1GRXA

Structure of e. coli glutaredoxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYSVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
pubmed rcsb
molecule keywords GLUTAREDOXIN
molecule tags Electron transport
source organism Escherichia coli
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1993-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1grxA00
4ACSA 1B8XA 2B5YA 4EE0A 5CRHA 1T00A 1B4PA 2NTOA 1VGLA 3C73A 1BG5A 1TU7A 2H72A 1SK1A 3GKNA 3QPMA 4IS0A 4NAXA 2V1MA 2VL3A 2B5XA 2YP6A 4GTUA 4WR5A 3CXGA 2VAFA 5H5QA 2VL9A 4OO5A 4HQSA 3LYKA 2CV4A 5CO3A 1FOVA 2E2GA 2WRTA 3MSZA 3KTLA 3TJFA 1GUHA 3VPQA 3ERFA 2C3TA 5ELAA 3FZ4A 4MA9A 3A2WA 1B48A 4MCUA 1FVJA 3GH9A 3GRXA 1GSDA 2E2MA 3UARA 1WP0A 1FO5A 3KZQA 3GIXA 1X9WB 1XW5A 2MMOA 3RDWA 3O76A 1OE7A 1V58A 5G1KA 4PUFC 4O32A 2D2ZA 2KUCA 4I6XA 3GH6A 5GZZB 4L5LA 17GSA 3IK9A 3FR9A 2CVKA 1H4OA 3KMOA 4EXJA 4N30A 1JZWA 4OD7A 1ERVA 1OAZA 4HU9A 3IA1A 4GLTA 3UJ1A 5EVOA 4IHUA 4V2MA 1MDIA 3VI7A 4MABA 4BWQA 3A2XA 4JU5A 3ISOA 3JCML 4MZBA 3TGZA 2VOCA 1GUMA 4KA0A 2E0QA 2PMTA 1XVQA 3HHVA 3D6IA 4ULXA 2X8CA 3W6GA 1PMTA 2LV3A 1GRXA 2HSYA 3I43A 2XBIA 5IMZA 4X0XA 1SKSB 5ENUA 2WFCA 3EINA 4DEJA 1GSYA 4ZB8A 5COHA 4AJ7A 3ZMKA 1SYXA 1XBSA 3ED3A 4J56E 2PGTA 4ECIA 4OO4A 1M9BA 3WGXA 1GSUA 3H4KA 4POMA 3A2VA 1Z3EA 1V9WA 3KGKA 2DIYA 3IRAA 2NBSA 3VWUA 3LYPA 1VF3A 5KN0A 1ERTA 3KMNA 2FHEA 2J9HA 3P2AA 1DSBA 4WF4A 2AHEA 1A0FA 4ECCA 3KTBA 3MWHA 3W8JA 2LUSA 4PQIA 2DLXA 2JZSA 2L5LA 4IVFA 3VFIA 5L71A 1IYIA 5ECSA 1TKDB 1FHEA 2P5QA 4WEYA 1AAZA 1Q4JA 5DALB 4RI7A 1QFNA 1ZGNA 1QGVA 3KP8A 3FZ5A 4BVXA 2GT6A 3VLNA 1MTCA 1EV4A 1O6JA 2ALBA 2KOKA 2VD1A 3O6TA 1RW1A 3PH9A 3ME7A 3HJMA 2PVOC 2I3YA 3CRTA 4Q5RA 1FG4A 4XCSA 3HJPA 3ZIVA 5DALA 3ZYWA 5F8BA 3HXSA 4NV5A 2L4QA 4O5RA 1A0RP 3O3TA 2A2SA 1M9AA 1GL8A 1A24A 2VM1A 4ZB9A 5IOWA 2LSTA 5INYA 3DVXA 3ZFBA 2GZPA 4J57E 3EC3A 5HFIA 1EV9A 3M0FA 2OA7A 3LXZA 4MK3A 5EPFA 4TR3A 3H79A 1O85A 2H1DA 3TCOA 5A4WA 2HFDA 2IWTA 1OE8A 5D9VA 3LSZA 5ECMB 2QKEA 5J41A 3J7Yb 4G9HA 4TXVA 3D4TA 3LG6A 4GSNA 1C72A 2LQQA 2WB9A 5DQSA 5FT3A 4I5QA 3U6VA 2BMXA 3BBYA 5EL8A 4KNDA 4ZIJA 4MMMA 1FVKA 3HA9A 1Z5YE 4OCFA 4OMVA 4PXOA 11GSA 2CVBA 1PQNA 3WGDA 3GSSA 3UMAA 3HCZA 4TR0A 2LNTA 4MZCA 4I2UA 3F8UA 1KTEA 19GSA 4ECBA 1JHBA 1PX6A 3HVSA 2PERA 1MEKA 3TKSC 4KDXA 3ZIJA 4WKWA 3TOTA 2YZHA 3TJGA 3KEBA 4MJCA 2LEGA 3WD6A 2L6DA 4NV2A 2TIRA 4OFNA 2GDRA 1NHOA 3L4NA 3TJJA 2MMAA 2H6YA 5D8IA 2FWHA 3WT1A 3GNJA 4Q5NA 3EU3A 1SKWB 3UIWA 5JCGA 4ZBDA 2B6MA 1XWGA 4WXTA 4LMWA 2HSHA 3GKKA 1SJIA 4XHMA 4LA1A 4XRAA 4HZ4A 2C8UA 2VO4A 3UBLA 4MJEA 2JACA 2HT9A 4K0GA 5IO2A 4HS1A 4OWYA 2XHFA 5F05A 1GLQA 2L5OA 2YJHA 3HD5A 4V1Ag 5F07A 3UBKA 1YF0A 3VPTA 4WF5A 4DVCA 1EWXA 4TR1A 4FH8A 5G31A 1TTZA 2X8HA 3UL3A 1DE1A 1PKZA 5DCHA 1YEXA 1DUGA 4K7OA 4KCAA 1Z6MA 4K2DA 2DC5A 2MYGA 4IQAA 1M99A 1K3YA 5DQYA 1VRSD 4EL1A 1RK4A 2GSTA 8GSSA 3LORA 1MDJA 3IHQA 4V2LA 3TKSA 1HNBA 1Z7PA 4HJ2A 2G0FA 2H8LA 2O7KA 4KAEA 2XBQA 4XIHA 2GTUA 1A2LA 3FZAA 4IGJA 4K6XA 4ML6A 1UVZA 2L57A 1ZZYA 2R2JA 1XOAA 5ECLB 3QAWA 2GT5A 4DSRA 1GUKA 1TDIA 3E3EA 5IMAA 2FY6A 3APQA 3CSJA 3DGQA 3BD2A 1BJXA 3M1GA 2K8VA 1GSSA 2VD0A 3RHBA 3D4MA 2C0FA 2R3XA 1TOFA 4DSSB 2REMA 3BOAA 3KM6A 5J5NA 5J9BA 1TP9A 1V40A 1OC9B 4EO3A 4HOJA 2VL2C 2NPBA 2OE0A 1XPVA 4CDOA 3FRCA 5ELGA 3M8NA 1T8EB 3GTUB 2C3NA 1U3AA 2LTKA 4F9ZA 1XXUA 4ZBAA 3WT2A 2CT6A 4NHWA 3F3QA 1AQVA 4KCEA 2DIZA 1F37A 1WIKA 3QOUA 2KLXA 4MJAA 4BPYA 1M2AA 3Q18A 2AB6A 2B7JA 2VCVA 3A3TA 4MF5A 3D5JA 3GKMA 2WJUA 5CRDA 5IPHA 1GULA 1SENA 3PINA 1EZKA 2YWNA 