2ZUPA

Updated crystal structure of dsbb-dsba complex from e. coli
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein dsbA
publication title Dynamic nature of disulphide bond formation catalysts revealed by crystal structures of DsbB
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 188
sequence length 188
ec nomenclature ec 1.8.4.-:
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2zupA00
4DEJA 4EXJA 1XIYA 2YZHA 3QOUA 3Q19A 4G10A 1A0RP 3TOUA 3LJRA 3UL3A 2JU5A 3KP9A 3GH9A 4RQRA 4G19A 3VLNA 1X5DA 1GUMA 3KGKA 1XVQA 4KCAA 2HZEB 2GT6A 1K3LA 1R26A 1VRSD 4K7IA 5ENUA 3VWVA 4POKA 1IYHA 4TR1B 2YJ7A 4V1Ap 1FOVA 2HRFA 1IYIA 2C1YA 4WR5A 2YANA 4HEA2 3GUSA 3G9BA 4EDYA 2V41A 3FR6A 2YJHA 3UBKA 2TRCP 1GTAA 4HZ4A 2LKUA 3TB2A 1JFUA 5D9TA 5HQPA 3APSA 1W4VA 5IMVA 1G6YA 1N2AA 4TR3A 3L9SA 3F9UA 1UA5A 5JWQB 2AYTA 5C00A 1GWCA 2E7PA 4MF5A 5AN1A 2QKEA 5ECPB 2FA4A 5B7CA 1Z6MA 3GHAA 1ACVA 4O5RA 2FNOA 2KHPA 4D73B 4NHZA 1FG4A 2I4AA 2H71A 1JHBA 5CYYA 2QGVA 2GSTA 2IMIA 2VCTA 5HFGA 2OKAA 2LS5A 4BWQA 4LA1A 2VOCA 4GQCA 1F37A 1TU8A 4K9ZA 4BWSA 2O8VB 4MP4A 4HDEA 1M2BA 17GSA 3L78A 6GSTA 2X99A 2WZ9A 4ML1A 4G2EA 1R5PA 3HCZA 3HJOA 4JBBA 4L0UA 4IGJA 4ZB8A 2PMTA 2ZUPA 1THOA 4JRRA 1NW2A 4FYUA 5DCHA 1WIKA 3ERFA 2LNTA 2YV7A 5ELGA 2ON5A 3BD2A 1QK8A 1SK0A 4TRXA 2VO4A 1BEDA 2PGTA 4ZB9A 1GUHA 2C0EA 1W89A 3QPMA 5G2ZA 4X43A 2AB6A 1E6BA 1BQ7A 1K0MA 1TK5B 2PVQA 5G1LA 2CQ9A 1YKCA 2GGTA 4CW9A 3TRQA 3CSHA 3ZLPA 2BTOT 3O3TA 2C4JA 4LMVA 4V2NA 5J3RA 1X5EA 3CSIA 4IJIA 4HQZA 1F6MC 1AIUA 2H0IA 6GSYA 4IKHA 1FVJA 1V58A 2G2QA 4HJMA 1PGTA 2PUKC 4L5OA 4IN0A 1OE7A 3IAM2 4JR4A 2B5XA 2HRNA 5A4VA 2FGXA 3K8NA 1PA3A 2OE0A 4XIHA 3H79A 5ELAA 2K9FA 5F06A 5KN2A 2DJ0A 5JWRB 1UC7A 1XW9A 5JCUA 5D93A 1A0FA 3CXGA 3EVIA 1S3CA 1TI1A 3WT1A 2GSSA 1XVWA 2YWIA 4AJ6A 2MMNA 2HE3A 2H75A 1F3AA 1M7TA 5COHA 4F82A 1F2EA 4KH7A 3P2AA 5D9WA 3WT2A 1ERTA 1B9YC 3WGXA 2DLXA 2MMZA 2AAWA 4X1UA 5G5FA 3TJGA 3DKSA 2JZSA 4OFMA 2GZZA 3UAPA 2P31A 1SL2B 4MPFA 4O7HA 3CMIA 2X8HA 4RI7A 2WB9A 5DJMA 3RHCA 4QL7A 2RIIA 4KGIA 2GS3A 2QSIA 5A5KA 3BBYA 3GRXA 1PRXA 4K8MA 3RPNA 5DDLA 2DJ3A 1AC1A 4KX4A 1MDJA 2N5FA 4K1FA 2ZNMA 2VL9A 1YY7A 5H5SA 1BAYA 2JSYA 4ZB6A 2RLIA 5EY6A 2LNSA 5KN1A 1DE2A 3QDNA 3ZFBA 2REMA 2GT5A 1OE8A 2H76A 1ERUA 1G0TA 4HI7A 4HU7A 3VFIA 1V9WA 5ECHB 4AJ8A 1Z7PA 2GZYA 5IO2A 2YV9A 2K8VA 4H86A 3CSJA 4KE3A 1TJDA 2NTOA 3GL3A 2VL2C 5IPGA 1Z7RA 1O8WA 4NXIA 3M0FA 1R5AA 1THXA 4KAEA 2B1KA 5ECRB 5IMAA 1XW6A 4EVMA 1WRYA 1WP0A 3RHBA 3LQ7A 4XRAA 3VWXA 4GWRA 5DQYA 4TN8A 5D9VA 5F8BA 5CP1A 2XPDA 1MEKA 3F6FA 4D73A 18GSA 4GRFA 1PMTA 5IMDA 2XBQA 5CAXA 2DJ2A 3HVSA 3U6VA 4PQHA 3LG6A 1N8JA 2X8GA 1F3BA 1JZDA 3KH9A 1EGRA 3DVWA 4I2TA 3OR5A 4N30A 4GQFA 1ILOA 1KBNA 2DC5A 5ID2B 1KNGA 1Y6EA 1TDIA 2HYXA 5DVBA 1B4QA 1OC9B 1YEXA 1PX6A 1B9XC 1SU9A 5CREA 4J57E 1K0OA 4HU9A 5IIZA 1PL1A 2IPAA 2JACA 3LWAA 3D6IA 1SK2A 1SJZA 3CTGA 3KMNA 2TRXA 3S9FA 1DE1A 2ON7A 3F4TA 4WEYA 3IK7A 3GTUB 3DGQA 2C0DA 2GZPA 5J9CA 1F9MA 2HNLA 4KA0A 5ECLB 3HVVA 4MF7A 1T7PB 1SKWB 1T4YA 4MJEA 2GLRA 4G9HA 3TKSE 2L5OA 4JE1A 1SJ6A 5DCGA 3L0HA 4NV5A 2M72A 3HD5A 1EP7A 1EV4A 1TK8B 5DALB 4MZWA 2LJRA 3DD3A 3CRUA 2L4CA 4MF6A 2YWOA 1Y25A 4XCSA 1ZCPA 1ML6A 1A2MA 2HXKA 4POMA 5ECMB 3VI5A 1QUWA 4F0CA 2AV4A 5GAND 1AUCA 1OVNA 2WS2A 3GX0A 3GX8A 1K3YA 4K0GA 5AGYA 5B6NA 4IHUA 1ZYQB 1GNWA 4RQXA 4POLA 3M3MA 1XWGA 3PINA 3E3EA 2H1AA 2A2SA 3O6TA 4AF2A 4ISDA 1FVKA 1M2AA 4ECBA 1M9AA 1LBKA 4GF0A 2TIRA 4WF5A 3LXZA 2DJ1A 1RW1A 3NIVA 4WETA 5LD0A 1XWAA 2C3TA 2GSRA 4IJ3A 4ZXGA 4WBRD 3ZITA 1HNCA 1GRXA 2N5AA 2VCQA 3HA9A 3FK8A 4PURA 3Q6OA 3TKPA 2L6DA 2AUVA 7GSSA 2HI7A 4K6XA 4TKYA 4WKWA 4GXZA 2B7JA 2FUG2 2NDOA 1TRWA 1T3BA 16GSA 1WE0A 1EWXA 4IP1A 2E2MA 2R3XA 4EE0A 3EMPA 4ECCA 2DMMA 1TP9A 4F2IA 5INYA 4ECIA 1SD8A 3ZTLA 2FLSA 3EC3A 5C04A 5JCWA 1HYUA 1NHOA 1V57A 3UEMA 2H19A 1SJIA 1HNBA 4P3YB 1OC8A 2H6YA 5A4UA 2C80A 19GSA 1YKAA 4YAPA 3TUEA 1OYJA 1GSEA 2XPEA 4IVFA 4EO3A 1C72A 4O32A 4XS6A 10GSA 3MAKA 8GSSA 1O6JA 2E0QA 3F4RA 1QQ2A 6GSVA 1WWJA 1M2DA 4XHMA 2VCZA 2VIMA 3ZMKA 2R4VA 3IE3A 2ES7A 1PKZA 1A2LA 5HR0A 1BYEA 4DVCA 2WDUA 3QAGA 2K8SA 3G7YA 1GSYA 4ZIJA 4BPYA 3WGDA 2V6OA 1SKRB 1YF1A 2R37A 2O89A 2MBSA 5ID2A 2VUPA 4LL1B 4CDOA 4YH2A 2F9SA 5JWOB 4KW6A 2ALBA 3TDGA 3FKFA 2VLVA 9GSSA 2FY6A 1T00A 2H01A 3M8NA 3H93A 1URMA 4NPBA 2GVPA 3GFKA 2LRNA 4MZBA 4Q5FA 2EIRA 1TK0B 5EPFA 3DWVA 2C0GA 3KTBA 2FD3A 3TRXA 1TRUA 2ZCTA 1O7UA 3GH6A 2KUCA 1XFLA 1K0NA 3VWUA 3NZNA 3TKSC 4DSSA 3D4MA 4GCIA 2OACA 4LLRA 1FW1A 4OCEA 1ON4A 4N0VA 3PR8A 1XCCA 3WYWA 2CVKA 5GAPD 2CX3A 3SWLA 1USBA 1GTBA 3L9UA 4CHSA 3EWLA 3A5WA 1T1VA 5DQSA 4K7NA 4IP6A 1U87A 5GSSA 5IOWA 5CRHA 3C73A 3C8EA 1WPIA 1CQGA 1I5GA 2CVDA 3MNGA 3IXRA 5L71A 6GSSA 3V1WA 4MLYA 5G1KA 5HR3A 3KZQA 2L59A 2IFQB 3C7MA 3VPTA 4I8BA 4ZBAA 1K3OA 2R6KA 4KSMA 2AHEA 2YWNA 4ID0A 5J5NA 1A24A 3ED3A 5D9XA 3KTLA 4RUVA 1GH2A 1SKSB 3HKRA 4JR6A 3D5JA 2KP1A 4XS4A 4MJCA 1GSQA 2B3SA 4POBA 11GSA 3BCIA 3M9JA 2KLXA 2OE3A 3RBTA 2HSYA 2FHEA 4TR4A 3TRPA 3TKRA 1AXDA 4XRDA 5F0GA 1Z5YE 4KCEA 5ECOB 5HFIA 4MA9A 4OCFA 3FRCA 3TJFA 2R5GA 2V1MA 3P8WA 2HZEA 5IQYA 2VD1A 4K7OA 2H1BA 1MTCA 1K0AA 4BVYA 4TR1A 4BVXA 3VURA 4HJ2A 3SBCA 1YF0A 1EP8A 4I6XA 2MMAA 3E9JB 2DBCA 4K0NA 4ML6A 2WCIA 2IIYA 1G7EA 1OAZA 5G30A 2GQMA 2YP6A 13GSA 1EOGA 2YPMA 1Q98A 2IMFA 3QFAC 5FWGA 1ST9A 3EMXA 1K0CA 3DYRA 2M46A 1BG5A 2JSZA 5LNKe 1O85A 1J08A 2VAFA 3FEUA 5AISA 3IRAA 4IW9A 2OBIA 3E0UA 3LEFA 3QAWA 4ZL9A 3MDKA 2H70A 5IO0A 4MCUA 1JLVA 3KEBA 3CTFA 4WBJA 3N9JA 2E2GA 2OADA 1GSFA 1PL2A 2C8UA 2CAQA 3IAS2 3IV4A 3ZFLA 5ECIB 3IC4A 1CQHA 1GL8A 3LFLA 3DIEA 3KH7A 3TKQA 2OJLA 2F3MA 4K2DA 3ZIVA 5ABRA 1B8XA 3UVTA 3A2XA 2CA8A 1PKWA 3O76A 3WGEA 5CRWA 2FCHA 3M9KA 4PUFC 1XWKA 2H6ZA 4KDUA 1XWCA 3EINA 5G31A 4Q5RA 1YQ1A 2VD0A 2JZRA 2PN8A 3KM6A 3QAVA 2JZTA 4HS1A 2K18A 20GSA 1T4ZA 4F9ZA 4L8EA 2KP2A 4HZ2A 5B8AA 2RUFA 3FR3A 4WF4A 2YWMA 2X8CA 3FYGA 4YAVA 5CRGA 2DJJA 4OWYA 3IK9A 3A2WA 2LQOA 5EVOA 4N10A 1ZZYA 2NPBA 3MSZA 1OKTA 2CVBA 1T8EB 1OKDA 4JZQA 1U3AA 5IPHA 4EKZA 5HFKA 2Z9SA 1AQVA 2RM5A 1Z6NA 3GKKA 3DXBA 2HLSA 3WD6A 1AW9A 4QQ7A 5IOXA 2F8AA 4OO5A 1NHYA 1SL1B 4J56E 4EC0A 2HSHA 4TXVA 3D21A 3HVXA 1SD9A 1TRVA 1SYRA 2L4QA 1RK4A 4RI6A 3CBUA 1EV9A 1ERWA 2LJAA 1DSBA 1XW5A 4TXOB 2GDRA 1AQWA 5GSTA 3VPQA 3R2QA 2VM2A 4IBPA 4MPGA 2LQQA 3IDVA 2H1GA 5IMCA 5IM9A 2PVOC 1K0DA 3EU3A 2YN1A 4N0ZA 2D2ZA 4AGSA 2IFQA 1TXXA 3UOMA 5KEJA 4X0XA 1O73A 3GIXA 2LJKA 1HD2A 2RUEA 4MZCA 5KN3A 1UVZA 2MZCA 5FHIA 2VL2A 3GKXA 1GNEA 1TRSA 3IHQA 2H0HA 3PH9A 4YQVA 2B5EA 3DMLA 3BCKA 4LL4B 3GKNA 1A2JA 4HQSA 4GSNA 3EU4A 4ZBDA 2J9HA 3VWWA 3ZVJD 3I69A 3F8UA 1M0UA 2EIQA 4IS0A 1FB6A 5B6MA 3HYPA 2YOIA 1YDKA 2DIZA 4PQ1A 3FR9A 1DBYA 2AJQB 2OBKA 4PUAA 2JADA 4MMMA 2LTKA 4N11A 4GSTA 5D73A 3VI7A 3DRNA 5ECSA 1WJKA 5E4WA 3QMXA 2WGRA 2VLTA 4NWYA 3QCPA 3FZ5A 3GMFA 4NV2A 1GSSA 3P7XA 3QFBC 2LRCA 3IPZA 4ZL7A 1H4OA 1NSWA 3IA1A 2VM1A 1PX7A 3FZ4A 1FO5A 5A4WA 3G7IA 3Q74A 2NBSA 4OFTA 4KB3A 2OA7A 2IMDA 4ECJA 4ZILA 3C71A 12GSA 6GSWA 5FT3A 4FYBA 1WMJA 5DAKB 1UN2A 4V2LA 1LU4A 3ZRDA 1O8XA 5J41A 1FB0A 3KP8A 3C1RA 2VCVA 2YZUA 3HJMA 2EC4A 1VF1A 2VL3A 2G0FA 1V98A 1OC3A 4TR0A 1S3AA 2VCWA 4YQMA 3KXOA 1G6WA 1TU7A 2IN3A 4EL1A 3TJBA 2WJUA 2P5QA 2H8LA 2HT9A 2BJXA 4BL7A 3LORA 5LCZA 3KMOA 2LRTA 3HXSA 3TCOA 2N5BA 1OC9A 4OO4A 5J4UA 5HR1A 4ZBBA 1QFNA 5E59A 5G5EA 4JEDA 1R7HA 3GYKA 4XTSA 4J2FA 4L5LA 2YCDA 4IQ1A 4E8EA 2LUSA 1J9BA 3TGZA 1ZOFA 1SK1A 4YQUA 2I1UA 3D4TA 3GTUA 1XOBA 3I6AA 1TW9A 4TOPA 5GZZB 5JCGA 3FHKA 3FZAA 1M99A 2LV3A 1U88A 1SENA 2IWTA 1ZYEA 3ZZXA 1X9SB 1A8LA 1GUKA 4TW5A 5D96A 3IBHA 4Q5QA 4Q5NA 3FW2A 3ISOA 1GLPA 2H0GA 3CYNA 4FIWA 2C0FA 3LGCA 3UBLA 2H30A 3W8SA 4Z7XA 2IMKA 1ABAA 22GSA 3APOA 3F6DA 5DALA 4ULXA 3GNJA 1XOAA 3N5OA 4AJ7A 3LXTA 2L6CA 2NVLA 3HY2A 1XXUA 2XHFA 5AIVA 1PSQA 5ECKB 2DMLA 1JZRA 3FY7A 4HOJA 4ILFA 3IR4A 3GSTA 4F0BA 1EGOA 2O87A 1JLWA 1MDKA 2FWFA 1I9DA 2C3NA 4NAXA 1VF3A 2J23A 3RAZA 4KDYA 4JU5A 3KCMA 2B7KA 2K6VA 1ZGNA 4TXOA 3NOFA 3ZIJA 1X5CA 2M80A 1FHEA 2LSTA 1H75A 1YZXA 3UVHA 4KUNA 2H72A 4NMUA 4FO5A 1X0RA 2XC2A 1HQOA 2CZ2A 4PNFA 1TI3A 1A23A 4V1Ag 3ZMLA 5DBQA 2F8FA 2IMEA 2JL4A 2HZFA 2VCXA 5J9BA 4MJBA 4E8HA 5H5RA 1U6TA 4ZL8A 3EE2A 3J7Yk 1SL0B 1XPVA 4GLTA 3EURA 1VF4A 3L4NA 3HZ4A 2FA8A 1GTUA 1Q4JA 4FYCA 3I43A 1K0BA 2PERA 2H73A 5F05A 3A2VA 5EL8A 4F03A 1WOUA 2P5RA 3QD9A 3GA4A 5CNWA 4MJAA 3D22A 1GSDA 3BOAA 3APQA 4OD7A 1PD21 2DSAA 2YNXA 1VGLA 4V2MA 5ECQB 4MH3A 1ZMAA 2MBTA 2DJKA 4I5QA 3Q18A 2B6MA 1TOFA 3AY8A 5CRDA 1MDIA 4WXTA 1XZOA 1YJ6A 3IOSA 1AAZA 2H1DA 2F51A 4PNGA 4OMVA 3ME8A 4PQIA 3L9VA 1V2AA 2C3QA 3HZ8A 3BJ5A 6GSUA 1QGVA 1M9BA 1XWBA 4OFNA 3LYKA 4O92A 1Z3EA 5HR2A 1EOHA 1GULA 3TJJA 2CT6A 2FWHA 2H6XA 4MDCA 3PGTA 1E2YA 2WRTA 4KSOA 1J0FA 4I97A 1ZL9A 2O7KA 4DSRA 1EZKA 2H66A 3RPPA 4LMWA 1EEMA 5DAKA 2I9HA 4XS1A 1O81A 3US3A 4EDZA 3GN3A 3TJKA 1HNAA 2PBJA 1TTZA 1NM3A 2V6KA 1VF2A 3F4SA 4GSSA 3ZREA 1PQNA 2A4VA 3JCML 3RDWA 3TKSA 4PX1A 2A2RA 2GSQA 5H5QA 2PU9C 2I3YA 1GLQA 4DSQA 3F3QA 2HFDA 2CZ3A 1A8YA 1B4PA 3ZYWA 3QR6A 1AQXA 2PPTA 3ZVJA 1JZOA 1JZWA 2OE1A 3W6GA 1KTEA 3MWHA 4MABA 3ERGA 2H74A 3W8JA 3GV1A 1SYXA 2BMXA 3ERWA 3UMAA 1U3IA 2CAIA 5CO3A 2KOKA 3KJYA 1X9MB 2I81A 2B5YA 2MYGA 2LEGA 1QXHA 1DUGA 2L5LA 4NHWA 14GSA 1V40A 2FWEA 1KEBA 2V32A 2WFCA 2R2JA 4TVEA 2FWGA 3F3RA 3KIJA 4IQAA 4KDXA 1MD4A 2P0GA 3GSSA 1BX9A 4WR4A 1FAAA 4MK3A 4BA7A 2PWJA 5DJLA 4QL9A 3GL5A 1EEJA 3H8QA 1B48A 4PGTA 3KD0A 4I2UA 3DEXA 1R4WA 3DVXA 5F07A 4MH2A 5IMFA 1GSUA 4PXOA 3VK9A 2L57A 2MMOA 3HJPA 1GP1A 3C1SA 1PN9A 4DSSB 5AIXA 2CV4A 4L0WA 5D8IA 2B1LA 1XBSA 4KNDA 5IMZA 2CX4A 3CRTA 2GQKA 1YEPA 3F63A 2GTUA 4EUYA 2IL3A 1Z9HA 2O85A 2GQLA 5KN0A 3TOTA 1ERVA 3U5RE 2RM6A 1TKDB 3A3TA 3G7JA 2DIYA 3UJ1A 2QC7A 2EIOA 3LYPA 3D0ZA 3ZL5A 4EF0A 2X64A 3M1GA 2WULA 3UIWA 3J7Yb 3GKMA 3LSZA 1RQMA 1G7OA 3ME7A 1LJRA 2V2GA 3HDCA 3H1NA 4FH8A 3GURA 3UARA 3EYTA 3FZ9A 3HHVA 3H4KA 2IJYA 2XBIA 3I9V2 1MD3A 5B8BA 1X9WB 6GSXA 3F0IA 1S3DA 1QMVA 1BJXA 4ACSA 4HUAA 1GTIA 4XS4B 4IELA 2VLUA 3P90A 4GTUA 5ECNB
