCEA 3DEXA 1H75A 1VF1A 2R4VA 2G2QA 1F37A 4J56E 3ZFBA 3UOMA 18GSA 5KN1A 2OE0A 2IWTA 5IQYA 3FEUA 3IBHA 3VLNA 1NSWA 2FA8A 3DRNA 1EV4A 3ZMLA 5AIVA 4ZL7A 1THXA 1K0BA 3O6TA 3G9BA 4E8HA 12GSA 4CW9A 4OO4A 1WPIA 4TR0A 3HD5A 2HZFA 1LBKA 2FNOA 5D93A 2DMMA 3TJBA 1O6JA 1U88A 10GSA 1YY7A 2JSZA 4G2EA 1XW5A 3LYPA 3EINA 3NOFA 5IOXA 3TRPA 1SK1A 3GTUB 5GAND 3CSHA 1OC9B 3HVVA 3GKMA 3CBUA 2DJJA 2GTUA 1FO5A 4KE3A 2FWGA 4OFNA 2OE3A 2L5OA 4F82A 1EGRA 2NPBA 1T00A 3HVSA 5F8BA 3TUEA 1SJIA 2DC5A 4TKYA 5JCWA 2RIIA 5CREA 2ON5A 2VO4A 4POMA 3F0IA 3TJKA 2MMAA 1XVWA 4DSQA 3KP9A 3A2WA 9GSSA 2DSAA 2WJUA 2VD0A 3WGEA 2RLIA 2E2MA 3CSJA 1SJZA 2C4JA 3LXTA 3RHCA 5IPGA 4ZL9A 4BWQA 2OACA 2K8SA 1M9BA 1LU4A 1TXXA 1SYRA 1YZXA 2XBQA 1T8EB 2IMIA 5GZZB 3VWXA 1J08A 4ZL8A 3TKSC 4MZWA 2MYGA 1XPVA 5IM9A 3M8NA 5J3RA 1OAZA 4PGTA 1O73A 2H1DA 1ERTA 4KUNA 3IPZA 4EXJA 3H1NA 5IMCA 3GNJA 3V1WA 5GSSA 2GSRA 4KSOA 3UARA 2C8UA 1DSBA 1OKDA 2L5LA 3H79A 2HRFA 2YANA 1XOBA 1BYEA 4N0ZA 2OBIA 4N10A 1A0RP 4NV5A 1A0FA 5DBQA 5G30A 14GSA 4OCEA 5HR0A 1XBSA 1R5AA 3ZVJD 3N5OA 3C1RA 3D5JA 3BD2A 2FD3A 4HJ2A 3VFIA 4TXVA 3R2QA 5EPFA 2VL2A 2C3QA 5JWQB 1VF3A 1JZOA 3EVIA 1WJKA 2Z9SA 4PURA 1EZKA 3C71A 2DJ0A 1AC1A 1ML6A 1M0UA 5ECLB 2CZ3A 5ECKB 4K8MA 2LV3A 4I6XA 3VK9A 1PN9A 2H70A 4F9ZA 3W8SA 1A8LA 1XWCA 5CRHA 4MLYA 5B8AA 3CTFA 4JU5A 1PQNA 4ZBBA 1WRYA 2LJKA 3W8JA 3ERGA 1VF2A 3QFBC 3ERFA 3E9JB 5F0GA 1URMA 1F2EA 1MDJA 3MSZA 3VI5A 2LQOA 1XW9A 2ON7A 3F4SA 3QAGA 3PR8A 2P5RA 4XS4B 4BA7A 1YQ1A 4KB3A 1NHOA 5G2ZA 1IYIA 3QR6A 2IMFA 4ML6A 5C00A 4I2UA 2DJ3A 3BCIA 5FWGA 5ECPB 2FHEA 1AAZA 3HYPA 4L0UA 3H4KA 5G1LA 2B1KA 16GSA 1GLPA 3F3QA 1TI1A 2X99A 3IHQA 1Q4JA 3ME7A 5HFKA 2FWFA 3F6DA 1T4YA 2HNLA 1T3BA 5CO3A 4OCFA 4WF5A 2H8LA 1GSQA 3G7IA 1EOGA 3EU4A 2VLUA 3HJMA 1G7EA 1O8XA 2HE3A 1E6BA 1JZDA 3UEMA 1AQVA 1Z9HA 2YPMA 11GSA 2C3NA 3FR3A 2H66A 5LD0A 4I2TA 4HUAA 2XC2A 2B3SA 2IMDA 5IMZA 1YF1A 1WMJA 3ZREA 4WXTA 3IA1A 4L5OA 5L71A 4PQ1A 4PQIA 4YAPA 2OA7A 4G9HA 2X8HA 1K0NA 1SENA 1TTZA 3MNGA 2O85A 1Z7RA 1ZYQB 2I81A 2V2GA 4D73A 2A2RA 2I1UA 1XVQA 2X8GA 3TRXA 2JACA 5A4UA 2B5EA 1R5PA 5DJLA 3FK8A 4NPBA 3KCMA 4O92A 3APQA 2H0IA 1WP0A 4MMMA 4TOPA 4XRAA 1QXHA 2LSTA 5A4VA 1GUHA 4DEJA 2CX3A 1T4ZA 4IN0A 4XRDA 4WR5A 4XHMA 1SKSB 1MD4A 1DBYA 2MZCA 4ACSA 2F51A 5C04A 2VCVA 3BJ5A 1W4VA 2H6ZA 5AISA 1S3CA 4K9ZA 4PQHA 1HQOA 2KP2A 1TJDA 2LKUA 1JHBA 1QFNA 2P5QA 4JRRA 3D21A 4O32A 6GSUA 6GSXA 1M2BA 3A3TA 4WKWA 1EP7A 1I9DA 3HJOA 2YWIA 2IIYA 3KM6A 3LG6A 4TW5A 3GX0A 2GT6A 1EP8A 5HR2A 1G0TA 3U6VA 1PGTA 2HSYA 6GSWA 2IJYA 2VAFA 5EL8A 1B48A 3BOAA 4EE0A 2YP6A 5D73A 3EURA 4GLTA 2EIOA 3W6GA 3C7MA 4EC0A 3QOUA 2A4VA 4I8BA 1ABAA 5F07A 1NHYA 2H75A 4BWSA 3BBYA 4L0WA 4ID0A 4IW9A 4MJAA 1TDIA 3GH6A 3KMOA 4DSSA 5CP1A 4ZBAA 3UVHA 2VL2C 3WGXA 5IOWA 4ECJA 1BEDA 1A8YA 1FB0A 4RI6A 3RHBA 3HVXA 1UC7A 3KH9A 1HYUA 2PBJA 2HSHA 5D8IA 5D9XA 4Q5NA 2MMNA 3ZIVA 3FR9A 3GL5A 4ECCA 5IMDA 1DE2A 3DVWA 2B7JA 1GTAA 5IMVA 3EE2A 5J4UA 4N11A 5CRDA 4KAEA 3ZFLA 5D9VA 2P0GA 1GSYA 3TRQA 4OWYA 4HOJA 1G6WA 1MTCA 1OC3A 5AN1A 2FWEA 5ID2B 1V9WA 2AYTA 1T1VA 4GSSA 1AXDA 3ME8A 4OFMA 2LJAA 4QQ7A 1F3BA 3RPPA 3P8WA 1CQGA 3KH7A 4XS1A 4DSSB 1PSQA 2R37A 1TU7A 5ECMB 2WFCA 3HY2A 2VD1A 4L8EA 2HFDA 2RM6A 1GP1A 2HI7A 3P90A 4Q5QA 4AJ7A 5IIZA 5KN2A 3MWHA 6GSTA 2WRTA 3US3A 5DQSA 2ZCTA 1J0FA 1S3AA 3QAVA 4ML1A 3RAZA 4NV2A 2L6DA 2NTOA 2YJ7A 4KDYA 3RPNA 1WOUA 1M99A 1B8XA 3VWVA 3E0UA 1TRUA 4HQZA 4E8EA 20GSA 1HNCA 2VM2A 1HNBA 2EIQA 4AJ6A 1U87A 1XXUA 1SD8A 2CAQA 1B9YC 1GSFA 4TR3A 1GL8A 2GLRA 1F6MC 1X9WB 1XWGA 3QFAC 2DJ1A 5ENUA 1A2MA 4V2LA 2YV7A 2HLSA 1BG5A 4MK3A 1SJ6A 1B9XC 3LYKA 2WULA 4WBRD 4HZ4A 2VLTA 3GHAA 5G5EA 2L57A 1PMTA 3HKRA 5JWOB 5H5QA 2TRCP 1OE7A 4QL7A 4YQMA 5ECNB 1JZRA 3H8QA 3GV1A 3TJJA 2C1YA 3IAS2 3CTGA 1QUWA 2QSIA 1GTBA 1AQXA 3FRCA 4XS4A 3KD0A 2KUCA 1ZCPA 4KH7A 2V32A 1N2AA 2BTOT 1ZMAA 4ZXGA 4IP6A 2FGXA 4EL1A 5D96A 1RK4A 4TR1A 1X5EA 2VL9A 1FAAA 3HDCA 4HU7A 2EC4A 2IPAA 3MDKA 1AUCA 3A2XA 3VURA 4X1UA 6GSSA 2MMZA 3FZ4A 2JZTA 5IPHA 4MF5A 3L78A 3LEFA 2L4CA 1QGVA 4NAXA 1M2DA 3ZZXA 1V2AA 1YF0A 1H4OA 3APOA 2HRNA 2N5BA 3QAWA 4HDEA 3IAM2 2GDRA 1VGLA 3KP8A 3CRUA 1EOHA 1ILOA 2C0EA 2YNXA 5EY6A 2K6VA 1EEMA 1XWBA 3UMAA 1Q98A 2WCIA 3F6FA 4HEA2 1JZWA 4GXZA 2CAIA 1OE8A 5E4WA 3TOTA 4K7OA 4P3YB 1PL1A 3WT2A 1Z6MA 2YWNA 1TK0B 4POLA 2WGRA 1E2YA 4POBA 4FYBA 4HU9A 2BMXA 4MJBA 3WGDA 2K8VA 4TR1B 3PGTA 5J41A 5AIXA 1B4PA 2IFQB 2M80A 4LA1A 3M3MA 2H1AA 13GSA 4EDYA 1ZYEA 2L59A 3GKKA 2V6OA 5JCGA 2AHEA 4I5QA 5H5RA 3IV4A 2RM5A 2WDUA 1ST9A 1YDKA 4GSNA 8GSSA 3ZIJA 7GSSA 2JL4A 1R4WA 4NHWA 1KNGA 4GSTA 3C73A 2DIYA 1YJ6A 1BQ7A 4ZBDA 4GRFA 4ISDA 3FZAA 1ERVA 2PU9C 2GVPA 1V40A 2H01A 2XBIA 3HCZA 2PVQA 3D6IA 2QGVA 1GUKA 4BL7A 4IJIA 1A2JA 3D4TA 1SD9A 2LNTA 4GF0A 3GKXA 5JCUA 3GKNA 2V6KA 4K2DA 2OJLA 3G7YA 2GQKA 3UBLA 3GIXA 4V1Ag 4HQSA 3TB2A 4GWRA 5ELGA 3M9JA 3GYKA 5ECQB 4JR4A 1TRSA 3F8UA 4ZB9A 1GULA 5FT3A 5A5KA 2GSQA 1B4QA 1BX9A 2PVOC 3F9UA 3L0HA 1OKTA 2KOKA 2F3MA 5IO2A 2L6CA 3C1SA 3CXGA 1HD2A 3LXZA 4ULXA 1CQHA 2I4AA 3VPTA 5ELAA 2XPDA 1U6TA 3VPQA 3M0FA 1BAYA 2VIMA 5KN0A 1TK8B 3DXBA 4K0GA 1FB6A 2I3YA 1M9AA 4ZB6A 1EV9A 3CYNA 4FYCA 1SYXA 2FY6A 1TOFA 2DBCA 1TU8A 1HNAA 3A5WA 2CVKA 3KGKA 3LSZA 4L5LA 1O8WA 4NWYA 3Q18A 2J23A 2LRNA 3D0ZA 4PNGA 3WT1A 1XWKA 3TKSA 5F05A 2H6YA 2WB9A 1ERUA 3EC3A 4ECIA 3IK9A 3P2AA 5IMAA 2NBSA 2GT5A 1ZZYA 4LMVA 4TRXA 4YQUA 4JEDA 3HA9A 1ZOFA 2K9FA 1GWCA 4JZQA 3WD6A 6GSYA 4HI7A 2QC7A 2H73A 2FCHA 1JLWA 1DE1A 4O5RA 3FY7A 2PUKC 5CYYA 2H71A 4RI7A 5IMFA 4V1Ap 5AGYA 2GS3A 1KTEA 4KDXA 3E3EA 4K0NA 2CT6A 2DMLA 2E2GA 3WYWA 3I6AA 2VCZA 1X5DA 5J9CA 2CVBA 3LQ7A 4IBPA 4Q5RA 2H6XA 3IDVA 2CV4A 2CVDA 4ECBA 1PX7A 3NZNA 3HXSA 5ID2A 1O81A 1ZGNA 4XTSA 2YV9A 2HT9A 5ECRB 1U3AA 4KCAA 4MDCA 4XIHA 2TRXA 4POKA 3DGQA 2LQQA 1Y6EA 5GSTA 3HZ4A 1Y25A 1XOAA 2F8FA 1OVNA 1JFUA 1X9SB 4ZB8A 2WZ9A 1UN2A 5F06A 2E0QA 1OYJA 5ECSA 2JSYA 2NVLA 2PWJA 4GQCA 2B5XA 1PA3A 5HFIA 1XFLA 2A2SA 1A23A 1NW2A 2XHFA 2H19A 2FA4A 4PNFA 2FWHA 5GAPD 2YN1A 4IQ1A 2H74A 4LL4B 4AJ8A 5IO0A 2B5YA 4IVFA 3GURA 4WF4A 3O3TA 1AQWA 2YCDA 3FKFA 2OKAA 3EMXA 4MA9A 4GTUA 3DVXA 3S9FA 1RW1A 2ZUPA 1O7UA 3GX8A 2IN3A 3TDGA 1SL0B 3TKRA 1FG4A 1R7HA 3TKSE 2EIRA 2TIRA 1V58A 1TP9A 5FHIA 2HZEB 3GSSA 1K0AA 1EWXA 5DDLA 2O8VB 3RDWA 2FLSA 1THOA 2YZHA 1Z7PA 2BJXA 2C0DA 3IXRA 3L9UA 2MBSA 3QMXA 2O89A 2DJ2A 4AGSA 5ECHB 2YOIA 4GQFA 3IOSA 5KEJA 2PN8A 2V41A 2YJHA 1XCCA 3MAKA 1AW9A 3LGCA 1UVZA 3VWUA 4RQXA 1TW9A 4OMVA 4X0XA 3FZ9A 1DUGA 2V1MA 4MP4A 4TXOB 3Q74A 4F0CA 4HS1A 1K0OA 1K3LA 4K6XA 5G1KA 17GSA 3UL3A 2H0HA 3KXOA 3GH9A 3GRXA 1G7OA 3IK7A 3U5RE 1PL2A 3QPMA 4V2MA 2H1GA 3LFLA 2VLVA 1V98A 1GUMA 3UBKA 2LJRA 4G10A 4XCSA 1K0CA 4OO5A 3L9VA 3N9JA 1YEPA 1F3AA 2O87A 4F03A 2DJKA 3CRTA 3GUSA 2LEGA 2C80A 5DCHA 1MD3A 1K0MA 1FVJA 2LRCA 2JZSA 5CAXA 1WWJA 1IYHA 1TRWA 4HJMA 2B6MA 1EEJA 4BVXA 2E7PA 4V2NA 2IMKA 3I43A 3DYRA 5G31A 1SL2B 3LWAA 3IR4A 2HXKA 4BPYA 3PH9A 4N0VA 5DALA 3GL3A 3SBCA 5G5FA 3KTBA 3RBTA 5LCZA 2RUFA 1A2LA 1MDKA 1X9MB 3LJRA 4PX1A 1M7TA 4EVMA 4EDZA 1X5CA 2PPTA 5ABRA 3ISOA 4O7HA 3J7Yk 4I97A 2VCXA 4PUAA 3GN3A 2O7KA 3L4NA 2AUVA 2REMA 4X43A 3ZMKA 2GZYA 1GSSA 2H1BA 4MZCA 2QKEA 1XW6A 1GSDA 1ZL9A 2IFQA 4KW6A 2B1LA 4MH2A 4MF7A 4F0BA 5HFGA 2FUG2 1VF4A 5D9TA 4EO3A 3VWWA 1Z3EA 2VM1A 2GZPA 4K1FA 1GLQA 5B7CA 2DIZA 2CQ9A 1PD21 4G19A 1PX6A 1R26A 2IMEA 2ES7A 2N5AA 4GCIA 4NHZA 1YEXA 4NXIA 1K3OA 1WE0A 4FH8A 3TKPA 2X8CA 2H72A 2CX4A 1FW1A 4KGIA 5DALB 2P31A 2VCTA 1A24A 5DAKA 5HR3A 5A4WA 2AV4A 3Q19A 2H76A 3ZRDA 1PKWA 5CRGA 2AB6A 2OBKA 1GNWA 1AIUA 1OC8A 3K8NA 3EYTA 4TVEA 4ZILA 1I5GA 2AAWA 1K0DA 3D4MA 1T7PB 4KNDA 4IKHA 3I9V2 2WS2A 2VCWA 4XS6A 2VOCA 2KLXA 3DKSA 2L4QA 3KIJA 2PERA 4JR6A 3O76A 4YQVA 1SKRB 1W89A 3ED3A 1VRSD 3A2VA 3TGZA 3TJGA 4CHSA 2GQLA 3SWLA 2HYXA 1BJXA 1GSUA 3F3RA 4LLRA 3ZLPA 4J57E 3ZITA 2OE1A 3KEBA 2H0GA 2DLXA 1XWAA 5INYA 2CA8A 1Z6NA 4ILFA 2LS5A 3IE3A 3GFKA 2YWOA 4EKZA 4IJ3A 2F8AA 1MEKA 5D9WA 3EMPA 3CSIA 2LTKA 1O85A 5DVBA 1Z5YE 3QDNA 1X0RA 1U3IA 5J9BA 2JADA 4WETA 1SK0A 1JLVA 3M1GA 1V57A 3KMNA 4WEYA 3FW2A 4K7IA 5DAKB 3JCML 1UA5A 3TOUA 2MBTA 5CRWA 2PGTA 1GNEA 1GTIA 1FOVA 4LMWA 1USBA 1F9MA 3M9KA 5EVOA 4IHUA 5HR1A 4RQRA 4PXOA 4IS0A 2GZZA 4KSMA 4MJCA 3UJ1A 2R6KA 2F9SA 1MDIA 1GRXA 1RQMA 4F2IA 4CDOA 4AF2A 2GSTA 3P7XA 2C0FA 2XPEA 1PKZA 5DJMA 3IRAA 5E59A 1YKCA 3GSTA 3LORA 4TN8A 3HHVA 1SK2A 3Q6OA 4MJEA 5LNKe 4HZ2A 3L9SA 1TRVA 2K18A 5J5NA 1NM3A 4OFTA 2M46A 3DD3A 4MZBA 4KX4A 2R5GA 2LUSA 3ZVJA 1EGOA 3APSA 5B6NA 5H5SA 3J7Yb 3ERWA 2J9HA 3G7JA 4IP1A 3TKQA 4KDUA 3D22A 1S3DA 1YKAA 2PMTA 2LRTA 3GA4A 2CZ2A 2VUPA 1FVKA 2JZRA 19GSA 1J9BA 4JBBA 3FYGA 4H86A 4WBJA 3EU3A 4MPGA 4MH3A 4NMUA 3VI7A 5B6MA 4FIWA 6GSVA 1TKDB 3KJYA 2B7KA 3F63A 3NIVA 2IL3A 2C3TA 4IQAA 1LJRA 2YZUA 2R3XA 1M2AA 1ACVA 1TI3A 2N5FA 3ZTLA 2AJQB 3DWVA 4DVCA 4EF0A 1PRXA 2G0FA 4N30A 2R2JA 3KZQA 1C72A 5DCGA 2KHPA 1QK8A 4DSRA 4RUVA 1KBNA 3QCPA 5KN3A 2I9HA 1GSEA 2NDOA 2HZEA 4MABA 5JWRB 3ZL5A 4BVYA 4D73B 3PINA 1XZOA 4FO5A 2X64A 4FYUA 3TCOA 3H93A 3UIWA 4TR4A 3AY8A 3GMFA 3UVTA 3ZYWA 2D2ZA 1QQ2A 3DMLA 2ALBA 4EUYA 2GSSA 2MMOA 1WIKA 2RUEA 2YWMA 4WR4A 4J2FA 3FR6A 2ZNMA 3C8EA 5DQYA 3I69A 4KA0A 4Q5FA 4TXOA 1SKWB 1SL1B 3IC4A 2C0GA 3F4RA 5ECOB 4QL9A 22GSA 3HZ8A 3FHKA 4JE1A 4IELA 2VL3A 1XIYA 4Z7XA 2GGTA 4IGJA 4MF6A 5ECIB 5CNWA 2JU5A 3TJFA 2KP1A 5B8BA 4MPFA 3F4TA 4LL1B 1GTUA 1TK5B 2OADA 2VCQA 3CMIA 2GQMA 1QMVA 5COHA 4K7NA 3GTUA 1ERWA 3UAPA 3KTLA 1OC9A 3FZ5A 1G6YA 4MCUA 1K3YA 4PUFC 4YH2A 1SU9A 4ZIJA 1N8JA 3HJPA