2JL4A 5IM9A 1LU4A 3QD9A 1G6YA 3GTUA 2CQ9A 4KSMA 1G7OA 2I1UA 4MZWA 4ZBBA 2OADA 1FB0A 4XRDA 1SL0B 2EIOA 2H66A 4IN0A 5GSSA 2YWIA 1YQ1A 1T1VA 2C0EA 1AC1A 3RAZA 3QFAC 1JZDA 4MDCA 2DJKA 3QMXA 5IMFA 4OFMA 4OCEA 5D93A 1YEPA 3I69A 3CSIA 1K3LA 2OBKA 4TXOB 4MH2A 3CRUA 2IIYA 1TI1A 4QQ7A 2VL2A 5G5FA 1PA3A 2K6VA 1Z9HA 3Q19A 2MBTA 3IXRA 3TRXA 1Y25A 1ABAA 3NIVA 3US3A 1PSQA 5AGYA 1R5PA 2YWOA 3CSHA 4MJBA 5IPGA 2LKUA 2QGVA 2GVPA 4K8MA 2P31A 3WYWA 4RQRA 2JSZA 3ZREA 3GA4A 4PQ1A 3CBUA 4D73B 2FWGA 5EY6A 3UAPA 2GLRA 3HY2A 2FLSA 3VWVA 4FYBA 1R7HA 1XWAA 1F3BA 2AUVA 4ID0A 4NWYA 2HXKA 5CYYA 5HR0A 14GSA 4RI6A 1AUCA 2C3QA 2VIMA 3R2QA 2QSIA 2YZUA 6GSVA 2C80A 4V2NA 3ZRDA 2HRFA 2ES7A 1SL2B 1IYHA 2YV9A 3GMFA 2TRCP 5A4VA 5KEJA 5LCZA 3HJOA 2N5AA 3FR6A 4N0VA 6GSWA 7GSSA 4PUAA 5B7CA 4LLRA 2FWEA 4I97A 2HRNA 4EKZA 1U6TA 3G9BA 4GQFA 3GURA 1TXXA 1K0BA 3MDKA 1MD3A 2CZ3A 1U87A 3MNGA 3H8QA 1EOGA 2X8GA 4JBBA 3ZITA 4YH2A 1F3AA 1GTIA 4KDUA 2V2GA 1USBA 4PX1A 4ZILA 4IP1A 1GSEA 1B9YC 1BQ7A 2OKAA 4G2EA 3DMLA 2DBCA 2B3SA 3PGTA 5ECOB 2PWJA 3DKSA 2H73A 4WR4A 5C04A 4QL9A 6GSXA 3LQ7A 5FHIA 2H30A 5ABRA 3IOSA 6GSYA 1VF2A 5ECQB 4EDZA 2A2RA 3APOA 4GRFA 3ZFLA 3F0IA 1N8JA 3UVHA 1TRUA 1WJKA 1S3CA 2P5RA 2HZEB 1K0AA 3ME8A 9GSSA 1EP7A 2CZ2A 2GQMA 3D0ZA 2RUFA 4F0CA 2FA4A 3TOUA 1XW9A 3F9UA 4PNGA 1PL2A 3EE2A 2CA8A 2H70A 2XPDA 1O7UA 5AISA 4BA7A 2IFQB 1URMA 4KB3A 1A8LA 3P90A 1TRWA 2FGXA 4IJ3A 4L8EA 1GLPA 1XWCA 2RM6A 3C8EA 3D22A 6GSSA 1UN2A 3FKFA 4CW9A 4JE1A 2PN8A 2CX4A 1WOUA 1DBYA 2OJLA 3M9JA 2WGRA 2IFQA 4MF7A 3G7IA 4JR6A 2H0IA 2C1YA 1ERWA 5CP1A 3DIEA 2V32A 5AIVA 1M2DA 2AJQB 4JR4A 3F6DA 3TKSE 5HQPA 2YV7A 1BYEA 1OKTA 4ECJA 3TUEA 2BTOT 2VLVA 3P7XA 1T4ZA 5A4UA 5IO0A 3HDCA 2PPTA 1W4VA 5IMDA 2DJ3A 1X9MB 3Q6OA 2C4JA 2LQOA 4NXIA 4BVYA 1AXDA 2RLIA 3AY8A 10GSA 2FNOA 1EP8A 5JCUA 3QFBC 5G1LA 5C00A 2BJXA 1BEDA 2NDOA 3QAVA 2PU9C 3WGEA 2GSSA 2V6OA 2N5FA 2O87A 3IAM2 2HI7A 1NHYA 1G6WA 2R5GA 2C0GA 2GGTA 3IV4A 5D73A 2CAIA 2GQKA 2HE3A 2RM5A 1PN9A 3U5RE 2JZTA 3C7MA 3ERWA 3EMPA 4NHZA 1XOBA 3LWAA 5DAKB 5DDLA 1YJ6A 2IL3A 2OE1A 1GWCA 2I81A 4GQCA 3F4TA 1SKRB 1KBNA 1ST9A 1SYRA 1EGOA 1FB6A 5DJLA 1NW2A 4JRRA 3DEXA 2EIRA 1SL1B 2H1GA 2FUG2 5GAPD 1V2AA 2LNSA 3D21A 2FCHA 3VURA 4NPBA 1YF1A 3PR8A 2VCTA 1ZOFA 1K0NA 1PGTA 3QDNA 4IJIA 5F06A 4KX4A 2IMEA 3C1SA 3EU4A 2MMNA 2YCDA 1ZYEA 3EYTA 1X0RA 5F0GA 2KP1A 1VF1A 5FWGA 1QUWA 4N11A 1ZMAA 4F0BA 4K9ZA 2VCXA 5ECNB 2VLUA 3UVTA 2M46A 3KJYA 2CAQA 2OBIA 1SK2A 4AJ6A 3L9SA 2F8AA 2H1AA 4KUNA 3F63A 1XWKA 1J0FA 4N0ZA 1G0TA 2IJYA 4X43A 3P8WA 3I9V2 1S3AA 3G7YA 3IBHA 4LMVA 2DSAA 1K0OA 1WWJA 3ZL5A 1A23A 2LJKA 1K0CA 2R6KA 4G19A 4WBJA 1XW6A 4HUAA 3QAGA 3GHAA 4QL7A 3TKQA 3N9JA 1K0MA 3HKRA 1GSFA 1ML6A 2YANA 1TU8A 5B6NA 2M72A 2F8FA 2PUKC 4E8EA 1RQMA 3E9JB 4TKYA 5J4UA 1V57A 4JEDA 4HZ2A 2A4VA 1BX9A 5G2ZA 3DXBA 3ZVJD 1AW9A 2B5EA 3OR5A 2V41A 2H0GA 2DMLA 3IAS2 4FYUA 1R4WA 1UA5A 3CTGA 3CYNA 2EIQA 4HQZA 5HR3A 4XS6A 3S9FA 5CRGA 1GTAA 2H6XA 4BWSA 3KH7A 4DSSA 2P0GA 1EGRA 5LD0A 3KD0A 5A5KA 2E7PA 4X1UA 1GP1A 6GSUA 1OC9A 4K0NA 5KN3A 5JWQB 5DVBA 1TI3A 3TKPA 1JLWA 4E8HA 3FW2A 1ON4A 2HNLA 2XC2A 2VCZA 3RBTA 4K7NA 3F6FA 3NOFA 5ECRB 1TJDA 4XTSA 1XCCA 2YPMA 4KGIA 2WS2A 4GCIA 1LJRA 1J08A 2VUPA 1XIYA 1O81A 4MF6A 1YKCA 1WE0A 5DJMA 4L0UA 3NZNA 3DRNA 5IIZA 2HZFA 2O85A 4KH7A 1ILOA 3DWVA 4F82A 1T4YA 5KN1A 1Y6EA 1T3BA 1B9XC 1K3OA 1HNCA 2PVQA 4IKHA 4F03A 4F2IA 2L6CA 3TDGA 4WETA 1QQ2A 1U88A 2RUEA 1Q98A 1W89A 4ILFA 1GTUA 4K7IA 4YQVA 4FYCA 1Z6NA 2VM2A 3GX8A 5B6MA 3F4RA 2B1LA 2R37A 1K0DA 1THXA 2AV4A 3W8SA 5CAXA 4TXOA 4MPFA 