chains in the Genus database with same CATH superfamily
4DEJA 4EXJA 1XIYA 2YZHA 3QOUA 3Q19A 4G10A 1A0RP 3TOUA 3LJRA 3UL3A 2JU5A 3KP9A 3GH9A 4RQRA 4G19A 3VLNA 1X5DA 1GUMA 3KGKA 1XVQA 4KCAA 2HZEB 2GT6A 1K3LA 1R26A 1VRSD 4K7IA 3HVNA 5ENUA 3VWVA 4POKA 1IYHA 4BVYB 4TR1B 4BVXB 2YJ7A 4Z2RA 4V1Ap 1FOVA 2HRFA 1IYIA 2C1YA 4WR5A 2YANA 4HEA2 3GUSA 3G9BA 4EDYA 2V41A 3FR6A 2YJHA 3UBKA 2TRCP 1GTAA 4HZ4A 2LKUA 3TB2A 1JFUA 5D9TA 5HQPA 3APSA 1W4VA 5IMVA 1G6YA 1N2AA 4TR3A 3L9SA 3F9UA 1UA5A 5JWQB 2AYTA 5C00A 1GWCA 2E7PA 4MF5A 4G0IA 4YKGA 5AN1A 2QKEA 5ECPB 2FA4A 5B7CA 1Z6MA 3GHAA 1ACVA 4O5RA 2FNOA 2KHPA 4D73B 4NHZA 1FG4A 2I4AA 2H71A 1JHBA 5CYYA 2QGVA 2GSTA 2IMIA 2VCTA 5HFGA 2OKAA 4K5RA 2LS5A 4BWQA 4Z2UA 4LA1A 2VOCA 4GQCA 1F37A 1TU8A 4K9ZA 4BWSA 2O8VB 4MP4A 4HDEA 1M2BA 17GSA 3L78A 6GSTA 2X99A 2WZ9A 4ML1A 4G2EA 1R5PA 3HCZA 3HJOA 4JBBA 4L0UA 4IGJA 4ZB8A 2PMTA 2ZUPA 1THOA 4JRRA 1NW2A 4FYUA 5DCHA 1WIKA 3ERFA 2LNTA 2YV7A 5ELGA 2ON5A 3BD2A 1QK8A 1SK0A 4TRXA 2VO4A 1BEDA 2PGTA 4ZB9A 1GUHA 2C0EA 1W89A 3QPMA 5G2ZA 4X43A 2AB6A 1E6BA 1BQ7A 1K0MA 1TK5B 2PVQA 5G1LA 2CQ9A 1YKCA 4A5PA 2GGTA 4CW9A 3TRQA 4Z2TA 3CSHA 3ZLPA 2BTOT 3LW9A 3O3TA 2C4JA 4LMVA 4V2NA 5J3RA 1X5EA 3CSIA 4IJIA 4HQZA 1F6MC 1AIUA 2H0IA 6GSYA 4IKHA 1FVJA 1V58A 2G2QA 4HJMA 3IC8A 1PGTA 2PUKC 4L5OA 4IN0A 1OE7A 3IAM2 4JR4A 2B5XA 2HRNA 4EIPA 5A4VA 2FGXA 3K8NA 1PA3A 2OE0A 4XIHA 3H79A 4X4JA 5ELAA 2K9FA 5F06A 5KN2A 2DJ0A 5JWRB 1UC7A 3PPUA 1XW9A 5JCUA 1ZYNA 5D93A 1A0FA 3CXGA 3EVIA 1S3CA 1TI1A 3WT1A 2GSSA 1XVWA 2YWIA 4AJ6A 2MMNA 4O5UA 2HE3A 2H75A 1F3AA 1M7TA 5COHA 4F82A 1F2EA 4KH7A 3P2AA 5D9WA 3WT2A 1ERTA 1B9YC 4CY8A 3WGXA 2DLXA 2MMZA 2AAWA 4X1UA 5G5FA 3TJGA 1ZYPA 3DKSA 2JZSA 4OFMA 2GZZA 3UAPA 2P31A 1SL2B 4MPFA 4O7HA 3CMIA 2X8HA 4RI7A 2WB9A 5DJMA 3RHCA 4QL7A 2RIIA 4KGIA 2GS3A 2QSIA 5A5KA 3BBYA 3GRXA 1PRXA 4K8MA 3RPNA 5DDLA 2DJ3A 1AC1A 4KX4A 1MDJA 2N5FA 4K1FA 2ZNMA 2VL9A 1YY7A 5H5SA 1BAYA 2JSYA 4ZB6A 2RLIA 5EY6A 2LNSA 5KN1A 2A4HA 1DE2A 3QDNA 3ZFBA 2REMA 2GT5A 1OE8A 2H76A 1ERUA 1G0TA 4HI7A 4HU7A 3VFIA 1V9WA 5ECHB 4AJ8A 1Z7PA 2GZYA 5IO2A 2YV9A 2K8VA 4H86A 3CSJA 4KE3A 1TJDA 2NTOA 3GL3A 2DKHA 2VL2C 5IPGA 1Z7RA 1O8WA 4NXIA 3M0FA 1R5AA 1THXA 4KAEA 2B1KA 5ECRB 5IMAA 1XW6A 4EVMA 1WRYA 1WP0A 3RHBA 3LQ7A 4XRAA 3VWXA 4GWRA 5DQYA 4TN8A 5D9VA 5F8BA 5CP1A 2XPDA 1MEKA 3F6FA 4D73A 18GSA 4GRFA 1PMTA 5IMDA 2XBQA 5CAXA 2DJ2A 3HVSA 3U6VA 4PQHA 3LG6A 1N8JA 2X8GA 1F3BA 1JZDA 3KH9A 1EGRA 3DVWA 4I2TA 3OR5A 4N30A 4GQFA 4BL7B 1ILOA 1KBNA 2DC5A 5ID2B 1KNGA 1Y6EA 1TDIA 2HYXA 5DVBA 1B4QA 1OC9B 1YEXA 1PX6A 1B9XC 1SU9A 5CREA 4J57E 1K0OA 4HU9A 5IIZA 1PL1A 2IPAA 2JACA 3LWAA 3D6IA 1SK2A 1SJZA 3CTGA 3KMNA 2TRXA 3S9FA 1DE1A 2ON7A 3F4TA 4WEYA 3IK7A 3GTUB 3DGQA 2C0DA 2GZPA 2QA1A 5J9CA 1F9MA 2HNLA 4KA0A 2HRKA 5ECLB 3HVVA 4MF7A 1T7PB 2X4AA 1SKWB 1T4YA 4MJEA 2GLRA 4G9HA 3TKSE 2L5OA 4JE1A 1SJ6A 5DCGA 3L0HA 4NV5A 2M72A 3HD5A 5BMUA 1EP7A 1EV4A 1TK8B 5DALB 4MZWA 2LJRA 3DD3A 3CRUA 2L4CA 4MF6A 2YWOA 1Y25A 4XCSA 1ZCPA 1ML6A 1A2MA 2HXKA 4POMA 5ECMB 3VI5A 1QUWA 4F0CA 2AV4A 5GAND 1AUCA 1OVNA 2WS2A 3GX0A 3GX8A 1K3YA 4K0GA 5AGYA 5B6NA 4IHUA 1ZYQB 1GNWA 4RQXA 4POLA 3M3MA 1XWGA 3PINA 3E3EA 2H1AA 4USSA 2A2SA 3O6TA 4AF2A 4ISDA 1FVKA 1M2AA 4ECBA 1M9AA 1LBKA 4GF0A 2TIRA 4WF5A 3LXZA 2DJ1A 1RW1A 3NIVA 4G0LA 4WETA 5LD0A 1XWAA 2C3TA 2GSRA 4IJ3A 4ZXGA 4WBRD 3ZITA 1HNCA 1GRXA 2N5AA 2VCQA 3HA9A 3FK8A 4PURA 3Q6OA 3TKPA 2L6DA 2AUVA 7GSSA 2HI7A 4K6XA 4TKYA 4WKWA 4GXZA 2B7JA 2FUG2 2NDOA 1TRWA 1T3BA 16GSA 1WE0A 4BIKA 1FOHA 1EWXA 4IP1A 2E2MA 2R3XA 4EE0A 3EMPA 4ECCA 2DMMA 1TP9A 4F2IA 5INYA 4ECIA 1SD8A 3ZTLA 2FLSA 3EC3A 5C04A 5JCWA 1HYUA 1NHOA 1V57A 3UEMA 2H19A 1SJIA 1HNBA 4P3YB 1OC8A 2H6YA 5A4UA 2C80A 19GSA 1YKAA 4YAPA 3TUEA 1OYJA 1GSEA 2XPEA 4IVFA 4EO3A 1C72A 4O32A 4XS6A 10GSA 3MAKA 8GSSA 1O6JA 2E0QA 3F4RA 1QQ2A 6GSVA 2X49A 1WWJA 1M2DA 4XHMA 2VCZA 2VIMA 3ZMKA 2R4VA 4O5QA 3IE3A 2ES7A 1PKZA 1A2LA 5HR0A 1BYEA 4DVCA 2WDUA 3QAGA 4MNNA 2K8SA 3G7YA 1GSYA 4ZIJA 4BPYA 3WGDA 2V6OA 1SKRB 1YF1A 2HRAA 2R37A 2O89A 2MBSA 5ID2A 2VUPA 4LL1B 4CDOA 4YH2A 2F9SA 5JWOB 4KW6A 2ALBA 3TDGA 3FKFA 2VLVA 4PTSA 9GSSA 2FY6A 1T00A 2H01A 3M8NA 3H93A 1URMA 4NPBA 2GVPA 3GFKA 2LRNA 4MZBA 4Q5FA 2EIRA 1TK0B 5EPFA 3DWVA 2C0GA 3KTBA 2FD3A 2HSMA 3TRXA 1TRUA 2ZCTA 1O7UA 3GH6A 2KUCA 1XFLA 1K0NA 3VWUA 3NZNA 1M3JA 3TKSC 4DSSA 3D4MA 4GCIA 2OACA 4LLRA 5BRTA 1FW1A 4OCEA 1ON4A 4N0VA 3PR8A 1XCCA 3WYWA 2CVKA 5GAPD 2CX3A 3SWLA 1USBA 1GTBA 3L9UA 4CHSA 3MYDA 3EWLA 3A5WA 1T1VA 5DQSA 4K7NA 4IP6A 1U87A 4KF9A 5GSSA 5IOWA 5CRHA 3C73A 3CQFA 3C8EA 1WPIA 1CQGA 1I5GA 2CVDA 3MNGA 3IXRA 5L71A 6GSSA 3V1WA 4MLYA 5G1KA 5HR3A 3KZQA 2L59A 2IFQB 3C7MA 3VPTA 4I8BA 4ZBAA 1K3OA 2R6KA 4KSMA 2AHEA 2YWNA 4ID0A 5J5NA 1A24A 3ED3A 5D9XA 3KTLA 4RUVA 1GH2A 1SKSB 3HKRA 4JR6A 3D5JA 2KP1A 4XS4A 4MJCA 1GSQA 4YKFA 2B3SA 4POBA 11GSA 3BCIA 3M9JA 2KLXA 2OE3A 3RBTA 2HSYA 2FHEA 4TR4A 3TRPA 3TKRA 1AXDA 4XRDA 5F0GA 1Z5YE 4KCEA 5ECOB 4FQUA 5HFIA 1XG8A 4MA9A 4OCFA 3FRCA 3TJFA 2R5GA 2V1MA 3P8WA 2HZEA 5IQYA 2VD1A 4K7OA 2H1BA 1MTCA 1K0AA 4BVYA 4TR1A 4BVXA 3VURA 4HJ2A 3SBCA 1YF0A 1EP8A 4I6XA 2MMAA 3E9JB 2DBCA 4K0NA 4ML6A 2WCIA 2IIYA 1G7EA 1OAZA 5G30A 2GQMA 2YP6A 13GSA 1EOGA 2YPMA 1Q98A 2IMFA 3QFAC 5FWGA 1ST9A 3EMXA 1K0CA 3DYRA 2M46A 1BG5A 2JSZA 5LNKe 1O85A 1J08A 2VAFA 3FEUA 5AISA 3IRAA 2A2PA 4IW9A 2OBIA 3E0UA 3LEFA 3QAWA 4ZL9A 3MDKA 2H70A 5IO0A 4MCUA 1JLVA 3KEBA 3CTFA 4WBJA 3N9JA 2E2GA 2OADA 1GSFA 2R0GA 1PL2A 2C8UA 2CAQA 3IAS2 3IV4A 3ZFLA 5ECIB 3IC4A 1CQHA 1GL8A 3LFLA 3DIEA 3KH7A 3TKQA 2OJLA 2F3MA 4K2DA 3ZIVA 5ABRA 1B8XA 3UVTA 3A2XA 2CA8A 1PKWA 3O76A 1PFOA 3WGEA 5CRWA 2FCHA 3M9KA 4PUFC 1XWKA 2H6ZA 4KDUA 1XWCA 3EINA 5G31A 4Q5RA 1YQ1A 2VD0A 2JZRA 2PN8A 3KM6A 3QAVA 2JZTA 4HS1A 2K18A 20GSA 1T4ZA 4F9ZA 4L8EA 2KP2A 4HZ2A 5B8AA 2RUFA 3FR3A 4WF4A 2YWMA 2X8CA 3FYGA 4YAVA 5CRGA 2DJJA 4OWYA 3IK9A 2QA2A 3A2WA 2LQOA 5EVOA 4N10A 1ZZYA 2NPBA 3MSZA 1OKTA 2CVBA 1T8EB 1OKDA 4JZQA 1U3AA 5IPHA 4EKZA 5HFKA 2Z9SA 1AQVA 2RM5A 1Z6NA 3GKKA 3DXBA 2HLSA 3WD6A 1AW9A 4QQ7A 5IOXA 2F8AA 4OO5A 1NHYA 1SL1B 3FMWA 4J56E 4EC0A 2HSHA 4TXVA 3D21A 3HVXA 1SD9A 1TRVA 1SYRA 2L4QA 1RK4A 4RI6A 3R3EA 3CBUA 1EV9A 1ERWA 2LJAA 1DSBA 1XW5A 4TXOB 2GDRA 1AQWA 5GSTA 3VPQA 3R2QA 2VM2A 4IBPA 4MPGA 2LQQA 3IDVA 2H1GA 5IMCA 5IM9A 2PVOC 1K0DA 3EU3A 2YN1A 4N0ZA 2D2ZA 4AGSA 2IFQA 1TXXA 3UOMA 5KEJA 4X0XA 1O73A 3GIXA 2LJKA 1HD2A 2RUEA 4MZCA 5KN3A 1UVZA 2MZCA 5FHIA 2VL2A 3GKXA 1GNEA 3A5IA 1TRSA 3IHQA 2H0HA 3PH9A 4YQVA 2B5EA 3DMLA 3BCKA 4LL4B 3GKNA 1M3IA 1A2JA 4HQSA 4GSNA 3EU4A 4ZBDA 2J9HA 3VWWA 3ZVJD 3I69A 3F8UA 1M0UA 2EIQA 4IS0A 1FB6A 5B6MA 3HYPA 2YOIA 1YDKA 2DIZA 4PQ1A 3FR9A 1DBYA 2AJQB 2OBKA 4PUAA 2JADA 4MMMA 2LTKA 4N11A 4GSTA 5D73A 3VI7A 3DRNA 5ECSA 1WJKA 5E4WA 3QMXA 2WGRA 2VLTA 4NWYA 3QCPA 3FZ5A 3GMFA 4NV2A 1GSSA 3P7XA 3QFBC 2LRCA 3IPZA 4ZL7A 1H4OA 1NSWA 3IA1A 2VM1A 1PX7A 3FZ4A 1FO5A 5A4WA 3G7IA 3Q74A 2NBSA 4OFTA 4KB3A 2OA7A 2IMDA 4ECJA 4ZILA 3C71A 12GSA 6GSWA 5FT3A 4FYBA 1WMJA 5DAKB 1UN2A 4V2LA 1LU4A 3ZRDA 1O8XA 5J41A 1FB0A 3KP8A 3C1RA 2VCVA 2YZUA 3HJMA 2EC4A 1VF1A 2VL3A 2G0FA 1V98A 1OC3A 4TR0A 1S3AA 2VCWA 4YQMA 5KOXA 3KXOA 1G6WA 1TU7A 2IN3A 4EL1A 3TJBA 2WJUA 2P5QA 2H8LA 2HT9A 2BJXA 4BL7A 3LORA 5LCZA 3KMOA 2DKIA 1PN0A 2LRTA 3HXSA 3TCOA 2N5BA 1OC9A 4OO4A 5J4UA 5HR1A 4ZBBA 1QFNA 5E59A 5G5EA 4JEDA 1R7HA 3GYKA 4XTSA 4J2FA 4L5LA 2YCDA 4IQ1A 4E8EA 2LUSA 1J9BA 3TGZA 1ZOFA 1SK1A 4YQUA 2I1UA 3D4TA 3GTUA 1XOBA 3I6AA 1TW9A 4TOPA 4CY6A 5GZZB 5JCGA 3FHKA 3FZAA 1M99A 2LV3A 1U88A 1SENA 2IWTA 1ZYEA 3ZZXA 1X9SB 1A8LA 1GUKA 4TW5A 5D96A 3IBHA 4Q5QA 4Q5NA 3FW2A 3ISOA 1GLPA 2H0GA 3CYNA 4FIWA 2C0FA 3LGCA 3UBLA 2H30A 3W8SA 4Z7XA 2IMKA 1ABAA 22GSA 3APOA 3F6DA 5DALA 4ULXA 3GNJA 1XOAA 3N5OA 4AJ7A 3LXTA 2L6CA 2NVLA 3HY2A 1XXUA 2XHFA 5AIVA 1PSQA 5ECKB 2DMLA 1JZRA 3FY7A 4HOJA 4ILFA 3IR4A 3GSTA 4F0BA 1EGOA 2O87A 1JLWA 1MDKA 2FWFA 4ICYA 1I9DA 2C3NA 4NAXA 1VF3A 2J23A 3RAZA 4HSCX 4KDYA 4JU5A 3KCMA 2B7KA 2K6VA 1ZGNA 4TXOA 3NOFA 3ZIJA 1X5CA 2M80A 1FHEA 2LSTA 1H75A 1YZXA 3UVHA 4KUNA 2H72A 4NMUA 4FO5A 1X0RA 2XC2A 1HQOA 2CZ2A 4PNFA 1TI3A 1A23A 4V1Ag 3ZMLA 5DBQA 2F8FA 2IMEA 2JL4A 2HZFA 2VCXA 5J9BA 4MJBA 4E8HA 5H5RA 1U6TA 1S3RA 4ZL8A 2R0CA 3EE2A 3J7Yk 1SL0B 1XPVA 4GLTA 3EURA 1VF4A 3L4NA 3HZ4A 2FA8A 1GTUA 2R0PA 1Q4JA 4FYCA 3I43A 1K0BA 2PERA 2H73A 5F05A 3A2VA 5EL8A 4F03A 3MIXA 1WOUA 2P5RA 3QD9A 3GA4A 5CNWA 4MJAA 3D22A 1GSDA 3BOAA 3APQA 4OD7A 1PD21 2DSAA 2YNXA 1VGLA 4V2MA 5ECQB 4MH3A 1ZMAA 2MBTA 2DJKA 4I5QA 3Q18A 2B6MA 1TOFA 3AY8A 5CRDA 1MDIA 4WXTA 1XZOA 1YJ6A 3IOSA 1AAZA 2H1DA 2F51A 4PNGA 4OMVA 3ME8A 4PQIA 3L9VA 1V2AA 2C3QA 3HZ8A 3BJ5A 6GSUA 1QGVA 1M9BA 1XWBA 4OFNA 3LYKA 