chains in the Genus database with same CATH superfamily
1GH2A 3QD9A 3DIEA 1KEBA 3OR5A 2DKHA 2LNSA 1FHEA 1ON4A 3BCKA 3EWLA 4OD7A 4Z2RA 2H30A 5HQPA 2M72A 4YAVA 4KCEA 3DEXA 1H75A 1VF1A 2R4VA 2G2QA 1F37A 4YKFA 4J56E 3ZFBA 3UOMA 18GSA 5KN1A 2OE0A 2IWTA 5IQYA 3FEUA 3IBHA 3VLNA 1NSWA 2FA8A 3DRNA 1EV4A 3ZMLA 5AIVA 4ZL7A 1THXA 1K0BA 3O6TA 3G9BA 4E8HA 12GSA 4CW9A 4OO4A 1WPIA 4TR0A 3HD5A 2HZFA 1LBKA 2FNOA 5D93A 2DMMA 3TJBA 1O6JA 1U88A 10GSA 1YY7A 2JSZA 4G2EA 1XW5A 3LYPA 3EINA 3NOFA 5IOXA 3TRPA 1SK1A 3GTUB 5GAND 3CSHA 1OC9B 3HVVA 3GKMA 3CBUA 2DJJA 2GTUA 1FO5A 4KE3A 2FWGA 4OFNA 2OE3A 2L5OA 4F82A 1EGRA 2NPBA 1T00A 3HVSA 5F8BA 3TUEA 1SJIA 2DC5A 4TKYA 5JCWA 2RIIA 5CREA 2ON5A 2VO4A 4POMA 3F0IA 3TJKA 2MMAA 1XVWA 2X49A 4DSQA 3KP9A 3A2WA 9GSSA 2DSAA 2WJUA 2VD0A 3WGEA 2RLIA 2E2MA 3CSJA 1SJZA 2C4JA 3LXTA 3RHCA 5IPGA 4ZL9A 4BWQA 2OACA 2K8SA 1M9BA 1LU4A 1TXXA 1SYRA 1YZXA 2XBQA 1T8EB 2IMIA 5GZZB 3VWXA 1J08A 4ZL8A 3TKSC 4MZWA 2MYGA 1XPVA 5IM9A 3M8NA 5J3RA 1OAZA 4PGTA 1O73A 2H1DA 1ERTA 4KUNA 3IPZA 4EXJA 3H1NA 5IMCA 3GNJA 3V1WA 5GSSA 2GSRA 4KSOA 3UARA 2C8UA 1DSBA 1OKDA 2L5LA 3H79A 2HRFA 2YANA 1XOBA 1BYEA 4N0ZA 2OBIA 4N10A 1A0RP 4NV5A 1A0FA 5DBQA 5G30A 14GSA 4OCEA 3LW9A 5HR0A 1XBSA 1R5AA 3ZVJD 3EPTA 3N5OA 3C1RA 3D5JA 3BD2A 2FD3A 4HJ2A 3VFIA 4TXVA 3R2QA 5EPFA 2VL2A 2C3QA 5JWQB 1VF3A 1JZOA 3EVIA 1WJKA 2Z9SA 4CY6A 4PURA 1EZKA 3C71A 2DJ0A 1AC1A 1PFOA 1ML6A 1M0UA 5ECLB 2CZ3A 5ECKB 4K8MA 2LV3A 4I6XA 3VK9A 1PN9A 2H70A 4F9ZA 3W8SA 1A8LA 1XWCA 5CRHA 4MLYA 5B8AA 3CTFA 4JU5A 2A4HA 1PQNA 4ZBBA 1WRYA 2LJKA 3W8JA 3ERGA 1VF2A 3QFBC 3ERFA 3E9JB 5F0GA 1URMA 1F2EA 1MDJA 3MSZA 3VI5A 2LQOA 2HRAA 4EIQA 1XW9A 2ON7A 3F4SA 3QAGA 3PR8A 2P5RA 4XS4B 4BA7A 1YQ1A 4KB3A 1NHOA 5G2ZA 1IYIA 3QR6A 2IMFA 4ML6A 5C00A 3MYDA 4I2UA 2DJ3A 3BCIA 5FWGA 5ECPB 2FHEA 1AAZA 3HYPA 4L0UA 3H4KA 5G1LA 2B1KA 16GSA 1GLPA 2R0PA 3F3QA 1TI1A 2X99A 3IHQA 1Q4JA 3ME7A 5HFKA 2FWFA 3F6DA 1T4YA 2HNLA 1T3BA 5CO3A 4OCFA 4WF5A 2H8LA 1GSQA 3G7IA 1EOGA 3EU4A 2VLUA 3HJMA 1G7EA 1O8XA 2HE3A 1E6BA 1JZDA 3UEMA 1AQVA 1Z9HA 2YPMA 11GSA 2C3NA 3FR3A 2H66A 5LD0A 4I2TA 4HUAA 2XC2A 2B3SA 2IMDA 5IMZA 1YF1A 1WMJA 3ZREA 4WXTA 3IA1A 4L5OA 5L71A 4PQ1A 4PQIA 4YAPA 2OA7A 4G9HA 2X8HA 1K0NA 1SENA 1TTZA 3MNGA 2O85A 1Z7RA 1ZYQB 2I81A 2V2GA 4D73A 2A2RA 2I1UA 4G0KA 1XVQA 2X8GA 3TRXA 2JACA 5A4UA 2B5EA 1R5PA 5DJLA 3FK8A 4NPBA 3KCMA 4O92A 3APQA 2H0IA 1WP0A 4MMMA 4TOPA 4XRAA 1QXHA 2LSTA 5A4VA 1GUHA 4DEJA 2CX3A 1T4ZA 4IN0A 4XRDA 4WR5A 4XHMA 1SKSB 4HSCX 2HSMA 1MD4A 1DBYA 2MZCA 4ACSA 2F51A 5C04A 2VCVA 3BJ5A 1W4VA 2H6ZA 5AISA 4BL7B 1S3CA 4K9ZA 4PQHA 1HQOA 2KP2A 1TJDA 2LKUA 1JHBA 1QFNA 2P5QA 4JRRA 3D21A 4O32A 6GSUA 6GSXA 1M2BA 3A3TA 4WKWA 1EP7A 1I9DA 3HJOA 2YWIA 2IIYA 3KM6A 3LG6A 4TW5A 3GX0A 2GT6A 1EP8A 4K2XA 5HR2A 1G0TA 3U6VA 1PGTA 2HSYA 4K5SA 6GSWA 2IJYA 2VAFA 5EL8A 4Z2TA 2R0CA 1B48A 3BOAA 4EE0A 2YP6A 5D73A 3EURA 4GLTA 2EIOA 3W6GA 3C7MA 4EC0A 3QOUA 2A4VA 4I8BA 1ABAA 5F07A 1NHYA 2H75A 4BWSA 3BBYA 4L0WA 4ID0A 4IW9A 4MJAA 1TDIA 3GH6A 3KMOA 4DSSA 5CP1A 4ZBAA 3UVHA 2VL2C 3WGXA 5IOWA 4ECJA 1BEDA 1A8YA 1FB0A 4RI6A 3RHBA 3HVXA 1UC7A 3KH9A 1HYUA 2PBJA 2HSHA 5D8IA 5D9XA 4Q5NA 5BMUA 2MMNA 3ZIVA 3FR9A 3GL5A 4ECCA 5IMDA 1DE2A 3DVWA 2B7JA 1GTAA 5IMVA 3EE2A 5J4UA 4N11A 5CRDA 4KAEA 3ZFLA 1M3IA 4ICYA 5D9VA 2P0GA 1GSYA 3TRQA 4OWYA 4HOJA 1G6WA 1MTCA 1OC3A 5AN1A 2FWEA 5ID2B 1V9WA 2AYTA 1T1VA 4GSSA 1AXDA 3ME8A 4OFMA 2LJAA 3A5IA 4QQ7A 1F3BA 3RPPA 3P8WA 1XG8A 1CQGA 3KH7A 4XS1A 4DSSB 1PSQA 2R37A 1TU7A 5ECMB 2WFCA 3HY2A 3FMWA 2VD1A 4L8EA 2HFDA 2RM6A 1GP1A 2HI7A 3P90A 4Q5QA 4AJ7A 5IIZA 5KN2A 3MWHA 6GSTA 2WRTA 3US3A 5DQSA 2ZCTA 1J0FA 1S3AA 3QAVA 4ML1A 3RAZA 4NV2A 2L6DA 2NTOA 2YJ7A 4KDYA 3RPNA 1WOUA 1M99A 1B8XA 3VWVA 3E0UA 1TRUA 4HQZA 4E8EA 20GSA 1HNCA 2VM2A 1HNBA 2EIQA 4AJ6A 1U87A 1XXUA 1SD8A 2CAQA 1B9YC 1GSFA 4TR3A 4EIPA 1GL8A 2GLRA 1F6MC 1X9WB 1XWGA 3QFAC 2DJ1A 5ENUA 1A2MA 4V2LA 2YV7A 2HLSA 1BG5A 4MK3A 1SJ6A 1B9XC 3LYKA 2WULA 4WBRD 4HZ4A 2VLTA 3GHAA 5G5EA 2L57A 1PMTA 3HKRA 5JWOB 5H5QA 2TRCP 1OE7A 4QL7A 4YQMA 5ECNB 1JZRA 3H8QA 3GV1A 3TJJA 2C1YA 3IAS2 3CTGA 1QUWA 2QSIA 1GTBA 1AQXA 3FRCA 4XS4A 3KD0A 2KUCA 1ZCPA 4KH7A 2V32A 4O5UA 1N2AA 2BTOT 1ZMAA 4ZXGA 4IP6A 2FGXA 4EL1A 5D96A 1RK4A 4TR1A 1X5EA 2VL9A 4CY8A 1FAAA 3HDCA 4HU7A 2EC4A 2IPAA 3MDKA 1AUCA 3A2XA 3VURA 4X1UA 6GSSA 2MMZA 3FZ4A 2JZTA 5IPHA 4MF5A 3L78A 3LEFA 2L4CA 4BVXB 1QGVA 4NAXA 1M2DA 3ZZXA 1V2AA 1YF0A 1H4OA 2DKIA 3APOA 2HRNA 2N5BA 3QAWA 4HDEA 3IAM2 2GDRA 1VGLA 3KP8A 3CRUA 1EOHA 1ILOA 2C0EA 2YNXA 5EY6A 2K6VA 1EEMA 1XWBA 3UMAA 1Q98A 2WCIA 3F6FA 4HEA2 1JZWA 4GXZA 2CAIA 1OE8A 5E4WA 3TOTA 4K7OA 4P3YB 1PL1A 3WT2A 1Z6MA 2YWNA 1TK0B 4POLA 2WGRA 1E2YA 4POBA 4FYBA 4K5RA 4HU9A 2BMXA 4MJBA 3WGDA 2K8VA 4TR1B 3PGTA 5J41A 5AIXA 1B4PA 4FQUA 2IFQB 2M80A 4LA1A 3M3MA 2H1AA 13GSA 4EDYA 1ZYEA 2L59A 3GKKA 2V6OA 5JCGA 2AHEA 4I5QA 5H5RA 3IV4A 2RM5A 2WDUA 1ST9A 1YDKA 4GSNA 8GSSA 3ZIJA 7GSSA 2JL4A 1R4WA 4NHWA 1KNGA 4GSTA 3C73A 2DIYA 1YJ6A 1BQ7A 4ZBDA 4GRFA 4ISDA 3FZAA 1ERVA 2PU9C 2GVPA 1V40A 2H01A 2XBIA 3HCZA 2PVQA 3D6IA 2QGVA 1GUKA 4BL7A 4IJIA 1A2JA 3D4TA 1SD9A 2LNTA 4GF0A 3GKXA 5JCUA 3GKNA 2V6KA 4K2DA 2OJLA 3G7YA 4USSA 2GQKA 3UBLA 3GIXA 4V1Ag 4HQSA 3TB2A 4GWRA 4Z2UA 5KOXA 5ELGA 3M9JA 3GYKA 5ECQB 4JR4A 1TRSA 3F8UA 4ZB9A 1GULA 1ZYPA 5FT3A 5A5KA 2GSQA 1B4QA 1BX9A 2PVOC 3CQFA 3F9UA 3L0HA 1OKTA 2KOKA 2F3MA 5IO2A 2L6CA 3C1SA 3CXGA 1HD2A 3LXZA 4ULXA 1CQHA 2I4AA 3VPTA 5ELAA 2XPDA 1U6TA 3VPQA 3M0FA 1BAYA 2VIMA 5KN0A 1TK8B 3DXBA 4K0GA 1FB6A 2I3YA 1M9AA 4ZB6A 1EV9A 3CYNA 4FYCA 1SYXA 2FY6A 1TOFA 2DBCA 1TU8A 1HNAA 3A5WA 2CVKA 3KGKA 3LSZA 4L5LA 1O8WA 4NWYA 3Q18A 2J23A 2LRNA 3D0ZA 4PNGA 3WT1A 1XWKA 3TKSA 5F05A 2H6YA 2WB9A 1ERUA 3EC3A 4ECIA 3IK9A 3P2AA 5IMAA 2NBSA 2GT5A 1ZZYA 4LMVA 4TRXA 4YQUA 4JEDA 3HA9A 1ZOFA 2K9FA 1GWCA 4JZQA 3WD6A 4X4JA 6GSYA 4HI7A 2QC7A 2H73A 2FCHA 1JLWA 1DE1A 4O5RA 3FY7A 2R0GA 2PUKC 5CYYA 2H71A 4RI7A 5IMFA 4V1Ap 5AGYA 2GS3A 1KTEA 4KDXA 3E3EA 4K0NA 2CT6A 2DMLA 2E2GA 3WYWA 3I6AA 2VCZA 1X5DA 5J9CA 2CVBA 3LQ7A 4IBPA 4KF9A 4Q5RA 2H6XA 3IDVA 2CV4A 2CVDA 4ECBA 1PX7A 3NZNA 3HXSA 5ID2A 1O81A 1ZGNA 4XTSA 2YV9A 2HT9A 5ECRB 1U3AA 4KCAA 4MDCA 4XIHA 2TRXA 4POKA 3DGQA 2LQQA 1Y6EA 5GSTA 3HZ4A 1Y25A 3R3EA 1XOAA 2F8FA 1OVNA 1JFUA 1X9SB 4ZB8A 2WZ9A 4A5PA 1UN2A 5F06A 2E0QA 1OYJA 5ECSA 2JSYA 2NVLA 2PWJA 4GQCA 2B5XA 1PA3A 5HFIA 1XFLA 2A2SA 1FOHA 1A23A 1NW2A 2XHFA 2H19A 2FA4A 4PNFA 2FWHA 5GAPD 2YN1A 4IQ1A 2H74A 4LL4B 4AJ8A 5IO0A 2B5YA 4IVFA 3GURA 4WF4A 3O3TA 1AQWA 2YCDA 3FKFA 3PPUA 2OKAA 3EMXA 4MA9A 4GTUA 3DVXA 3S9FA 1RW1A 2ZUPA 1O7UA 3GX8A 2IN3A 3TDGA 1SL0B 3TKRA 1FG4A 1R7HA 1PN0A 3TKSE 2EIRA 2TIRA 1V58A 1TP9A 5FHIA 2HZEB 3GSSA 1K0AA 1EWXA 5DDLA 4BVYB 2O8VB 3RDWA 2FLSA 1THOA 2YZHA 1Z7PA 2BJXA 2C0DA 3IXRA 3L9UA 2MBSA 3QMXA 2O89A 2DJ2A 4AGSA 5ECHB 2YOIA 4GQFA 3IOSA 5KEJA 2PN8A 2V41A 2YJHA 1XCCA 3MAKA 1AW9A 3LGCA 1UVZA 3VWUA 4RQXA 1TW9A 4OMVA 4X0XA 3FZ9A 1DUGA 2V1MA 4MP4A 4TXOB 3Q74A 4F0CA 4HS1A 1K0OA 1K3LA 4K6XA 5G1KA 17GSA 3UL3A 2H0HA 3KXOA 3GH9A 3GRXA 1G7OA 3IK7A 3U5RE 1PL2A 3QPMA 4V2MA 2H1GA 3LFLA 2VLVA 1V98A 1GUMA 3UBKA 2LJRA 4G10A 4XCSA 1K0CA 4OO5A 3L9VA 3N9JA 1YEPA 1F3AA 2O87A 4F03A 2DJKA 3CRTA 3IC8A 3GUSA 4BIKA 2LEGA 2C80A 5BRTA 5DCHA 1MD3A 1K0MA 1FVJA 2LRCA 2JZSA 5CAXA 1WWJA 1IYHA 1TRWA 4HJMA 2B6MA 1EEJA 4BVXA 2E7PA 4V2NA 2IMKA 3I43A 3DYRA 5G31A 1M3JA 1SL2B 3LWAA 3IR4A 2HXKA 4BPYA 3PH9A 4N0VA 5DALA 3GL3A 3SBCA 3HVNA 5G5FA 3KTBA 3RBTA 5LCZA 2RUFA 1A2LA 1MDKA 1X9MB 3LJRA 4PX1A 1M7TA 4EVMA 4EDZA 1X5CA 2PPTA 2QA2A 5ABRA 3ISOA 4O7HA 3J7Yk 4I97A 2VCXA 4PUAA 3GN3A 5KOWA 2O7KA 3L4NA 2AUVA 2REMA 4X43A 3ZMKA 2GZYA 1GSSA 2H1BA 4MZCA 2QKEA 1XW6A 1GSDA 1ZL9A 2IFQA 4KW6A 2B1LA 4MH2A 4MF7A 4F0BA 5HFGA 2FUG2 1VF4A 5D9TA 4EO3A 3VWWA 1Z3EA 2VM1A 2GZPA 4K1FA 1GLQA 5B7CA 2DIZA 2CQ9A 4G0LA 1PD21 4G19A 1PX6A 1R26A 2IMEA 2ES7A 2N5AA 4GCIA 4NHZA 1YEXA 4NXIA 2A2PA 1K3OA 1WE0A 4FH8A 3TKPA 2X8CA 2H72A 2CX4A 1FW1A 4KGIA 5DALB 2P31A 2VCTA 1A24A 5DAKA 5HR3A 5A4WA 2AV4A 4G0IA 3Q19A 2H76A 3ZRDA 1PKWA 5CRGA 2AB6A 2OBKA 1GNWA 1AIUA 1OC8A 4PTSA 3K8NA 3EYTA 4TVEA 4ZILA 4O5QA 1I5GA 2AAWA 1K0DA 3D4MA 2HRKA 1T7PB 4KNDA 4IKHA 3I9V2 2WS2A 2VCWA 4XS6A 2VOCA 2KLXA 3DKSA 2L4QA 3KIJA 2PERA 4JR6A 3O76A 4YQVA 1SKRB 1W89A 3ED3A 1VRSD 3A2VA 3TGZA 3TJGA 4CHSA 2GQLA 3SWLA 2HYXA 1BJXA 1GSUA 3F3RA 4LLRA 3ZLPA 4J57E 3ZITA 2OE1A 3KEBA 2H0GA 2DLXA 1XWAA 5INYA 2CA8A 2QA1A 1Z6NA 4ILFA 2LS5A 3IE3A 3GFKA 2YWOA 4EKZA 4IJ3A 2F8AA 1MEKA 5D9WA 3EMPA 3CSIA 2LTKA 1O85A 5DVBA 1Z5YE 3QDNA 1X0RA 1U3IA 5J9BA 2JADA 4WETA 1SK0A 1JLVA 3M1GA 1V57A 3KMNA 4WEYA 3FW2A 4K7IA 5DAKB 3JCML 1UA5A 3TOUA 2MBTA 5CRWA 2PGTA 1GNEA 1GTIA 1FOVA 4LMWA 1USBA 1F9MA 3M9KA 5EVOA 4IHUA 5HR1A 4RQRA 4PXOA 4IS0A 2GZZA 4KSMA 4MJCA 3UJ1A 2R6KA 2F9SA 1MDIA 1GRXA 1RQMA 4F2IA 4CDOA 4AF2A 2GSTA 3P7XA 2C0FA 2XPEA 1PKZA 5DJMA 3IRAA 5E59A 1YKCA 3GSTA 3LORA 4TN8A 3HHVA 1SK2A 3Q6OA 4MJEA 5LNKe 4HZ2A 3L9SA 1TRVA 2K18A 5J5NA 1NM3A 4OFTA 2M46A 3DD3A 4MZBA 4KX4A 2R5GA 2LUSA 3ZVJA 1EGOA 3APSA 5B6NA 5H5SA 3J7Yb 3ERWA 2J9HA 3G7JA 4IP1A 3TKQA 4KDUA 3D22A 1S3DA 1YKAA 2PMTA 2LRTA 3GA4A 2CZ2A 2VUPA 1FVKA 2JZRA 19GSA 1J9BA 4JBBA 3FYGA 4H86A 4WBJA 3EU3A 4MPGA 4MH3A 4NMUA 3VI7A 5B6MA 4FIWA 6GSVA 1TKDB 3KJYA 2B7KA 3F63A 3NIVA 2IL3A 2C3TA 4IQAA 1LJRA 2YZUA 2R3XA 1M2AA 1ACVA 1TI3A 2N5FA 3ZTLA 2AJQB 3DWVA 4DVCA 4EF0A 1PRXA 2G0FA 4N30A 2R2JA 3KZQA 1C72A 5DCGA 2KHPA 1QK8A 4DSRA 4YKGA 4RUVA 1KBNA 3QCPA 5KN3A 2I9HA 1GSEA 2NDOA 2HZEA 4MABA 5JWRB 3ZL5A 4BVYA 4D73B 3PINA 1XZOA 4FO5A 2X64A 4FYUA 3TCOA 3H93A 3UIWA 4TR4A 3AY8A 3GMFA 3UVTA 3ZYWA 2D2ZA 1QQ2A 3DMLA 2UZ8A 2ALBA 4EUYA 1S3RA 2GSSA 2MMOA 1WIKA 2RUEA 2YWMA 4WR4A 4J2FA 3FR6A 2ZNMA 3C8EA 5DQYA 3I69A 4KA0A 4Q5FA 4TXOA 1SKWB 1SL1B 4MNNA 3IC4A 2C0GA 3F4RA 5ECOB 4QL9A 22GSA 3HZ8A 3FHKA 4JE1A 4IELA 2VL3A 1XIYA 4Z7XA 2GGTA 3MIXA 4IGJA 4MF6A 5ECIB 5CNWA 2JU5A 3TJFA 2KP1A 5B8BA 4MPFA 3F4TA 4LL1B 2X4AA 1GTUA 1TK5B 2OADA 2VCQA 3CMIA 2GQMA 1QMVA 5COHA 4K7NA 3GTUA 1ERWA 1ZYNA 3UAPA 3KTLA 1OC9A 3FZ5A 1G6YA 4MCUA 1K3YA 4PUFC 4YH2A 1SU9A 4ZIJA 1N8JA 3HJPA 3IHGA