2L4CA 5HR2A 3IDVA 4JZQA 5JWRB 3KXOA 3TB2A 4HI7A 4HDEA 4ML1A 1Z7RA 3VK9A 2H71A 1NM3A 5DBQA 20GSA 3EURA 2YNXA 3CMIA 2I9HA 2DJ0A 3K8NA 1EEJA 3SBCA 5IMVA 1AQXA 2O89A 2FA8A 5ECHB 3ZZXA 3DVWA 4AGSA 1CQGA 1OVNA 1B4QA 1O73A 2GZZA 1JLVA 4D73A 1XWBA 5ECKB 4J2FA 5B8BA 2LJAA 2V6KA 3APSA 5ECIB 1GSQA 1OC8A 2Z9SA 3IPZA 3TKRA 2AYTA 3HZ8A 2WULA 3MAKA 4GF0A 3FHKA 3L9VA 2G2QA 1FW1A 1OKDA 2DJJA 4O7HA 3FZ9A 1KNGA 2GSQA 4KW6A 2H6ZA 4ZL8A 3GSTA 3TRPA 2B7KA 2GQLA 4POKA 4HEA2 2GS3A 3I6AA 3GL5A 4ZL7A 5GAND 1G7EA 4CHSA 2WCIA 1NSWA 2F51A 4GSTA 2YJ7A 1A8YA 3L78A 4YQUA 3BCIA 3HZ4A 4DSQA 1OYJA 4WBRD 2F9SA 1YY7A 1JZRA 1XVWA 1VF4A 2C0DA 1TW9A 4Z7XA 3FYGA 1HNAA 5IMCA 2L59A 2IPAA 3VWXA 12GSA 1YKAA 3ZVJA 5B8AA 13GSA 4K1FA 1AIUA 3F3RA 4IBPA 4PNFA 2DJ2A 4EF0A 3VWWA 1TK0B 1F9MA 1UC7A 3QR6A 4LL1B 1E6BA 4G10A 3HVVA 5D96A 3GUSA 2IN3A 2VCWA 5CREA 4GWRA 1F2EA 1QXHA 2YN1A 4P3YB 1QMVA 3EWLA 2CX3A 4O92A 3BJ5A 1PD21 2CVDA 2VCQA 2WDUA 3H93A 1GNEA 2FD3A 1JFUA 3G7JA 4PURA 1HYUA 4IW9A 2KHPA 4GXZA 3FEUA 1EOHA 4EUYA 1XFLA 3TJKA 1PX7A 2HZEA 2JSYA 4MP4A 1HD2A 2IMKA 5JWOB 1V98A 4TR4A 5E59A 2NVLA 1ZL9A 1T7PB 4KDYA 3RHCA 3GX0A 3DYRA 2O8VB 5HFKA 3F4SA 5LNKe 2M80A 4HJMA 4RUVA 2H1BA 3EVIA 1SJ6A 2K18A 1O8XA 4EDYA 3GFKA 3LXTA 1M7TA 1F6MC 2H01A 1WRYA 1I9DA 4EC0A 1I5GA 1CQHA 2MMZA 2ZNMA 1XZOA 1YDKA 3KIJA 2ZUPA 1TK8B 5KN2A 5GSTA 4IELA 5J3RA 1J9BA 3TRQA 4H86A 5AN1A 4XS4B 4YAPA 5JCWA 4ZB6A 3EMXA 5ID2B 4ISDA 2ON5A 3ERGA 2EC4A 2LRCA 3ZMLA 2TRXA 2FWFA 5H5RA 4V1Ap 2MZCA 1PRXA 3L9UA 1BAYA 5E4WA 5HR1A 4GSSA 3RPPA 1X9SB 1X5DA 3J7Yk 2YWMA 4MH3A 1M2BA 2X99A 3HYPA 1ACVA 5CRWA 2X64A 4AF2A 2RIIA 4XS4A 2H19A 2J23A 3C1RA 4HU7A 3FR3A 5ID2A 1SD9A 2I4AA 5D9TA 3E0UA 3GYKA 1A2JA 4MPGA 2AAWA 5D9XA 1X5EA 4NMUA 5J9CA 16GSA 5HFGA 2K9FA 1GH2A 2JADA 1SU9A 2GSRA 5IOXA 4IP6A 1E2YA 3C71A 2H0HA 4Q5QA 4MLYA 3UOMA 4L0WA 4AJ8A 4TR1B 3A5WA 1TRVA 1U3IA 4ZXGA 4BL7A 3H1NA 3V1WA 1SJZA 3IK7A 2ON7A 4TN8A 3FY7A 3GN3A 4Q5FA 5ECPB 3KP9A 2LS5A 3M3MA 5H5SA 2IMFA 1GNWA 4I8BA 4KE3A 5DAKA 4YAVA 1ERUA 2MBSA 1SD8A 2IMDA 4YQMA 22GSA 1M0UA 4POLA 2LRNA 2DJ1A 1TK5B 3UEMA 3GV1A 1HQOA 4TOPA 2DMMA 3N5OA 1A2MA 3LEFA 4PGTA 2LRTA 4TRXA 5G30A 1PL1A 2IMIA 2QC7A 2N5BA 1R26A 1PKWA 4RQXA 3FK8A 2ZCTA 1TRSA 5DCGA 2OE3A 3ZTLA 5AIXA 2H76A 3CTFA 5G5EA 3BCKA 2H75A 2OACA 1DE2A 1S3DA 1LBKA 2GZYA 2JU5A 3DD3A 4FO5A 3SWLA 2XPEA 3GL3A 3RPNA 1H75A 1QK8A 4XS1A 4ZL9A 1X5CA 4FIWA 3KCMA 3ZLPA 4KSOA 1THOA 3TJBA 2HLSA 3QCPA 1MDKA 3KH9A 3IE3A 4POBA 2KP2A 4EVMA 1KEBA 2F3MA 3LFLA 3IC4A 1YZXA 4LL4B 4TVEA 5IQYA 1R5AA 1ZYQB 1N2AA 1AQWA 1O8WA 4N10A 1OC3A 4L5OA 4OFTA 4I2TA 5CNWA 5D9WA 4PQHA 18GSA 4IQ1A 2K8SA 3IR4A 4TW5A 2PBJA 2JZRA 3L0HA 1SK0A 1JZOA 1FAAA 3HVXA 3VI5A 1MD4A 1GTBA 2R4VA 2VLTA 1WPIA 3LGCA 2H74A 3Q74A 3LJRA 2B1KA 2LJRA 3GKXA 1EEMA 2HYXA 6GSTA 3M9KA 2WZ9A 1ZCPA 1WMJA 2YOIA
chains in the Genus database with same CATH superfamily
4ACSA 1B8XA 2B5YA 2DKHA 4EE0A 5CRHA 1T00A 1B4PA 2NTOA 1VGLA 3C73A 1BG5A 1TU7A 2H72A 1SK1A 3GKNA 3QPMA 4IS0A 4NAXA 2V1MA 2VL3A 2B5XA 2YP6A 4GTUA 4WR5A 3CXGA 2VAFA 5H5QA 2VL9A 4OO5A 4HQSA 3LYKA 2CV4A 5CO3A 1FOVA 2E2GA 2WRTA 3MSZA 1S3RA 3IHGA 3KTLA 3TJFA 1GUHA 3VPQA 3ERFA 2C3TA 5ELAA 3FZ4A 4MA9A 3A2WA 1B48A 4MCUA 1FVJA 3GH9A 3GRXA 1GSDA 2E2MA 3UARA 1WP0A 1FO5A 3KZQA 3GIXA 1X9WB 1XW5A 2MMOA 3RDWA 3O76A 1OE7A 1V58A 5G1KA 4PUFC 4O32A 2D2ZA 2KUCA 4I6XA 3GH6A 5GZZB 4L5LA 17GSA 2R0CA 3IK9A 3FR9A 2CVKA 1H4OA 3KMOA 4EXJA 4N30A 1JZWA 4OD7A 1ERVA 4K5SA 1OAZA 4HU9A 1M3IA 3IA1A 4GLTA 3UJ1A 5EVOA 4IHUA 4V2MA 1MDIA 3VI7A 4MABA 4BWQA 3A2XA 4JU5A 3ISOA 