4O92A 1Z3EA 5HR2A 1EOHA 1GULA 3TJJA 2CT6A 2FWHA 2H6XA 4MDCA 3PGTA 1E2YA 2WRTA 4KSOA 1J0FA 4I97A 1ZL9A 2O7KA 4DSRA 1EZKA 2H66A 3RPPA 4LMWA 4K2XA 1EEMA 5DAKA 2I9HA 4XS1A 1O81A 3US3A 4EDZA 3GN3A 3TJKA 4K5SA 1HNAA 2PBJA 1TTZA 1NM3A 2V6KA 1VF2A 3F4SA 4GSSA 3ZREA 1PQNA 2A4VA 3JCML 3RDWA 3TKSA 4PX1A 2A2RA 2GSQA 5H5QA 2PU9C 2I3YA 1GLQA 4DSQA 3F3QA 2HFDA 2CZ3A 1A8YA 1B4PA 3ZYWA 3QR6A 1AQXA 2PPTA 3ZVJA 1JZOA 1JZWA 2OE1A 3W6GA 1KTEA 3MWHA 2UZ8A 4MABA 3ERGA 2H74A 3W8JA 3GV1A 1SYXA 2BMXA 3ERWA 3UMAA 1U3IA 2CAIA 5CO3A 2KOKA 3KJYA 1X9MB 2I81A 2B5YA 2MYGA 2LEGA 1QXHA 1DUGA 2L5LA 4NHWA 14GSA 1V40A 2FWEA 1KEBA 2V32A 2WFCA 2R2JA 4TVEA 2FWGA 3EPTA 3F3RA 3KIJA 4IQAA 4KDXA 1MD4A 2P0GA 3GSSA 1BX9A 4WR4A 1FAAA 4MK3A 4BA7A 2PWJA 4EIQA 5DJLA 4QL9A 3GL5A 1EEJA 3H8QA 1B48A 4PGTA 3KD0A 4I2UA 3DEXA 1R4WA 3DVXA 5F07A 4MH2A 5IMFA 1GSUA 4PXOA 3VK9A 2L57A 2MMOA 3HJPA 1GP1A 3C1SA 1PN9A 4DSSB 5AIXA 2CV4A 4L0WA 5D8IA 2B1LA 1XBSA 4KNDA 5IMZA 2CX4A 3CRTA 2GQKA 1YEPA 3F63A 2GTUA 4EUYA 2IL3A 1Z9HA 2O85A 2GQLA 5KN0A 3TOTA 1ERVA 3U5RE 2RM6A 1TKDB 3A3TA 3G7JA 2DIYA 3UJ1A 2QC7A 2EIOA 3LYPA 5KOWA 3D0ZA 3ZL5A 4EF0A 2X64A 3M1GA 2WULA 4G0KA 3UIWA 3J7Yb 3GKMA 3LSZA 1RQMA 1G7OA 3ME7A 1LJRA 2V2GA 3HDCA 3H1NA 4FH8A 3GURA 3UARA 3EYTA 3FZ9A 3HHVA 3H4KA 2IJYA 2XBIA 3I9V2 1MD3A 5B8BA 1X9WB 6GSXA 3F0IA 1S3DA 1QMVA 1BJXA 4ACSA 4HUAA 1GTIA 4XS4B 3IHGA 4IELA 2VLUA 3P90A 4GTUA 5ECNB
chains in the Genus database with same CATH topology
4DEJA 4EXJA 1XIYA 2YZHA 3QOUA 3Q19A 4G10A 1A0RP 3TOUA 3LJRA 3UL3A 2JU5A 3KP9A 3GH9A 4RQRA 4G19A 3VLNA 1X5DA 1GUMA 3KGKA 1XVQA 4KCAA 2HZEB 2GT6A 1K3LA 1R26A 1VRSD 4K7IA 5ENUA 3VWVA 4POKA 1IYHA 4BVYB 4TR1B 4BVXB 2YJ7A 4Z2RA 4V1Ap 1FOVA 2HRFA 1IYIA 2C1YA 4WR5A 2YANA 4HEA2 3GUSA 3G9BA 4EDYA 2V41A 3FR6A 2YJHA 3UBKA 2TRCP 1GTAA 4HZ4A 2LKUA 3TB2A 1JFUA 5D9TA 5HQPA 3APSA 1W4VA 5IMVA 1G6YA 1N2AA 4TR3A 3L9SA 3F9UA 1UA5A 5JWQB 2AYTA 5C00A 1GWCA 2E7PA 4MF5A 4G0IA 4YKGA 5AN1A 2QKEA 5ECPB 2FA4A 5B7CA 1Z6MA 3GHAA 1ACVA 4O5RA 2FNOA 2KHPA 4D73B 4NHZA 1FG4A 2I4AA 2H71A 1JHBA 5CYYA 2QGVA 2GSTA 2IMIA 2VCTA 5HFGA 2OKAA 4K5RA 2LS5A 4BWQA 4Z2UA 4LA1A 2VOCA 4GQCA 1F37A 1TU8A 4K9ZA 4BWSA 2O8VB 4MP4A 4HDEA 1M2BA 17GSA 3L78A 6GSTA 2X99A 2WZ9A 4ML1A 4G2EA 1R5PA 3HCZA 3HJOA 4JBBA 4L0UA 4IGJA 4ZB8A 2PMTA 2ZUPA 1THOA 4JRRA 1NW2A 4FYUA 5DCHA 1WIKA 3ERFA 2LNTA 2YV7A 5ELGA 2ON5A 3BD2A 1QK8A 1SK0A 4TRXA 2VO4A 1BEDA 2PGTA 4ZB9A 1GUHA 2C0EA 1W89A 3QPMA 5G2ZA 4X43A 2AB6A 1E6BA 1BQ7A 1K0MA 1TK5B 2PVQA 5G1LA 2CQ9A 1YKCA 4A5PA 2GGTA 4CW9A 3TRQA 4Z2TA 3CSHA 3ZLPA 2BTOT 3LW9A 3O3TA 2C4JA 4LMVA 4V2NA 5J3RA 1X5EA 3CSIA 4IJIA 4HQZA 1F6MC 1AIUA 2H0IA 6GSYA 4IKHA 1FVJA 1V58A 2G2QA 4HJMA 3IC8A 1PGTA 2PUKC 4L5OA 4IN0A 1OE7A 3IAM2 4JR4A 2B5XA 2HRNA 4EIPA 5A4VA 2FGXA 3K8NA 1PA3A 2OE0A 4XIHA 3H79A 4X4JA 5ELAA 2K9FA 5F06A 5KN2A 2DJ0A 5JWRB 1UC7A 3PPUA 1XW9A 5JCUA 1ZYNA 5D93A 1A0FA 3CXGA 3EVIA 1S3CA 1TI1A 3WT1A 2GSSA 1XVWA 2YWIA 4AJ6A 2MMNA 4O5UA 2HE3A 2H75A 1F3AA 1M7TA 5COHA 4F82A 1F2EA 4KH7A 3P2AA 5D9WA 3WT2A 1ERTA 1B9YC 4CY8A 3WGXA 2DLXA 2MMZA 2AAWA 4X1UA 5G5FA 3TJGA 1ZYPA 3DKSA 2JZSA 4OFMA 2GZZA 3UAPA 2P31A 1SL2B 4MPFA 4O7HA 3CMIA 2X8HA 4RI7A 2WB9A 5DJMA 3RHCA 4QL7A 2RIIA 4KGIA 2GS3A 2QSIA 5A5KA 3BBYA 3GRXA 1PRXA 4K8MA 3RPNA 5DDLA 2DJ3A 1AC1A 4KX4A 1MDJA 2N5FA 4K1FA 2ZNMA 2VL9A 1YY7A 5H5SA 1BAYA 2JSYA 4ZB6A 2RLIA 5EY6A 2LNSA 5KN1A 2A4HA 1DE2A 3QDNA 3ZFBA 2REMA 2GT5A 1OE8A 2H76A 1ERUA 1G0TA 4HI7A 4HU7A 3VFIA 1V9WA 5ECHB 4AJ8A 1Z7PA 2GZYA 5IO2A 2YV9A 2K8VA 4H86A 3CSJA 4KE3A 1TJDA 2NTOA 3GL3A 2DKHA 2VL2C 5IPGA 1Z7RA 1O8WA 4NXIA 3M0FA 1R5AA 1THXA 4KAEA 2B1KA 5ECRB 5IMAA 1XW6A 4EVMA 1WRYA 1WP0A 3RHBA 3LQ7A 4XRAA 3VWXA 4GWRA 5DQYA 4TN8A 5D9VA 5F8BA 5CP1A 2XPDA 1MEKA 3F6FA 4D73A 18GSA 4GRFA 1PMTA 5IMDA 2XBQA 5CAXA 2DJ2A 3HVSA 3U6VA 4PQHA 3LG6A 1N8JA 2X8GA 1F3BA 1JZDA 3KH9A 1EGRA 3DVWA 4I2TA 3OR5A 4N30A 4GQFA 4BL7B 1ILOA 1KBNA 2DC5A 5ID2B 1KNGA 1Y6EA 1TDIA 2HYXA 5DVBA 1B4QA 1OC9B 1YEXA 1PX6A 1B9XC 1SU9A 5CREA 4J57E 1K0OA 4HU9A 5IIZA 1PL1A 2IPAA 2JACA 3LWAA 3D6IA 1SK2A 1SJZA 3CTGA 3KMNA 2TRXA 3S9FA 1DE1A 2ON7A 3F4TA 4WEYA 3IK7A 3GTUB 3DGQA 2C0DA 2GZPA 2QA1A 5J9CA 1F9MA 2HNLA 4KA0A 2HRKA 5ECLB 3HVVA 4MF7A 1T7PB 2X4AA 1SKWB 1T4YA 4MJEA 2GLRA 4G9HA 3TKSE 2L5OA 4JE1A 1SJ6A 5DCGA 3L0HA 4NV5A 2M72A 3HD5A 5BMUA 1EP7A 1EV4A 1TK8B 5DALB 4MZWA 2LJRA 3DD3A 3CRUA 2L4CA 4MF6A 2YWOA 1Y25A 4XCSA 1ZCPA 1ML6A 1A2MA 2HXKA 4POMA 5ECMB 3VI5A 1QUWA 4F0CA 2AV4A 5GAND 1AUCA 1OVNA 2WS2A 3GX0A 3GX8A 1K3YA 4K0GA 5AGYA 5B6NA 4IHUA 1ZYQB 1GNWA 4RQXA 4POLA 3M3MA 1XWGA 3PINA 3E3EA 2H1AA 4USSA 2A2SA 3O6TA 4AF2A 4ISDA 1FVKA 1M2AA 4ECBA 1M9AA 1LBKA 4GF0A 2TIRA 4WF5A 3LXZA 2DJ1A 1RW1A 3NIVA 4G0LA 4WETA 5LD0A 1XWAA 2C3TA 2GSRA 4IJ3A 4ZXGA 4WBRD 3ZITA 1HNCA 1GRXA 2N5AA 2VCQA 3HA9A 3FK8A 4PURA 3Q6OA 3TKPA 2L6DA 2AUVA 7GSSA 2HI7A 4K6XA 4TKYA 4WKWA 4GXZA 2B7JA 2FUG2 2NDOA 1TRWA 1T3BA 16GSA 1WE0A 1FOHA 1EWXA 4IP1A 2E2MA 2R3XA 4EE0A 3EMPA 4ECCA 2DMMA 1TP9A 4F2IA 5INYA 4ECIA 1SD8A 3ZTLA 2FLSA 3EC3A 5C04A 5JCWA 1HYUA 1NHOA 1V57A 3UEMA 2H19A 1SJIA 1HNBA 4P3YB 1OC8A 2H6YA 5A4UA 2C80A 19GSA 1YKAA 4YAPA 3TUEA 1OYJA 1GSEA 2XPEA 4IVFA 4EO3A 1C72A 4O32A 4XS6A 10GSA 3MAKA 8GSSA 1O6JA 2E0QA 3F4RA 1QQ2A 6GSVA 2X49A 1WWJA 1M2DA 4XHMA 2VCZA 2VIMA 3ZMKA 2R4VA 4O5QA 3IE3A 2ES7A 1PKZA 1A2LA 5HR0A 1BYEA 4DVCA 2WDUA 3QAGA 4MNNA 2K8SA 3G7YA 1GSYA 4ZIJA 4BPYA 3WGDA 2V6OA 1SKRB 1YF1A 2HRAA 2R37A 2O89A 2MBSA 5ID2A 2VUPA 4LL1B 4CDOA 4YH2A 2F9SA 5JWOB 4KW6A 2ALBA 3TDGA 3FKFA 2VLVA 4PTSA 9GSSA 2FY6A 1T00A 2H01A 3M8NA 3H93A 1URMA 4NPBA 2GVPA 3GFKA 2LRNA 4MZBA 4Q5FA 2EIRA 1TK0B 5EPFA 3DWVA 2C0GA 3KTBA 2FD3A 2HSMA 3TRXA 1TRUA 2ZCTA 1O7UA 3GH6A 2KUCA 1XFLA 1K0NA 3VWUA 3NZNA 3TKSC 4DSSA 3D4MA 4GCIA 2OACA 4LLRA 5BRTA 1FW1A 4OCEA 1ON4A 4N0VA 3PR8A 1XCCA 3WYWA 2CVKA 5GAPD 2CX3A 3SWLA 1USBA 1GTBA 3L9UA 4CHSA 3MYDA 3EWLA 3A5WA 1T1VA 5DQSA 4K7NA 4IP6A 1U87A 4KF9A 5GSSA 5IOWA 5CRHA 3C73A 3C8EA 1WPIA 1CQGA 1I5GA 2CVDA 3MNGA 3IXRA 5L71A 6GSSA 3V1WA 4MLYA 5G1KA 5HR3A 3KZQA 2L59A 2IFQB 3C7MA 3VPTA 4I8BA 4ZBAA 1K3OA 2R6KA 4KSMA 2AHEA 2YWNA 4ID0A 5J5NA 1A24A 3ED3A 5D9XA 3KTLA 4RUVA 1GH2A 1SKSB 3HKRA 4JR6A 3D5JA 2KP1A 4XS4A 4MJCA 1GSQA 4YKFA 2B3SA 4POBA 11GSA 3BCIA 3M9JA 2KLXA 2OE3A 3RBTA 2HSYA 2FHEA 4TR4A 3TRPA 3TKRA 1AXDA 4XRDA 5F0GA 1Z5YE 4KCEA 5ECOB 4FQUA 5HFIA 4MA9A 4OCFA 3FRCA 3TJFA 2R5GA 2V1MA 3P8WA 2HZEA 5IQYA 2VD1A 4K7OA 2H1BA 1MTCA 1K0AA 4BVYA 4TR1A 4BVXA 3VURA 4HJ2A 3SBCA 1YF0A 1EP8A 4I6XA 2MMAA 3E9JB 2DBCA 4K0NA 4ML6A 2WCIA 2IIYA 1G7EA 1OAZA 5G30A 2GQMA 2YP6A 13GSA 1EOGA 2YPMA 1Q98A 2IMFA 3QFAC 5FWGA 1ST9A 3EMXA 1K0CA 3DYRA 2M46A 1BG5A 2JSZA 5LNKe 1O85A 1J08A 2VAFA 3FEUA 5AISA 3IRAA 2A2PA 4IW9A 2OBIA 3E0UA 3LEFA 3QAWA 4ZL9A 3MDKA 2H70A 5IO0A 4MCUA 1JLVA 3KEBA 3CTFA 4WBJA 3N9JA 2E2GA 2OADA 1GSFA 2R0GA 1PL2A 2C8UA 2CAQA 3IAS2 3IV4A 3ZFLA 5ECIB 3IC4A 1CQHA 1GL8A 3LFLA 3DIEA 3KH7A 3TKQA 2OJLA 2F3MA 4K2DA 3ZIVA 5ABRA 1B8XA 3UVTA 3A2XA 2CA8A 1PKWA 3O76A 3WGEA 5CRWA 2FCHA 3M9KA 4PUFC 1XWKA 2H6ZA 4KDUA 1XWCA 3EINA 5G31A 4Q5RA 1YQ1A 2VD0A 2JZRA 2PN8A 3KM6A 3QAVA 2JZTA 4HS1A 2K18A 20GSA 1T4ZA 4F9ZA 4L8EA 2KP2A 4HZ2A 5B8AA 2RUFA 3FR3A 4WF4A 2YWMA 2X8CA 3FYGA 4YAVA 5CRGA 2DJJA 4OWYA 3IK9A 2QA2A 3A2WA 2LQOA 5EVOA 4N10A 1ZZYA 2NPBA 3MSZA 1OKTA 2CVBA 1T8EB 1OKDA 4JZQA 1U3AA 5IPHA 4EKZA 5HFKA 2Z9SA 1AQVA 2RM5A 1Z6NA 3GKKA 3DXBA 2HLSA 3WD6A 1AW9A 4QQ7A 5IOXA 2F8AA 4OO5A 1NHYA 1SL1B 3FMWA 4J56E 4EC0A 2HSHA 4TXVA 3D21A 3HVXA 1SD9A 1TRVA 1SYRA 2L4QA 1RK4A 4RI6A 3R3EA 3CBUA 1EV9A 1ERWA 2LJAA 1DSBA 1XW5A 4TXOB 2GDRA 1AQWA 5GSTA 3VPQA 3R2QA 2VM2A 4IBPA 4MPGA 2LQQA 3IDVA 2H1GA 5IMCA 5IM9A 2PVOC 1K0DA 3EU3A 2YN1A 4N0ZA 2D2ZA 4AGSA 2IFQA 1TXXA 3UOMA 5KEJA 4X0XA 1O73A 3GIXA 2LJKA 1HD2A 2RUEA 4MZCA 5KN3A 1UVZA 2MZCA 5FHIA 2VL2A 3GKXA 1GNEA 3A5IA 1TRSA 3IHQA 2H0HA 3PH9A 4YQVA 2B5EA 3DMLA 3BCKA 4LL4B 3GKNA 1A2JA 4HQSA 4GSNA 3EU4A 4ZBDA 2J9HA 3VWWA 3ZVJD 3I69A 3F8UA 1M0UA 2EIQA 4IS0A 1FB6A 5B6MA 3HYPA 2YOIA 1YDKA 2DIZA 4PQ1A 3FR9A 1DBYA 2AJQB 2OBKA 4PUAA 2JADA 4MMMA 2LTKA 4N11A 4GSTA 5D73A 3VI7A 3DRNA 5ECSA 1WJKA 5E4WA 3QMXA 2WGRA 2VLTA 4NWYA 3QCPA 3FZ5A 3GMFA 4NV2A 1GSSA 3P7XA 3QFBC 2LRCA 3IPZA 4ZL7A 1H4OA 1NSWA 3IA1A 2VM1A 1PX7A 3FZ4A 1FO5A 5A4WA 3G7IA 3Q74A 2NBSA 4OFTA 4KB3A 2OA7A 2IMDA 4ECJA 4ZILA 3C71A 12GSA 6GSWA 5FT3A 4FYBA 1WMJA 5DAKB 1UN2A 4V2LA 1LU4A 3ZRDA 1O8XA 5J41A 1FB0A 3KP8A 3C1RA 2VCVA 2YZUA 3HJMA 2EC4A 1VF1A 2VL3A 2G0FA 1V98A 1OC3A 4TR0A 1S3AA 2VCWA 4YQMA 5KOXA 3KXOA 1G6WA 1TU7A 2IN3A 4EL1A 3TJBA 2WJUA 2P5QA 2H8LA 2HT9A 2BJXA 4BL7A 3LORA 5LCZA 3KMOA 2DKIA 1PN0A 2LRTA 3HXSA 3TCOA 2N5BA 1OC9A 4OO4A 5J4UA 5HR1A 4ZBBA 1QFNA 5E59A 5G5EA 4JEDA 1R7HA 3GYKA 4XTSA 4J2FA 4L5LA 2YCDA 4IQ1A 4E8EA 2LUSA 1J9BA 3TGZA 1ZOFA 1SK1A 4YQUA 2I1UA 3D4TA 3GTUA 1XOBA 3I6AA 1TW9A 4TOPA 4CY6A 5GZZB 5JCGA 3FHKA 3FZAA 1M99A 2LV3A 1U88A 1SENA 2IWTA 1ZYEA 3ZZXA 1X9SB 1A8LA 1GUKA 4TW5A 5D96A 3IBHA 4Q5QA 4Q5NA 3FW2A 3ISOA 1GLPA 2H0GA 3CYNA 4FIWA 2C0FA 3LGCA 3UBLA 2H30A 3W8SA 4Z7XA 2IMKA 1ABAA 22GSA 3APOA 3F6DA 5DALA 4ULXA 3GNJA 1XOAA 3N5OA 4AJ7A 3LXTA 2L6CA 2NVLA 3HY2A 1XXUA 2XHFA 5AIVA 1PSQA 5ECKB 2DMLA 1JZRA 3FY7A 4HOJA 4ILFA 3IR4A 3GSTA 4F0BA 1EGOA 2O87A 1JLWA 1MDKA 2FWFA 4ICYA 1I9DA 2C3NA 4NAXA 1VF3A 2J23A 3RAZA 4KDYA 4JU5A 3KCMA 2B7KA 2K6VA 1ZGNA 4TXOA 