chains in the Genus database with same CATH topology
1GH2A 3QD9A 3DIEA 1KEBA 3OR5A 2DKHA 2LNSA 1FHEA 1ON4A 3BCKA 3EWLA 4OD7A 4Z2RA 2H30A 5HQPA 2M72A 4YAVA 4KCEA 3DEXA 1H75A 1VF1A 2R4VA 2G2QA 1F37A 4YKFA 4J56E 3ZFBA 3UOMA 18GSA 5KN1A 2OE0A 2IWTA 5IQYA 3FEUA 3IBHA 3VLNA 1NSWA 2FA8A 3DRNA 1EV4A 3ZMLA 5AIVA 4ZL7A 1THXA 1K0BA 3O6TA 3G9BA 4E8HA 12GSA 4CW9A 4OO4A 1WPIA 4TR0A 3HD5A 2HZFA 1LBKA 2FNOA 5D93A 2DMMA 3TJBA 1O6JA 1U88A 10GSA 1YY7A 2JSZA 4G2EA 1XW5A 3LYPA 3EINA 3NOFA 5IOXA 3TRPA 1SK1A 3GTUB 5GAND 3CSHA 1OC9B 3HVVA 3GKMA 3CBUA 2DJJA 2GTUA 1FO5A 4KE3A 2FWGA 4OFNA 2OE3A 2L5OA 4F82A 1EGRA 2NPBA 1T00A 3HVSA 5F8BA 3TUEA 1SJIA 2DC5A 4TKYA 5JCWA 2RIIA 5CREA 2ON5A 2VO4A 4POMA 3F0IA 3TJKA 2MMAA 1XVWA 2X49A 4DSQA 3KP9A 3A2WA 9GSSA 2DSAA 2WJUA 2VD0A 3WGEA 2RLIA 2E2MA 3CSJA 1SJZA 2C4JA 3LXTA 3RHCA 5IPGA 4ZL9A 4BWQA 2OACA 2K8SA 1M9BA 1LU4A 1TXXA 1SYRA 1YZXA 2XBQA 1T8EB 2IMIA 5GZZB 3VWXA 1J08A 4ZL8A 3TKSC 4MZWA 2MYGA 1XPVA 5IM9A 3M8NA 5J3RA 1OAZA 4PGTA 1O73A 2H1DA 1ERTA 4KUNA 3IPZA 4EXJA 3H1NA 5IMCA 3GNJA 3V1WA 5GSSA 2GSRA 4KSOA 3UARA 2C8UA 1DSBA 1OKDA 2L5LA 3H79A 2HRFA 2YANA 1XOBA 1BYEA 4N0ZA 2OBIA 4N10A 1A0RP 4NV5A 1A0FA 5DBQA 5G30A 14GSA 4OCEA 3LW9A 5HR0A 1XBSA 1R5AA 3ZVJD 3EPTA 3N5OA 3C1RA 3D5JA 3BD2A 2FD3A 4HJ2A 3VFIA 4TXVA 3R2QA 5EPFA 2VL2A 2C3QA 5JWQB 1VF3A 1JZOA 3EVIA 1WJKA 2Z9SA 4CY6A 4PURA 1EZKA 3C71A 2DJ0A 1AC1A 1ML6A 1M0UA 5ECLB 2CZ3A 5ECKB 4K8MA 2LV3A 4I6XA 3VK9A 1PN9A 2H70A 4F9ZA 3W8SA 1A8LA 1XWCA 5CRHA 4MLYA 5B8AA 3CTFA 4JU5A 2A4HA 1PQNA 4ZBBA 1WRYA 2LJKA 3W8JA 3ERGA 1VF2A 3QFBC 3ERFA 3E9JB 5F0GA 1URMA 1F2EA 1MDJA 3MSZA 3VI5A 2LQOA 2HRAA 4EIQA 1XW9A 2ON7A 3F4SA 3QAGA 3PR8A 2P5RA 4XS4B 4BA7A 1YQ1A 4KB3A 1NHOA 5G2ZA 1IYIA 3QR6A 2IMFA 4ML6A 5C00A 3MYDA 4I2UA 2DJ3A 3BCIA 5FWGA 5ECPB 2FHEA 1AAZA 3HYPA 4L0UA 3H4KA 5G1LA 2B1KA 16GSA 1GLPA 2R0PA 3F3QA 1TI1A 2X99A 3IHQA 1Q4JA 3ME7A 5HFKA 2FWFA 3F6DA 1T4YA 2HNLA 1T3BA 5CO3A 4OCFA 4WF5A 2H8LA 1GSQA 3G7IA 1EOGA 3EU4A 2VLUA 3HJMA 1G7EA 1O8XA 2HE3A 1E6BA 1JZDA 3UEMA 1AQVA 1Z9HA 2YPMA 11GSA 2C3NA 3FR3A 2H66A 5LD0A 4I2TA 4HUAA 2XC2A 2B3SA 2IMDA 5IMZA 1YF1A 1WMJA 3ZREA 4WXTA 3IA1A 4L5OA 5L71A 4PQ1A 4PQIA 4YAPA 2OA7A 4G9HA 2X8HA 1K0NA 1SENA 1TTZA 3MNGA 2O85A 1Z7RA 1ZYQB 2I81A 2V2GA 4D73A 2A2RA 2I1UA 4G0KA 1XVQA 2X8GA 3TRXA 2JACA 5A4UA 2B5EA 1R5PA 5DJLA 3FK8A 4NPBA 3KCMA 4O92A 3APQA 2H0IA 1WP0A 4MMMA 4TOPA 4XRAA 1QXHA 2LSTA 5A4VA 1GUHA 4DEJA 2CX3A 1T4ZA 4IN0A 4XRDA 4WR5A 4XHMA 1SKSB 2HSMA 1MD4A 1DBYA 2MZCA 4ACSA 2F51A 5C04A 2VCVA 3BJ5A 1W4VA 2H6ZA 5AISA 4BL7B 1S3CA 4K9ZA 4PQHA 1HQOA 2KP2A 1TJDA 2LKUA 1JHBA 1QFNA 2P5QA 4JRRA 3D21A 4O32A 6GSUA 6GSXA 1M2BA 3A3TA 4WKWA 1EP7A 1I9DA 3HJOA 2YWIA 2IIYA 3KM6A 3LG6A 4TW5A 3GX0A 2GT6A 1EP8A 4K2XA 5HR2A 1G0TA 3U6VA 1PGTA 2HSYA 4K5SA 6GSWA 2IJYA 2VAFA 5EL8A 4Z2TA 2R0CA 1B48A 3BOAA 4EE0A 2YP6A 5D73A 3EURA 4GLTA 2EIOA 3W6GA 3C7MA 4EC0A 3QOUA 2A4VA 4I8BA 1ABAA 5F07A 1NHYA 2H75A 4BWSA 3BBYA 4L0WA 4ID0A 4IW9A 4MJAA 1TDIA 3GH6A 3KMOA 4DSSA 5CP1A 4ZBAA 3UVHA 2VL2C 3WGXA 5IOWA 4ECJA 1BEDA 1A8YA 1FB0A 4RI6A 3RHBA 3HVXA 1UC7A 3KH9A 1HYUA 2PBJA 2HSHA 5D8IA 5D9XA 4Q5NA 5BMUA 2MMNA 3ZIVA 3FR9A 3GL5A 4ECCA 5IMDA 1DE2A 3DVWA 2B7JA 1GTAA 5IMVA 3EE2A 5J4UA 4N11A 5CRDA 4KAEA 3ZFLA 4ICYA 5D9VA 2P0GA 1GSYA 3TRQA 4OWYA 4HOJA 1G6WA 1MTCA 1OC3A 5AN1A 2FWEA 5ID2B 1V9WA 2AYTA 1T1VA 4GSSA 1AXDA 3ME8A 4OFMA 2LJAA 3A5IA 4QQ7A 1F3BA 3RPPA 3P8WA 1CQGA 3KH7A 4XS1A 4DSSB 1PSQA 2R37A 1TU7A 5ECMB 2WFCA 3HY2A 3FMWA 2VD1A 4L8EA 2HFDA 2RM6A 1GP1A 2HI7A 3P90A 4Q5QA 4AJ7A 5IIZA 5KN2A 3MWHA 6GSTA 2WRTA 3US3A 5DQSA 2ZCTA 1J0FA 1S3AA 3QAVA 4ML1A 3RAZA 4NV2A 2L6DA 2NTOA 2YJ7A 4KDYA 3RPNA 1WOUA 1M99A 1B8XA 3VWVA 3E0UA 1TRUA 4HQZA 4E8EA 20GSA 1HNCA 2VM2A 1HNBA 2EIQA 4AJ6A 1U87A 1XXUA 1SD8A 2CAQA 1B9YC 1GSFA 4TR3A 4EIPA 1GL8A 2GLRA 1F6MC 1X9WB 1XWGA 3QFAC 2DJ1A 5ENUA 1A2MA 4V2LA 2YV7A 2HLSA 1BG5A 4MK3A 1SJ6A 1B9XC 3LYKA 2WULA 4WBRD 4HZ4A 2VLTA 3GHAA 5G5EA 2L57A 1PMTA 3HKRA 5JWOB 5H5QA 2TRCP 1OE7A 4QL7A 4YQMA 5ECNB 1JZRA 3H8QA 3GV1A 3TJJA 2C1YA 3IAS2 3CTGA 1QUWA 2QSIA 1GTBA 1AQXA 3FRCA 4XS4A 3KD0A 2KUCA 1ZCPA 4KH7A 2V32A 4O5UA 1N2AA 2BTOT 1ZMAA 4ZXGA 4IP6A 2FGXA 4EL1A 5D96A 1RK4A 4TR1A 1X5EA 2VL9A 4CY8A 1FAAA 3HDCA 4HU7A 2EC4A 2IPAA 3MDKA 1AUCA 3A2XA 3VURA 4X1UA 6GSSA 2MMZA 3FZ4A 2JZTA 5IPHA 4MF5A 3L78A 3LEFA 2L4CA 4BVXB 1QGVA 4NAXA 1M2DA 3ZZXA 1V2AA 1YF0A 1H4OA 2DKIA 3APOA 2HRNA 2N5BA 3QAWA 4HDEA 3IAM2 2GDRA 1VGLA 3KP8A 3CRUA 1EOHA 1ILOA 2C0EA 2YNXA 5EY6A 2K6VA 1EEMA 1XWBA 3UMAA 1Q98A 2WCIA 3F6FA 4HEA2 1JZWA 4GXZA 2CAIA 1OE8A 5E4WA 3TOTA 4K7OA 4P3YB 1PL1A 3WT2A 1Z6MA 2YWNA 1TK0B 4POLA 2WGRA 1E2YA 4POBA 4FYBA 4K5RA 4HU9A 2BMXA 4MJBA 3WGDA 2K8VA 4TR1B 3PGTA 5J41A 5AIXA 1B4PA 4FQUA 2IFQB 2M80A 4LA1A 3M3MA 2H1AA 13GSA 4EDYA 1ZYEA 2L59A 3GKKA 2V6OA 5JCGA 2AHEA 4I5QA 5H5RA 3IV4A 2RM5A 2WDUA 1ST9A 1YDKA 4GSNA 8GSSA 3ZIJA 7GSSA 2JL4A 1R4WA 4NHWA 1KNGA 4GSTA 3C73A 2DIYA 1YJ6A 1BQ7A 4ZBDA 4GRFA 4ISDA 3FZAA 1ERVA 2PU9C 2GVPA 1V40A 2H01A 2XBIA 3HCZA 2PVQA 3D6IA 2QGVA 1GUKA 4BL7A 4IJIA 1A2JA 3D4TA 1SD9A 2LNTA 4GF0A 3GKXA 5JCUA 3GKNA 2V6KA 4K2DA 2OJLA 3G7YA 4USSA 2GQKA 3UBLA 3GIXA 4V1Ag 4HQSA 3TB2A 4GWRA 4Z2UA 5KOXA 5ELGA 3M9JA 3GYKA 5ECQB 4JR4A 1TRSA 3F8UA 4ZB9A 1GULA 1ZYPA 5FT3A 5A5KA 2GSQA 1B4QA 1BX9A 2PVOC 3F9UA 3L0HA 1OKTA 2KOKA 2F3MA 5IO2A 2L6CA 3C1SA 3CXGA 1HD2A 3LXZA 4ULXA 1CQHA 2I4AA 3VPTA 5ELAA 2XPDA 1U6TA 3VPQA 3M0FA 1BAYA 2VIMA 5KN0A 1TK8B 3DXBA 4K0GA 1FB6A 2I3YA 1M9AA 4ZB6A 1EV9A 3CYNA 4FYCA 1SYXA 2FY6A 1TOFA 2DBCA 1TU8A 1HNAA 3A5WA 2CVKA 3KGKA 3LSZA 4L5LA 1O8WA 4NWYA 3Q18A 2J23A 2LRNA 3D0ZA 4PNGA 3WT1A 1XWKA 3TKSA 5F05A 2H6YA 2WB9A 1ERUA 3EC3A 4ECIA 3IK9A 3P2AA 5IMAA 2NBSA 2GT5A 1ZZYA 4LMVA 4TRXA 4YQUA 4JEDA 3HA9A 1ZOFA 2K9FA 1GWCA 4JZQA 3WD6A 4X4JA 6GSYA 4HI7A 2QC7A 2H73A 2FCHA 1JLWA 1DE1A 4O5RA 3FY7A 2R0GA 2PUKC 5CYYA 2H71A 4RI7A 5IMFA 4V1Ap 5AGYA 2GS3A 1KTEA 4KDXA 3E3EA 4K0NA 2CT6A 2DMLA 2E2GA 3WYWA 3I6AA 2VCZA 1X5DA 5J9CA 2CVBA 3LQ7A 4IBPA 4KF9A 4Q5RA 2H6XA 3IDVA 2CV4A 2CVDA 4ECBA 1PX7A 3NZNA 3HXSA 5ID2A 1O81A 1ZGNA 4XTSA 2YV9A 2HT9A 5ECRB 1U3AA 4KCAA 4MDCA 4XIHA 2TRXA 4POKA 3DGQA 2LQQA 1Y6EA 5GSTA 3HZ4A 1Y25A 3R3EA 1XOAA 2F8FA 1OVNA 1JFUA 1X9SB 4ZB8A 2WZ9A 4A5PA 1UN2A 5F06A 2E0QA 1OYJA 5ECSA 2JSYA 2NVLA 2PWJA 4GQCA 2B5XA 1PA3A 5HFIA 1XFLA 2A2SA 1FOHA 1A23A 1NW2A 2XHFA 2H19A 2FA4A 4PNFA 2FWHA 5GAPD 2YN1A 4IQ1A 2H74A 4LL4B 4AJ8A 5IO0A 2B5YA 4IVFA 3GURA 4WF4A 3O3TA 1AQWA 2YCDA 3FKFA 3PPUA 2OKAA 3EMXA 4MA9A 4GTUA 3DVXA 3S9FA 1RW1A 2ZUPA 1O7UA 3GX8A 2IN3A 3TDGA 1SL0B 3TKRA 1FG4A 1R7HA 1PN0A 3TKSE 2EIRA 2TIRA 1V58A 1TP9A 5FHIA 2HZEB 3GSSA 1K0AA 1EWXA 5DDLA 4BVYB 2O8VB 3RDWA 2FLSA 1THOA 2YZHA 1Z7PA 2BJXA 2C0DA 3IXRA 3L9UA 2MBSA 3QMXA 2O89A 2DJ2A 4AGSA 5ECHB 2YOIA 4GQFA 3IOSA 5KEJA 2PN8A 2V41A 2YJHA 1XCCA 3MAKA 1AW9A 3LGCA 1UVZA 3VWUA 4RQXA 1TW9A 4OMVA 4X0XA 3FZ9A 1DUGA 2V1MA 4MP4A 4TXOB 3Q74A 4F0CA 4HS1A 1K0OA 1K3LA 4K6XA 5G1KA 17GSA 3UL3A 2H0HA 3KXOA 3GH9A 3GRXA 1G7OA 3IK7A 3U5RE 1PL2A 3QPMA 4V2MA 2H1GA 3LFLA 2VLVA 1V98A 1GUMA 3UBKA 2LJRA 4G10A 4XCSA 1K0CA 4OO5A 3L9VA 3N9JA 1YEPA 1F3AA 2O87A 4F03A 2DJKA 3CRTA 3IC8A 3GUSA 2LEGA 2C80A 5BRTA 5DCHA 1MD3A 1K0MA 1FVJA 2LRCA 2JZSA 5CAXA 1WWJA 1IYHA 1TRWA 4HJMA 2B6MA 1EEJA 4BVXA 2E7PA 4V2NA 2IMKA 3I43A 3DYRA 5G31A 1SL2B 3LWAA 3IR4A 2HXKA 4BPYA 3PH9A 4N0VA 5DALA 3GL3A 3SBCA 5G5FA 3KTBA 3RBTA 5LCZA 2RUFA 1A2LA 1MDKA 1X9MB 3LJRA 4PX1A 1M7TA 4EVMA 4EDZA 1X5CA 2PPTA 2QA2A 5ABRA 3ISOA 4O7HA 3J7Yk 4I97A 2VCXA 4PUAA 3GN3A 5KOWA 2O7KA 3L4NA 2AUVA 2REMA 4X43A 3ZMKA 2GZYA 1GSSA 2H1BA 4MZCA 2QKEA 1XW6A 1GSDA 1ZL9A 2IFQA 4KW6A 2B1LA 4MH2A 4MF7A 4F0BA 5HFGA 2FUG2 1VF4A 5D9TA 4EO3A 3VWWA 1Z3EA 2VM1A 2GZPA 4K1FA 1GLQA 5B7CA 2DIZA 2CQ9A 4G0LA 1PD21 4G19A 1PX6A 1R26A 2IMEA 2ES7A 2N5AA 4GCIA 4NHZA 1YEXA 4NXIA 2A2PA 1K3OA 1WE0A 4FH8A 3TKPA 2X8CA 2H72A 2CX4A 1FW1A 4KGIA 5DALB 2P31A 2VCTA 1A24A 5DAKA 5HR3A 5A4WA 2AV4A 4G0IA 3Q19A 2H76A 3ZRDA 1PKWA 5CRGA 2AB6A 2OBKA 1GNWA 1AIUA 1OC8A 4PTSA 3K8NA 3EYTA 4TVEA 4ZILA 4O5QA 1I5GA 2AAWA 1K0DA 3D4MA 2HRKA 1T7PB 4KNDA 4IKHA 3I9V2 2WS2A 2VCWA 4XS6A 2VOCA 2KLXA 3DKSA 2L4QA 3KIJA 2PERA 4JR6A 3O76A 4YQVA 1SKRB 1W89A 3ED3A 1VRSD 3A2VA 3TGZA 3TJGA 4CHSA 2GQLA 