3JCML 4MZBA 3TGZA 2VOCA 1GUMA 4KA0A 2E0QA 2PMTA 1XVQA 3HHVA 3D6IA 4ULXA 2X8CA 3W6GA 1PMTA 2LV3A 1GRXA 2HSYA 3I43A 2XBIA 5IMZA 4X0XA 1SKSB 3IC8A 5ENUA 2WFCA 3EINA 4DEJA 1GSYA 4ZB8A 5COHA 4AJ7A 3ZMKA 1SYXA 1XBSA 3ED3A 4J56E 2PGTA 4ECIA 4OO4A 1M9BA 3WGXA 1GSUA 3H4KA 4POMA 3A2VA 1Z3EA 1V9WA 3KGKA 2DIYA 3IRAA 2NBSA 3VWUA 4BVXB 3LYPA 1VF3A 5KN0A 1ERTA 3KMNA 2FHEA 2J9HA 3P2AA 1DSBA 4WF4A 2AHEA 1A0FA 4ECCA 3KTBA 3MWHA 3W8JA 2LUSA 4PQIA 2DLXA 2JZSA 2L5LA 4IVFA 3VFIA 5L71A 1IYIA 5ECSA 1TKDB 1FHEA 2P5QA 4WEYA 1AAZA 1Q4JA 5DALB 4RI7A 1QFNA 1ZGNA 1QGVA 3KP8A 3FZ5A 4BVXA 2GT6A 3VLNA 1MTCA 4YKFA 1EV4A 1O6JA 2ALBA 2KOKA 2VD1A 3O6TA 1RW1A 3PH9A 4O5QA 3ME7A 3FMWA 3HJMA 2PVOC 2I3YA 3CRTA 4Q5RA 1FG4A 4XCSA 3HJPA 3ZIVA 5DALA 3ZYWA 3HXSA 4NV5A 5F8BA 2L4QA 4O5RA 1A0RP 3O3TA 2A2SA 1M9AA 1GL8A 1A24A 2VM1A 4ZB9A 5IOWA 2LSTA 5INYA 3DVXA 3ZFBA 2GZPA 4J57E 1ZYNA 3EC3A 5HFIA 1EV9A 3M0FA 1M3JA 2OA7A 3LXZA 4MK3A 5EPFA 4TR3A 3H79A 4O5UA 1O85A 2H1DA 3TCOA 5A4WA 2HFDA 2IWTA 1OE8A 5D9VA 3LSZA 5ECMB 2QKEA 5J41A 3J7Yb 4G0IA 4G9HA 4TXVA 3D4TA 4BVYB 4Z2TA 3LG6A 4GSNA 1C72A 2LQQA 2WB9A 5DQSA 5FT3A 4I5QA 3U6VA 2BMXA 3BBYA 5EL8A 4KNDA 4ZIJA 4MMMA 1FVKA 3HA9A 1Z5YE 4OCFA 4OMVA 4PXOA 11GSA 2CVBA 1PQNA 3WGDA 3GSSA 3UMAA 3HCZA 5BMUA 4TR0A 2LNTA 4MZCA 4I2UA 3F8UA 1KTEA 19GSA 4ECBA 2DKIA 1JHBA 1PX6A 3HVSA 2PERA 1MEKA 3TKSC 4KDXA 3ZIJA 4WKWA 3TOTA 2YZHA 3TJGA 3KEBA 4MJCA 2LEGA 3WD6A 2L6DA 4NV2A 2TIRA 4OFNA 2GDRA 1NHOA 3L4NA 3TJJA 2MMAA 2H6YA 5D8IA 2FWHA 3WT1A 3GNJA 4K5RA 4Q5NA 3EU3A 1SKWB 3UIWA 5JCGA 4ZBDA 2B6MA 1XWGA 4WXTA 4G0LA 4LMWA 2HSHA 3GKKA 1SJIA 4XHMA 4LA1A 4XRAA 4HZ4A 2C8UA 2VO4A 3UBLA 4MJEA 2JACA 2HT9A 4K0GA 5IO2A 4HS1A 4OWYA 2XHFA 5F05A 1GLQA 2L5OA 2YJHA 3HD5A 4V1Ag 5F07A 3UBKA 1YF0A 3VPTA 4WF5A 4DVCA 1EWXA 4TR1A 4FH8A 5G31A 1TTZA 2X8HA 3UL3A 1DE1A 1PKZA 5DCHA 1YEXA 1DUGA 4K7OA 4KCAA 1Z6MA 4K2DA 2DC5A 2MYGA 4IQAA 1M99A 1K3YA 5DQYA 1VRSD 4EL1A 1RK4A 2GSTA 8GSSA 3LORA 1MDJA 3IHQA 4V2LA 3TKSA 1HNBA 1Z7PA 4HJ2A 2G0FA 2H8LA 2O7KA 4KAEA 2XBQA 4XIHA 2GTUA 1A2LA 3FZAA 4IGJA 4K6XA 4ML6A 1UVZA 2L57A 1ZZYA 2R2JA 1XOAA 5ECLB 3QAWA 2GT5A 4DSRA 4YKGA 1GUKA 1TDIA 3E3EA 5IMAA 2FY6A 3APQA 3CSJA 3DGQA 3BD2A 1BJXA 3M1GA 2K8VA 1GSSA 2VD0A 3RHBA 3D4MA 2C0FA 2R3XA 1TOFA 4DSSB 2REMA 3BOAA 3KM6A 5J5NA 5J9BA 1TP9A 1V40A 1OC9B 4EO3A 4HOJA 2VL2C 2NPBA 2OE0A 1XPVA 4CDOA 3FRCA 5ELGA 3M8NA 1T8EB 3GTUB 2C3NA 1U3AA 2LTKA 4F9ZA 1XXUA 4ZBAA 3WT2A 2CT6A 4NHWA 3F3QA 1AQVA 4KCEA 2DIZA 1F37A 1WIKA 3QOUA 2KLXA 4MJAA 4BPYA 1M2AA 3Q18A 2AB6A 2B7JA 2VCVA 3A3TA 4MF5A 3D5JA 3GKMA 2WJUA 5CRDA 5IPHA 1GULA 1SENA 3PINA 1EZKA 2YWNA 2JL4A 5IM9A 1LU4A 3QD9A 1G6YA 3GTUA 2CQ9A 4KSMA 1G7OA 2I1UA 4MZWA 4ZBBA 2OADA 1FB0A 4XRDA 1SL0B 2EIOA 2H66A 4IN0A 5GSSA 2YWIA 1YQ1A 1T1VA 2C0EA 1AC1A 3RAZA 3A5IA 3QFAC 1JZDA 4MDCA 2DJKA 3QMXA 5IMFA 4OFMA 4OCEA 5D93A 2UZ8A 1YEPA 3I69A 3CSIA 1K3LA 2OBKA 4TXOB 4MH2A 3CRUA 2IIYA 1TI1A 4QQ7A 2VL2A 5G5FA 1PA3A 2K6VA 1Z9HA 3Q19A 2MBTA 3IXRA 3TRXA 1Y25A 1ABAA 3NIVA 3US3A 1PSQA 5AGYA 1R5PA 2YWOA 3CSHA 4MJBA 5IPGA 2LKUA 2QGVA 2GVPA 4K8MA 4MNNA 2P31A 3WYWA 4RQRA 2JSZA 3ZREA 3GA4A 4PQ1A 3CBUA 4D73B 2FWGA 2R0PA 5EY6A 3UAPA 2GLRA 3HY2A 2FLSA 2X4AA 3VWVA 4FYBA 1R7HA 1XWAA 1F3BA 2AUVA 4ID0A 4NWYA 2HXKA 5CYYA 5HR0A 14GSA 4RI6A 1AUCA 2C3QA 2VIMA 3R2QA 2QSIA 2YZUA 6GSVA 2C80A 4V2NA 3ZRDA 2HRFA 2ES7A 1SL2B 1IYHA 2YV9A 3GMFA 2TRCP 5A4VA 5KEJA 5LCZA 3HJOA 2N5AA 3FR6A 4N0VA 2A4HA 6GSWA 7GSSA 4PUAA 5B7CA 4LLRA 2FWEA 4I97A 2HRNA 4EKZA 1U6TA 3G9BA 4GQFA 3GURA 1TXXA 1K0BA 3MDKA 1MD3A 5KOXA 2CZ3A 