3NOFA 3ZIJA 1X5CA 2M80A 1FHEA 2LSTA 1H75A 1YZXA 3UVHA 4KUNA 2H72A 4NMUA 4FO5A 1X0RA 2XC2A 1HQOA 2CZ2A 4PNFA 1TI3A 1A23A 4V1Ag 3ZMLA 5DBQA 2F8FA 2IMEA 2JL4A 2HZFA 2VCXA 5J9BA 4MJBA 4E8HA 5H5RA 1U6TA 4ZL8A 2R0CA 3EE2A 3J7Yk 1SL0B 1XPVA 4GLTA 3EURA 1VF4A 3L4NA 3HZ4A 2FA8A 1GTUA 2R0PA 1Q4JA 4FYCA 3I43A 1K0BA 2PERA 2H73A 5F05A 3A2VA 5EL8A 4F03A 3MIXA 1WOUA 2P5RA 3QD9A 3GA4A 5CNWA 4MJAA 3D22A 1GSDA 3BOAA 3APQA 4OD7A 1PD21 2DSAA 2YNXA 1VGLA 4V2MA 5ECQB 4MH3A 1ZMAA 2MBTA 2DJKA 4I5QA 3Q18A 2B6MA 1TOFA 3AY8A 5CRDA 1MDIA 4WXTA 1XZOA 1YJ6A 3IOSA 1AAZA 2H1DA 2F51A 4PNGA 4OMVA 3ME8A 4PQIA 3L9VA 1V2AA 2C3QA 3HZ8A 3BJ5A 6GSUA 1QGVA 1M9BA 1XWBA 4OFNA 3LYKA 4O92A 1Z3EA 5HR2A 1EOHA 1GULA 3TJJA 2CT6A 2FWHA 2H6XA 4MDCA 3PGTA 1E2YA 2WRTA 4KSOA 1J0FA 4I97A 1ZL9A 2O7KA 4DSRA 1EZKA 2H66A 3RPPA 4LMWA 4K2XA 1EEMA 5DAKA 2I9HA 4XS1A 1O81A 3US3A 4EDZA 3GN3A 3TJKA 4K5SA 1HNAA 2PBJA 1TTZA 1NM3A 2V6KA 1VF2A 3F4SA 4GSSA 3ZREA 1PQNA 2A4VA 3JCML 3RDWA 3TKSA 4PX1A 2A2RA 2GSQA 5H5QA 2PU9C 2I3YA 1GLQA 4DSQA 3F3QA 2HFDA 2CZ3A 1A8YA 1B4PA 3ZYWA 3QR6A 1AQXA 2PPTA 3ZVJA 1JZOA 1JZWA 2OE1A 3W6GA 1KTEA 3MWHA 2UZ8A 4MABA 3ERGA 2H74A 3W8JA 3GV1A 1SYXA 2BMXA 3ERWA 3UMAA 1U3IA 2CAIA 5CO3A 2KOKA 3KJYA 1X9MB 2I81A 2B5YA 2MYGA 2LEGA 1QXHA 1DUGA 2L5LA 4NHWA 14GSA 1V40A 2FWEA 1KEBA 2V32A 2WFCA 2R2JA 4TVEA 2FWGA 3EPTA 3F3RA 3KIJA 4IQAA 4KDXA 1MD4A 2P0GA 3GSSA 1BX9A 4WR4A 1FAAA 4MK3A 4BA7A 2PWJA 4EIQA 5DJLA 4QL9A 3GL5A 1EEJA 3H8QA 1B48A 4PGTA 3KD0A 4I2UA 3DEXA 1R4WA 3DVXA 5F07A 4MH2A 5IMFA 1GSUA 4PXOA 3VK9A 2L57A 2MMOA 3HJPA 1GP1A 3C1SA 1PN9A 4DSSB 5AIXA 2CV4A 4L0WA 5D8IA 2B1LA 1XBSA 4KNDA 5IMZA 2CX4A 3CRTA 2GQKA 1YEPA 3F63A 2GTUA 4EUYA 2IL3A 1Z9HA 2O85A 2GQLA 5KN0A 3TOTA 1ERVA 3U5RE 2RM6A 1TKDB 3A3TA 3G7JA 2DIYA 3UJ1A 2QC7A 2EIOA 3LYPA 5KOWA 3D0ZA 3ZL5A 4EF0A 2X64A 3M1GA 2WULA 4G0KA 3UIWA 3J7Yb 3GKMA 3LSZA 1RQMA 1G7OA 3ME7A 1LJRA 2V2GA 3HDCA 3H1NA 4FH8A 3GURA 3UARA 3EYTA 3FZ9A 3HHVA 3H4KA 2IJYA 2XBIA 3I9V2 1MD3A 5B8BA 1X9WB 6GSXA 3F0IA 1S3DA 1QMVA 1BJXA 4ACSA 4HUAA 1GTIA 4XS4B 3IHGA 4IELA 2VLUA 3P90A 4GTUA 5ECNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEJ A;  4EXJ A;  1XIY A;  2YZH A;  3QOU A;  3Q19 A;  4G10 A;  1A0R P;  3TOU A;  3LJR A;  3UL3 A;  2JU5 A;  3KP9 A;  3GH9 A;  4RQR A;  4G19 A;  3VLN A;  1X5D A;  1GUM A;  3KGK A;  1XVQ A;  4KCA A;  2HZE B;  2GT6 A;  1K3L A;  1R26 A;  1VRS D;  4K7I A;  5ENU A;  3VWV A;  4POK A;  1IYH A;  4TR1 B;  2YJ7 A;  4V1A p;  1FOV A;  2HRF A;  1IYI A;  2C1Y A;  4WR5 A;  2YAN A;  4HEA 2;  3GUS A;  3G9B A;  4EDY A;  2V41 A;  3FR6 A;  2YJH A;  3UBK A;  2TRC P;  1GTA A;  4HZ4 A;  2LKU A;  3TB2 A;  1JFU A;  5D9T A;  5HQP A;  3APS A;  1W4V A;  5IMV A;  1G6Y A;  1N2A A;  4TR3 A;  3L9S A;  3F9U A;  1UA5 A;  5JWQ B;  2AYT A;  5C00 A;  1GWC A;  2E7P A;  4MF5 A;  5AN1 A;  2QKE A;  5ECP B;  2FA4 A;  5B7C A;  1Z6M A;  3GHA A;  1ACV A;  4O5R A;  2FNO A;  2KHP A;  4D73 B;  4NHZ A;  1FG4 A;  2I4A A;  2H71 A;  1JHB A;  5CYY A;  2QGV A;  2GST A;  2IMI A;  2VCT A;  5HFG A;  2OKA A;  2LS5 A;  4BWQ A;  4LA1 A;  2VOC A;  4GQC A;  1F37 A;  1TU8 A;  4K9Z A;  4BWS A;  2O8V B;  4MP4 A;  4HDE A;  1M2B A;  17GS A;  3L78 A;  6GST A;  2X99 A;  2WZ9 A;  4ML1 A;  4G2E A;  1R5P A;  3HCZ A;  3HJO A;  4JBB A;  4L0U A;  4IGJ A;  4ZB8 A;  2PMT A;  2ZUP A;  1THO A;  4JRR A;  1NW2 A;  4FYU A;  5DCH A;  1WIK A;  3ERF A;  2LNT A;  2YV7 A;  5ELG A;  2ON5 A;  3BD2 A;  1QK8 A;  1SK0 A;  4TRX A;  2VO4 A;  1BED A;  2PGT A;  4ZB9 A;  1GUH A;  2C0E A;  1W89 A;  3QPM A;  5G2Z A;  4X43 A;  2AB6 A;  1E6B A;  1BQ7 A;  1K0M A;  1TK5 B;  2PVQ A;  5G1L A;  2CQ9 A;  1YKC A;  2GGT A;  4CW9 A;  3TRQ A;  3CSH A;  3ZLP A;  2BTO T;  3O3T A;  2C4J A;  4LMV A;  4V2N A;  5J3R A;  1X5E A;  3CSI A;  4IJI A;  4HQZ A;  1F6M C;  1AIU A;  2H0I A;  6GSY A;  4IKH A;  1FVJ A;  1V58 A;  2G2Q A;  4HJM A;  1PGT A;  2PUK C;  4L5O A;  4IN0 A;  1OE7 A;  3IAM 2;  4JR4 A;  2B5X A;  2HRN A;  5A4V A;  2FGX A;  3K8N A;  1PA3 A;  2OE0 A;  4XIH A;  3H79 A;  5ELA A;  2K9F A;  5F06 A;  5KN2 A;  2DJ0 A;  5JWR B;  1UC7 A;  1XW9 A;  5JCU A;  5D93 A;  1A0F A;  3CXG A;  3EVI A;  1S3C A;  1TI1 A;  3WT1 A;  2GSS A;  1XVW A;  2YWI A;  4AJ6 A;  2MMN A;  2HE3 A;  2H75 A;  1F3A A;  1M7T A;  5COH A;  4F82 A;  1F2E A;  4KH7 A;  3P2A A;  5D9W A;  3WT2 A;  1ERT A;  1B9Y C;  3WGX A;  2DLX A;  2MMZ A;  2AAW A;  4X1U A;  5G5F A;  3TJG A;  3DKS A;  2JZS A;  4OFM A;  2GZZ A;  3UAP A;  2P31 A;  1SL2 B;  4MPF A;  4O7H A;  3CMI A;  2X8H A;  4RI7 A;  2WB9 A;  5DJM A;  3RHC A;  4QL7 A;  2RII A;  4KGI A;  2GS3 A;  2QSI A;  5A5K A;  3BBY A;  3GRX A;  1PRX A;  4K8M A;  3RPN A;  5DDL A;  2DJ3 A;  1AC1 A;  4KX4 A;  1MDJ A;  2N5F A;  4K1F A;  2ZNM A;  2VL9 A;  1YY7 A;  5H5S A;  1BAY A;  2JSY A;  4ZB6 A;  2RLI A;  5EY6 A;  2LNS A;  5KN1 A;  1DE2 A;  3QDN A;  3ZFB A;  2REM A;  2GT5 A;  1OE8 A;  2H76 A;  1ERU A;  1G0T A;  4HI7 A;  4HU7 A;  3VFI A;  1V9W A;  5ECH B;  4AJ8 A;  1Z7P A;  2GZY A;  5IO2 A;  2YV9 A;  2K8V A;  4H86 A;  3CSJ A;  4KE3 A;  1TJD A;  2NTO A;  3GL3 A;  2VL2 C;  5IPG A;  1Z7R A;  1O8W A;  4NXI A;  3M0F A;  1R5A A;  1THX A;  4KAE A;  2B1K A;  5ECR B;  5IMA A;  1XW6 A;  4EVM A;  1WRY A;  1WP0 A;  3RHB A;  3LQ7 A;  4XRA A;  3VWX A;  4GWR A;  5DQY A;  4TN8 A;  5D9V A;  5F8B A;  5CP1 A;  2XPD A;  1MEK A;  3F6F A;  4D73 A;  18GS A;  4GRF A;  1PMT A;  5IMD A;  2XBQ A;  5CAX A;  2DJ2 A;  3HVS A;  3U6V A;  4PQH A;  3LG6 A;  1N8J A;  2X8G A;  1F3B A;  1JZD A;  3KH9 A;  1EGR A;  3DVW A;  4I2T A;  3OR5 A;  4N30 A;  4GQF A;  1ILO A;  1KBN A;  2DC5 A;  5ID2 B;  1KNG A;  1Y6E A;  1TDI A;  2HYX A;  5DVB A;  1B4Q A;  1OC9 B;  1YEX A;  1PX6 A;  1B9X C;  1SU9 A;  5CRE A;  4J57 E;  1K0O A;  4HU9 A;  5IIZ A;  1PL1 A;  2IPA A;  2JAC A;  3LWA A;  3D6I A;  1SK2 A;  1SJZ A;  3CTG A;  3KMN A;  2TRX A;  3S9F A;  1DE1 A;  2ON7 A;  3F4T A;  4WEY A;  3IK7 A;  3GTU B;  3DGQ A;  2C0D A;  2GZP A;  5J9C A;  1F9M A;  2HNL A;  4KA0 A;  5ECL B;  3HVV A;  4MF7 A;  1T7P B;  1SKW B;  1T4Y A;  4MJE A;  2GLR A;  4G9H A;  3TKS E;  2L5O A;  4JE1 A;  1SJ6 A;  5DCG A;  3L0H A;  4NV5 A;  2M72 A;  3HD5 A;  1EP7 A;  1EV4 A;  1TK8 B;  5DAL B;  4MZW A;  2LJR A;  3DD3 A;  3CRU A;  2L4C A;  4MF6 A;  2YWO A;  1Y25 A;  4XCS A;  1ZCP A;  1ML6 A;  1A2M A;  2HXK A;  4POM A;  5ECM B;  3VI5 A;  1QUW A;  4F0C A;  2AV4 A;  5GAN D;  1AUC A;  1OVN A;  2WS2 A;  3GX0 A;  3GX8 A;  1K3Y A;  4K0G A;  5AGY A;  5B6N A;  4IHU A;  1ZYQ B;  1GNW A;  4RQX A;  4POL A;  3M3M A;  1XWG A;  3PIN A;  3E3E A;  2H1A A;  2A2S A;  3O6T A;  4AF2 A;  4ISD A;  1FVK A;  1M2A A;  4ECB A;  1M9A A;  1LBK A;  4GF0 A;  2TIR A;  4WF5 A;  3LXZ A;  2DJ1 A;  1RW1 A;  3NIV A;  4WET A;  5LD0 A;  1XWA A;  2C3T A;  2GSR A;  4IJ3 A;  4ZXG A;  4WBR D;  3ZIT A;  1HNC A;  1GRX A;  2N5A A;  2VCQ A;  3HA9 A;  3FK8 A;  4PUR A;  3Q6O A;  3TKP A;  2L6D A;  2AUV A;  7GSS A;  2HI7 A;  4K6X A;  4TKY A;  4WKW A;  4GXZ A;  2B7J A;  2FUG 2;  2NDO A;  1TRW A;  1T3B A;  16GS A;  1WE0 A;  1EWX A;  4IP1 A;  2E2M A;  2R3X A;  4EE0 A;  3EMP A;  4ECC A;  2DMM A;  1TP9 A;  4F2I A;  5INY A;  4ECI A;  1SD8 A;  3ZTL A;  2FLS A;  3EC3 A;  5C04 A;  5JCW A;  1HYU A;  1NHO A;  1V57 A;  3UEM A;  2H19 A;  1SJI A;  1HNB A;  4P3Y B;  1OC8 A;  2H6Y A;  5A4U A;  2C80 A;  19GS A;  1YKA A;  4YAP A;  3TUE A;  1OYJ A;  1GSE A;  2XPE A;  4IVF A;  4EO3 A;  1C72 A;  4O32 A;  4XS6 A;  10GS A;  3MAK A;  8GSS A;  1O6J A;  2E0Q A;  3F4R A;  1QQ2 A;  6GSV A;  1WWJ A;  1M2D A;  4XHM A;  2VCZ A;  2VIM A;  3ZMK A;  2R4V A;  3IE3 A;  2ES7 A;  1PKZ A;  1A2L A;  5HR0 A;  1BYE A;  4DVC A;  2WDU A;  3QAG A;  2K8S A;  3G7Y A;  1GSY A;  4ZIJ A;  4BPY A;  3WGD A;  2V6O A;  1SKR B;  1YF1 A;  2R37 A;  2O89 A;  2MBS A;  5ID2 A;  2VUP A;  4LL1 B;  4CDO A;  4YH2 A;  2F9S A;  5JWO B;  4KW6 A;  2ALB A;  3TDG A;  3FKF A;  2VLV A;  9GSS A;  2FY6 A;  1T00 A;  2H01 A;  3M8N A;  3H93 A;  1URM A;  4NPB A;  2GVP A;  3GFK A;  2LRN A;  4MZB A;  4Q5F A;  2EIR A;  1TK0 B;  5EPF A;  3DWV A;  2C0G A;  3KTB A;  2FD3 A;  3TRX A;  1TRU A;  2ZCT A;  1O7U A;  3GH6 A;  2KUC A;  1XFL A;  1K0N A;  3VWU A;  3NZN A;  3TKS C;  4DSS A;  3D4M A;  4GCI A;  2OAC A;  4LLR A;  1FW1 A;  4OCE A;  1ON4 A;  4N0V A;  3PR8 A;  1XCC A;  3WYW A;  2CVK A;  5GAP D;  2CX3 A;  3SWL A;  1USB A;  1GTB A;  3L9U A;  4CHS A;  3EWL A;  3A5W A;  1T1V A;  5DQS A;  4K7N A;  4IP6 A;  1U87 A;  5GSS A;  5IOW A;  5CRH A;  3C73 A;  3C8E A;  1WPI A;  1CQG A;  1I5G A;  2CVD A;  3MNG A;  3IXR A;  5L71 A;  6GSS A;  3V1W A;  4MLY A;  5G1K A;  5HR3 A;  3KZQ A;  2L59 A;  2IFQ B;  3C7M A;  3VPT A;  4I8B A;  4ZBA A;  1K3O A;  2R6K A;  4KSM A;  2AHE A;  2YWN A;  4ID0 A;  5J5N A;  1A24 A;  3ED3 A;  5D9X A;  3KTL A;  4RUV A;  1GH2 A;  1SKS B;  3HKR A;  4JR6 A;  3D5J A;  2KP1 A;  4XS4 A;  4MJC A;  1GSQ A;  2B3S A;  4POB A;  11GS A;  3BCI A;  3M9J A;  2KLX A;  2OE3 A;  3RBT A;  2HSY A;  2FHE A;  4TR4 A;  3TRP A;  3TKR A;  1AXD A;  4XRD A;  5F0G A;  1Z5Y E;  4KCE A;  5ECO B;  5HFI A;  4MA9 A;  4OCF A;  3FRC A;  3TJF A;  2R5G A;  2V1M A;  3P8W A;  2HZE A;  5IQY A;  2VD1 A;  4K7O A;  2H1B A;  1MTC A;  1K0A A;  4BVY A;  4TR1 A;  4BVX A;  3VUR A;  4HJ2 A;  3SBC A;  1YF0 A;  1EP8 A;  4I6X A;  2MMA A;  3E9J