3SWLA 2HYXA 1BJXA 1GSUA 3F3RA 4LLRA 3ZLPA 4J57E 3ZITA 2OE1A 3KEBA 2H0GA 2DLXA 1XWAA 5INYA 2CA8A 2QA1A 1Z6NA 4ILFA 2LS5A 3IE3A 3GFKA 2YWOA 4EKZA 4IJ3A 2F8AA 1MEKA 5D9WA 3EMPA 3CSIA 2LTKA 1O85A 5DVBA 1Z5YE 3QDNA 1X0RA 1U3IA 5J9BA 2JADA 4WETA 1SK0A 1JLVA 3M1GA 1V57A 3KMNA 4WEYA 3FW2A 4K7IA 5DAKB 3JCML 1UA5A 3TOUA 2MBTA 5CRWA 2PGTA 1GNEA 1GTIA 1FOVA 4LMWA 1USBA 1F9MA 3M9KA 5EVOA 4IHUA 5HR1A 4RQRA 4PXOA 4IS0A 2GZZA 4KSMA 4MJCA 3UJ1A 2R6KA 2F9SA 1MDIA 1GRXA 1RQMA 4F2IA 4CDOA 4AF2A 2GSTA 3P7XA 2C0FA 2XPEA 1PKZA 5DJMA 3IRAA 5E59A 1YKCA 3GSTA 3LORA 4TN8A 3HHVA 1SK2A 3Q6OA 4MJEA 5LNKe 4HZ2A 3L9SA 1TRVA 2K18A 5J5NA 1NM3A 4OFTA 2M46A 3DD3A 4MZBA 4KX4A 2R5GA 2LUSA 3ZVJA 1EGOA 3APSA 5B6NA 5H5SA 3J7Yb 3ERWA 2J9HA 3G7JA 4IP1A 3TKQA 4KDUA 3D22A 1S3DA 1YKAA 2PMTA 2LRTA 3GA4A 2CZ2A 2VUPA 1FVKA 2JZRA 19GSA 1J9BA 4JBBA 3FYGA 4H86A 4WBJA 3EU3A 4MPGA 4MH3A 4NMUA 3VI7A 5B6MA 4FIWA 6GSVA 1TKDB 3KJYA 2B7KA 3F63A 3NIVA 2IL3A 2C3TA 4IQAA 1LJRA 2YZUA 2R3XA 1M2AA 1ACVA 1TI3A 2N5FA 3ZTLA 2AJQB 3DWVA 4DVCA 4EF0A 1PRXA 2G0FA 4N30A 2R2JA 3KZQA 1C72A 5DCGA 2KHPA 1QK8A 4DSRA 4YKGA 4RUVA 1KBNA 3QCPA 5KN3A 2I9HA 1GSEA 2NDOA 2HZEA 4MABA 5JWRB 3ZL5A 4BVYA 4D73B 3PINA 1XZOA 4FO5A 2X64A 4FYUA 3TCOA 3H93A 3UIWA 4TR4A 3AY8A 3GMFA 3UVTA 3ZYWA 2D2ZA 1QQ2A 3DMLA 2UZ8A 2ALBA 4EUYA 2GSSA 2MMOA 1WIKA 2RUEA 2YWMA 4WR4A 4J2FA 3FR6A 2ZNMA 3C8EA 5DQYA 3I69A 4KA0A 4Q5FA 4TXOA 1SKWB 1SL1B 4MNNA 3IC4A 2C0GA 3F4RA 5ECOB 4QL9A 22GSA 3HZ8A 3FHKA 4JE1A 4IELA 2VL3A 1XIYA 4Z7XA 2GGTA 3MIXA 4IGJA 4MF6A 5ECIB 5CNWA 2JU5A 3TJFA 2KP1A 5B8BA 4MPFA 3F4TA 4LL1B 2X4AA 1GTUA 1TK5B 2OADA 2VCQA 3CMIA 2GQMA 1QMVA 5COHA 4K7NA 3GTUA 1ERWA 1ZYNA 3UAPA 3KTLA 1OC9A 3FZ5A 1G6YA 4MCUA 1K3YA 4PUFC 4YH2A 1SU9A 4ZIJA 1N8JA 3HJPA 3IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH2 A;  3QD9 A;  3DIE A;  1KEB A;  3OR5 A;  2LNS A;  1FHE A;  1ON4 A;  3BCK A;  3EWL A;  4OD7 A;  2H30 A;  5HQP A;  2M72 A;  4YAV A;  4KCE A;  3DEX A;  1H75 A;  1VF1 A;  2R4V A;  2G2Q A;  1F37 A;  4J56 E;  3ZFB A;  3UOM A;  18GS A;  5KN1 A;  2OE0 A;  2IWT A;  5IQY A;  3FEU A;  3IBH A;  3VLN A;  1NSW A;  2FA8 A;  3DRN A;  1EV4 A;  3ZML A;  5AIV A;  4ZL7 A;  1THX A;  1K0B A;  3O6T A;  3G9B A;  4E8H A;  12GS A;  4CW9 A;  4OO4 A;  1WPI A;  4TR0 A;  3HD5 A;  2HZF A;  1LBK A;  2FNO A;  5D93 A;  2DMM A;  3TJB A;  1O6J A;  1U88 A;  10GS A;  1YY7 A;  2JSZ A;  4G2E A;  1XW5 A;  3LYP A;  3EIN A;  3NOF A;  5IOX A;  3TRP A;  1SK1 A;  3GTU B;  5GAN D;  3CSH A;  1OC9 B;  3HVV A;  3GKM A;  3CBU A;  2DJJ A;  2GTU A;  1FO5 A;  4KE3 A;  2FWG A;  4OFN A;  2OE3 A;  2L5O A;  4F82 A;  1EGR A;  2NPB A;  1T00 A;  3HVS A;  5F8B A;  3TUE A;  1SJI A;  2DC5 A;  4TKY A;  5JCW A;  2RII A;  5CRE A;  2ON5 A;  2VO4 A;  4POM A;  3F0I A;  3TJK A;  2MMA A;  1XVW A;  4DSQ A;  3KP9 A;  3A2W A;  9GSS A;  2DSA A;  2WJU A;  2VD0 A;  3WGE A;  2RLI A;  2E2M A;  3CSJ A;  1SJZ A;  2C4J A;  3LXT A;  3RHC A;  5IPG A;  4ZL9 A;  4BWQ A;  2OAC A;  2K8S A;  1M9B A;  1LU4 A;  1TXX A;  1SYR A;  1YZX A;  2XBQ A;  1T8E B;  2IMI A;  5GZZ B;  3VWX A;  1J08 A;  4ZL8 A;  3TKS C;  4MZW A;  2MYG A;  1XPV A;  5IM9 A;  3M8N A;  5J3R A;  1OAZ A;  4PGT A;  1O73 A;  2H1D A;  1ERT A;  4KUN A;  3IPZ A;  4EXJ A;  3H1N A;  5IMC A;  3GNJ A;  3V1W A;  5GSS A;  2GSR A;  4KSO A;  3UAR A;  2C8U A;  1DSB A;  1OKD A;  2L5L A;  3H79 A;  2HRF A;  2YAN A;  1XOB A;  1BYE A;  4N0Z A;  2OBI A;  4N10 A;  1A0R P;  4NV5 A;  1A0F A;  5DBQ A;  5G30 A;  14GS A;  4OCE A;  5HR0 A;  1XBS A;  1R5A A;  3ZVJ D;  3N5O A;  3C1R A;  3D5J A;  3BD2 A;  2FD3 A;  4HJ2 A;  3VFI A;  4TXV A;  3R2Q A;  5EPF A;  2VL2 A;  2C3Q A;  5JWQ B;  1VF3 A;  1JZO A;  3EVI A;  1WJK A;  2Z9S A;  4PUR A;  1EZK A;  3C71 A;  2DJ0 A;  1AC1 A;  1ML6 A;  1M0U A;  5ECL B;  2CZ3 A;  5ECK B;  4K8M A;  2LV3 A;  4I6X A;  3VK9 A;  1PN9 A;  2H70 A;  4F9Z A;  3W8S A;  1A8L A;  1XWC A;  5CRH A;  4MLY A;  5B8A A;  3CTF A;  4JU5 A;  1PQN A;  4ZBB A;  1WRY A;  2LJK A;  3W8J A;  3ERG A;  1VF2 A;  3QFB C;  3ERF A;  3E9J B;  5F0G A;  1URM A;  1F2E A;  1MDJ A;  3MSZ A;  3VI5 A;  2LQO A;  1XW9 A;  2ON7 A;  3F4S A;  3QAG A;  3PR8 A;  2P5R A;  4XS4 B;  4BA7 A;  1YQ1 A;  4KB3 A;  1NHO A;  5G2Z A;  1IYI A;  3QR6 A;  2IMF A;  4ML6 A;  5C00 A;  4I2U A;  2DJ3 A;  3BCI A;  5FWG A;  5ECP B;  2FHE A;  1AAZ A;  3HYP A;  4L0U A;  3H4K A;  5G1L A;  2B1K A;  16GS A;  1GLP A;  3F3Q A;  1TI1 A;  2X99 A;  3IHQ A;  1Q4J A;  3ME7 A;  5HFK A;  2FWF A;  3F6D A;  1T4Y A;  2HNL A;  1T3B A;  5CO3 A;  4OCF A;  4WF5 A;  2H8L A;  1GSQ A;  3G7I A;  1EOG A;  3EU4 A;  2VLU A;  3HJM A;  1G7E A;  1O8X A;  2HE3 A;  1E6B A;  1JZD A;  3UEM A;  1AQV A;  1Z9H A;  2YPM A;  11GS A;  2C3N A;  3FR3 A;  2H66 A;  5LD0 A;  4I2T A;  4HUA A;  2XC2 A;  2B3S A;  2IMD A;  5IMZ A;  1YF1 A;  1WMJ A;  3ZRE A;  4WXT A;  3IA1 A;  4L5O A;  5L71 A;  4PQ1 A;  4PQI A;  4YAP A;  2OA7 A;  4G9H A;  2X8H A;  1K0N A;  1SEN A;  1TTZ A;  3MNG A;  2O85 A;  1Z7R A;  1ZYQ B;  2I81 A;  2V2G A;  4D73 A;  2A2R A;  2I1U A;  1XVQ A;  2X8G A;  3TRX A;  2JAC A;  5A4U A;  2B5E A;  1R5P A;  5DJL A;  3FK8 A;  4NPB A;  3KCM A;  4O92 A;  3APQ A;  2H0I A;  1WP0 A;  4MMM A;  4TOP A;  4XRA A;  1QXH A;  2LST A;  5A4V A;  1GUH A;  4DEJ A;  2CX3 A;  1T4Z A;  4IN0 A;  4XRD A;  4WR5 A;  4XHM A;  1SKS B;  1MD4 A;  1DBY A;  2MZC A;  4ACS A;  2F51 A;  5C04 A;  2VCV A;  3BJ5 A;  1W4V A;  2H6Z A;  5AIS A;  1S3C A;  4K9Z A;  4PQH A;  1HQO A;  2KP2 A;  1TJD A;  2LKU A;  1JHB A;  1QFN A;  2P5Q A;  4JRR A;  3D21 A;  4O32 A;  6GSU A;  6GSX A;  1M2B A;  3A3T A;  4WKW A;  1EP7 A;  1I9D A;  3HJO A;  2YWI A;  2IIY A;  3KM6 A;  3LG6 A;  4TW5 A;  3GX0 A;  2GT6 A;  1EP8 A;  5HR2 A;  1G0T A;  3U6V A;  1PGT A;  2HSY A;  6GSW A;  2IJY A;  2VAF A;  5EL8 A;  1B48 A;  3BOA A;  4EE0 A;  2YP6 A;  5D73 A;  3EUR A;  4GLT A;  2EIO A;  3W6G A;  3C7M A;  4EC0 A;  3QOU A;  2A4V A;  4I8B A;  1ABA A;  5F07 A;  1NHY A;  2H75 A;  4BWS A;  3BBY A;  4L0W A;  4ID0 A;  4IW9 A;  4MJA A;  1TDI A;  3GH6 A;  3KMO A;  4DSS A;  5CP1 A;  4ZBA A;  3UVH A;  2VL2 C;  3WGX A;  5IOW A;  4ECJ A;  1BED A;  1A8Y A;  1FB0 A;  4RI6 A;  3RHB A;  3HVX A;  1UC7 A;  3KH9 A;  1HYU A;  2PBJ A;  2HSH A;  5D8I A;  5D9X A;  4Q5N A;  2MMN A;  3ZIV A;  3FR9 A;  3GL5 A;  4ECC A;  5IMD A;  1DE2 A;  3DVW A;  2B7J A;  1GTA A;  5IMV A;  3EE2 A;  5J4U A;  4N11 A;  5CRD A;  4KAE A;  3ZFL A;  5D9V A;  2P0G A;  1GSY A;  3TRQ A;  4OWY A;  4HOJ A;  1G6W A;  1MTC A;  1OC3 A;  5AN1 A;  2FWE A;  5ID2 B;  1V9W A;  2AYT A;  1T1V A;  4GSS A;  1AXD A;  3ME8 A;  4OFM A;  2LJA A;  4QQ7 A;  1F3B A;  3RPP A;  3P8W A;  1CQG A;  3KH7 A;  4XS1 A;  4DSS B;  1PSQ A;  2R37 A;  1TU7 A;  5ECM B;  2WFC A;  3HY2 A;  2VD1 A;  4L8E A;  2HFD A;  2RM6 A;  1GP1 A;  2HI7 A;  3P90 A;  4Q5Q A;  4AJ7 A;  5IIZ A;  5KN2 A;  3MWH A;  6GST A;  2WRT A;  3US3 A;  5DQS A;  2ZCT A;  1J0F A;  1S3A A;  3QAV A;  4ML1 A;  3RAZ A;  4NV2 A;  2L6D A;  2NTO A;  2YJ7 A;  4KDY A;  3RPN A;  1WOU A;  1M99 A;  1B8X A;  3VWV A;  3E0U A;  1TRU A;  4HQZ A;  4E8E A;  20GS A;  1HNC A;  2VM2 A;  1HNB A;  2EIQ A;  4AJ6 A;  1U87 A;  1XXU A;  1SD8 A;  2CAQ A;  1B9Y C;  1GSF A;  4TR3 A;  1GL8 A;  2GLR A;  1F6M C;  1X9W B;  1XWG A;  3QFA C;  2DJ1 A;  5ENU A;  1A2M A;  4V2L A;  2YV7 A;  2HLS A;  1BG5 A;  4MK3 A;  1SJ6 A;  1B9X C;  3LYK A;  2WUL A;  4WBR D;  4HZ4 A;  2VLT A;  3GHA A;  5G5E A;  2L57 A;  1PMT A;  3HKR A;  5JWO B;  5H5Q A;  2TRC P;  1OE7 A;  4QL7 A;  4YQM A;  5ECN B;  1JZR A;  3H8Q A;  3GV1 A;  3TJJ A;  2C1Y A;  3IAS 2;  3CTG A;  1QUW A;  2QSI A;  1GTB A;  1AQX A;  3FRC A;  4XS4 A;  3KD0 A;  2KUC A;  1ZCP A;  4KH7 A;  2V32 A;  1N2A A;  2BTO T;  1ZMA A;  4ZXG A;  4IP6 A;  2FGX A;  4EL1 A;  5D96 A;  1RK4 A;  4TR1 A;  1X5E A;  2VL9 A;  1FAA A;  3HDC A;  4HU7 A;  2EC4 A;  2IPA A;  3MDK A;  1AUC A;  3A2X A;  3VUR A;  4X1U A;  6GSS A;  2MMZ A;  3FZ4 A;  2JZT A;  5IPH A;  4MF5 A;  3L78 A;  3LEF A;  2L4C A;  1QGV A;  4NAX A;  1M2D A;  3ZZX A;  1V2A A;  1YF0 A;  1H4O A;  3APO A;  2HRN A;  2N5B A;  3QAW A;  4HDE A;  3IAM 2;  2GDR A;  1VGL A;  3KP8 A;  3CRU A;  1EOH A;  1ILO A;  2C0E A;  2YNX A;  5EY6 A;  2K6V A;  1EEM A;  1XWB A;  3UMA A;  1Q98 A;  2WCI A;  3F6F A;  4HEA 2;  1JZW A;  4GXZ A;  2CAI A;  1OE8 A;  5E4W A;  3TOT A;  4K7O A;  4P3Y B;  1PL1 A;  3WT2 A;  1Z6M A;  2YWN A;  1TK0 B;  4POL A;  2WGR A;  1E2Y A;  4POB A;  4FYB A;  4HU9 A;  2BMX A;  4MJB A;  3WGD A;  2K8V A;  4TR1 B;  3PGT A;  5J41 A;  5AIX A;  1B4P A;  2IFQ B;  2M80 A;  4LA1 A;  3M3M A;  2H1A A;  13GS A;  4EDY A;  1ZYE A;  2L59 A;  3GKK A;  2V6O A;  5JCG A;  2AHE A;  4I5Q A;  5H5R A;  3IV4 A;  2RM5 A;  2WDU A;  1ST9 A;  1YDK A;  4GSN A;  8GSS A;  3ZIJ A;  7GSS A;  2JL4 A;  1R4W A;  4NHW A;  1KNG A;  4GST A;  3C73 A;  2DIY A;  1YJ6 A;  1BQ7 A;  4ZBD A;  4GRF A;  4ISD A;  3FZA A;  1ERV A;  2PU9 C;  2GVP A;  1V40 A;  2H01 A;  2XBI A;  3HCZ A;  2PVQ A;  3D6I A;  2QGV A;  1GUK A;  4BL7 A;  4IJI A;  1A2J A;  3D4T A;  1SD9 A;  2LNT A;  4GF0 A;  3GKX A;  5JCU A;  3GKN A;  2V6K A;  4K2D A;  2OJL A;  3G7Y A;  2GQK A;  3UBL A;  3GIX A;  4V1A g;  4HQS A;  3TB2 A;  4GWR A;  5ELG A;  3M9J A;  3GYK A;  