1U87A 3MNGA 3H8QA 1EOGA 2X8GA 4JBBA 3ZITA 4YH2A 1F3AA 1GTIA 4KDUA 2V2GA 1USBA 4PX1A 4ZILA 4X4JA 4IP1A 1GSEA 1B9YC 1PN0A 1BQ7A 2OKAA 4G2EA 3DMLA 2DBCA 2B3SA 3PGTA 5ECOB 3R3EA 2PWJA 3DKSA 2H73A 4WR4A 5C04A 4EIQA 4QL9A 6GSXA 3LQ7A 5FHIA 2H30A 5ABRA 3IOSA 4Z2UA 6GSYA 1VF2A 5ECQB 4EDZA 2A2RA 3APOA 4GRFA 3ZFLA 3F0IA 1N8JA 3UVHA 1TRUA 1WJKA 1S3CA 2P5RA 2HZEB 2HRAA 1K0AA 3ME8A 9GSSA 1EP7A 2CZ2A 2GQMA 3D0ZA 2RUFA 4F0CA 2FA4A 3TOUA 1XW9A 3F9UA 4PNGA 1PL2A 3EE2A 2CA8A 2H70A 2XPDA 3CQFA 1O7UA 5AISA 4BA7A 2IFQB 1URMA 4KB3A 1A8LA 3P90A 1TRWA 2FGXA 4IJ3A 4L8EA 1GLPA 1XWCA 2RM6A 3C8EA 3D22A 6GSSA 1UN2A 1XG8A 3FKFA 4CW9A 4JE1A 2PN8A 2CX4A 1WOUA 1DBYA 2OJLA 3M9JA 2WGRA 2IFQA 4MF7A 3G7IA 4JR6A 2H0IA 2C1YA 1ERWA 5CP1A 3DIEA 2V32A 5AIVA 1M2DA 2AJQB 4JR4A 3F6DA 3TKSE 5HQPA 2YV7A 1BYEA 1OKTA 4ECJA 3TUEA 2BTOT 2VLVA 3P7XA 1T4ZA 5A4UA 5IO0A 3HDCA 2PPTA 1W4VA 5IMDA 2DJ3A 1X9MB 3Q6OA 2C4JA 2LQOA 4NXIA 4BVYA 1AXDA 2RLIA 3AY8A 10GSA 2FNOA 1EP8A 5JCUA 3QFBC 5G1LA 5C00A 2BJXA 1BEDA 2NDOA 3QAVA 2PU9C 3WGEA 2GSSA 2V6OA 2N5FA 2O87A 3IAM2 2HI7A 1NHYA 1G6WA 2R5GA 2C0GA 2GGTA 3IV4A 4BL7B 5D73A 2CAIA 2GQKA 2HE3A 2RM5A 1PN9A 3U5RE 2JZTA 3C7MA 2HSMA 3ERWA 3EMPA 4NHZA 1XOBA 3LWAA 5DAKB 5DDLA 1YJ6A 2IL3A 2OE1A 1GWCA 2I81A 4GQCA 3F4TA 1SKRB 1KBNA 1ST9A 1SYRA 1EGOA 1FB6A 5DJLA 1NW2A 4JRRA 3DEXA 2EIRA 1SL1B 2H1GA 2FUG2 5GAPD 1V2AA 2LNSA 3D21A 2FCHA 3VURA 4NPBA 1YF1A 1ZYPA 3PR8A 2VCTA 1ZOFA 1K0NA 1PGTA 3QDNA 4IJIA 5F06A 4KX4A 2IMEA 3C1SA 3EU4A 2MMNA 2YCDA 1ZYEA 3EYTA 1X0RA 5F0GA 2KP1A 1VF1A 5FWGA 1QUWA 4N11A 1ZMAA 5BRTA 4F0BA 4K9ZA 2VCXA 5ECNB 2VLUA 3UVTA 2M46A 3KJYA 2CAQA 4ICYA 2OBIA 1SK2A 4AJ6A 3L9SA 2F8AA 2H1AA 4KUNA 3F63A 1XWKA 1J0FA 4N0ZA 1G0TA 2IJYA 4X43A 3P8WA 1FOHA 3I9V2 1S3AA 3G7YA 3IBHA 4LMVA 2DSAA 1K0OA 1WWJA 3ZL5A 1A23A 2LJKA 1K0CA 2R6KA 4G19A 4WBJA 1XW6A 4HUAA 3QAGA 3GHAA 4QL7A 3TKQA 3N9JA 1K0MA 3HKRA 1GSFA 1ML6A 2YANA 1TU8A 5B6NA 2M72A 2F8FA 2PUKC 4E8EA 1RQMA 3E9JB 4TKYA 5J4UA 1V57A 4JEDA 4HZ2A 2A4VA 1BX9A 5G2ZA 3DXBA 3ZVJD 1AW9A 2B5EA 3OR5A 2V41A 2H0GA 2DMLA 3IAS2 4FYUA 1R4WA 1UA5A 3CTGA 3CYNA 2EIQA 4HQZA 5HR3A 4XS6A 3MYDA 3S9FA 5CRGA 1GTAA 2H6XA 4BWSA 3KH7A 4DSSA 4Z2RA 2P0GA 1EGRA 5LD0A 4K2XA 3KD0A 5A5KA 2E7PA 4X1UA 1GP1A 6GSUA 1OC9A 4K0NA 5KN3A 5JWQB 5DVBA 1TI3A 3TKPA 1JLWA 4E8HA 3FW2A 1ON4A 2HNLA 2XC2A 2VCZA 3RBTA 4K7NA 3F6FA 3NOFA 5ECRB 1TJDA 4XTSA 1XCCA 2YPMA 4KGIA 2WS2A 4GCIA 1LJRA 1J08A 2VUPA 1XIYA 1O81A 4MF6A 1YKCA 1WE0A 5DJMA 4L0UA 3NZNA 3DRNA 5IIZA 2HZFA 2O85A 4KH7A 1ILOA 3DWVA 4PTSA 4F82A 1T4YA 5KN1A 1Y6EA 1T3BA 1B9XC 1K3OA 1HNCA 2PVQA 4IKHA 4F03A 2QA2A 4F2IA 2L6CA 3TDGA 4WETA 1QQ2A 1U88A 2RUEA 1Q98A 1W89A 4ILFA 1GTUA 4K7IA 4YQVA 4FYCA 1Z6NA 2VM2A 3GX8A 5B6MA 3F4RA 2B1LA 2R37A 4FQUA 1K0DA 1THXA 2AV4A 3W8SA 5CAXA 4TXOA 4MPFA 2L4CA 5HR2A 3IDVA 4JZQA 5JWRB 3KXOA 3TB2A 4HI7A 4HDEA 4ML1A 1Z7RA 3VK9A 2H71A 2HRKA 1NM3A 5DBQA 20GSA 3EURA 2YNXA 4USSA 3CMIA 2I9HA 2DJ0A 3K8NA 1EEJA 3SBCA 5IMVA 1AQXA 2O89A 2FA8A 5ECHB 3ZZXA 3DVWA 4AGSA 1CQGA 1OVNA 1B4QA 1O73A 2GZZA 1JLVA 4D73A 1XWBA 5ECKB 4J2FA 5B8BA 2LJAA 2V6KA 3APSA 5ECIB 1GSQA 1OC8A 2Z9SA 3IPZA 3TKRA 2AYTA 3HZ8A 2WULA 3MAKA 4GF0A 3FHKA 3L9VA 2G2QA 1FW1A 1OKDA 2DJJA 4O7HA 3FZ9A 1KNGA 2GSQA 4KW6A 2H6ZA 4ZL8A 3GSTA 3TRPA 2B7KA 2GQLA 4POKA 4HEA2 2GS3A 3I6AA 3GL5A 4ZL7A 5GAND 4BIKA 1G7EA 4CHSA 2WCIA 1NSWA 2F51A 4GSTA 2YJ7A 1A8YA 4KF9A 3L78A 4YQUA 3MIXA 3BCIA 3HZ4A 4DSQA 1OYJA 4WBRD 2F9SA 1YY7A 1JZRA 1XVWA 1VF4A 2C0DA 1TW9A 4Z7XA 3FYGA 1HNAA 3EPTA 2L59A 5IMCA 2IPAA 3VWXA 12GSA 1YKAA 3ZVJA 5B8AA 