B;  2DBC A;  4K0N A;  4ML6 A;  2WCI A;  2IIY A;  1G7E A;  1OAZ A;  5G30 A;  2GQM A;  2YP6 A;  13GS A;  1EOG A;  2YPM A;  1Q98 A;  2IMF A;  3QFA C;  5FWG A;  1ST9 A;  3EMX A;  1K0C A;  3DYR A;  2M46 A;  1BG5 A;  2JSZ A;  5LNK e;  1O85 A;  1J08 A;  2VAF A;  3FEU A;  5AIS A;  3IRA A;  4IW9 A;  2OBI A;  3E0U A;  3LEF A;  3QAW A;  4ZL9 A;  3MDK A;  2H70 A;  5IO0 A;  4MCU A;  1JLV A;  3KEB A;  3CTF A;  4WBJ A;  3N9J A;  2E2G A;  2OAD A;  1GSF A;  1PL2 A;  2C8U A;  2CAQ A;  3IAS 2;  3IV4 A;  3ZFL A;  5ECI B;  3IC4 A;  1CQH A;  1GL8 A;  3LFL A;  3DIE A;  3KH7 A;  3TKQ A;  2OJL A;  2F3M A;  4K2D A;  3ZIV A;  5ABR A;  1B8X A;  3UVT A;  3A2X A;  2CA8 A;  1PKW A;  3O76 A;  3WGE A;  5CRW A;  2FCH A;  3M9K A;  4PUF C;  1XWK A;  2H6Z A;  4KDU A;  1XWC A;  3EIN A;  5G31 A;  4Q5R A;  1YQ1 A;  2VD0 A;  2JZR A;  2PN8 A;  3KM6 A;  3QAV A;  2JZT A;  4HS1 A;  2K18 A;  20GS A;  1T4Z A;  4F9Z A;  4L8E A;  2KP2 A;  4HZ2 A;  5B8A A;  2RUF A;  3FR3 A;  4WF4 A;  2YWM A;  2X8C A;  3FYG A;  4YAV A;  5CRG A;  2DJJ A;  4OWY A;  3IK9 A;  3A2W A;  2LQO A;  5EVO A;  4N10 A;  1ZZY A;  2NPB A;  3MSZ A;  1OKT A;  2CVB A;  1T8E B;  1OKD A;  4JZQ A;  1U3A A;  5IPH A;  4EKZ A;  5HFK A;  2Z9S A;  1AQV A;  2RM5 A;  1Z6N A;  3GKK A;  3DXB A;  2HLS A;  3WD6 A;  1AW9 A;  4QQ7 A;  5IOX A;  2F8A A;  4OO5 A;  1NHY A;  1SL1 B;  4J56 E;  4EC0 A;  2HSH A;  4TXV A;  3D21 A;  3HVX A;  1SD9 A;  1TRV A;  1SYR A;  2L4Q A;  1RK4 A;  4RI6 A;  3CBU A;  1EV9 A;  1ERW A;  2LJA A;  1DSB A;  1XW5 A;  4TXO B;  2GDR A;  1AQW A;  5GST A;  3VPQ A;  3R2Q A;  2VM2 A;  4IBP A;  4MPG A;  2LQQ A;  3IDV A;  2H1G A;  5IMC A;  5IM9 A;  2PVO C;  1K0D A;  3EU3 A;  2YN1 A;  4N0Z A;  2D2Z A;  4AGS A;  2IFQ A;  1TXX A;  3UOM A;  5KEJ A;  4X0X A;  1O73 A;  3GIX A;  2LJK A;  1HD2 A;  2RUE A;  4MZC A;  5KN3 A;  1UVZ A;  2MZC A;  5FHI A;  2VL2 A;  3GKX A;  1GNE A;  1TRS A;  3IHQ A;  2H0H A;  3PH9 A;  4YQV A;  2B5E A;  3DML A;  3BCK A;  4LL4 B;  3GKN A;  1A2J A;  4HQS A;  4GSN A;  3EU4 A;  4ZBD A;  2J9H A;  3VWW A;  3ZVJ D;  3I69 A;  3F8U A;  1M0U A;  2EIQ A;  4IS0 A;  1FB6 A;  5B6M A;  3HYP A;  2YOI A;  1YDK A;  2DIZ A;  4PQ1 A;  3FR9 A;  1DBY A;  2AJQ B;  2OBK A;  4PUA A;  2JAD A;  4MMM A;  2LTK A;  4N11 A;  4GST A;  5D73 A;  3VI7 A;  3DRN A;  5ECS A;  1WJK A;  5E4W A;  3QMX A;  2WGR A;  2VLT A;  4NWY A;  3QCP A;  3FZ5 A;  3GMF A;  4NV2 A;  1GSS A;  3P7X A;  3QFB C;  2LRC A;  3IPZ A;  4ZL7 A;  1H4O A;  1NSW A;  3IA1 A;  2VM1 A;  1PX7 A;  3FZ4 A;  1FO5 A;  5A4W A;  3G7I A;  3Q74 A;  2NBS A;  4OFT A;  4KB3 A;  2OA7 A;  2IMD A;  4ECJ A;  4ZIL A;  3C71 A;  12GS A;  6GSW A;  5FT3 A;  4FYB A;  1WMJ A;  5DAK B;  1UN2 A;  4V2L A;  1LU4 A;  3ZRD A;  1O8X A;  5J41 A;  1FB0 A;  3KP8 A;  3C1R A;  2VCV A;  2YZU A;  3HJM A;  2EC4 A;  1VF1 A;  2VL3 A;  2G0F A;  1V98 A;  1OC3 A;  4TR0 A;  1S3A A;  2VCW A;  4YQM A;  3KXO A;  1G6W A;  1TU7 A;  2IN3 A;  4EL1 A;  3TJB A;  2WJU A;  2P5Q A;  2H8L A;  2HT9 A;  2BJX A;  4BL7 A;  3LOR A;  5LCZ A;  3KMO A;  2LRT A;  3HXS A;  3TCO A;  2N5B A;  1OC9 A;  4OO4 A;  5J4U A;  5HR1 A;  4ZBB A;  1QFN A;  5E59 A;  5G5E A;  4JED A;  1R7H A;  3GYK A;  4XTS A;  4J2F A;  4L5L A;  2YCD A;  4IQ1 A;  4E8E A;  2LUS A;  1J9B A;  3TGZ A;  1ZOF A;  1SK1 A;  4YQU A;  2I1U A;  3D4T A;  3GTU A;  1XOB A;  3I6A A;  1TW9 A;  4TOP A;  5GZZ B;  5JCG A;  3FHK A;  3FZA A;  1M99 A;  2LV3 A;  1U88 A;  1SEN A;  2IWT A;  1ZYE A;  3ZZX A;  1X9S B;  1A8L A;  1GUK A;  4TW5 A;  5D96 A;  3IBH A;  4Q5Q A;  4Q5N A;  3FW2 A;  3ISO A;  1GLP A;  2H0G A;  3CYN A;  4FIW A;  2C0F A;  3LGC A;  3UBL A;  2H30 A;  3W8S A;  4Z7X A;  2IMK A;  1ABA A;  22GS A;  3APO A;  3F6D A;  5DAL A;  4ULX A;  3GNJ A;  1XOA A;  3N5O A;  4AJ7 A;  3LXT A;  2L6C A;  2NVL A;  3HY2 A;  1XXU A;  2XHF A;  5AIV A;  1PSQ A;  5ECK B;  2DML A;  1JZR A;  3FY7 A;  4HOJ A;  4ILF A;  3IR4 A;  3GST A;  4F0B A;  1EGO A;  2O87 A;  1JLW A;  1MDK A;  2FWF A;  1I9D A;  2C3N A;  4NAX A;  1VF3 A;  2J23 A;  3RAZ A;  4KDY A;  4JU5 A;  3KCM A;  2B7K A;  2K6V A;  1ZGN A;  4TXO A;  3NOF A;  3ZIJ A;  1X5C A;  2M80 A;  1FHE A;  2LST A;  1H75 A;  1YZX A;  3UVH A;  4KUN A;  2H72 A;  4NMU A;  4FO5 A;  1X0R A;  2XC2 A;  1HQO A;  2CZ2 A;  4PNF A;  1TI3 A;  1A23 A;  4V1A g;  3ZML A;  5DBQ A;  2F8F A;  2IME A;  2JL4 A;  2HZF A;  2VCX A;  5J9B A;  4MJB A;  4E8H A;  5H5R A;  1U6T A;  4ZL8 A;  3EE2 A;  3J7Y k;  1SL0 B;  1XPV A;  4GLT A;  3EUR A;  1VF4 A;  3L4N A;  3HZ4 A;  2FA8 A;  1GTU A;  1Q4J A;  4FYC A;  3I43 A;  1K0B A;  2PER A;  2H73 A;  5F05 A;  3A2V A;  5EL8 A;  4F03 A;  1WOU A;  2P5R A;  3QD9 A;  3GA4 A;  5CNW A;  4MJA A;  3D22 A;  1GSD A;  3BOA A;  3APQ A;  4OD7 A;  1PD2 1;  2DSA A;  2YNX A;  1VGL A;  4V2M A;  5ECQ B;  4MH3 A;  1ZMA A;  2MBT A;  2DJK A;  4I5Q A;  3Q18 A;  2B6M A;  1TOF A;  3AY8 A;  5CRD A;  1MDI A;  4WXT A;  1XZO A;  1YJ6 A;  3IOS A;  1AAZ A;  2H1D A;  2F51 A;  4PNG A;  4OMV A;  3ME8 A;  4PQI A;  3L9V A;  1V2A A;  2C3Q A;  3HZ8 A;  3BJ5 A;  6GSU A;  1QGV A;  1M9B A;  1XWB A;  4OFN A;  3LYK A;  4O92 A;  1Z3E A;  5HR2 A;  1EOH A;  1GUL A;  3TJJ A;  2CT6 A;  2FWH A;  2H6X A;  4MDC A;  3PGT A;  1E2Y A;  2WRT A;  4KSO A;  1J0F A;  4I97 A;  1ZL9 A;  2O7K A;  4DSR A;  1EZK A;  2H66 A;  3RPP A;  4LMW A;  1EEM A;  5DAK A;  2I9H A;  4XS1 A;  1O81 A;  3US3 A;  4EDZ A;  3GN3 A;  3TJK A;  1HNA A;  2PBJ A;  1TTZ A;  1NM3 A;  2V6K A;  1VF2 A;  3F4S A;  4GSS A;  3ZRE A;  1PQN A;  2A4V A;  3JCM L;  3RDW A;  3TKS A;  4PX1 A;  2A2R A;  2GSQ A;  5H5Q A;  2PU9 C;  2I3Y A;  1GLQ A;  4DSQ A;  3F3Q A;  2HFD A;  2CZ3 A;  1A8Y A;  1B4P A;  3ZYW A;  3QR6 A;  1AQX A;  2PPT A;  3ZVJ A;  1JZO A;  1JZW A;  2OE1 A;  3W6G A;  1KTE A;  3MWH A;  4MAB A;  3ERG A;  2H74 A;  3W8J A;  3GV1 A;  1SYX A;  2BMX A;  3ERW A;  3UMA A;  1U3I A;  2CAI A;  5CO3 A;  2KOK A;  3KJY A;  1X9M B;  2I81 A;  2B5Y A;  2MYG A;  2LEG A;  1QXH A;  1DUG A;  2L5L A;  4NHW A;  14GS A;  1V40 A;  2FWE A;  1KEB A;  2V32 A;  2WFC A;  2R2J A;  4TVE A;  2FWG A;  3F3R A;  3KIJ A;  4IQA A;  4KDX A;  1MD4 A;  2P0G A;  3GSS A;  1BX9 A;  4WR4 A;  1FAA A;  4MK3 A;  4BA7 A;  2PWJ A;  5DJL A;  4QL9 A;  3GL5 A;  1EEJ A;  3H8Q A;  1B48 A;  4PGT A;  3KD0 A;  4I2U A;  3DEX A;  1R4W A;  3DVX A;  5F07 A;  4MH2 A;  5IMF A;  1GSU A;  4PXO A;  3VK9 A;  2L57 A;  2MMO A;  3HJP A;  1GP1 A;  3C1S A;  1PN9 A;  4DSS B;  5AIX A;  2CV4 A;  4L0W A;  5D8I A;  2B1L A;  1XBS A;  4KND A;  5IMZ A;  2CX4 A;  3CRT A;  2GQK A;  1YEP A;  3F63 A;  2GTU A;  4EUY A;  2IL3 A;  1Z9H A;  2O85 A;  2GQL A;  5KN0 A;  3TOT A;  1ERV A;  3U5R E;  2RM6 A;  1TKD B;  3A3T A;  3G7J A;  2DIY A;  3UJ1 A;  2QC7 A;  2EIO A;  3LYP A;  3D0Z A;  3ZL5 A;  4EF0 A;  2X64 A;  3M1G A;  2WUL A;  3UIW A;  3J7Y b;  3GKM A;  3LSZ A;  1RQM A;  1G7O A;  3ME7 A;  1LJR A;  2V2G A;  3HDC A;  3H1N A;  4FH8 A;  3GUR A;  3UAR A;  3EYT A;  3FZ9 A;  3HHV A;  3H4K A;  2IJY A;  2XBI A;  3I9V 2;  1MD3 A;  5B8B A;  1X9W B;  6GSX A;  3F0I A;  1S3D A;  1QMV A;  1BJX A;  4ACS A;  4HUA A;  1GTI A;  4XS4 B;  4IEL A;  2VLU A;  3P90 A;  4GTU A;  5ECN B; 
#chains in the Genus database with same CATH topology
 4DEJ A;  4EXJ A;  1XIY A;  2YZH A;  3QOU A;  3Q19 A;  4G10 A;  1A0R P;  3TOU A;  3LJR A;  3UL3 A;  2JU5 A;  3KP9 A;  3GH9 A;  4RQR A;  4G19 A;  3VLN A;  1X5D A;  1GUM A;  3KGK A;  1XVQ A;  4KCA A;  2HZE B;  2GT6 A;  1K3L A;  1R26 A;  1VRS D;  4K7I A;  3HVN A;  5ENU A;  3VWV A;  4POK A;  1IYH A;  4BVY B;  4TR1 B;  4BVX B;  2YJ7 A;  4Z2R A;  4V1A p;  1FOV A;  2HRF A;  1IYI A;  2C1Y A;  4WR5 A;  2YAN A;  4HEA 2;  3GUS A;  3G9B A;  4EDY A;  2V41 A;  3FR6 A;  2YJH A;  3UBK A;  2TRC P;  1GTA A;  4HZ4 A;  2LKU A;  3TB2 A;  1JFU A;  5D9T A;  5HQP A;  3APS A;  1W4V A;  5IMV A;  1G6Y A;  1N2A A;  4TR3 A;  3L9S A;  3F9U A;  1UA5 A;  5JWQ B;  2AYT A;  5C00 A;  1GWC A;  2E7P A;  4MF5 A;  4G0I A;  4YKG A;  5AN1 A;  2QKE A;  5ECP B;  2FA4 A;  5B7C A;  1Z6M A;  3GHA A;  1ACV A;  4O5R A;  2FNO A;  2KHP A;  4D73 B;  4NHZ A;  1FG4 A;  2I4A A;  2H71 A;  1JHB A;  5CYY A;  2QGV A;  2GST A;  2IMI A;  2VCT A;  5HFG A;  2OKA A;  4K5R A;  2LS5 A;  4BWQ A;  4Z2U A;  4LA1 A;  2VOC A;  4GQC A;  1F37 A;  1TU8 A;  4K9Z A;  4BWS A;  2O8V B;  4MP4 A;  4HDE A;  1M2B A;  17GS A;  3L78 A;  6GST A;  2X99 A;  2WZ9 A;  4ML1 A;  4G2E A;  1R5P A;  3HCZ A;  3HJO A;  4JBB A;  4L0U A;  4IGJ A;  4ZB8 A;  2PMT A;  2ZUP A;  1THO A;  4JRR A;  1NW2 A;  4FYU A;  5DCH A;  1WIK A;  3ERF A;  2LNT A;  2YV7 A;  5ELG A;  2ON5 A;  3BD2 A;  1QK8 A;  1SK0 A;  4TRX A;  2VO4 A;  1BED A;  2PGT A;  4ZB9 A;  1GUH A;  2C0E A;  1W89 A;  3QPM A;  5G2Z A;  4X43 A;  2AB6 A;  1E6B A;  1BQ7 A;  1K0M A;  1TK5 B;  2PVQ A;  5G1L A;  2CQ9 A;  1YKC A;  4A5P A;  2GGT A;  4CW9 A;  3TRQ A;  4Z2T A;  3CSH A;  3ZLP A;  2BTO T;  3LW9 A;  3O3T A;  2C4J A;  4LMV A;  4V2N A;  5J3R A;  1X5E A;  3CSI A;  4IJI A;  4HQZ A;  1F6M C;  1AIU A;  2H0I A;  6GSY A;  4IKH A;  1FVJ A;  1V58 A;  2G2Q A;  4HJM A;  3IC8 A;  1PGT A;  2PUK C;  4L5O A;  4IN0 A;  1OE7 A;  3IAM 2;  4JR4 A;  2B5X A;  2HRN A;  4EIP A;  5A4V A;  2FGX A;  3K8N A;  1PA3 A;  2OE0 A;  4XIH A;  3H79 A;  4X4J A;  5ELA A;  2K9F A;  5F06 A;  5KN2 A;  2DJ0 A;  5JWR B;  