5ECQ B;  4JR4 A;  1TRS A;  3F8U A;  4ZB9 A;  1GUL A;  5FT3 A;  5A5K A;  2GSQ A;  1B4Q A;  1BX9 A;  2PVO C;  3F9U A;  3L0H A;  1OKT A;  2KOK A;  2F3M A;  5IO2 A;  2L6C A;  3C1S A;  3CXG A;  1HD2 A;  3LXZ A;  4ULX A;  1CQH A;  2I4A A;  3VPT A;  5ELA A;  2XPD A;  1U6T A;  3VPQ A;  3M0F A;  1BAY A;  2VIM A;  5KN0 A;  1TK8 B;  3DXB A;  4K0G A;  1FB6 A;  2I3Y A;  1M9A A;  4ZB6 A;  1EV9 A;  3CYN A;  4FYC A;  1SYX A;  2FY6 A;  1TOF A;  2DBC A;  1TU8 A;  1HNA A;  3A5W A;  2CVK A;  3KGK A;  3LSZ A;  4L5L A;  1O8W A;  4NWY A;  3Q18 A;  2J23 A;  2LRN A;  3D0Z A;  4PNG A;  3WT1 A;  1XWK A;  3TKS A;  5F05 A;  2H6Y A;  2WB9 A;  1ERU A;  3EC3 A;  4ECI A;  3IK9 A;  3P2A A;  5IMA A;  2NBS A;  2GT5 A;  1ZZY A;  4LMV A;  4TRX A;  4YQU A;  4JED A;  3HA9 A;  1ZOF A;  2K9F A;  1GWC A;  4JZQ A;  3WD6 A;  6GSY A;  4HI7 A;  2QC7 A;  2H73 A;  2FCH A;  1JLW A;  1DE1 A;  4O5R A;  3FY7 A;  2PUK C;  5CYY A;  2H71 A;  4RI7 A;  5IMF A;  4V1A p;  5AGY A;  2GS3 A;  1KTE A;  4KDX A;  3E3E A;  4K0N A;  2CT6 A;  2DML A;  2E2G A;  3WYW A;  3I6A A;  2VCZ A;  1X5D A;  5J9C A;  2CVB A;  3LQ7 A;  4IBP A;  4Q5R A;  2H6X A;  3IDV A;  2CV4 A;  2CVD A;  4ECB A;  1PX7 A;  3NZN A;  3HXS A;  5ID2 A;  1O81 A;  1ZGN A;  4XTS A;  2YV9 A;  2HT9 A;  5ECR B;  1U3A A;  4KCA A;  4MDC A;  4XIH A;  2TRX A;  4POK A;  3DGQ A;  2LQQ A;  1Y6E A;  5GST A;  3HZ4 A;  1Y25 A;  1XOA A;  2F8F A;  1OVN A;  1JFU A;  1X9S B;  4ZB8 A;  2WZ9 A;  1UN2 A;  5F06 A;  2E0Q A;  1OYJ A;  5ECS A;  2JSY A;  2NVL A;  2PWJ A;  4GQC A;  2B5X A;  1PA3 A;  5HFI A;  1XFL A;  2A2S A;  1A23 A;  1NW2 A;  2XHF A;  2H19 A;  2FA4 A;  4PNF A;  2FWH A;  5GAP D;  2YN1 A;  4IQ1 A;  2H74 A;  4LL4 B;  4AJ8 A;  5IO0 A;  2B5Y A;  4IVF A;  3GUR A;  4WF4 A;  3O3T A;  1AQW A;  2YCD A;  3FKF A;  2OKA A;  3EMX A;  4MA9 A;  4GTU A;  3DVX A;  3S9F A;  1RW1 A;  2ZUP A;  1O7U A;  3GX8 A;  2IN3 A;  3TDG A;  1SL0 B;  3TKR A;  1FG4 A;  1R7H A;  3TKS E;  2EIR A;  2TIR A;  1V58 A;  1TP9 A;  5FHI A;  2HZE B;  3GSS A;  1K0A A;  1EWX A;  5DDL A;  2O8V B;  3RDW A;  2FLS A;  1THO A;  2YZH A;  1Z7P A;  2BJX A;  2C0D A;  3IXR A;  3L9U A;  2MBS A;  3QMX A;  2O89 A;  2DJ2 A;  4AGS A;  5ECH B;  2YOI A;  4GQF A;  3IOS A;  5KEJ A;  2PN8 A;  2V41 A;  2YJH A;  1XCC A;  3MAK A;  1AW9 A;  3LGC A;  1UVZ A;  3VWU A;  4RQX A;  1TW9 A;  4OMV A;  4X0X A;  3FZ9 A;  1DUG A;  2V1M A;  4MP4 A;  4TXO B;  3Q74 A;  4F0C A;  4HS1 A;  1K0O A;  1K3L A;  4K6X A;  5G1K A;  17GS A;  3UL3 A;  2H0H A;  3KXO A;  3GH9 A;  3GRX A;  1G7O A;  3IK7 A;  3U5R E;  1PL2 A;  3QPM A;  4V2M A;  2H1G A;  3LFL A;  2VLV A;  1V98 A;  1GUM A;  3UBK A;  2LJR A;  4G10 A;  4XCS A;  1K0C A;  4OO5 A;  3L9V A;  3N9J A;  1YEP A;  1F3A A;  2O87 A;  4F03 A;  2DJK A;  3CRT A;  3GUS A;  2LEG A;  2C80 A;  5DCH A;  1MD3 A;  1K0M A;  1FVJ A;  2LRC A;  2JZS A;  5CAX A;  1WWJ A;  1IYH A;  1TRW A;  4HJM A;  2B6M A;  1EEJ A;  4BVX A;  2E7P A;  4V2N A;  2IMK A;  3I43 A;  3DYR A;  5G31 A;  1SL2 B;  3LWA A;  3IR4 A;  2HXK A;  4BPY A;  3PH9 A;  4N0V A;  5DAL A;  3GL3 A;  3SBC A;  5G5F A;  3KTB A;  3RBT A;  5LCZ A;  2RUF A;  1A2L A;  1MDK A;  1X9M B;  3LJR A;  4PX1 A;  1M7T A;  4EVM A;  4EDZ A;  1X5C A;  2PPT A;  5ABR A;  3ISO A;  4O7H A;  3J7Y k;  4I97 A;  2VCX A;  4PUA A;  3GN3 A;  2O7K A;  3L4N A;  2AUV A;  2REM A;  4X43 A;  3ZMK A;  2GZY A;  1GSS A;  2H1B A;  4MZC A;  2QKE A;  1XW6 A;  1GSD A;  1ZL9 A;  2IFQ A;  4KW6 A;  2B1L A;  4MH2 A;  4MF7 A;  4F0B A;  5HFG A;  2FUG 2;  1VF4 A;  5D9T A;  4EO3 A;  3VWW A;  1Z3E A;  2VM1 A;  2GZP A;  4K1F A;  1GLQ A;  5B7C A;  2DIZ A;  2CQ9 A;  1PD2 1;  4G19 A;  1PX6 A;  1R26 A;  2IME A;  2ES7 A;  2N5A A;  4GCI A;  4NHZ A;  1YEX A;  4NXI A;  1K3O A;  1WE0 A;  4FH8 A;  3TKP A;  2X8C A;  2H72 A;  2CX4 A;  1FW1 A;  4KGI A;  5DAL B;  2P31 A;  2VCT A;  1A24 A;  5DAK A;  5HR3 A;  5A4W A;  2AV4 A;  3Q19 A;  2H76 A;  3ZRD A;  1PKW A;  5CRG A;  2AB6 A;  2OBK A;  1GNW A;  1AIU A;  1OC8 A;  3K8N A;  3EYT A;  4TVE A;  4ZIL A;  1I5G A;  2AAW A;  1K0D A;  3D4M A;  1T7P B;  4KND A;  4IKH A;  3I9V 2;  2WS2 A;  2VCW A;  4XS6 A;  2VOC A;  2KLX A;  3DKS A;  2L4Q A;  3KIJ A;  2PER A;  4JR6 A;  3O76 A;  4YQV A;  1SKR B;  1W89 A;  3ED3 A;  1VRS D;  3A2V A;  3TGZ A;  3TJG A;  4CHS A;  2GQL A;  3SWL A;  2HYX A;  1BJX A;  1GSU A;  3F3R A;  4LLR A;  3ZLP A;  4J57 E;  3ZIT A;  2OE1 A;  3KEB A;  2H0G A;  2DLX A;  1XWA A;  5INY A;  2CA8 A;  1Z6N A;  4ILF A;  2LS5 A;  3IE3 A;  3GFK A;  2YWO A;  4EKZ A;  4IJ3 A;  2F8A A;  1MEK A;  5D9W A;  3EMP A;  3CSI A;  2LTK A;  1O85 A;  5DVB A;  1Z5Y E;  3QDN A;  1X0R A;  1U3I A;  5J9B A;  2JAD A;  4WET A;  1SK0 A;  1JLV A;  3M1G A;  1V57 A;  3KMN A;  4WEY A;  3FW2 A;  4K7I A;  5DAK B;  3JCM L;  1UA5 A;  3TOU A;  2MBT A;  5CRW A;  2PGT A;  1GNE A;  1GTI A;  1FOV A;  4LMW A;  1USB A;  1F9M A;  3M9K A;  5EVO A;  4IHU A;  5HR1 A;  4RQR A;  4PXO A;  4IS0 A;  2GZZ A;  4KSM A;  4MJC A;  3UJ1 A;  2R6K A;  2F9S A;  1MDI A;  1GRX A;  1RQM A;  4F2I A;  4CDO A;  4AF2 A;  2GST A;  3P7X A;  2C0F A;  2XPE A;  1PKZ A;  5DJM A;  3IRA A;  5E59 A;  1YKC A;  3GST A;  3LOR A;  4TN8 A;  3HHV A;  1SK2 A;  3Q6O A;  4MJE A;  5LNK e;  4HZ2 A;  3L9S A;  1TRV A;  2K18 A;  5J5N A;  1NM3 A;  4OFT A;  2M46 A;  3DD3 A;  4MZB A;  4KX4 A;  2R5G A;  2LUS A;  3ZVJ A;  1EGO A;  3APS A;  5B6N A;  5H5S A;  3J7Y b;  3ERW A;  2J9H A;  3G7J A;  4IP1 A;  3TKQ A;  4KDU A;  3D22 A;  1S3D A;  1YKA A;  2PMT A;  2LRT A;  3GA4 A;  2CZ2 A;  2VUP A;  1FVK A;  2JZR A;  19GS A;  1J9B A;  4JBB A;  3FYG A;  4H86 A;  4WBJ A;  3EU3 A;  4MPG A;  4MH3 A;  4NMU A;  3VI7 A;  5B6M A;  4FIW A;  6GSV A;  1TKD B;  3KJY A;  2B7K A;  3F63 A;  3NIV A;  2IL3 A;  2C3T A;  4IQA A;  1LJR A;  2YZU A;  2R3X A;  1M2A A;  1ACV A;  1TI3 A;  2N5F A;  3ZTL A;  2AJQ B;  3DWV A;  4DVC A;  4EF0 A;  1PRX A;  2G0F A;  4N30 A;  2R2J A;  3KZQ A;  1C72 A;  5DCG A;  2KHP A;  1QK8 A;  4DSR A;  4RUV A;  1KBN A;  3QCP A;  5KN3 A;  2I9H A;  1GSE A;  2NDO A;  2HZE A;  4MAB A;  5JWR B;  3ZL5 A;  4BVY A;  4D73 B;  3PIN A;  1XZO A;  4FO5 A;  2X64 A;  4FYU A;  3TCO A;  3H93 A;  3UIW A;  4TR4 A;  3AY8 A;  3GMF A;  3UVT A;  3ZYW A;  2D2Z A;  1QQ2 A;  3DML A;  2ALB A;  4EUY A;  2GSS A;  2MMO A;  1WIK A;  2RUE A;  2YWM A;  4WR4 A;  4J2F A;  3FR6 A;  2ZNM A;  3C8E A;  5DQY A;  3I69 A;  4KA0 A;  4Q5F A;  4TXO A;  1SKW B;  1SL1 B;  3IC4 A;  2C0G A;  3F4R A;  5ECO B;  4QL9 A;  22GS A;  3HZ8 A;  3FHK A;  4JE1 A;  4IEL A;  2VL3 A;  1XIY A;  4Z7X A;  2GGT A;  4IGJ A;  4MF6 A;  5ECI B;  5CNW A;  2JU5 A;  3TJF A;  2KP1 A;  5B8B A;  4MPF A;  3F4T A;  4LL1 B;  1GTU A;  1TK5 B;  2OAD A;  2VCQ A;  3CMI A;  2GQM A;  1QMV A;  5COH A;  4K7N A;  3GTU A;  1ERW A;  3UAP A;  3KTL A;  1OC9 A;  3FZ5 A;  1G6Y A;  4MCU A;  1K3Y A;  4PUF C;  4YH2 A;  1SU9 A;  4ZIJ A;  1N8J A;  3HJP A; 
#chains in the Genus database with same CATH topology
 1GH2 A;  3QD9 A;  3DIE A;  1KEB A;  3OR5 A;  2DKH A;  2LNS A;  1FHE A;  1ON4 A;  3BCK A;  3EWL A;  4OD7 A;  4Z2R A;  2H30 A;  5HQP A;  2M72 A;  4YAV A;  4KCE A;  3DEX A;  1H75 A;  1VF1 A;  2R4V A;  2G2Q A;  1F37 A;  4YKF A;  4J56 E;  3ZFB A;  3UOM A;  18GS A;  5KN1 A;  2OE0 A;  2IWT A;  5IQY A;  3FEU A;  3IBH A;  3VLN A;  1NSW A;  2FA8 A;  3DRN A;  1EV4 A;  3ZML A;  5AIV A;  4ZL7 A;  1THX A;  1K0B A;  3O6T A;  3G9B A;  4E8H A;  12GS A;  4CW9 A;  4OO4 A;  1WPI A;  4TR0 A;  3HD5 A;  2HZF A;  1LBK A;  2FNO A;  5D93 A;  2DMM A;  3TJB A;  1O6J A;  1U88 A;  10GS A;  1YY7 A;  2JSZ A;  4G2E A;  1XW5 A;  3LYP A;  3EIN A;  3NOF A;  5IOX A;  3TRP A;  1SK1 A;  3GTU B;  5GAN D;  3CSH A;  1OC9 B;  3HVV A;  3GKM A;  3CBU A;  2DJJ A;  2GTU A;  1FO5 A;  4KE3 A;  2FWG A;  4OFN A;  2OE3 A;  2L5O A;  4F82 A;  1EGR A;  2NPB A;  1T00 A;  3HVS A;  5F8B A;  3TUE A;  1SJI A;  2DC5 A;  4TKY A;  5JCW A;  2RII A;  5CRE A;  2ON5 A;  2VO4 A;  4POM A;  3F0I A;  3TJK A;  2MMA A;  1XVW A;  2X49 A;  4DSQ A;  3KP9 A;  3A2W A;  9GSS A;  2DSA A;  2WJU A;  2VD0 A;  3WGE A;  2RLI A;  2E2M A;  3CSJ A;  1SJZ A;  2C4J A;  3LXT A;  3RHC A;  5IPG A;  4ZL9 A;  4BWQ A;  2OAC A;  2K8S A;  1M9B A;  1LU4 A;  1TXX A;  1SYR A;  1YZX A;  2XBQ A;  1T8E B;  2IMI A;  5GZZ B;  3VWX A;  1J08 A;  4ZL8 A;  3TKS C;  4MZW A;  2MYG A;  1XPV A;  5IM9 A;  3M8N A;  5J3R A;  1OAZ A;  4PGT A;  1O73 A;  2H1D A;  1ERT A;  4KUN A;  3IPZ A;  4EXJ A;  3H1N A;  5IMC A;  3GNJ A;  3V1W A;  5GSS A;  2GSR A;  4KSO A;  3UAR A;  2C8U A;  1DSB A;  1OKD A;  2L5L A;  3H79 A;  2HRF A;  2YAN A;  1XOB A;  1BYE A;  4N0Z A;  2OBI A;  4N10 A;  1A0R P;  4NV5 A;  1A0F A;  5DBQ A;  5G30 A;  14GS A;  4OCE A;  3LW9 A;  5HR0 A;  1XBS A;  1R5A A;  3ZVJ D;  3EPT A;  3N5O A;  3C1R A;  3D5J A;  3BD2 A;  2FD3 A;  4HJ2 A;  3VFI A;  4TXV A;  3R2Q A;  5EPF A;  2VL2 A;  2C3Q A;  5JWQ B;  1VF3 A;  1JZO A;  3EVI A;  1WJK A;  2Z9S A;  4CY6 A;  4PUR A;  1EZK A;  3C71 A;  2DJ0 A;  1AC1 A;  1PFO A;  1ML6 A;  1M0U A;  5ECL B;  2CZ3 A;  5ECK B;  4K8M A;  2LV3 A;  4I6X A;  3VK9 A;  1PN9 A;  2H70 A;  4F9Z A;  3W8S A;  1A8L A;  1XWC A;  5CRH A;  4MLY A;  5B8A A;  3CTF A;  4JU5 A;  2A4H A;  1PQN A;  4ZBB A;  1WRY A;  2LJK A;  3W8J A;  