13GSA 4K1FA 1AIUA 3F3RA 4IBPA 4PNFA 2DJ2A 4EIPA 4EF0A 3VWWA 1TK0B 1F9MA 1UC7A 3QR6A 4LL1B 1E6BA 4G10A 3HVVA 5D96A 3GUSA 2IN3A 2VCWA 5CREA 4GWRA 2R0GA 1F2EA 1QXHA 2YN1A 4P3YB 1QMVA 3EWLA 2CX3A 4O92A 3BJ5A 1PD21 2CVDA 2VCQA 2WDUA 3H93A 1GNEA 2FD3A 1JFUA 3G7JA 4PURA 1HYUA 1PFOA 2KHPA 4GXZA 4IW9A 4A5PA 3FEUA 1EOHA 4EUYA 1XFLA 3TJKA 1PX7A 2HZEA 2JSYA 4MP4A 1HD2A 2IMKA 5JWOB 1V98A 4TR4A 5E59A 2NVLA 1ZL9A 1T7PB 4KDYA 3RHCA 3GX0A 3DYRA 2O8VB 5HFKA 3F4SA 5LNKe 2M80A 4HJMA 4RUVA 2H1BA 3EVIA 1SJ6A 2K18A 1O8XA 4EDYA 3GFKA 3LXTA 1M7TA 1F6MC 2H01A 1WRYA 1I9DA 4EC0A 1I5GA 1CQHA 4CY6A 2MMZA 2ZNMA 1XZOA 1YDKA 3KIJA 2ZUPA 1TK8B 5KN2A 5GSTA 4IELA 5J3RA 1J9BA 3TRQA 4H86A 5AN1A 4XS4B 4YAPA 5JCWA 4ZB6A 3EMXA 5ID2B 4ISDA 2ON5A 3ERGA 2EC4A 2LRCA 3ZMLA 2TRXA 2FWFA 5H5RA 4V1Ap 2MZCA 1PRXA 3L9UA 1BAYA 5E4WA 5HR1A 4GSSA 3LW9A 3RPPA 1X9SB 1X5DA 3J7Yk 2YWMA 4MH3A 1M2BA 2X99A 3HYPA 1ACVA 5CRWA 2X64A 4AF2A 2RIIA 4XS4A 2H19A 2J23A 3C1RA 4HU7A 3FR3A 5ID2A 1SD9A 2I4AA 5D9TA 3E0UA 3GYKA 1A2JA 4MPGA 2AAWA 5D9XA 3HVNA 1X5EA 4NMUA 5J9CA 16GSA 5HFGA 2K9FA 4HSCX 1GH2A 2JADA 1SU9A 2GSRA 5IOXA 4IP6A 1E2YA 3C71A 2H0HA 5KOWA 4Q5QA 4MLYA 3UOMA 4L0WA 4AJ8A 4TR1B 3A5WA 1TRVA 1U3IA 4ZXGA 4BL7A 3H1NA 3V1WA 1SJZA 3IK7A 2ON7A 4TN8A 3FY7A 3GN3A 4Q5FA 5ECPB 3KP9A 2LS5A 3M3MA 5H5SA 2IMFA 1GNWA 4I8BA 4KE3A 5DAKA 4YAVA 1ERUA 2MBSA 1SD8A 2IMDA 4YQMA 22GSA 3PPUA 4G0KA 1M0UA 2X49A 4POLA 2LRNA 2DJ1A 1TK5B 2QA1A 3UEMA 3GV1A 1HQOA 4TOPA 2DMMA 3N5OA 1A2MA 3LEFA 4PGTA 2LRTA 4TRXA 5G30A 1PL1A 2IMIA 2QC7A 2N5BA 1R26A 1PKWA 4RQXA 3FK8A 2ZCTA 1TRSA 5DCGA 2OE3A 3ZTLA 5AIXA 2H76A 3CTFA 5G5EA 3BCKA 2H75A 2OACA 1DE2A 1S3DA 1LBKA 2GZYA 2JU5A 3DD3A 4FO5A 3SWLA 2XPEA 3GL3A 3RPNA 1H75A 1QK8A 4XS1A 4ZL9A 1X5CA 4FIWA 3KCMA 3ZLPA 4KSOA 1THOA 2A2PA 3TJBA 2HLSA 3QCPA 1MDKA 3KH9A 3IE3A 4POBA 2KP2A 4EVMA 1KEBA 2F3MA 3LFLA 3IC4A 1YZXA 4LL4B 4TVEA 5IQYA 1R5AA 1ZYQB 4CY8A 1N2AA 1AQWA 1O8WA 4N10A 1OC3A 4L5OA 4OFTA 4I2TA 5CNWA 5D9WA 4PQHA 18GSA 4IQ1A 2K8SA 3IR4A 4TW5A 2PBJA 2JZRA 3L0HA 1SK0A 1JZOA 1FAAA 3HVXA 3VI5A 1MD4A 1GTBA 2R4VA 2VLTA 1WPIA 3LGCA 2H74A 3Q74A 3LJRA 2B1KA 2LJRA 3GKXA 1EEMA 2HYXA 6GSTA 3M9KA 2WZ9A 1ZCPA 1WMJA 2YOIA
chains in the Genus database with same CATH topology
4ACSA 1B8XA 2B5YA 2DKHA 4EE0A 5CRHA 1T00A 1B4PA 2NTOA 1VGLA 3C73A 1BG5A 1TU7A 2H72A 1SK1A 3GKNA 3QPMA 4IS0A 4NAXA 2V1MA 2VL3A 2B5XA 2YP6A 4GTUA 4WR5A 3CXGA 2VAFA 5H5QA 2VL9A 4OO5A 4HQSA 3LYKA 2CV4A 5CO3A 1FOVA 2E2GA 2WRTA 3MSZA 3IHGA 3KTLA 3TJFA 1GUHA 3VPQA 3ERFA 2C3TA 5ELAA 3FZ4A 4MA9A 3A2WA 1B48A 4MCUA 1FVJA 3GH9A 3GRXA 1GSDA 2E2MA 3UARA 1WP0A 1FO5A 3KZQA 3GIXA 1X9WB 1XW5A 2MMOA 3RDWA 3O76A 1OE7A 1V58A 5G1KA 4PUFC 4O32A 2D2ZA 2KUCA 4I6XA 3GH6A 5GZZB 4L5LA 17GSA 2R0CA 3IK9A 3FR9A 2CVKA 1H4OA 3KMOA 4EXJA 4N30A 1JZWA 4OD7A 1ERVA 4K5SA 1OAZA 4HU9A 3IA1A 4GLTA 3UJ1A 5EVOA 4IHUA 4V2MA 1MDIA 3VI7A 4MABA 4BWQA 3A2XA 4JU5A 3ISOA 3JCML 4MZBA 3TGZA 2VOCA 1GUMA 4KA0A 2E0QA 2PMTA 1XVQA 3HHVA 3D6IA 4ULXA 2X8CA 3W6GA 1PMTA 2LV3A 1GRXA 2HSYA 3I43A 2XBIA 5IMZA 4X0XA 1SKSB 3IC8A 5ENUA 2WFCA 3EINA 4DEJA 1GSYA 4ZB8A 5COHA 4AJ7A 3ZMKA 1SYXA 1XBSA 3ED3A 4J56E 2PGTA 4ECIA 4OO4A 1M9BA 3WGXA 1GSUA 3H4KA 4POMA 3A2VA 1Z3EA 1V9WA 3KGKA 2DIYA 3IRAA 2NBSA 3VWUA 4BVXB 3LYPA 1VF3A 5KN0A 1ERTA 3KMNA 2FHEA 2J9HA 3P2AA 1DSBA 4WF4A 2AHEA 1A0FA 4ECCA 3KTBA 3MWHA 3W8JA 2LUSA 4PQIA 2DLXA 2JZSA 2L5LA 4IVFA 3VFIA 5L71A 1IYIA 5ECSA 1TKDB 1FHEA 2P5QA 4WEYA 1AAZA 1Q4JA 5DALB 4RI7A 1QFNA 1ZGNA 1QGVA 3KP8A 3FZ5A 4BVXA 2GT6A 3VLNA 1MTCA 4YKFA 1EV4A 1O6JA 2ALBA 2KOKA 