1UC7 A;  3PPU A;  1XW9 A;  5JCU A;  1ZYN A;  5D93 A;  1A0F A;  3CXG A;  3EVI A;  1S3C A;  1TI1 A;  3WT1 A;  2GSS A;  1XVW A;  2YWI A;  4AJ6 A;  2MMN A;  4O5U A;  2HE3 A;  2H75 A;  1F3A A;  1M7T A;  5COH A;  4F82 A;  1F2E A;  4KH7 A;  3P2A A;  5D9W A;  3WT2 A;  1ERT A;  1B9Y C;  4CY8 A;  3WGX A;  2DLX A;  2MMZ A;  2AAW A;  4X1U A;  5G5F A;  3TJG A;  1ZYP A;  3DKS A;  2JZS A;  4OFM A;  2GZZ A;  3UAP A;  2P31 A;  1SL2 B;  4MPF A;  4O7H A;  3CMI A;  2X8H A;  4RI7 A;  2WB9 A;  5DJM A;  3RHC A;  4QL7 A;  2RII A;  4KGI A;  2GS3 A;  2QSI A;  5A5K A;  3BBY A;  3GRX A;  1PRX A;  4K8M A;  3RPN A;  5DDL A;  2DJ3 A;  1AC1 A;  4KX4 A;  1MDJ A;  2N5F A;  4K1F A;  2ZNM A;  2VL9 A;  1YY7 A;  5H5S A;  1BAY A;  2JSY A;  4ZB6 A;  2RLI A;  5EY6 A;  2LNS A;  5KN1 A;  2A4H A;  1DE2 A;  3QDN A;  3ZFB A;  2REM A;  2GT5 A;  1OE8 A;  2H76 A;  1ERU A;  1G0T A;  4HI7 A;  4HU7 A;  3VFI A;  1V9W A;  5ECH B;  4AJ8 A;  1Z7P A;  2GZY A;  5IO2 A;  2YV9 A;  2K8V A;  4H86 A;  3CSJ A;  4KE3 A;  1TJD A;  2NTO A;  3GL3 A;  2DKH A;  2VL2 C;  5IPG A;  1Z7R A;  1O8W A;  4NXI A;  3M0F A;  1R5A A;  1THX A;  4KAE A;  2B1K A;  5ECR B;  5IMA A;  1XW6 A;  4EVM A;  1WRY A;  1WP0 A;  3RHB A;  3LQ7 A;  4XRA A;  3VWX A;  4GWR A;  5DQY A;  4TN8 A;  5D9V A;  5F8B A;  5CP1 A;  2XPD A;  1MEK A;  3F6F A;  4D73 A;  18GS A;  4GRF A;  1PMT A;  5IMD A;  2XBQ A;  5CAX A;  2DJ2 A;  3HVS A;  3U6V A;  4PQH A;  3LG6 A;  1N8J A;  2X8G A;  1F3B A;  1JZD A;  3KH9 A;  1EGR A;  3DVW A;  4I2T A;  3OR5 A;  4N30 A;  4GQF A;  4BL7 B;  1ILO A;  1KBN A;  2DC5 A;  5ID2 B;  1KNG A;  1Y6E A;  1TDI A;  2HYX A;  5DVB A;  1B4Q A;  1OC9 B;  1YEX A;  1PX6 A;  1B9X C;  1SU9 A;  5CRE A;  4J57 E;  1K0O A;  4HU9 A;  5IIZ A;  1PL1 A;  2IPA A;  2JAC A;  3LWA A;  3D6I A;  1SK2 A;  1SJZ A;  3CTG A;  3KMN A;  2TRX A;  3S9F A;  1DE1 A;  2ON7 A;  3F4T A;  4WEY A;  3IK7 A;  3GTU B;  3DGQ A;  2C0D A;  2GZP A;  2QA1 A;  5J9C A;  1F9M A;  2HNL A;  4KA0 A;  2HRK A;  5ECL B;  3HVV A;  4MF7 A;  1T7P B;  2X4A A;  1SKW B;  1T4Y A;  4MJE A;  2GLR A;  4G9H A;  3TKS E;  2L5O A;  4JE1 A;  1SJ6 A;  5DCG A;  3L0H A;  4NV5 A;  2M72 A;  3HD5 A;  5BMU A;  1EP7 A;  1EV4 A;  1TK8 B;  5DAL B;  4MZW A;  2LJR A;  3DD3 A;  3CRU A;  2L4C A;  4MF6 A;  2YWO A;  1Y25 A;  4XCS A;  1ZCP A;  1ML6 A;  1A2M A;  2HXK A;  4POM A;  5ECM B;  3VI5 A;  1QUW A;  4F0C A;  2AV4 A;  5GAN D;  1AUC A;  1OVN A;  2WS2 A;  3GX0 A;  3GX8 A;  1K3Y A;  4K0G A;  5AGY A;  5B6N A;  4IHU A;  1ZYQ B;  1GNW A;  4RQX A;  4POL A;  3M3M A;  1XWG A;  3PIN A;  3E3E A;  2H1A A;  4USS A;  2A2S A;  3O6T A;  4AF2 A;  4ISD A;  1FVK A;  1M2A A;  4ECB A;  1M9A A;  1LBK A;  4GF0 A;  2TIR A;  4WF5 A;  3LXZ A;  2DJ1 A;  1RW1 A;  3NIV A;  4G0L A;  4WET A;  5LD0 A;  1XWA A;  2C3T A;  2GSR A;  4IJ3 A;  4ZXG A;  4WBR D;  3ZIT A;  1HNC A;  1GRX A;  2N5A A;  2VCQ A;  3HA9 A;  3FK8 A;  4PUR A;  3Q6O A;  3TKP A;  2L6D A;  2AUV A;  7GSS A;  2HI7 A;  4K6X A;  4TKY A;  4WKW A;  4GXZ A;  2B7J A;  2FUG 2;  2NDO A;  1TRW A;  1T3B A;  16GS A;  1WE0 A;  4BIK A;  1FOH A;  1EWX A;  4IP1 A;  2E2M A;  2R3X A;  4EE0 A;  3EMP A;  4ECC A;  2DMM A;  1TP9 A;  4F2I A;  5INY A;  4ECI A;  1SD8 A;  3ZTL A;  2FLS A;  3EC3 A;  5C04 A;  5JCW A;  1HYU A;  1NHO A;  1V57 A;  3UEM A;  2H19 A;  1SJI A;  1HNB A;  4P3Y B;  1OC8 A;  2H6Y A;  5A4U A;  2C80 A;  19GS A;  1YKA A;  4YAP A;  3TUE A;  1OYJ A;  1GSE A;  2XPE A;  4IVF A;  4EO3 A;  1C72 A;  4O32 A;  4XS6 A;  10GS A;  3MAK A;  8GSS A;  1O6J A;  2E0Q A;  3F4R A;  1QQ2 A;  6GSV A;  2X49 A;  1WWJ A;  1M2D A;  4XHM A;  2VCZ A;  2VIM A;  3ZMK A;  2R4V A;  4O5Q A;  3IE3 A;  2ES7 A;  1PKZ A;  1A2L A;  5HR0 A;  1BYE A;  4DVC A;  2WDU A;  3QAG A;  4MNN A;  2K8S A;  3G7Y A;  1GSY A;  4ZIJ A;  4BPY A;  3WGD A;  2V6O A;  1SKR B;  1YF1 A;  2HRA A;  2R37 A;  2O89 A;  2MBS A;  5ID2 A;  2VUP A;  4LL1 B;  4CDO A;  4YH2 A;  2F9S A;  5JWO B;  4KW6 A;  2ALB A;  3TDG A;  3FKF A;  2VLV A;  4PTS A;  9GSS A;  2FY6 A;  1T00 A;  2H01 A;  3M8N A;  3H93 A;  1URM A;  4NPB A;  2GVP A;  3GFK A;  2LRN A;  4MZB A;  4Q5F A;  2EIR A;  1TK0 B;  5EPF A;  3DWV A;  2C0G A;  3KTB A;  2FD3 A;  2HSM A;  3TRX A;  1TRU A;  2ZCT A;  1O7U A;  3GH6 A;  2KUC A;  1XFL A;  1K0N A;  3VWU A;  3NZN A;  1M3J A;  3TKS C;  4DSS A;  3D4M A;  4GCI A;  2OAC A;  4LLR A;  5BRT A;  1FW1 A;  4OCE A;  1ON4 A;  4N0V A;  3PR8 A;  1XCC A;  3WYW A;  2CVK A;  5GAP D;  2CX3 A;  3SWL A;  1USB A;  1GTB A;  3L9U A;  4CHS A;  3MYD A;  3EWL A;  3A5W A;  1T1V A;  5DQS A;  4K7N A;  4IP6 A;  1U87 A;  4KF9 A;  5GSS A;  5IOW A;  5CRH A;  3C73 A;  3CQF A;  3C8E A;  1WPI A;  1CQG A;  1I5G A;  2CVD A;  3MNG A;  3IXR A;  5L71 A;  6GSS A;  3V1W A;  4MLY A;  5G1K A;  5HR3 A;  3KZQ A;  2L59 A;  2IFQ B;  3C7M A;  3VPT A;  4I8B A;  4ZBA A;  1K3O A;  2R6K A;  4KSM A;  2AHE A;  2YWN A;  4ID0 A;  5J5N A;  1A24 A;  3ED3 A;  5D9X A;  3KTL A;  4RUV A;  1GH2 A;  1SKS B;  3HKR A;  4JR6 A;  3D5J A;  2KP1 A;  4XS4 A;  4MJC A;  1GSQ A;  4YKF A;  2B3S A;  4POB A;  11GS A;  3BCI A;  3M9J A;  2KLX A;  2OE3 A;  3RBT A;  2HSY A;  2FHE A;  4TR4 A;  3TRP A;  3TKR A;  1AXD A;  4XRD A;  5F0G A;  1Z5Y E;  4KCE A;  5ECO B;  4FQU A;  5HFI A;  1XG8 A;  4MA9 A;  4OCF A;  3FRC A;  3TJF A;  2R5G A;  2V1M A;  3P8W A;  2HZE A;  5IQY A;  2VD1 A;  4K7O A;  2H1B A;  1MTC A;  1K0A A;  4BVY A;  4TR1 A;  4BVX A;  3VUR A;  4HJ2 A;  3SBC A;  1YF0 A;  1EP8 A;  4I6X A;  2MMA A;  3E9J B;  2DBC A;  4K0N A;  4ML6 A;  2WCI A;  2IIY A;  1G7E A;  1OAZ A;  5G30 A;  2GQM A;  2YP6 A;  13GS A;  1EOG A;  2YPM A;  1Q98 A;  2IMF A;  3QFA C;  5FWG A;  1ST9 A;  3EMX A;  1K0C A;  3DYR A;  2M46 A;  1BG5 A;  2JSZ A;  5LNK e;  1O85 A;  1J08 A;  2VAF A;  3FEU A;  5AIS A;  3IRA A;  2A2P A;  4IW9 A;  2OBI A;  3E0U A;  3LEF A;  3QAW A;  4ZL9 A;  3MDK A;  2H70 A;  5IO0 A;  4MCU A;  1JLV A;  3KEB A;  3CTF A;  4WBJ A;  3N9J A;  2E2G A;  2OAD A;  1GSF A;  2R0G A;  1PL2 A;  2C8U A;  2CAQ A;  3IAS 2;  3IV4 A;  3ZFL A;  5ECI B;  3IC4 A;  1CQH A;  1GL8 A;  3LFL A;  3DIE A;  3KH7 A;  3TKQ A;  2OJL A;  2F3M A;  4K2D A;  3ZIV A;  5ABR A;  1B8X A;  3UVT A;  3A2X A;  2CA8 A;  1PKW A;  3O76 A;  1PFO A;  3WGE A;  5CRW A;  2FCH A;  3M9K A;  4PUF C;  1XWK A;  2H6Z A;  4KDU A;  1XWC A;  3EIN A;  5G31 A;  4Q5R A;  1YQ1 A;  2VD0 A;  2JZR A;  2PN8 A;  3KM6 A;  3QAV A;  2JZT A;  4HS1 A;  2K18 A;  20GS A;  1T4Z A;  4F9Z A;  4L8E A;  2KP2 A;  4HZ2 A;  5B8A A;  2RUF A;  3FR3 A;  4WF4 A;  2YWM A;  2X8C A;  3FYG A;  4YAV A;  5CRG A;  2DJJ A;  4OWY A;  3IK9 A;  2QA2 A;  3A2W A;  2LQO A;  5EVO A;  4N10 A;  1ZZY A;  2NPB A;  3MSZ A;  1OKT A;  2CVB A;  1T8E B;  1OKD A;  4JZQ A;  1U3A A;  5IPH A;  4EKZ A;  5HFK A;  2Z9S A;  1AQV A;  2RM5 A;  1Z6N A;  3GKK A;  3DXB A;  2HLS A;  3WD6 A;  1AW9 A;  4QQ7 A;  5IOX A;  2F8A A;  4OO5 A;  1NHY A;  1SL1 B;  3FMW A;  4J56 E;  4EC0 A;  2HSH A;  4TXV A;  3D21 A;  3HVX A;  1SD9 A;  1TRV A;  1SYR A;  2L4Q A;  1RK4 A;  4RI6 A;  3R3E A;  3CBU A;  1EV9 A;  1ERW A;  2LJA A;  1DSB A;  1XW5 A;  4TXO B;  2GDR A;  1AQW A;  5GST A;  3VPQ A;  3R2Q A;  2VM2 A;  4IBP A;  4MPG A;  2LQQ A;  3IDV A;  2H1G A;  5IMC A;  5IM9 A;  2PVO C;  1K0D A;  3EU3 A;  2YN1 A;  4N0Z A;  2D2Z A;  4AGS A;  2IFQ A;  1TXX A;  3UOM A;  5KEJ A;  4X0X A;  1O73 A;  3GIX A;  2LJK A;  1HD2 A;  2RUE A;  4MZC A;  5KN3 A;  1UVZ A;  2MZC A;  5FHI A;  2VL2 A;  3GKX A;  1GNE A;  3A5I A;  1TRS A;  3IHQ A;  2H0H A;  3PH9 A;  4YQV A;  2B5E A;  3DML A;  3BCK A;  4LL4 B;  3GKN A;  1M3I A;  1A2J A;  4HQS A;  4GSN A;  3EU4 A;  4ZBD A;  2J9H A;  3VWW A;  3ZVJ D;  3I69 A;  3F8U A;  1M0U A;  2EIQ A;  4IS0 A;  1FB6 A;  5B6M A;  3HYP A;  2YOI A;  1YDK A;  2DIZ A;  4PQ1 A;  3FR9 A;  1DBY A;  2AJQ B;  2OBK A;  4PUA A;  2JAD A;  4MMM A;  2LTK A;  4N11 A;  4GST A;  5D73 A;  3VI7 A;  3DRN A;  5ECS A;  1WJK A;  5E4W A;  3QMX A;  2WGR A;  2VLT A;  4NWY A;  3QCP A;  3FZ5 A;  3GMF A;  4NV2 A;  1GSS A;  3P7X A;  3QFB C;  2LRC A;  3IPZ A;  4ZL7 A;  1H4O A;  1NSW A;  3IA1 A;  2VM1 A;  1PX7 A;  3FZ4 A;  1FO5 A;  5A4W A;  3G7I A;  3Q74 A;  2NBS A;  4OFT A;  4KB3 A;  2OA7 A;  2IMD A;  4ECJ A;  4ZIL A;  3C71 A;  12GS A;  6GSW A;  5FT3 A;  4FYB A;  1WMJ A;  5DAK B;  1UN2 A;  4V2L A;  1LU4 A;  3ZRD A;  1O8X A;  5J41 A;  1FB0 A;  3KP8 A;  3C1R A;  2VCV A;  2YZU A;  3HJM A;  2EC4 A;  1VF1 A;  2VL3 A;  2G0F A;  1V98 A;  1OC3 A;  4TR0 A;  1S3A A;  2VCW A;  4YQM A;  5KOX A;  3KXO A;  1G6W A;  1TU7 A;  2IN3 A;  4EL1 A;  3TJB A;  2WJU A;  2P5Q A;  2H8L A;  2HT9 A;  2BJX A;  4BL7 A;  3LOR A;  5LCZ A;  3KMO A;  2DKI A;  1PN0 A;  2LRT A;  3HXS A;  3TCO A;  2N5B A;  1OC9 A;  4OO4 A;  5J4U A;  5HR1 A;  4ZBB A;  1QFN A;  5E59 A;  5G5E A;  4JED A;  1R7H A;  3GYK A;  4XTS A;  4J2F A;  4L5L A;  2YCD A;  4IQ1 A;  4E8E A;  2LUS A;  1J9B A;  3TGZ A;  1ZOF A;  1SK1 A;  4YQU A;  2I1U A;  3D4T A;  3GTU A;  1XOB A;  3I6A A;  1TW9 A;  4TOP A;  4CY6 A;  5GZZ B;  5JCG A;  3FHK A;  3FZA A;  1M99 A;  2LV3 A;  1U88 A;  1SEN A;  2IWT A;  1ZYE A;  3ZZX A;  1X9S B;  1A8L A;  1GUK A;  4TW5 A;  5D96 A;  3IBH A;  4Q5Q A;  4Q5N A;  3FW2 A;  3ISO A;  1GLP A;  2H0G A;  3CYN A;  4FIW A;  2C0F A;  3LGC A;  3UBL A;  2H30 A;  3W8S A;  4Z7X A;  2IMK A;  1ABA A;  