3ERG A;  1VF2 A;  3QFB C;  3ERF A;  3E9J B;  5F0G A;  1URM A;  1F2E A;  1MDJ A;  3MSZ A;  3VI5 A;  2LQO A;  2HRA A;  4EIQ A;  1XW9 A;  2ON7 A;  3F4S A;  3QAG A;  3PR8 A;  2P5R A;  4XS4 B;  4BA7 A;  1YQ1 A;  4KB3 A;  1NHO A;  5G2Z A;  1IYI A;  3QR6 A;  2IMF A;  4ML6 A;  5C00 A;  3MYD A;  4I2U A;  2DJ3 A;  3BCI A;  5FWG A;  5ECP B;  2FHE A;  1AAZ A;  3HYP A;  4L0U A;  3H4K A;  5G1L A;  2B1K A;  16GS A;  1GLP A;  2R0P A;  3F3Q A;  1TI1 A;  2X99 A;  3IHQ A;  1Q4J A;  3ME7 A;  5HFK A;  2FWF A;  3F6D A;  1T4Y A;  2HNL A;  1T3B A;  5CO3 A;  4OCF A;  4WF5 A;  2H8L A;  1GSQ A;  3G7I A;  1EOG A;  3EU4 A;  2VLU A;  3HJM A;  1G7E A;  1O8X A;  2HE3 A;  1E6B A;  1JZD A;  3UEM A;  1AQV A;  1Z9H A;  2YPM A;  11GS A;  2C3N A;  3FR3 A;  2H66 A;  5LD0 A;  4I2T A;  4HUA A;  2XC2 A;  2B3S A;  2IMD A;  5IMZ A;  1YF1 A;  1WMJ A;  3ZRE A;  4WXT A;  3IA1 A;  4L5O A;  5L71 A;  4PQ1 A;  4PQI A;  4YAP A;  2OA7 A;  4G9H A;  2X8H A;  1K0N A;  1SEN A;  1TTZ A;  3MNG A;  2O85 A;  1Z7R A;  1ZYQ B;  2I81 A;  2V2G A;  4D73 A;  2A2R A;  2I1U A;  4G0K A;  1XVQ A;  2X8G A;  3TRX A;  2JAC A;  5A4U A;  2B5E A;  1R5P A;  5DJL A;  3FK8 A;  4NPB A;  3KCM A;  4O92 A;  3APQ A;  2H0I A;  1WP0 A;  4MMM A;  4TOP A;  4XRA A;  1QXH A;  2LST A;  5A4V A;  1GUH A;  4DEJ A;  2CX3 A;  1T4Z A;  4IN0 A;  4XRD A;  4WR5 A;  4XHM A;  1SKS B;  4HSC X;  2HSM A;  1MD4 A;  1DBY A;  2MZC A;  4ACS A;  2F51 A;  5C04 A;  2VCV A;  3BJ5 A;  1W4V A;  2H6Z A;  5AIS A;  4BL7 B;  1S3C A;  4K9Z A;  4PQH A;  1HQO A;  2KP2 A;  1TJD A;  2LKU A;  1JHB A;  1QFN A;  2P5Q A;  4JRR A;  3D21 A;  4O32 A;  6GSU A;  6GSX A;  1M2B A;  3A3T A;  4WKW A;  1EP7 A;  1I9D A;  3HJO A;  2YWI A;  2IIY A;  3KM6 A;  3LG6 A;  4TW5 A;  3GX0 A;  2GT6 A;  1EP8 A;  4K2X A;  5HR2 A;  1G0T A;  3U6V A;  1PGT A;  2HSY A;  4K5S A;  6GSW A;  2IJY A;  2VAF A;  5EL8 A;  4Z2T A;  2R0C A;  1B48 A;  3BOA A;  4EE0 A;  2YP6 A;  5D73 A;  3EUR A;  4GLT A;  2EIO A;  3W6G A;  3C7M A;  4EC0 A;  3QOU A;  2A4V A;  4I8B A;  1ABA A;  5F07 A;  1NHY A;  2H75 A;  4BWS A;  3BBY A;  4L0W A;  4ID0 A;  4IW9 A;  4MJA A;  1TDI A;  3GH6 A;  3KMO A;  4DSS A;  5CP1 A;  4ZBA A;  3UVH A;  2VL2 C;  3WGX A;  5IOW A;  4ECJ A;  1BED A;  1A8Y A;  1FB0 A;  4RI6 A;  3RHB A;  3HVX A;  1UC7 A;  3KH9 A;  1HYU A;  2PBJ A;  2HSH A;  5D8I A;  5D9X A;  4Q5N A;  5BMU A;  2MMN A;  3ZIV A;  3FR9 A;  3GL5 A;  4ECC A;  5IMD A;  1DE2 A;  3DVW A;  2B7J A;  1GTA A;  5IMV A;  3EE2 A;  5J4U A;  4N11 A;  5CRD A;  4KAE A;  3ZFL A;  1M3I A;  4ICY A;  5D9V A;  2P0G A;  1GSY A;  3TRQ A;  4OWY A;  4HOJ A;  1G6W A;  1MTC A;  1OC3 A;  5AN1 A;  2FWE A;  5ID2 B;  1V9W A;  2AYT A;  1T1V A;  4GSS A;  1AXD A;  3ME8 A;  4OFM A;  2LJA A;  3A5I A;  4QQ7 A;  1F3B A;  3RPP A;  3P8W A;  1XG8 A;  1CQG A;  3KH7 A;  4XS1 A;  4DSS B;  1PSQ A;  2R37 A;  1TU7 A;  5ECM B;  2WFC A;  3HY2 A;  3FMW A;  2VD1 A;  4L8E A;  2HFD A;  2RM6 A;  1GP1 A;  2HI7 A;  3P90 A;  4Q5Q A;  4AJ7 A;  5IIZ A;  5KN2 A;  3MWH A;  6GST A;  2WRT A;  3US3 A;  5DQS A;  2ZCT A;  1J0F A;  1S3A A;  3QAV A;  4ML1 A;  3RAZ A;  4NV2 A;  2L6D A;  2NTO A;  2YJ7 A;  4KDY A;  3RPN A;  1WOU A;  1M99 A;  1B8X A;  3VWV A;  3E0U A;  1TRU A;  4HQZ A;  4E8E A;  20GS A;  1HNC A;  2VM2 A;  1HNB A;  2EIQ A;  4AJ6 A;  1U87 A;  1XXU A;  1SD8 A;  2CAQ A;  1B9Y C;  1GSF A;  4TR3 A;  4EIP A;  1GL8 A;  2GLR A;  1F6M C;  1X9W B;  1XWG A;  3QFA C;  2DJ1 A;  5ENU A;  1A2M A;  4V2L A;  2YV7 A;  2HLS A;  1BG5 A;  4MK3 A;  1SJ6 A;  1B9X C;  3LYK A;  2WUL A;  4WBR D;  4HZ4 A;  2VLT A;  3GHA A;  5G5E A;  2L57 A;  1PMT A;  3HKR A;  5JWO B;  5H5Q A;  2TRC P;  1OE7 A;  4QL7 A;  4YQM A;  5ECN B;  1JZR A;  3H8Q A;  3GV1 A;  3TJJ A;  2C1Y A;  3IAS 2;  3CTG A;  1QUW A;  2QSI A;  1GTB A;  1AQX A;  3FRC A;  4XS4 A;  3KD0 A;  2KUC A;  1ZCP A;  4KH7 A;  2V32 A;  4O5U A;  1N2A A;  2BTO T;  1ZMA A;  4ZXG A;  4IP6 A;  2FGX A;  4EL1 A;  5D96 A;  1RK4 A;  4TR1 A;  1X5E A;  2VL9 A;  4CY8 A;  1FAA A;  3HDC A;  4HU7 A;  2EC4 A;  2IPA A;  3MDK A;  1AUC A;  3A2X A;  3VUR A;  4X1U A;  6GSS A;  2MMZ A;  3FZ4 A;  2JZT A;  5IPH A;  4MF5 A;  3L78 A;  3LEF A;  2L4C A;  4BVX B;  1QGV A;  4NAX A;  1M2D A;  3ZZX A;  1V2A A;  1YF0 A;  1H4O A;  2DKI A;  3APO A;  2HRN A;  2N5B A;  3QAW A;  4HDE A;  3IAM 2;  2GDR A;  1VGL A;  3KP8 A;  3CRU A;  1EOH A;  1ILO A;  2C0E A;  2YNX A;  5EY6 A;  2K6V A;  1EEM A;  1XWB A;  3UMA A;  1Q98 A;  2WCI A;  3F6F A;  4HEA 2;  1JZW A;  4GXZ A;  2CAI A;  1OE8 A;  5E4W A;  3TOT A;  4K7O A;  4P3Y B;  1PL1 A;  3WT2 A;  1Z6M A;  2YWN A;  1TK0 B;  4POL A;  2WGR A;  1E2Y A;  4POB A;  4FYB A;  4K5R A;  4HU9 A;  2BMX A;  4MJB A;  3WGD A;  2K8V A;  4TR1 B;  3PGT A;  5J41 A;  5AIX A;  1B4P A;  4FQU A;  2IFQ B;  2M80 A;  4LA1 A;  3M3M A;  2H1A A;  13GS A;  4EDY A;  1ZYE A;  2L59 A;  3GKK A;  2V6O A;  5JCG A;  2AHE A;  4I5Q A;  5H5R A;  3IV4 A;  2RM5 A;  2WDU A;  1ST9 A;  1YDK A;  4GSN A;  8GSS A;  3ZIJ A;  7GSS A;  2JL4 A;  1R4W A;  4NHW A;  1KNG A;  4GST A;  3C73 A;  2DIY A;  1YJ6 A;  1BQ7 A;  4ZBD A;  4GRF A;  4ISD A;  3FZA A;  1ERV A;  2PU9 C;  2GVP A;  1V40 A;  2H01 A;  2XBI A;  3HCZ A;  2PVQ A;  3D6I A;  2QGV A;  1GUK A;  4BL7 A;  4IJI A;  1A2J A;  3D4T A;  1SD9 A;  2LNT A;  4GF0 A;  3GKX A;  5JCU A;  3GKN A;  2V6K A;  4K2D A;  2OJL A;  3G7Y A;  4USS A;  2GQK A;  3UBL A;  3GIX A;  4V1A g;  4HQS A;  3TB2 A;  4GWR A;  4Z2U A;  5KOX A;  5ELG A;  3M9J A;  3GYK A;  5ECQ B;  4JR4 A;  1TRS A;  3F8U A;  4ZB9 A;  1GUL A;  1ZYP A;  5FT3 A;  5A5K A;  2GSQ A;  1B4Q A;  1BX9 A;  2PVO C;  3CQF A;  3F9U A;  3L0H A;  1OKT A;  2KOK A;  2F3M A;  5IO2 A;  2L6C A;  3C1S A;  3CXG A;  1HD2 A;  3LXZ A;  4ULX A;  1CQH A;  2I4A A;  3VPT A;  5ELA A;  2XPD A;  1U6T A;  3VPQ A;  3M0F A;  1BAY A;  2VIM A;  5KN0 A;  1TK8 B;  3DXB A;  4K0G A;  1FB6 A;  2I3Y A;  1M9A A;  4ZB6 A;  1EV9 A;  3CYN A;  4FYC A;  1SYX A;  2FY6 A;  1TOF A;  2DBC A;  1TU8 A;  1HNA A;  3A5W A;  2CVK A;  3KGK A;  3LSZ A;  4L5L A;  1O8W A;  4NWY A;  3Q18 A;  2J23 A;  2LRN A;  3D0Z A;  4PNG A;  3WT1 A;  1XWK A;  3TKS A;  5F05 A;  2H6Y A;  2WB9 A;  1ERU A;  3EC3 A;  4ECI A;  3IK9 A;  3P2A A;  5IMA A;  2NBS A;  2GT5 A;  1ZZY A;  4LMV A;  4TRX A;  4YQU A;  4JED A;  3HA9 A;  1ZOF A;  2K9F A;  1GWC A;  4JZQ A;  3WD6 A;  4X4J A;  6GSY A;  4HI7 A;  2QC7 A;  2H73 A;  2FCH A;  1JLW A;  1DE1 A;  4O5R A;  3FY7 A;  2R0G A;  2PUK C;  5CYY A;  2H71 A;  4RI7 A;  5IMF A;  4V1A p;  5AGY A;  2GS3 A;  1KTE A;  4KDX A;  3E3E A;  4K0N A;  2CT6 A;  2DML A;  2E2G A;  3WYW A;  3I6A A;  2VCZ A;  1X5D A;  5J9C A;  2CVB A;  3LQ7 A;  4IBP A;  4KF9 A;  4Q5R A;  2H6X A;  3IDV A;  2CV4 A;  2CVD A;  4ECB A;  1PX7 A;  3NZN A;  3HXS A;  5ID2 A;  1O81 A;  1ZGN A;  4XTS A;  2YV9 A;  2HT9 A;  5ECR B;  1U3A A;  4KCA A;  4MDC A;  4XIH A;  2TRX A;  4POK A;  3DGQ A;  2LQQ A;  1Y6E A;  5GST A;  3HZ4 A;  1Y25 A;  3R3E A;  1XOA A;  2F8F A;  1OVN A;  1JFU A;  1X9S B;  4ZB8 A;  2WZ9 A;  4A5P A;  1UN2 A;  5F06 A;  2E0Q A;  1OYJ A;  5ECS A;  2JSY A;  2NVL A;  2PWJ A;  4GQC A;  2B5X A;  1PA3 A;  5HFI A;  1XFL A;  2A2S A;  1FOH A;  1A23 A;  1NW2 A;  2XHF A;  2H19 A;  2FA4 A;  4PNF A;  2FWH A;  5GAP D;  2YN1 A;  4IQ1 A;  2H74 A;  4LL4 B;  4AJ8 A;  5IO0 A;  2B5Y A;  4IVF A;  3GUR A;  4WF4 A;  3O3T A;  1AQW A;  2YCD A;  3FKF A;  3PPU A;  2OKA A;  3EMX A;  4MA9 A;  4GTU A;  3DVX A;  3S9F A;  1RW1 A;  2ZUP A;  1O7U A;  3GX8 A;  2IN3 A;  3TDG A;  1SL0 B;  3TKR A;  1FG4 A;  1R7H A;  1PN0 A;  3TKS E;  2EIR A;  2TIR A;  1V58 A;  1TP9 A;  5FHI A;  2HZE B;  3GSS A;  1K0A A;  1EWX A;  5DDL A;  4BVY B;  2O8V B;  3RDW A;  2FLS A;  1THO A;  2YZH A;  1Z7P A;  2BJX A;  2C0D A;  3IXR A;  3L9U A;  2MBS A;  3QMX A;  2O89 A;  2DJ2 A;  4AGS A;  5ECH B;  2YOI A;  4GQF A;  3IOS A;  5KEJ A;  2PN8 A;  2V41 A;  2YJH A;  1XCC A;  3MAK A;  1AW9 A;  3LGC A;  1UVZ A;  3VWU A;  4RQX A;  1TW9 A;  4OMV A;  4X0X A;  3FZ9 A;  1DUG A;  2V1M A;  4MP4 A;  4TXO B;  3Q74 A;  4F0C A;  4HS1 A;  1K0O A;  1K3L A;  4K6X A;  5G1K A;  17GS A;  3UL3 A;  2H0H A;  3KXO A;  3GH9 A;  3GRX A;  1G7O A;  3IK7 A;  3U5R E;  1PL2 A;  3QPM A;  4V2M A;  2H1G A;  3LFL A;  2VLV A;  1V98 A;  1GUM A;  3UBK A;  2LJR A;  4G10 A;  4XCS A;  1K0C A;  4OO5 A;  3L9V A;  3N9J A;  1YEP A;  1F3A A;  2O87 A;  4F03 A;  2DJK A;  3CRT A;  3IC8 A;  3GUS A;  4BIK A;  2LEG A;  2C80 A;  5BRT A;  5DCH A;  1MD3 A;  1K0M A;  1FVJ A;  2LRC A;  2JZS A;  5CAX A;  1WWJ A;  1IYH A;  1TRW A;  4HJM A;  2B6M A;  1EEJ A;  4BVX A;  2E7P A;  4V2N A;  2IMK A;  3I43 A;  3DYR A;  5G31 A;  1M3J A;  1SL2 B;  3LWA A;  3IR4 A;  2HXK A;  4BPY A;  3PH9 A;  4N0V A;  5DAL A;  3GL3 A;  3SBC A;  3HVN A;  5G5F A;  3KTB A;  3RBT A;  5LCZ A;  2RUF A;  1A2L A;  1MDK A;  1X9M B;  3LJR A;  4PX1 A;  1M7T A;  4EVM A;  4EDZ A;  1X5C A;  2PPT A;  2QA2 A;  5ABR A;  3ISO A;  4O7H A;  3J7Y k;  4I97 A;  2VCX A;  4PUA A;  3GN3 A;  5KOW A;  2O7K A;  3L4N A;  2AUV A;  2REM A;  4X43 A;  3ZMK A;  2GZY A;  1GSS A;  2H1B A;  4MZC A;  2QKE A;  1XW6 A;  1GSD A;  1ZL9 A;  2IFQ A;  4KW6 A;  2B1L A;  4MH2 A;  4MF7 A;  4F0B A;  5HFG A;  2FUG 2;  1VF4 A;  5D9T A;  4EO3 A;  3VWW A;  1Z3E