2VD1A 3O6TA 1RW1A 3PH9A 4O5QA 3ME7A 3FMWA 3HJMA 2PVOC 2I3YA 3CRTA 4Q5RA 1FG4A 4XCSA 3HJPA 3ZIVA 5DALA 3ZYWA 3HXSA 4NV5A 5F8BA 2L4QA 4O5RA 1A0RP 3O3TA 2A2SA 1M9AA 1GL8A 1A24A 2VM1A 4ZB9A 5IOWA 2LSTA 5INYA 3DVXA 3ZFBA 2GZPA 4J57E 1ZYNA 3EC3A 5HFIA 1EV9A 3M0FA 2OA7A 3LXZA 4MK3A 5EPFA 4TR3A 3H79A 4O5UA 1O85A 2H1DA 3TCOA 5A4WA 2HFDA 2IWTA 1OE8A 5D9VA 3LSZA 5ECMB 2QKEA 5J41A 3J7Yb 4G0IA 4G9HA 4TXVA 3D4TA 4BVYB 4Z2TA 3LG6A 4GSNA 1C72A 2LQQA 2WB9A 5DQSA 5FT3A 4I5QA 3U6VA 2BMXA 3BBYA 5EL8A 4KNDA 4ZIJA 4MMMA 1FVKA 3HA9A 1Z5YE 4OCFA 4OMVA 4PXOA 11GSA 2CVBA 1PQNA 3WGDA 3GSSA 3UMAA 3HCZA 5BMUA 4TR0A 2LNTA 4MZCA 4I2UA 3F8UA 1KTEA 19GSA 4ECBA 2DKIA 1JHBA 1PX6A 3HVSA 2PERA 1MEKA 3TKSC 4KDXA 3ZIJA 4WKWA 3TOTA 2YZHA 3TJGA 3KEBA 4MJCA 2LEGA 3WD6A 2L6DA 4NV2A 2TIRA 4OFNA 2GDRA 1NHOA 3L4NA 3TJJA 2MMAA 2H6YA 5D8IA 2FWHA 3WT1A 3GNJA 4K5RA 4Q5NA 3EU3A 1SKWB 3UIWA 5JCGA 4ZBDA 2B6MA 1XWGA 4WXTA 4G0LA 4LMWA 2HSHA 3GKKA 1SJIA 4XHMA 4LA1A 4XRAA 4HZ4A 2C8UA 2VO4A 3UBLA 4MJEA 2JACA 2HT9A 4K0GA 5IO2A 4HS1A 4OWYA 2XHFA 5F05A 1GLQA 2L5OA 2YJHA 3HD5A 4V1Ag 5F07A 3UBKA 1YF0A 3VPTA 4WF5A 4DVCA 1EWXA 4TR1A 4FH8A 5G31A 1TTZA 2X8HA 3UL3A 1DE1A 1PKZA 5DCHA 1YEXA 1DUGA 4K7OA 4KCAA 1Z6MA 4K2DA 2DC5A 2MYGA 4IQAA 1M99A 1K3YA 5DQYA 1VRSD 4EL1A 1RK4A 2GSTA 8GSSA 3LORA 1MDJA 3IHQA 4V2LA 3TKSA 1HNBA 1Z7PA 4HJ2A 2G0FA 2H8LA 2O7KA 4KAEA 2XBQA 4XIHA 2GTUA 1A2LA 3FZAA 4IGJA 4K6XA 4ML6A 1UVZA 2L57A 1ZZYA 2R2JA 1XOAA 5ECLB 3QAWA 2GT5A 4DSRA 4YKGA 1GUKA 1TDIA 3E3EA 5IMAA 2FY6A 3APQA 3CSJA 3DGQA 3BD2A 1BJXA 3M1GA 2K8VA 1GSSA 2VD0A 3RHBA 3D4MA 2C0FA 2R3XA 1TOFA 4DSSB 2REMA 3BOAA 3KM6A 5J5NA 5J9BA 1TP9A 1V40A 1OC9B 4EO3A 4HOJA 2VL2C 2NPBA 2OE0A 1XPVA 4CDOA 3FRCA 5ELGA 3M8NA 1T8EB 3GTUB 2C3NA 1U3AA 2LTKA 4F9ZA 1XXUA 4ZBAA 3WT2A 2CT6A 4NHWA 3F3QA 1AQVA 4KCEA 2DIZA 1F37A 1WIKA 3QOUA 2KLXA 4MJAA 4BPYA 1M2AA 3Q18A 2AB6A 2B7JA 2VCVA 3A3TA 4MF5A 3D5JA 3GKMA 2WJUA 5CRDA 5IPHA 1GULA 1SENA 3PINA 1EZKA 2YWNA 2JL4A 5IM9A 1LU4A 3QD9A 1G6YA 3GTUA 2CQ9A 4KSMA 1G7OA 2I1UA 4MZWA 4ZBBA 2OADA 1FB0A 4XRDA 1SL0B 2EIOA 2H66A 4IN0A 5GSSA 2YWIA 1YQ1A 1T1VA 2C0EA 1AC1A 3RAZA 3A5IA 3QFAC 1JZDA 4MDCA 2DJKA 3QMXA 5IMFA 4OFMA 4OCEA 5D93A 2UZ8A 1YEPA 3I69A 3CSIA 1K3LA 2OBKA 4TXOB 4MH2A 3CRUA 2IIYA 1TI1A 4QQ7A 2VL2A 5G5FA 1PA3A 2K6VA 1Z9HA 3Q19A 2MBTA 3IXRA 3TRXA 1Y25A 1ABAA 3NIVA 3US3A 1PSQA 5AGYA 1R5PA 2YWOA 3CSHA 4MJBA 5IPGA 2LKUA 2QGVA 2GVPA 4K8MA 4MNNA 2P31A 3WYWA 4RQRA 2JSZA 3ZREA 3GA4A 4PQ1A 3CBUA 4D73B 2FWGA 2R0PA 5EY6A 3UAPA 2GLRA 3HY2A 2FLSA 2X4AA 3VWVA 4FYBA 1R7HA 1XWAA 1F3BA 2AUVA 4ID0A 4NWYA 2HXKA 5CYYA 5HR0A 14GSA 4RI6A 1AUCA 2C3QA 2VIMA 3R2QA 2QSIA 2YZUA 6GSVA 2C80A 4V2NA 3ZRDA 2HRFA 2ES7A 1SL2B 1IYHA 2YV9A 3GMFA 2TRCP 5A4VA 5KEJA 5LCZA 3HJOA 2N5AA 3FR6A 4N0VA 2A4HA 6GSWA 7GSSA 4PUAA 5B7CA 4LLRA 2FWEA 4I97A 2HRNA 4EKZA 1U6TA 3G9BA 4GQFA 3GURA 1TXXA 1K0BA 3MDKA 1MD3A 5KOXA 2CZ3A 1U87A 3MNGA 3H8QA 1EOGA 2X8GA 4JBBA 3ZITA 4YH2A 1F3AA 1GTIA 4KDUA 2V2GA 1USBA 4PX1A 4ZILA 4X4JA 4IP1A 1GSEA 1B9YC 1PN0A 1BQ7A 2OKAA 4G2EA 3DMLA 2DBCA 2B3SA 3PGTA 5ECOB 3R3EA 2PWJA 3DKSA 2H73A 4WR4A 5C04A 4EIQA 4QL9A 6GSXA 3LQ7A 5FHIA 2H30A 5ABRA 3IOSA 4Z2UA 6GSYA 1VF2A 5ECQB 4EDZA 2A2RA 3APOA 4GRFA 3ZFLA 3F0IA 1N8JA 3UVHA 1TRUA 1WJKA 1S3CA 2P5RA 2HZEB 2HRAA 1K0AA 3ME8A 9GSSA 1EP7A 2CZ2A 2GQMA 3D0ZA 2RUFA 4F0CA 2FA4A 3TOUA 1XW9A 3F9UA 4PNGA 1PL2A 3EE2A 2CA8A 2H70A 2XPDA 1O7UA 5AISA 4BA7A 2IFQB 1URMA 4KB3A 1A8LA 3P90A 1TRWA 2FGXA 4IJ3A 4L8EA 1GLPA 1XWCA 2RM6A 3C8EA 3D22A 6GSSA 1UN2A 3FKFA 4CW9A 4JE1A 2PN8A 2CX4A 