22GS A;  3APO A;  3F6D A;  5DAL A;  4ULX A;  3GNJ A;  1XOA A;  3N5O A;  4AJ7 A;  3LXT A;  2L6C A;  2NVL A;  3HY2 A;  1XXU A;  2XHF A;  5AIV A;  1PSQ A;  5ECK B;  2DML A;  1JZR A;  3FY7 A;  4HOJ A;  4ILF A;  3IR4 A;  3GST A;  4F0B A;  1EGO A;  2O87 A;  1JLW A;  1MDK A;  2FWF A;  4ICY A;  1I9D A;  2C3N A;  4NAX A;  1VF3 A;  2J23 A;  3RAZ A;  4HSC X;  4KDY A;  4JU5 A;  3KCM A;  2B7K A;  2K6V A;  1ZGN A;  4TXO A;  3NOF A;  3ZIJ A;  1X5C A;  2M80 A;  1FHE A;  2LST A;  1H75 A;  1YZX A;  3UVH A;  4KUN A;  2H72 A;  4NMU A;  4FO5 A;  1X0R A;  2XC2 A;  1HQO A;  2CZ2 A;  4PNF A;  1TI3 A;  1A23 A;  4V1A g;  3ZML A;  5DBQ A;  2F8F A;  2IME A;  2JL4 A;  2HZF A;  2VCX A;  5J9B A;  4MJB A;  4E8H A;  5H5R A;  1U6T A;  1S3R A;  4ZL8 A;  2R0C A;  3EE2 A;  3J7Y k;  1SL0 B;  1XPV A;  4GLT A;  3EUR A;  1VF4 A;  3L4N A;  3HZ4 A;  2FA8 A;  1GTU A;  2R0P A;  1Q4J A;  4FYC A;  3I43 A;  1K0B A;  2PER A;  2H73 A;  5F05 A;  3A2V A;  5EL8 A;  4F03 A;  3MIX A;  1WOU A;  2P5R A;  3QD9 A;  3GA4 A;  5CNW A;  4MJA A;  3D22 A;  1GSD A;  3BOA A;  3APQ A;  4OD7 A;  1PD2 1;  2DSA A;  2YNX A;  1VGL A;  4V2M A;  5ECQ B;  4MH3 A;  1ZMA A;  2MBT A;  2DJK A;  4I5Q A;  3Q18 A;  2B6M A;  1TOF A;  3AY8 A;  5CRD A;  1MDI A;  4WXT A;  1XZO A;  1YJ6 A;  3IOS A;  1AAZ A;  2H1D A;  2F51 A;  4PNG A;  4OMV A;  3ME8 A;  4PQI A;  3L9V A;  1V2A A;  2C3Q A;  3HZ8 A;  3BJ5 A;  6GSU A;  1QGV A;  1M9B A;  1XWB A;  4OFN A;  3LYK A;  4O92 A;  1Z3E A;  5HR2 A;  1EOH A;  1GUL A;  3TJJ A;  2CT6 A;  2FWH A;  2H6X A;  4MDC A;  3PGT A;  1E2Y A;  2WRT A;  4KSO A;  1J0F A;  4I97 A;  1ZL9 A;  2O7K A;  4DSR A;  1EZK A;  2H66 A;  3RPP A;  4LMW A;  4K2X A;  1EEM A;  5DAK A;  2I9H A;  4XS1 A;  1O81 A;  3US3 A;  4EDZ A;  3GN3 A;  3TJK A;  4K5S A;  1HNA A;  2PBJ A;  1TTZ A;  1NM3 A;  2V6K A;  1VF2 A;  3F4S A;  4GSS A;  3ZRE A;  1PQN A;  2A4V A;  3JCM L;  3RDW A;  3TKS A;  4PX1 A;  2A2R A;  2GSQ A;  5H5Q A;  2PU9 C;  2I3Y A;  1GLQ A;  4DSQ A;  3F3Q A;  2HFD A;  2CZ3 A;  1A8Y A;  1B4P A;  3ZYW A;  3QR6 A;  1AQX A;  2PPT A;  3ZVJ A;  1JZO A;  1JZW A;  2OE1 A;  3W6G A;  1KTE A;  3MWH A;  2UZ8 A;  4MAB A;  3ERG A;  2H74 A;  3W8J A;  3GV1 A;  1SYX A;  2BMX A;  3ERW A;  3UMA A;  1U3I A;  2CAI A;  5CO3 A;  2KOK A;  3KJY A;  1X9M B;  2I81 A;  2B5Y A;  2MYG A;  2LEG A;  1QXH A;  1DUG A;  2L5L A;  4NHW A;  14GS A;  1V40 A;  2FWE A;  1KEB A;  2V32 A;  2WFC A;  2R2J A;  4TVE A;  2FWG A;  3EPT A;  3F3R A;  3KIJ A;  4IQA A;  4KDX A;  1MD4 A;  2P0G A;  3GSS A;  1BX9 A;  4WR4 A;  1FAA A;  4MK3 A;  4BA7 A;  2PWJ A;  4EIQ A;  5DJL A;  4QL9 A;  3GL5 A;  1EEJ A;  3H8Q A;  1B48 A;  4PGT A;  3KD0 A;  4I2U A;  3DEX A;  1R4W A;  3DVX A;  5F07 A;  4MH2 A;  5IMF A;  1GSU A;  4PXO A;  3VK9 A;  2L57 A;  2MMO A;  3HJP A;  1GP1 A;  3C1S A;  1PN9 A;  4DSS B;  5AIX A;  2CV4 A;  4L0W A;  5D8I A;  2B1L A;  1XBS A;  4KND A;  5IMZ A;  2CX4 A;  3CRT A;  2GQK A;  1YEP A;  3F63 A;  2GTU A;  4EUY A;  2IL3 A;  1Z9H A;  2O85 A;  2GQL A;  5KN0 A;  3TOT A;  1ERV A;  3U5R E;  2RM6 A;  1TKD B;  3A3T A;  3G7J A;  2DIY A;  3UJ1 A;  2QC7 A;  2EIO A;  3LYP A;  5KOW A;  3D0Z A;  3ZL5 A;  4EF0 A;  2X64 A;  3M1G A;  2WUL A;  4G0K A;  3UIW A;  3J7Y b;  3GKM A;  3LSZ A;  1RQM A;  1G7O A;  3ME7 A;  1LJR A;  2V2G A;  3HDC A;  3H1N A;  4FH8 A;  3GUR A;  3UAR A;  3EYT A;  3FZ9 A;  3HHV A;  3H4K A;  2IJY A;  2XBI A;  3I9V 2;  1MD3 A;  5B8B A;  1X9W B;  6GSX A;  3F0I A;  1S3D A;  1QMV A;  1BJX A;  4ACS A;  4HUA A;  1GTI A;  4XS4 B;  3IHG A;  4IEL A;  2VLU A;  3P90 A;  4GTU A;  5ECN B; 
#chains in the Genus database with same CATH homology
 4DEJ A;  4EXJ A;  1XIY A;  2YZH A;  3QOU A;  3Q19 A;  4G10 A;  1A0R P;  3TOU A;  3LJR A;  3UL3 A;  2JU5 A;  3KP9 A;  3GH9 A;  4RQR A;  4G19 A;  3VLN A;  1X5D A;  1GUM A;  3KGK A;  1XVQ A;  4KCA A;  2HZE B;  2GT6 A;  1K3L A;  1R26 A;  1VRS D;  4K7I A;  5ENU A;  3VWV A;  4POK A;  1IYH A;  4BVY B;  4TR1 B;  4BVX B;  2YJ7 A;  4Z2R A;  4V1A p;  1FOV A;  2HRF A;  1IYI A;  2C1Y A;  4WR5 A;  2YAN A;  4HEA 2;  3GUS A;  3G9B A;  4EDY A;  2V41 A;  3FR6 A;  2YJH A;  3UBK A;  2TRC P;  1GTA A;  4HZ4 A;  2LKU A;  3TB2 A;  1JFU A;  5D9T A;  5HQP A;  3APS A;  1W4V A;  5IMV A;  1G6Y A;  1N2A A;  4TR3 A;  3L9S A;  3F9U A;  1UA5 A;  5JWQ B;  2AYT A;  5C00 A;  1GWC A;  2E7P A;  4MF5 A;  4G0I A;  4YKG A;  5AN1 A;  2QKE A;  5ECP B;  2FA4 A;  5B7C A;  1Z6M A;  3GHA A;  1ACV A;  4O5R A;  2FNO A;  2KHP A;  4D73 B;  4NHZ A;  1FG4 A;  2I4A A;  2H71 A;  1JHB A;  5CYY A;  2QGV A;  2GST A;  2IMI A;  2VCT A;  5HFG A;  2OKA A;  4K5R A;  2LS5 A;  4BWQ A;  4Z2U A;  4LA1 A;  2VOC A;  4GQC A;  1F37 A;  1TU8 A;  4K9Z A;  4BWS A;  2O8V B;  4MP4 A;  4HDE A;  1M2B A;  17GS A;  3L78 A;  6GST A;  2X99 A;  2WZ9 A;  4ML1 A;  4G2E A;  1R5P A;  3HCZ A;  3HJO A;  4JBB A;  4L0U A;  4IGJ A;  4ZB8 A;  2PMT A;  2ZUP A;  1THO A;  4JRR A;  1NW2 A;  4FYU A;  5DCH A;  1WIK A;  3ERF A;  2LNT A;  2YV7 A;  5ELG A;  2ON5 A;  3BD2 A;  1QK8 A;  1SK0 A;  4TRX A;  2VO4 A;  1BED A;  2PGT A;  4ZB9 A;  1GUH A;  2C0E A;  1W89 A;  3QPM A;  5G2Z A;  4X43 A;  2AB6 A;  1E6B A;  1BQ7 A;  1K0M A;  1TK5 B;  2PVQ A;  5G1L A;  2CQ9 A;  1YKC A;  4A5P A;  2GGT A;  4CW9 A;  3TRQ A;  4Z2T A;  3CSH A;  3ZLP A;  2BTO T;  3LW9 A;  3O3T A;  2C4J A;  4LMV A;  4V2N A;  5J3R A;  1X5E A;  3CSI A;  4IJI A;  4HQZ A;  1F6M C;  1AIU A;  2H0I A;  6GSY A;  4IKH A;  1FVJ A;  1V58 A;  2G2Q A;  4HJM A;  3IC8 A;  1PGT A;  2PUK C;  4L5O A;  4IN0 A;  1OE7 A;  3IAM 2;  4JR4 A;  2B5X A;  2HRN A;  4EIP A;  5A4V A;  2FGX A;  3K8N A;  1PA3 A;  2OE0 A;  4XIH A;  3H79 A;  4X4J A;  5ELA A;  2K9F A;  5F06 A;  5KN2 A;  2DJ0 A;  5JWR B;  1UC7 A;  3PPU A;  1XW9 A;  5JCU A;  1ZYN A;  5D93 A;  1A0F A;  3CXG A;  3EVI A;  1S3C A;  1TI1 A;  3WT1 A;  2GSS A;  1XVW A;  2YWI A;  4AJ6 A;  2MMN A;  4O5U A;  2HE3 A;  2H75 A;  1F3A A;  1M7T A;  5COH A;  4F82 A;  1F2E A;  4KH7 A;  3P2A A;  5D9W A;  3WT2 A;  1ERT A;  1B9Y C;  4CY8 A;  3WGX A;  2DLX A;  2MMZ A;  2AAW A;  4X1U A;  5G5F A;  3TJG A;  1ZYP A;  3DKS A;  2JZS A;  4OFM A;  2GZZ A;  3UAP A;  2P31 A;  1SL2 B;  4MPF A;  4O7H A;  3CMI A;  2X8H A;  4RI7 A;  2WB9 A;  5DJM A;  3RHC A;  4QL7 A;  2RII A;  4KGI A;  2GS3 A;  2QSI A;  5A5K A;  3BBY A;  3GRX A;  1PRX A;  4K8M A;  3RPN A;  5DDL A;  2DJ3 A;  1AC1 A;  4KX4 A;  1MDJ A;  2N5F A;  4K1F A;  2ZNM A;  2VL9 A;  1YY7 A;  5H5S A;  1BAY A;  2JSY A;  4ZB6 A;  2RLI A;  5EY6 A;  2LNS A;  5KN1 A;  2A4H A;  1DE2 A;  3QDN A;  3ZFB A;  2REM A;  2GT5 A;  1OE8 A;  2H76 A;  1ERU A;  1G0T A;  4HI7 A;  4HU7 A;  3VFI A;  1V9W A;  5ECH B;  4AJ8 A;  1Z7P A;  2GZY A;  5IO2 A;  2YV9 A;  2K8V A;  4H86 A;  3CSJ A;  4KE3 A;  1TJD A;  2NTO A;  3GL3 A;  2DKH A;  2VL2 C;  5IPG A;  1Z7R A;  1O8W A;  4NXI A;  3M0F A;  1R5A A;  1THX A;  4KAE A;  2B1K A;  5ECR B;  5IMA A;  1XW6 A;  4EVM A;  1WRY A;  1WP0 A;  3RHB A;  3LQ7 A;  4XRA A;  3VWX A;  4GWR A;  5DQY A;  4TN8 A;  5D9V A;  5F8B A;  5CP1 A;  2XPD A;  1MEK A;  3F6F A;  4D73 A;  18GS A;  4GRF A;  1PMT A;  5IMD A;  2XBQ A;  5CAX A;  2DJ2 A;  3HVS A;  3U6V A;  4PQH A;  3LG6 A;  1N8J A;  2X8G A;  1F3B A;  1JZD A;  3KH9 A;  1EGR A;  3DVW A;  4I2T A;  3OR5 A;  4N30 A;  4GQF A;  4BL7 B;  1ILO A;  1KBN A;  2DC5 A;  5ID2 B;  1KNG A;  1Y6E A;  1TDI A;  2HYX A;  5DVB A;  1B4Q A;  1OC9 B;  1YEX A;  1PX6 A;  1B9X C;  1SU9 A;  5CRE A;  4J57 E;  1K0O A;  4HU9 A;  5IIZ A;  1PL1 A;  2IPA A;  2JAC A;  3LWA A;  3D6I A;  1SK2 A;  1SJZ A;  3CTG A;  3KMN A;  2TRX A;  3S9F A;  1DE1 A;  2ON7 A;  3F4T A;  4WEY A;  3IK7 A;  3GTU B;  3DGQ A;  2C0D A;  2GZP A;  2QA1 A;  5J9C A;  1F9M A;  2HNL A;  4KA0 A;  2HRK A;  5ECL B;  3HVV A;  4MF7 A;  1T7P B;  2X4A A;  1SKW B;  1T4Y A;  4MJE A;  2GLR A;  4G9H A;  3TKS E;  2L5O A;  4JE1 A;  1SJ6 A;  5DCG A;  3L0H A;  4NV5 A;  2M72 A;  3HD5 A;  5BMU A;  1EP7 A;  1EV4 A;  1TK8 B;  5DAL B;  4MZW A;  2LJR A;  3DD3 A;  3CRU A;  2L4C A;  4MF6 A;  2YWO A;  1Y25 A;  4XCS A;  1ZCP A;  1ML6 A;  1A2M A;  2HXK A;  4POM A;  5ECM B;  3VI5 A;  1QUW A;  4F0C A;  2AV4 A;  5GAN D;  1AUC A;  1OVN A;  2WS2 A;  3GX0 A;  3GX8 A;  1K3Y A;  4K0G A;  5AGY A;  5B6N A;  4IHU A;  1ZYQ B;  1GNW A;  4RQX A;  4POL A;  3M3M A;  1XWG A;  3PIN A;  3E3E A;  2H1A A;  4USS A;  2A2S A;  3O6T A;  4AF2 A;  4ISD A;  1FVK A;  1M2A A;  4ECB A;  1M9A A;  1LBK A;  4GF0 A;  2TIR A;  4WF5 A;  3LXZ A;  2DJ1 A;  1RW1 A;  3NIV A;  4G0L A;  4WET A;  5LD0 A;  1XWA A;  2C3T A;  2GSR A;  4IJ3 A;  4ZXG A;  4WBR D;  3ZIT A;  1HNC A;  1GRX A;  2N5A A;  2VCQ A;  3HA9 A;  3FK8 A;  4PUR A;  3Q6O A;  3TKP A;  2L6D A;  2AUV A;  7GSS A;  2HI7 A;  4K6X A;  4TKY A;  4WKW A;  4GXZ A;  2B7J A;  2FUG 2;  2NDO A;  1TRW A;  1T3B A;  16GS A;  1WE0 A;  1FOH A;  1EWX A;  4IP1 A;  2E2M A;  2R3X A;  4EE0 A;  3EMP A;  4ECC A;  2DMM A;  1TP9 A;  4F2I A;  5INY A;  4ECI A;  1SD8 A;  3ZTL A;  2FLS A;  3EC3 A;  5C04 A;  5JCW A;  1HYU A;  1NHO A;  1V57 A;  3UEM A;  2H19 A;  1SJI A;  1HNB A;  4P3Y B;  1OC8 A;  2H6Y A;  5A4U A;  2C80 A;  19GS A;  1YKA A;  4YAP A;  3TUE A;  1OYJ A;  1GSE A;  2XPE A;  4IVF A;  4EO3 A;  1C72 A;  4O32 A;  4XS6 A;  10GS A;  3MAK A;  8GSS A;  1O6J A;  2E0Q A;  3F4R A;  1QQ2 A;  6GSV A;  2X49 A;  