A;  2VM1 A;  2GZP A;  4K1F A;  1GLQ A;  5B7C A;  2DIZ A;  2CQ9 A;  4G0L A;  1PD2 1;  4G19 A;  1PX6 A;  1R26 A;  2IME A;  2ES7 A;  2N5A A;  4GCI A;  4NHZ A;  1YEX A;  4NXI A;  2A2P A;  1K3O A;  1WE0 A;  4FH8 A;  3TKP A;  2X8C A;  2H72 A;  2CX4 A;  1FW1 A;  4KGI A;  5DAL B;  2P31 A;  2VCT A;  1A24 A;  5DAK A;  5HR3 A;  5A4W A;  2AV4 A;  4G0I A;  3Q19 A;  2H76 A;  3ZRD A;  1PKW A;  5CRG A;  2AB6 A;  2OBK A;  1GNW A;  1AIU A;  1OC8 A;  4PTS A;  3K8N A;  3EYT A;  4TVE A;  4ZIL A;  4O5Q A;  1I5G A;  2AAW A;  1K0D A;  3D4M A;  2HRK A;  1T7P B;  4KND A;  4IKH A;  3I9V 2;  2WS2 A;  2VCW A;  4XS6 A;  2VOC A;  2KLX A;  3DKS A;  2L4Q A;  3KIJ A;  2PER A;  4JR6 A;  3O76 A;  4YQV A;  1SKR B;  1W89 A;  3ED3 A;  1VRS D;  3A2V A;  3TGZ A;  3TJG A;  4CHS A;  2GQL A;  3SWL A;  2HYX A;  1BJX A;  1GSU A;  3F3R A;  4LLR A;  3ZLP A;  4J57 E;  3ZIT A;  2OE1 A;  3KEB A;  2H0G A;  2DLX A;  1XWA A;  5INY A;  2CA8 A;  2QA1 A;  1Z6N A;  4ILF A;  2LS5 A;  3IE3 A;  3GFK A;  2YWO A;  4EKZ A;  4IJ3 A;  2F8A A;  1MEK A;  5D9W A;  3EMP A;  3CSI A;  2LTK A;  1O85 A;  5DVB A;  1Z5Y E;  3QDN A;  1X0R A;  1U3I A;  5J9B A;  2JAD A;  4WET A;  1SK0 A;  1JLV A;  3M1G A;  1V57 A;  3KMN A;  4WEY A;  3FW2 A;  4K7I A;  5DAK B;  3JCM L;  1UA5 A;  3TOU A;  2MBT A;  5CRW A;  2PGT A;  1GNE A;  1GTI A;  1FOV A;  4LMW A;  1USB A;  1F9M A;  3M9K A;  5EVO A;  4IHU A;  5HR1 A;  4RQR A;  4PXO A;  4IS0 A;  2GZZ A;  4KSM A;  4MJC A;  3UJ1 A;  2R6K A;  2F9S A;  1MDI A;  1GRX A;  1RQM A;  4F2I A;  4CDO A;  4AF2 A;  2GST A;  3P7X A;  2C0F A;  2XPE A;  1PKZ A;  5DJM A;  3IRA A;  5E59 A;  1YKC A;  3GST A;  3LOR A;  4TN8 A;  3HHV A;  1SK2 A;  3Q6O A;  4MJE A;  5LNK e;  4HZ2 A;  3L9S A;  1TRV A;  2K18 A;  5J5N A;  1NM3 A;  4OFT A;  2M46 A;  3DD3 A;  4MZB A;  4KX4 A;  2R5G A;  2LUS A;  3ZVJ A;  1EGO A;  3APS A;  5B6N A;  5H5S A;  3J7Y b;  3ERW A;  2J9H A;  3G7J A;  4IP1 A;  3TKQ A;  4KDU A;  3D22 A;  1S3D A;  1YKA A;  2PMT A;  2LRT A;  3GA4 A;  2CZ2 A;  2VUP A;  1FVK A;  2JZR A;  19GS A;  1J9B A;  4JBB A;  3FYG A;  4H86 A;  4WBJ A;  3EU3 A;  4MPG A;  4MH3 A;  4NMU A;  3VI7 A;  5B6M A;  4FIW A;  6GSV A;  1TKD B;  3KJY A;  2B7K A;  3F63 A;  3NIV A;  2IL3 A;  2C3T A;  4IQA A;  1LJR A;  2YZU A;  2R3X A;  1M2A A;  1ACV A;  1TI3 A;  2N5F A;  3ZTL A;  2AJQ B;  3DWV A;  4DVC A;  4EF0 A;  1PRX A;  2G0F A;  4N30 A;  2R2J A;  3KZQ A;  1C72 A;  5DCG A;  2KHP A;  1QK8 A;  4DSR A;  4YKG A;  4RUV A;  1KBN A;  3QCP A;  5KN3 A;  2I9H A;  1GSE A;  2NDO A;  2HZE A;  4MAB A;  5JWR B;  3ZL5 A;  4BVY A;  4D73 B;  3PIN A;  1XZO A;  4FO5 A;  2X64 A;  4FYU A;  3TCO A;  3H93 A;  3UIW A;  4TR4 A;  3AY8 A;  3GMF A;  3UVT A;  3ZYW A;  2D2Z A;  1QQ2 A;  3DML A;  2UZ8 A;  2ALB A;  4EUY A;  1S3R A;  2GSS A;  2MMO A;  1WIK A;  2RUE A;  2YWM A;  4WR4 A;  4J2F A;  3FR6 A;  2ZNM A;  3C8E A;  5DQY A;  3I69 A;  4KA0 A;  4Q5F A;  4TXO A;  1SKW B;  1SL1 B;  4MNN A;  3IC4 A;  2C0G A;  3F4R A;  5ECO B;  4QL9 A;  22GS A;  3HZ8 A;  3FHK A;  4JE1 A;  4IEL A;  2VL3 A;  1XIY A;  4Z7X A;  2GGT A;  3MIX A;  4IGJ A;  4MF6 A;  5ECI B;  5CNW A;  2JU5 A;  3TJF A;  2KP1 A;  5B8B A;  4MPF A;  3F4T A;  4LL1 B;  2X4A A;  1GTU A;  1TK5 B;  2OAD A;  2VCQ A;  3CMI A;  2GQM A;  1QMV A;  5COH A;  4K7N A;  3GTU A;  1ERW A;  1ZYN A;  3UAP A;  3KTL A;  1OC9 A;  3FZ5 A;  1G6Y A;  4MCU A;  1K3Y A;  4PUF C;  4YH2 A;  1SU9 A;  4ZIJ A;  1N8J A;  3HJP A;  3IHG A; 
#chains in the Genus database with same CATH homology
 1GH2 A;  3QD9 A;  3DIE A;  1KEB A;  3OR5 A;  2DKH A;  2LNS A;  1FHE A;  1ON4 A;  3BCK A;  3EWL A;  4OD7 A;  4Z2R A;  2H30 A;  5HQP A;  2M72 A;  4YAV A;  4KCE A;  3DEX A;  1H75 A;  1VF1 A;  2R4V A;  2G2Q A;  1F37 A;  4YKF A;  4J56 E;  3ZFB A;  3UOM A;  18GS A;  5KN1 A;  2OE0 A;  2IWT A;  5IQY A;  3FEU A;  3IBH A;  3VLN A;  1NSW A;  2FA8 A;  3DRN A;  1EV4 A;  3ZML A;  5AIV A;  4ZL7 A;  1THX A;  1K0B A;  3O6T A;  3G9B A;  4E8H A;  12GS A;  4CW9 A;  4OO4 A;  1WPI A;  4TR0 A;  3HD5 A;  2HZF A;  1LBK A;  2FNO A;  5D93 A;  2DMM A;  3TJB A;  1O6J A;  1U88 A;  10GS A;  1YY7 A;  2JSZ A;  4G2E A;  1XW5 A;  3LYP A;  3EIN A;  3NOF A;  5IOX A;  3TRP A;  1SK1 A;  3GTU B;  5GAN D;  3CSH A;  1OC9 B;  3HVV A;  3GKM A;  3CBU A;  2DJJ A;  2GTU A;  1FO5 A;  4KE3 A;  2FWG A;  4OFN A;  2OE3 A;  2L5O A;  4F82 A;  1EGR A;  2NPB A;  1T00 A;  3HVS A;  5F8B A;  3TUE A;  1SJI A;  2DC5 A;  4TKY A;  5JCW A;  2RII A;  5CRE A;  2ON5 A;  2VO4 A;  4POM A;  3F0I A;  3TJK A;  2MMA A;  1XVW A;  2X49 A;  4DSQ A;  3KP9 A;  3A2W A;  9GSS A;  2DSA A;  2WJU A;  2VD0 A;  3WGE A;  2RLI A;  2E2M A;  3CSJ A;  1SJZ A;  2C4J A;  3LXT A;  3RHC A;  5IPG A;  4ZL9 A;  4BWQ A;  2OAC A;  2K8S A;  1M9B A;  1LU4 A;  1TXX A;  1SYR A;  1YZX A;  2XBQ A;  1T8E B;  2IMI A;  5GZZ B;  3VWX A;  1J08 A;  4ZL8 A;  3TKS C;  4MZW A;  2MYG A;  1XPV A;  5IM9 A;  3M8N A;  5J3R A;  1OAZ A;  4PGT A;  1O73 A;  2H1D A;  1ERT A;  4KUN A;  3IPZ A;  4EXJ A;  3H1N A;  5IMC A;  3GNJ A;  3V1W A;  5GSS A;  2GSR A;  4KSO A;  3UAR A;  2C8U A;  1DSB A;  1OKD A;  2L5L A;  3H79 A;  2HRF A;  2YAN A;  1XOB A;  1BYE A;  4N0Z A;  2OBI A;  4N10 A;  1A0R P;  4NV5 A;  1A0F A;  5DBQ A;  5G30 A;  14GS A;  4OCE A;  3LW9 A;  5HR0 A;  1XBS A;  1R5A A;  3ZVJ D;  3EPT A;  3N5O A;  3C1R A;  3D5J A;  3BD2 A;  2FD3 A;  4HJ2 A;  3VFI A;  4TXV A;  3R2Q A;  5EPF A;  2VL2 A;  2C3Q A;  5JWQ B;  1VF3 A;  1JZO A;  3EVI A;  1WJK A;  2Z9S A;  4CY6 A;  4PUR A;  1EZK A;  3C71 A;  2DJ0 A;  1AC1 A;  1ML6 A;  1M0U A;  5ECL B;  2CZ3 A;  5ECK B;  4K8M A;  2LV3 A;  4I6X A;  3VK9 A;  1PN9 A;  2H70 A;  4F9Z A;  3W8S A;  1A8L A;  1XWC A;  5CRH A;  4MLY A;  5B8A A;  3CTF A;  4JU5 A;  2A4H A;  1PQN A;  4ZBB A;  1WRY A;  2LJK A;  3W8J A;  3ERG A;  1VF2 A;  3QFB C;  3ERF A;  3E9J B;  5F0G A;  1URM A;  1F2E A;  1MDJ A;  3MSZ A;  3VI5 A;  2LQO A;  2HRA A;  4EIQ A;  1XW9 A;  2ON7 A;  3F4S A;  3QAG A;  3PR8 A;  2P5R A;  4XS4 B;  4BA7 A;  1YQ1 A;  4KB3 A;  1NHO A;  5G2Z A;  1IYI A;  3QR6 A;  2IMF A;  4ML6 A;  5C00 A;  3MYD A;  4I2U A;  2DJ3 A;  3BCI A;  5FWG A;  5ECP B;  2FHE A;  1AAZ A;  3HYP A;  4L0U A;  3H4K A;  5G1L A;  2B1K A;  16GS A;  1GLP A;  2R0P A;  3F3Q A;  1TI1 A;  2X99 A;  3IHQ A;  1Q4J A;  3ME7 A;  5HFK A;  2FWF A;  3F6D A;  1T4Y A;  2HNL A;  1T3B A;  5CO3 A;  4OCF A;  4WF5 A;  2H8L A;  1GSQ A;  3G7I A;  1EOG A;  3EU4 A;  2VLU A;  3HJM A;  1G7E A;  1O8X A;  2HE3 A;  1E6B A;  1JZD A;  3UEM A;  1AQV A;  1Z9H A;  2YPM A;  11GS A;  2C3N A;  3FR3 A;  2H66 A;  5LD0 A;  4I2T A;  4HUA A;  2XC2 A;  2B3S A;  2IMD A;  5IMZ A;  1YF1 A;  1WMJ A;  3ZRE A;  4WXT A;  3IA1 A;  4L5O A;  5L71 A;  4PQ1 A;  4PQI A;  4YAP A;  2OA7 A;  4G9H A;  2X8H A;  1K0N A;  1SEN A;  1TTZ A;  3MNG A;  2O85 A;  1Z7R A;  1ZYQ B;  2I81 A;  2V2G A;  4D73 A;  2A2R A;  2I1U A;  4G0K A;  1XVQ A;  2X8G A;  3TRX A;  2JAC A;  5A4U A;  2B5E A;  1R5P A;  5DJL A;  3FK8 A;  4NPB A;  3KCM A;  4O92 A;  3APQ A;  2H0I A;  1WP0 A;  4MMM A;  4TOP A;  4XRA A;  1QXH A;  2LST A;  5A4V A;  1GUH A;  4DEJ A;  2CX3 A;  1T4Z A;  4IN0 A;  4XRD A;  4WR5 A;  4XHM A;  1SKS B;  2HSM A;  1MD4 A;  1DBY A;  2MZC A;  4ACS A;  2F51 A;  5C04 A;  2VCV A;  3BJ5 A;  1W4V A;  2H6Z A;  5AIS A;  4BL7 B;  1S3C A;  4K9Z A;  4PQH A;  1HQO A;  2KP2 A;  1TJD A;  2LKU A;  1JHB A;  1QFN A;  2P5Q A;  4JRR A;  3D21 A;  4O32 A;  6GSU A;  6GSX A;  1M2B A;  3A3T A;  4WKW A;  1EP7 A;  1I9D A;  3HJO A;  2YWI A;  2IIY A;  3KM6 A;  3LG6 A;  4TW5 A;  3GX0 A;  2GT6 A;  1EP8 A;  4K2X A;  5HR2 A;  1G0T A;  3U6V A;  1PGT A;  2HSY A;  4K5S A;  6GSW A;  2IJY A;  2VAF A;  5EL8 A;  4Z2T A;  2R0C A;  1B48 A;  3BOA A;  4EE0 A;  2YP6 A;  5D73 A;  3EUR A;  4GLT A;  2EIO A;  3W6G A;  3C7M A;  4EC0 A;  3QOU A;  2A4V A;  4I8B A;  1ABA A;  5F07 A;  1NHY A;  2H75 A;  4BWS A;  3BBY A;  4L0W A;  4ID0 A;  4IW9 A;  4MJA A;  1TDI A;  3GH6 A;  3KMO A;  4DSS A;  5CP1 A;  4ZBA A;  3UVH A;  2VL2 C;  3WGX A;  5IOW A;  4ECJ A;  1BED A;  1A8Y A;  1FB0 A;  4RI6 A;  3RHB A;  3HVX A;  1UC7 A;  3KH9 A;  1HYU A;  2PBJ A;  2HSH A;  5D8I A;  5D9X A;  4Q5N A;  5BMU A;  2MMN A;  3ZIV A;  3FR9 A;  3GL5 A;  4ECC A;  5IMD A;  1DE2 A;  3DVW A;  2B7J A;  1GTA A;  5IMV A;  3EE2 A;  5J4U A;  4N11 A;  5CRD A;  4KAE A;  3ZFL A;  4ICY A;  5D9V A;  2P0G A;  1GSY A;  3TRQ A;  4OWY A;  4HOJ A;  1G6W A;  1MTC A;  1OC3 A;  5AN1 A;  2FWE A;  5ID2 B;  1V9W A;  2AYT A;  1T1V A;  4GSS A;  1AXD A;  3ME8 A;  4OFM A;  2LJA A;  3A5I A;  4QQ7 A;  1F3B A;  3RPP A;  3P8W A;  1CQG A;  3KH7 A;  4XS1 A;  4DSS B;  1PSQ A;  2R37 A;  1TU7 A;  5ECM B;  2WFC A;  3HY2 A;  3FMW A;  2VD1 A;  4L8E A;  2HFD A;  2RM6 A;  1GP1 A;  2HI7 A;  3P90 A;  4Q5Q A;  4AJ7 A;  5IIZ A;  5KN2 A;  3MWH A;  6GST A;  2WRT A;  3US3 A;  5DQS A;  2ZCT A;  1J0F A;  1S3A A;  3QAV A;  4ML1 A;  3RAZ A;  4NV2 A;  2L6D A;  2NTO A;  2YJ7 A;  4KDY A;  3RPN A;  1WOU A;  1M99 A;  1B8X A;  3VWV A;  3E0U A;  1TRU A;  4HQZ A;  4E8E A;  20GS A;  1HNC A;  2VM2 A;  1HNB A;  2EIQ A;  4AJ6 A;  1U87 A;  1XXU A;  1SD8 A;  2CAQ A;  1B9Y C;  1GSF A;  4TR3 A;  4EIP A;  1GL8 A;  2GLR A;  1F6M C;  1X9W B;  1XWG A;  3QFA C;  2DJ1 A;  5ENU A;  1A2M