1WWJ A;  1M2D A;  4XHM A;  2VCZ A;  2VIM A;  3ZMK A;  2R4V A;  4O5Q A;  3IE3 A;  2ES7 A;  1PKZ A;  1A2L A;  5HR0 A;  1BYE A;  4DVC A;  2WDU A;  3QAG A;  4MNN A;  2K8S A;  3G7Y A;  1GSY A;  4ZIJ A;  4BPY A;  3WGD A;  2V6O A;  1SKR B;  1YF1 A;  2HRA A;  2R37 A;  2O89 A;  2MBS A;  5ID2 A;  2VUP A;  4LL1 B;  4CDO A;  4YH2 A;  2F9S A;  5JWO B;  4KW6 A;  2ALB A;  3TDG A;  3FKF A;  2VLV A;  4PTS A;  9GSS A;  2FY6 A;  1T00 A;  2H01 A;  3M8N A;  3H93 A;  1URM A;  4NPB A;  2GVP A;  3GFK A;  2LRN A;  4MZB A;  4Q5F A;  2EIR A;  1TK0 B;  5EPF A;  3DWV A;  2C0G A;  3KTB A;  2FD3 A;  2HSM A;  3TRX A;  1TRU A;  2ZCT A;  1O7U A;  3GH6 A;  2KUC A;  1XFL A;  1K0N A;  3VWU A;  3NZN A;  3TKS C;  4DSS A;  3D4M A;  4GCI A;  2OAC A;  4LLR A;  5BRT A;  1FW1 A;  4OCE A;  1ON4 A;  4N0V A;  3PR8 A;  1XCC A;  3WYW A;  2CVK A;  5GAP D;  2CX3 A;  3SWL A;  1USB A;  1GTB A;  3L9U A;  4CHS A;  3MYD A;  3EWL A;  3A5W A;  1T1V A;  5DQS A;  4K7N A;  4IP6 A;  1U87 A;  4KF9 A;  5GSS A;  5IOW A;  5CRH A;  3C73 A;  3C8E A;  1WPI A;  1CQG A;  1I5G A;  2CVD A;  3MNG A;  3IXR A;  5L71 A;  6GSS A;  3V1W A;  4MLY A;  5G1K A;  5HR3 A;  3KZQ A;  2L59 A;  2IFQ B;  3C7M A;  3VPT A;  4I8B A;  4ZBA A;  1K3O A;  2R6K A;  4KSM A;  2AHE A;  2YWN A;  4ID0 A;  5J5N A;  1A24 A;  3ED3 A;  5D9X A;  3KTL A;  4RUV A;  1GH2 A;  1SKS B;  3HKR A;  4JR6 A;  3D5J A;  2KP1 A;  4XS4 A;  4MJC A;  1GSQ A;  4YKF A;  2B3S A;  4POB A;  11GS A;  3BCI A;  3M9J A;  2KLX A;  2OE3 A;  3RBT A;  2HSY A;  2FHE A;  4TR4 A;  3TRP A;  3TKR A;  1AXD A;  4XRD A;  5F0G A;  1Z5Y E;  4KCE A;  5ECO B;  4FQU A;  5HFI A;  4MA9 A;  4OCF A;  3FRC A;  3TJF A;  2R5G A;  2V1M A;  3P8W A;  2HZE A;  5IQY A;  2VD1 A;  4K7O A;  2H1B A;  1MTC A;  1K0A A;  4BVY A;  4TR1 A;  4BVX A;  3VUR A;  4HJ2 A;  3SBC A;  1YF0 A;  1EP8 A;  4I6X A;  2MMA A;  3E9J B;  2DBC A;  4K0N A;  4ML6 A;  2WCI A;  2IIY A;  1G7E A;  1OAZ A;  5G30 A;  2GQM A;  2YP6 A;  13GS A;  1EOG A;  2YPM A;  1Q98 A;  2IMF A;  3QFA C;  5FWG A;  1ST9 A;  3EMX A;  1K0C A;  3DYR A;  2M46 A;  1BG5 A;  2JSZ A;  5LNK e;  1O85 A;  1J08 A;  2VAF A;  3FEU A;  5AIS A;  3IRA A;  2A2P A;  4IW9 A;  2OBI A;  3E0U A;  3LEF A;  3QAW A;  4ZL9 A;  3MDK A;  2H70 A;  5IO0 A;  4MCU A;  1JLV A;  3KEB A;  3CTF A;  4WBJ A;  3N9J A;  2E2G A;  2OAD A;  1GSF A;  2R0G A;  1PL2 A;  2C8U A;  2CAQ A;  3IAS 2;  3IV4 A;  3ZFL A;  5ECI B;  3IC4 A;  1CQH A;  1GL8 A;  3LFL A;  3DIE A;  3KH7 A;  3TKQ A;  2OJL A;  2F3M A;  4K2D A;  3ZIV A;  5ABR A;  1B8X A;  3UVT A;  3A2X A;  2CA8 A;  1PKW A;  3O76 A;  3WGE A;  5CRW A;  2FCH A;  3M9K A;  4PUF C;  1XWK A;  2H6Z A;  4KDU A;  1XWC A;  3EIN A;  5G31 A;  4Q5R A;  1YQ1 A;  2VD0 A;  2JZR A;  2PN8 A;  3KM6 A;  3QAV A;  2JZT A;  4HS1 A;  2K18 A;  20GS A;  1T4Z A;  4F9Z A;  4L8E A;  2KP2 A;  4HZ2 A;  5B8A A;  2RUF A;  3FR3 A;  4WF4 A;  2YWM A;  2X8C A;  3FYG A;  4YAV A;  5CRG A;  2DJJ A;  4OWY A;  3IK9 A;  2QA2 A;  3A2W A;  2LQO A;  5EVO A;  4N10 A;  1ZZY A;  2NPB A;  3MSZ A;  1OKT A;  2CVB A;  1T8E B;  1OKD A;  4JZQ A;  1U3A A;  5IPH A;  4EKZ A;  5HFK A;  2Z9S A;  1AQV A;  2RM5 A;  1Z6N A;  3GKK A;  3DXB A;  2HLS A;  3WD6 A;  1AW9 A;  4QQ7 A;  5IOX A;  2F8A A;  4OO5 A;  1NHY A;  1SL1 B;  3FMW A;  4J56 E;  4EC0 A;  2HSH A;  4TXV A;  3D21 A;  3HVX A;  1SD9 A;  1TRV A;  1SYR A;  2L4Q A;  1RK4 A;  4RI6 A;  3R3E A;  3CBU A;  1EV9 A;  1ERW A;  2LJA A;  1DSB A;  1XW5 A;  4TXO B;  2GDR A;  1AQW A;  5GST A;  3VPQ A;  3R2Q A;  2VM2 A;  4IBP A;  4MPG A;  2LQQ A;  3IDV A;  2H1G A;  5IMC A;  5IM9 A;  2PVO C;  1K0D A;  3EU3 A;  2YN1 A;  4N0Z A;  2D2Z A;  4AGS A;  2IFQ A;  1TXX A;  3UOM A;  5KEJ A;  4X0X A;  1O73 A;  3GIX A;  2LJK A;  1HD2 A;  2RUE A;  4MZC A;  5KN3 A;  1UVZ A;  2MZC A;  5FHI A;  2VL2 A;  3GKX A;  1GNE A;  3A5I A;  1TRS A;  3IHQ A;  2H0H A;  3PH9 A;  4YQV A;  2B5E A;  3DML A;  3BCK A;  4LL4 B;  3GKN A;  1A2J A;  4HQS A;  4GSN A;  3EU4 A;  4ZBD A;  2J9H A;  3VWW A;  3ZVJ D;  3I69 A;  3F8U A;  1M0U A;  2EIQ A;  4IS0 A;  1FB6 A;  5B6M A;  3HYP A;  2YOI A;  1YDK A;  2DIZ A;  4PQ1 A;  3FR9 A;  1DBY A;  2AJQ B;  2OBK A;  4PUA A;  2JAD A;  4MMM A;  2LTK A;  4N11 A;  4GST A;  5D73 A;  3VI7 A;  3DRN A;  5ECS A;  1WJK A;  5E4W A;  3QMX A;  2WGR A;  2VLT A;  4NWY A;  3QCP A;  3FZ5 A;  3GMF A;  4NV2 A;  1GSS A;  3P7X A;  3QFB C;  2LRC A;  3IPZ A;  4ZL7 A;  1H4O A;  1NSW A;  3IA1 A;  2VM1 A;  1PX7 A;  3FZ4 A;  1FO5 A;  5A4W A;  3G7I A;  3Q74 A;  2NBS A;  4OFT A;  4KB3 A;  2OA7 A;  2IMD A;  4ECJ A;  4ZIL A;  3C71 A;  12GS A;  6GSW A;  5FT3 A;  4FYB A;  1WMJ A;  5DAK B;  1UN2 A;  4V2L A;  1LU4 A;  3ZRD A;  1O8X A;  5J41 A;  1FB0 A;  3KP8 A;  3C1R A;  2VCV A;  2YZU A;  3HJM A;  2EC4 A;  1VF1 A;  2VL3 A;  2G0F A;  1V98 A;  1OC3 A;  4TR0 A;  1S3A A;  2VCW A;  4YQM A;  5KOX A;  3KXO A;  1G6W A;  1TU7 A;  2IN3 A;  4EL1 A;  3TJB A;  2WJU A;  2P5Q A;  2H8L A;  2HT9 A;  2BJX A;  4BL7 A;  3LOR A;  5LCZ A;  3KMO A;  2DKI A;  1PN0 A;  2LRT A;  3HXS A;  3TCO A;  2N5B A;  1OC9 A;  4OO4 A;  5J4U A;  5HR1 A;  4ZBB A;  1QFN A;  5E59 A;  5G5E A;  4JED A;  1R7H A;  3GYK A;  4XTS A;  4J2F A;  4L5L A;  2YCD A;  4IQ1 A;  4E8E A;  2LUS A;  1J9B A;  3TGZ A;  1ZOF A;  1SK1 A;  4YQU A;  2I1U A;  3D4T A;  3GTU A;  1XOB A;  3I6A A;  1TW9 A;  4TOP A;  4CY6 A;  5GZZ B;  5JCG A;  3FHK A;  3FZA A;  1M99 A;  2LV3 A;  1U88 A;  1SEN A;  2IWT A;  1ZYE A;  3ZZX A;  1X9S B;  1A8L A;  1GUK A;  4TW5 A;  5D96 A;  3IBH A;  4Q5Q A;  4Q5N A;  3FW2 A;  3ISO A;  1GLP A;  2H0G A;  3CYN A;  4FIW A;  2C0F A;  3LGC A;  3UBL A;  2H30 A;  3W8S A;  4Z7X A;  2IMK A;  1ABA A;  22GS A;  3APO A;  3F6D A;  5DAL A;  4ULX A;  3GNJ A;  1XOA A;  3N5O A;  4AJ7 A;  3LXT A;  2L6C A;  2NVL A;  3HY2 A;  1XXU A;  2XHF A;  5AIV A;  1PSQ A;  5ECK B;  2DML A;  1JZR A;  3FY7 A;  4HOJ A;  4ILF A;  3IR4 A;  3GST A;  4F0B A;  1EGO A;  2O87 A;  1JLW A;  1MDK A;  2FWF A;  4ICY A;  1I9D A;  2C3N A;  4NAX A;  1VF3 A;  2J23 A;  3RAZ A;  4KDY A;  4JU5 A;  3KCM A;  2B7K A;  2K6V A;  1ZGN A;  4TXO A;  3NOF A;  3ZIJ A;  1X5C A;  2M80 A;  1FHE A;  2LST A;  1H75 A;  1YZX A;  3UVH A;  4KUN A;  2H72 A;  4NMU A;  4FO5 A;  1X0R A;  2XC2 A;  1HQO A;  2CZ2 A;  4PNF A;  1TI3 A;  1A23 A;  4V1A g;  3ZML A;  5DBQ A;  2F8F A;  2IME A;  2JL4 A;  2HZF A;  2VCX A;  5J9B A;  4MJB A;  4E8H A;  5H5R A;  1U6T A;  4ZL8 A;  2R0C A;  3EE2 A;  3J7Y k;  1SL0 B;  1XPV A;  4GLT A;  3EUR A;  1VF4 A;  3L4N A;  3HZ4 A;  2FA8 A;  1GTU A;  2R0P A;  1Q4J A;  4FYC A;  3I43 A;  1K0B A;  2PER A;  2H73 A;  5F05 A;  3A2V A;  5EL8 A;  4F03 A;  3MIX A;  1WOU A;  2P5R A;  3QD9 A;  3GA4 A;  5CNW A;  4MJA A;  3D22 A;  1GSD A;  3BOA A;  3APQ A;  4OD7 A;  1PD2 1;  2DSA A;  2YNX A;  1VGL A;  4V2M A;  5ECQ B;  4MH3 A;  1ZMA A;  2MBT A;  2DJK A;  4I5Q A;  3Q18 A;  2B6M A;  1TOF A;  3AY8 A;  5CRD A;  1MDI A;  4WXT A;  1XZO A;  1YJ6 A;  3IOS A;  1AAZ A;  2H1D A;  2F51 A;  4PNG A;  4OMV A;  3ME8 A;  4PQI A;  3L9V A;  1V2A A;  2C3Q A;  3HZ8 A;  3BJ5 A;  6GSU A;  1QGV A;  1M9B A;  1XWB A;  4OFN A;  3LYK A;  4O92 A;  1Z3E A;  5HR2 A;  1EOH A;  1GUL A;  3TJJ A;  2CT6 A;  2FWH A;  2H6X A;  4MDC A;  3PGT A;  1E2Y A;  2WRT A;  4KSO A;  1J0F A;  4I97 A;  1ZL9 A;  2O7K A;  4DSR A;  1EZK A;  2H66 A;  3RPP A;  4LMW A;  4K2X A;  1EEM A;  5DAK A;  2I9H A;  4XS1 A;  1O81 A;  3US3 A;  4EDZ A;  3GN3 A;  3TJK A;  4K5S A;  1HNA A;  2PBJ A;  1TTZ A;  1NM3 A;  2V6K A;  1VF2 A;  3F4S A;  4GSS A;  3ZRE A;  1PQN A;  2A4V A;  3JCM L;  3RDW A;  3TKS A;  4PX1 A;  2A2R A;  2GSQ A;  5H5Q A;  2PU9 C;  2I3Y A;  1GLQ A;  4DSQ A;  3F3Q A;  2HFD A;  2CZ3 A;  1A8Y A;  1B4P A;  3ZYW A;  3QR6 A;  1AQX A;  2PPT A;  3ZVJ A;  1JZO A;  1JZW A;  2OE1 A;  3W6G A;  1KTE A;  3MWH A;  2UZ8 A;  4MAB A;  3ERG A;  2H74 A;  3W8J A;  3GV1 A;  1SYX A;  2BMX A;  3ERW A;  3UMA A;  1U3I A;  2CAI A;  5CO3 A;  2KOK A;  3KJY A;  1X9M B;  2I81 A;  2B5Y A;  2MYG A;  2LEG A;  1QXH A;  1DUG A;  2L5L A;  4NHW A;  14GS A;  1V40 A;  2FWE A;  1KEB A;  2V32 A;  2WFC A;  2R2J A;  4TVE A;  2FWG A;  3EPT A;  3F3R A;  3KIJ A;  4IQA A;  4KDX A;  1MD4 A;  2P0G A;  3GSS A;  1BX9 A;  4WR4 A;  1FAA A;  4MK3 A;  4BA7 A;  2PWJ A;  4EIQ A;  5DJL A;  4QL9 A;  3GL5 A;  1EEJ A;  3H8Q A;  1B48 A;  4PGT A;  3KD0 A;  4I2U A;  3DEX A;  1R4W A;  3DVX A;  5F07 A;  4MH2 A;  5IMF A;  1GSU A;  4PXO A;  3VK9 A;  2L57 A;  2MMO A;  3HJP A;  1GP1 A;  3C1S A;  1PN9 A;  4DSS B;  5AIX A;  2CV4 A;  4L0W A;  5D8I A;  2B1L A;  1XBS A;  4KND A;  5IMZ A;  2CX4 A;  3CRT A;  2GQK A;  1YEP A;  3F63 A;  2GTU A;  4EUY A;  2IL3 A;  1Z9H A;  2O85 A;  2GQL A;  5KN0 A;  3TOT A;  1ERV A;  3U5R E;  2RM6 A;  1TKD B;  3A3T A;  3G7J A;  2DIY A;  3UJ1 A;  2QC7 A;  2EIO A;  3LYP A;  5KOW A;  3D0Z A;  3ZL5 A;  4EF0 A;  2X64 A;  3M1G A;  2WUL A;  4G0K A;  3UIW A;  3J7Y b;  3GKM A;  3LSZ A;  1RQM A;  1G7O A;  3ME7 A;  1LJR A;  2V2G A;  3HDC A;  3H1N A;  4FH8 A;  3GUR A;  3UAR A;  3EYT A;  3FZ9 A;  3HHV A;  3H4K A;  2IJY A;  2XBI A;  3I9V 2;  1MD3 A;  5B8B A;  1X9W B;  6GSX A;  3F0I A;  1S3D A;  1QMV A;  1BJX A;  4ACS A;  4HUA A;  1GTI A;  4XS4 B;  3IHG A;  4IEL A;  2VLU A;  3P90 A;  4GTU A;  5ECN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...