A;  4V2L A;  2YV7 A;  2HLS A;  1BG5 A;  4MK3 A;  1SJ6 A;  1B9X C;  3LYK A;  2WUL A;  4WBR D;  4HZ4 A;  2VLT A;  3GHA A;  5G5E A;  2L57 A;  1PMT A;  3HKR A;  5JWO B;  5H5Q A;  2TRC P;  1OE7 A;  4QL7 A;  4YQM A;  5ECN B;  1JZR A;  3H8Q A;  3GV1 A;  3TJJ A;  2C1Y A;  3IAS 2;  3CTG A;  1QUW A;  2QSI A;  1GTB A;  1AQX A;  3FRC A;  4XS4 A;  3KD0 A;  2KUC A;  1ZCP A;  4KH7 A;  2V32 A;  4O5U A;  1N2A A;  2BTO T;  1ZMA A;  4ZXG A;  4IP6 A;  2FGX A;  4EL1 A;  5D96 A;  1RK4 A;  4TR1 A;  1X5E A;  2VL9 A;  4CY8 A;  1FAA A;  3HDC A;  4HU7 A;  2EC4 A;  2IPA A;  3MDK A;  1AUC A;  3A2X A;  3VUR A;  4X1U A;  6GSS A;  2MMZ A;  3FZ4 A;  2JZT A;  5IPH A;  4MF5 A;  3L78 A;  3LEF A;  2L4C A;  4BVX B;  1QGV A;  4NAX A;  1M2D A;  3ZZX A;  1V2A A;  1YF0 A;  1H4O A;  2DKI A;  3APO A;  2HRN A;  2N5B A;  3QAW A;  4HDE A;  3IAM 2;  2GDR A;  1VGL A;  3KP8 A;  3CRU A;  1EOH A;  1ILO A;  2C0E A;  2YNX A;  5EY6 A;  2K6V A;  1EEM A;  1XWB A;  3UMA A;  1Q98 A;  2WCI A;  3F6F A;  4HEA 2;  1JZW A;  4GXZ A;  2CAI A;  1OE8 A;  5E4W A;  3TOT A;  4K7O A;  4P3Y B;  1PL1 A;  3WT2 A;  1Z6M A;  2YWN A;  1TK0 B;  4POL A;  2WGR A;  1E2Y A;  4POB A;  4FYB A;  4K5R A;  4HU9 A;  2BMX A;  4MJB A;  3WGD A;  2K8V A;  4TR1 B;  3PGT A;  5J41 A;  5AIX A;  1B4P A;  4FQU A;  2IFQ B;  2M80 A;  4LA1 A;  3M3M A;  2H1A A;  13GS A;  4EDY A;  1ZYE A;  2L59 A;  3GKK A;  2V6O A;  5JCG A;  2AHE A;  4I5Q A;  5H5R A;  3IV4 A;  2RM5 A;  2WDU A;  1ST9 A;  1YDK A;  4GSN A;  8GSS A;  3ZIJ A;  7GSS A;  2JL4 A;  1R4W A;  4NHW A;  1KNG A;  4GST A;  3C73 A;  2DIY A;  1YJ6 A;  1BQ7 A;  4ZBD A;  4GRF A;  4ISD A;  3FZA A;  1ERV A;  2PU9 C;  2GVP A;  1V40 A;  2H01 A;  2XBI A;  3HCZ A;  2PVQ A;  3D6I A;  2QGV A;  1GUK A;  4BL7 A;  4IJI A;  1A2J A;  3D4T A;  1SD9 A;  2LNT A;  4GF0 A;  3GKX A;  5JCU A;  3GKN A;  2V6K A;  4K2D A;  2OJL A;  3G7Y A;  4USS A;  2GQK A;  3UBL A;  3GIX A;  4V1A g;  4HQS A;  3TB2 A;  4GWR A;  4Z2U A;  5KOX A;  5ELG A;  3M9J A;  3GYK A;  5ECQ B;  4JR4 A;  1TRS A;  3F8U A;  4ZB9 A;  1GUL A;  1ZYP A;  5FT3 A;  5A5K A;  2GSQ A;  1B4Q A;  1BX9 A;  2PVO C;  3F9U A;  3L0H A;  1OKT A;  2KOK A;  2F3M A;  5IO2 A;  2L6C A;  3C1S A;  3CXG A;  1HD2 A;  3LXZ A;  4ULX A;  1CQH A;  2I4A A;  3VPT A;  5ELA A;  2XPD A;  1U6T A;  3VPQ A;  3M0F A;  1BAY A;  2VIM A;  5KN0 A;  1TK8 B;  3DXB A;  4K0G A;  1FB6 A;  2I3Y A;  1M9A A;  4ZB6 A;  1EV9 A;  3CYN A;  4FYC A;  1SYX A;  2FY6 A;  1TOF A;  2DBC A;  1TU8 A;  1HNA A;  3A5W A;  2CVK A;  3KGK A;  3LSZ A;  4L5L A;  1O8W A;  4NWY A;  3Q18 A;  2J23 A;  2LRN A;  3D0Z A;  4PNG A;  3WT1 A;  1XWK A;  3TKS A;  5F05 A;  2H6Y A;  2WB9 A;  1ERU A;  3EC3 A;  4ECI A;  3IK9 A;  3P2A A;  5IMA A;  2NBS A;  2GT5 A;  1ZZY A;  4LMV A;  4TRX A;  4YQU A;  4JED A;  3HA9 A;  1ZOF A;  2K9F A;  1GWC A;  4JZQ A;  3WD6 A;  4X4J A;  6GSY A;  4HI7 A;  2QC7 A;  2H73 A;  2FCH A;  1JLW A;  1DE1 A;  4O5R A;  3FY7 A;  2R0G A;  2PUK C;  5CYY A;  2H71 A;  4RI7 A;  5IMF A;  4V1A p;  5AGY A;  2GS3 A;  1KTE A;  4KDX A;  3E3E A;  4K0N A;  2CT6 A;  2DML A;  2E2G A;  3WYW A;  3I6A A;  2VCZ A;  1X5D A;  5J9C A;  2CVB A;  3LQ7 A;  4IBP A;  4KF9 A;  4Q5R A;  2H6X A;  3IDV A;  2CV4 A;  2CVD A;  4ECB A;  1PX7 A;  3NZN A;  3HXS A;  5ID2 A;  1O81 A;  1ZGN A;  4XTS A;  2YV9 A;  2HT9 A;  5ECR B;  1U3A A;  4KCA A;  4MDC A;  4XIH A;  2TRX A;  4POK A;  3DGQ A;  2LQQ A;  1Y6E A;  5GST A;  3HZ4 A;  1Y25 A;  3R3E A;  1XOA A;  2F8F A;  1OVN A;  1JFU A;  1X9S B;  4ZB8 A;  2WZ9 A;  4A5P A;  1UN2 A;  5F06 A;  2E0Q A;  1OYJ A;  5ECS A;  2JSY A;  2NVL A;  2PWJ A;  4GQC A;  2B5X A;  1PA3 A;  5HFI A;  1XFL A;  2A2S A;  1FOH A;  1A23 A;  1NW2 A;  2XHF A;  2H19 A;  2FA4 A;  4PNF A;  2FWH A;  5GAP D;  2YN1 A;  4IQ1 A;  2H74 A;  4LL4 B;  4AJ8 A;  5IO0 A;  2B5Y A;  4IVF A;  3GUR A;  4WF4 A;  3O3T A;  1AQW A;  2YCD A;  3FKF A;  3PPU A;  2OKA A;  3EMX A;  4MA9 A;  4GTU A;  3DVX A;  3S9F A;  1RW1 A;  2ZUP A;  1O7U A;  3GX8 A;  2IN3 A;  3TDG A;  1SL0 B;  3TKR A;  1FG4 A;  1R7H A;  1PN0 A;  3TKS E;  2EIR A;  2TIR A;  1V58 A;  1TP9 A;  5FHI A;  2HZE B;  3GSS A;  1K0A A;  1EWX A;  5DDL A;  4BVY B;  2O8V B;  3RDW A;  2FLS A;  1THO A;  2YZH A;  1Z7P A;  2BJX A;  2C0D A;  3IXR A;  3L9U A;  2MBS A;  3QMX A;  2O89 A;  2DJ2 A;  4AGS A;  5ECH B;  2YOI A;  4GQF A;  3IOS A;  5KEJ A;  2PN8 A;  2V41 A;  2YJH A;  1XCC A;  3MAK A;  1AW9 A;  3LGC A;  1UVZ A;  3VWU A;  4RQX A;  1TW9 A;  4OMV A;  4X0X A;  3FZ9 A;  1DUG A;  2V1M A;  4MP4 A;  4TXO B;  3Q74 A;  4F0C A;  4HS1 A;  1K0O A;  1K3L A;  4K6X A;  5G1K A;  17GS A;  3UL3 A;  2H0H A;  3KXO A;  3GH9 A;  3GRX A;  1G7O A;  3IK7 A;  3U5R E;  1PL2 A;  3QPM A;  4V2M A;  2H1G A;  3LFL A;  2VLV A;  1V98 A;  1GUM A;  3UBK A;  2LJR A;  4G10 A;  4XCS A;  1K0C A;  4OO5 A;  3L9V A;  3N9J A;  1YEP A;  1F3A A;  2O87 A;  4F03 A;  2DJK A;  3CRT A;  3IC8 A;  3GUS A;  2LEG A;  2C80 A;  5BRT A;  5DCH A;  1MD3 A;  1K0M A;  1FVJ A;  2LRC A;  2JZS A;  5CAX A;  1WWJ A;  1IYH A;  1TRW A;  4HJM A;  2B6M A;  1EEJ A;  4BVX A;  2E7P A;  4V2N A;  2IMK A;  3I43 A;  3DYR A;  5G31 A;  1SL2 B;  3LWA A;  3IR4 A;  2HXK A;  4BPY A;  3PH9 A;  4N0V A;  5DAL A;  3GL3 A;  3SBC A;  5G5F A;  3KTB A;  3RBT A;  5LCZ A;  2RUF A;  1A2L A;  1MDK A;  1X9M B;  3LJR A;  4PX1 A;  1M7T A;  4EVM A;  4EDZ A;  1X5C A;  2PPT A;  2QA2 A;  5ABR A;  3ISO A;  4O7H A;  3J7Y k;  4I97 A;  2VCX A;  4PUA A;  3GN3 A;  5KOW A;  2O7K A;  3L4N A;  2AUV A;  2REM A;  4X43 A;  3ZMK A;  2GZY A;  1GSS A;  2H1B A;  4MZC A;  2QKE A;  1XW6 A;  1GSD A;  1ZL9 A;  2IFQ A;  4KW6 A;  2B1L A;  4MH2 A;  4MF7 A;  4F0B A;  5HFG A;  2FUG 2;  1VF4 A;  5D9T A;  4EO3 A;  3VWW A;  1Z3E A;  2VM1 A;  2GZP A;  4K1F A;  1GLQ A;  5B7C A;  2DIZ A;  2CQ9 A;  4G0L A;  1PD2 1;  4G19 A;  1PX6 A;  1R26 A;  2IME A;  2ES7 A;  2N5A A;  4GCI A;  4NHZ A;  1YEX A;  4NXI A;  2A2P A;  1K3O A;  1WE0 A;  4FH8 A;  3TKP A;  2X8C A;  2H72 A;  2CX4 A;  1FW1 A;  4KGI A;  5DAL B;  2P31 A;  2VCT A;  1A24 A;  5DAK A;  5HR3 A;  5A4W A;  2AV4 A;  4G0I A;  3Q19 A;  2H76 A;  3ZRD A;  1PKW A;  5CRG A;  2AB6 A;  2OBK A;  1GNW A;  1AIU A;  1OC8 A;  4PTS A;  3K8N A;  3EYT A;  4TVE A;  4ZIL A;  4O5Q A;  1I5G A;  2AAW A;  1K0D A;  3D4M A;  2HRK A;  1T7P B;  4KND A;  4IKH A;  3I9V 2;  2WS2 A;  2VCW A;  4XS6 A;  2VOC A;  2KLX A;  3DKS A;  2L4Q A;  3KIJ A;  2PER A;  4JR6 A;  3O76 A;  4YQV A;  1SKR B;  1W89 A;  3ED3 A;  1VRS D;  3A2V A;  3TGZ A;  3TJG A;  4CHS A;  2GQL A;  3SWL A;  2HYX A;  1BJX A;  1GSU A;  3F3R A;  4LLR A;  3ZLP A;  4J57 E;  3ZIT A;  2OE1 A;  3KEB A;  2H0G A;  2DLX A;  1XWA A;  5INY A;  2CA8 A;  2QA1 A;  1Z6N A;  4ILF A;  2LS5 A;  3IE3 A;  3GFK A;  2YWO A;  4EKZ A;  4IJ3 A;  2F8A A;  1MEK A;  5D9W A;  3EMP A;  3CSI A;  2LTK A;  1O85 A;  5DVB A;  1Z5Y E;  3QDN A;  1X0R A;  1U3I A;  5J9B A;  2JAD A;  4WET A;  1SK0 A;  1JLV A;  3M1G A;  1V57 A;  3KMN A;  4WEY A;  3FW2 A;  4K7I A;  5DAK B;  3JCM L;  1UA5 A;  3TOU A;  2MBT A;  5CRW A;  2PGT A;  1GNE A;  1GTI A;  1FOV A;  4LMW A;  1USB A;  1F9M A;  3M9K A;  5EVO A;  4IHU A;  5HR1 A;  4RQR A;  4PXO A;  4IS0 A;  2GZZ A;  4KSM A;  4MJC A;  3UJ1 A;  2R6K A;  2F9S A;  1MDI A;  1GRX A;  1RQM A;  4F2I A;  4CDO A;  4AF2 A;  2GST A;  3P7X A;  2C0F A;  2XPE A;  1PKZ A;  5DJM A;  3IRA A;  5E59 A;  1YKC A;  3GST A;  3LOR A;  4TN8 A;  3HHV A;  1SK2 A;  3Q6O A;  4MJE A;  5LNK e;  4HZ2 A;  3L9S A;  1TRV A;  2K18 A;  5J5N A;  1NM3 A;  4OFT A;  2M46 A;  3DD3 A;  4MZB A;  4KX4 A;  2R5G A;  2LUS A;  3ZVJ A;  1EGO A;  3APS A;  5B6N A;  5H5S A;  3J7Y b;  3ERW A;  2J9H A;  3G7J A;  4IP1 A;  3TKQ A;  4KDU A;  3D22 A;  1S3D A;  1YKA A;  2PMT A;  2LRT A;  3GA4 A;  2CZ2 A;  2VUP A;  1FVK A;  2JZR A;  19GS A;  1J9B A;  4JBB A;  3FYG A;  4H86 A;  4WBJ A;  3EU3 A;  4MPG A;  4MH3 A;  4NMU A;  3VI7 A;  5B6M A;  4FIW A;  6GSV A;  1TKD B;  3KJY A;  2B7K A;  3F63 A;  3NIV A;  2IL3 A;  2C3T A;  4IQA A;  1LJR A;  2YZU A;  2R3X A;  1M2A A;  1ACV A;  1TI3 A;  2N5F A;  3ZTL A;  2AJQ B;  3DWV A;  4DVC A;  4EF0 A;  1PRX A;  2G0F A;  4N30 A;  2R2J A;  3KZQ A;  1C72 A;  5DCG A;  2KHP A;  1QK8 A;  4DSR A;  4YKG A;  4RUV A;  1KBN A;  3QCP A;  5KN3 A;  2I9H A;  1GSE A;  2NDO A;  2HZE A;  4MAB A;  5JWR B;  3ZL5 A;  4BVY A;  4D73 B;  3PIN A;  1XZO A;  4FO5 A;  2X64 A;  4FYU A;  3TCO A;  3H93 A;  3UIW A;  4TR4 A;  3AY8 A;  3GMF A;  3UVT A;  3ZYW A;  2D2Z A;  1QQ2 A;  3DML A;  2UZ8 A;  2ALB A;  4EUY A;  2GSS A;  2MMO A;  1WIK A;  2RUE A;  2YWM A;  4WR4 A;  4J2F A;  3FR6 A;  2ZNM A;  3C8E A;  5DQY A;  3I69 A;  4KA0 A;  4Q5F A;  4TXO A;  1SKW B;  1SL1 B;  4MNN A;  3IC4 A;  2C0G A;  3F4R A;  5ECO B;  4QL9 A;  22GS A;  3HZ8 A;  3FHK A;  4JE1 A;  4IEL A;  2VL3 A;  1XIY A;  4Z7X A;  2GGT A;  3MIX A;  4IGJ A;  4MF6 A;  5ECI B;  5CNW A;  2JU5 A;  3TJF A;  2KP1 A;  5B8B A;  4MPF A;  3F4T A;  4LL1 B;  2X4A A;  1GTU A;  1TK5 B;  2OAD A;  2VCQ A;  3CMI A;  2GQM A;  1QMV A;  5COH A;  4K7N A;  3GTU A;  1ERW A;  1ZYN A;  3UAP A;  3KTL A;  1OC9 A;  3FZ5 A;  1G6Y A;  4MCU A;  1K3Y A;  4PUF C;  4YH2 A;  1SU9 A;  4ZIJ A;  1N8J A;  3HJP A;  3IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...