1WOUA 1DBYA 2OJLA 3M9JA 2WGRA 2IFQA 4MF7A 3G7IA 4JR6A 2H0IA 2C1YA 1ERWA 5CP1A 3DIEA 2V32A 5AIVA 1M2DA 2AJQB 4JR4A 3F6DA 3TKSE 5HQPA 2YV7A 1BYEA 1OKTA 4ECJA 3TUEA 2BTOT 2VLVA 3P7XA 1T4ZA 5A4UA 5IO0A 3HDCA 2PPTA 1W4VA 5IMDA 2DJ3A 1X9MB 3Q6OA 2C4JA 2LQOA 4NXIA 4BVYA 1AXDA 2RLIA 3AY8A 10GSA 2FNOA 1EP8A 5JCUA 3QFBC 5G1LA 5C00A 2BJXA 1BEDA 2NDOA 3QAVA 2PU9C 3WGEA 2GSSA 2V6OA 2N5FA 2O87A 3IAM2 2HI7A 1NHYA 1G6WA 2R5GA 2C0GA 2GGTA 3IV4A 4BL7B 5D73A 2CAIA 2GQKA 2HE3A 2RM5A 1PN9A 3U5RE 2JZTA 3C7MA 2HSMA 3ERWA 3EMPA 4NHZA 1XOBA 3LWAA 5DAKB 5DDLA 1YJ6A 2IL3A 2OE1A 1GWCA 2I81A 4GQCA 3F4TA 1SKRB 1KBNA 1ST9A 1SYRA 1EGOA 1FB6A 5DJLA 1NW2A 4JRRA 3DEXA 2EIRA 1SL1B 2H1GA 2FUG2 5GAPD 1V2AA 2LNSA 3D21A 2FCHA 3VURA 4NPBA 1YF1A 1ZYPA 3PR8A 2VCTA 1ZOFA 1K0NA 1PGTA 3QDNA 4IJIA 5F06A 4KX4A 2IMEA 3C1SA 3EU4A 2MMNA 2YCDA 1ZYEA 3EYTA 1X0RA 5F0GA 2KP1A 1VF1A 5FWGA 1QUWA 4N11A 1ZMAA 5BRTA 4F0BA 4K9ZA 2VCXA 5ECNB 2VLUA 3UVTA 2M46A 3KJYA 2CAQA 4ICYA 2OBIA 1SK2A 4AJ6A 3L9SA 2F8AA 2H1AA 4KUNA 3F63A 1XWKA 1J0FA 4N0ZA 1G0TA 2IJYA 4X43A 3P8WA 1FOHA 3I9V2 1S3AA 3G7YA 3IBHA 4LMVA 2DSAA 1K0OA 1WWJA 3ZL5A 1A23A 2LJKA 1K0CA 2R6KA 4G19A 4WBJA 1XW6A 4HUAA 3QAGA 3GHAA 4QL7A 3TKQA 3N9JA 1K0MA 3HKRA 1GSFA 1ML6A 2YANA 1TU8A 5B6NA 2M72A 2F8FA 2PUKC 4E8EA 1RQMA 3E9JB 4TKYA 5J4UA 1V57A 4JEDA 4HZ2A 2A4VA 1BX9A 5G2ZA 3DXBA 3ZVJD 1AW9A 2B5EA 3OR5A 2V41A 2H0GA 2DMLA 3IAS2 4FYUA 1R4WA 1UA5A 3CTGA 3CYNA 2EIQA 4HQZA 5HR3A 4XS6A 3MYDA 3S9FA 5CRGA 1GTAA 2H6XA 4BWSA 3KH7A 4DSSA 4Z2RA 2P0GA 1EGRA 5LD0A 4K2XA 3KD0A 5A5KA 2E7PA 4X1UA 1GP1A 6GSUA 1OC9A 4K0NA 5KN3A 5JWQB 5DVBA 1TI3A 3TKPA 1JLWA 4E8HA 3FW2A 1ON4A 2HNLA 2XC2A 2VCZA 3RBTA 4K7NA 3F6FA 3NOFA 5ECRB 1TJDA 4XTSA 1XCCA 2YPMA 4KGIA 2WS2A 4GCIA 1LJRA 1J08A 2VUPA 1XIYA 1O81A 4MF6A 1YKCA 1WE0A 5DJMA 4L0UA 3NZNA 3DRNA 5IIZA 2HZFA 2O85A 4KH7A 1ILOA 3DWVA 4PTSA 4F82A 1T4YA 5KN1A 1Y6EA 1T3BA 1B9XC 1K3OA 1HNCA 2PVQA 4IKHA 4F03A 2QA2A 4F2IA 2L6CA 3TDGA 4WETA 1QQ2A 1U88A 2RUEA 1Q98A 1W89A 4ILFA 1GTUA 4K7IA 4YQVA 4FYCA 1Z6NA 2VM2A 3GX8A 5B6MA 3F4RA 2B1LA 2R37A 4FQUA 1K0DA 1THXA 2AV4A 3W8SA 5CAXA 4TXOA 4MPFA 2L4CA 5HR2A 3IDVA 4JZQA 5JWRB 3KXOA 3TB2A 4HI7A 4HDEA 4ML1A 1Z7RA 3VK9A 2H71A 2HRKA 1NM3A 5DBQA 20GSA 3EURA 2YNXA 4USSA 3CMIA 2I9HA 2DJ0A 3K8NA 1EEJA 3SBCA 5IMVA 1AQXA 2O89A 2FA8A 5ECHB 3ZZXA 3DVWA 4AGSA 1CQGA 1OVNA 1B4QA 1O73A 2GZZA 1JLVA 4D73A 1XWBA 5ECKB 4J2FA 5B8BA 2LJAA 2V6KA 3APSA 5ECIB 1GSQA 1OC8A 2Z9SA 3IPZA 3TKRA 2AYTA 3HZ8A 2WULA 3MAKA 4GF0A 3FHKA 3L9VA 2G2QA 1FW1A 1OKDA 2DJJA 4O7HA 3FZ9A 1KNGA 2GSQA 4KW6A 2H6ZA 4ZL8A 3GSTA 3TRPA 2B7KA 2GQLA 4POKA 4HEA2 2GS3A 3I6AA 3GL5A 4ZL7A 5GAND 1G7EA 4CHSA 2WCIA 1NSWA 2F51A 4GSTA 2YJ7A 1A8YA 4KF9A 3L78A 4YQUA 3MIXA 3BCIA 3HZ4A 4DSQA 1OYJA 4WBRD 2F9SA 1YY7A 1JZRA 1XVWA 1VF4A 2C0DA 1TW9A 4Z7XA 3FYGA 1HNAA 3EPTA 2L59A 5IMCA 2IPAA 3VWXA 12GSA 1YKAA 3ZVJA 5B8AA 13GSA 4K1FA 1AIUA 3F3RA 4IBPA 4PNFA 2DJ2A 4EIPA 4EF0A 3VWWA 1TK0B 1F9MA 1UC7A 3QR6A 4LL1B 1E6BA 4G10A 3HVVA 5D96A 3GUSA 2IN3A 2VCWA 5CREA 4GWRA 2R0GA 1F2EA 1QXHA 2YN1A 4P3YB 1QMVA 3EWLA 2CX3A 4O92A 3BJ5A 1PD21 2CVDA 2VCQA 2WDUA 3H93A 1GNEA 2FD3A 1JFUA 3G7JA 4PURA 1HYUA 4IW9A 2KHPA 4GXZA 4A5PA 3FEUA 1EOHA 4EUYA 1XFLA 3TJKA 1PX7A 2HZEA 2JSYA 4MP4A 1HD2A 2IMKA 5JWOB 1V98A 4TR4A 5E59A 2NVLA 1ZL9A 1T7PB 4KDYA 3RHCA 3GX0A 3DYRA 2O8VB 5HFKA 3F4SA 5LNKe 2M80A 4HJMA 4RUVA 2H1BA 3EVIA 1SJ6A 2K18A 1O8XA 4EDYA 3GFKA 3LXTA 1M7TA 1F6MC 2H01A 1WRYA 1I9DA 4EC0A 1I5GA 1CQHA 4CY6A 2MMZA 2ZNMA 1XZOA 1YDKA 3KIJA 2ZUPA 1TK8B 5KN2A 5GSTA 4IELA 5J3RA 1J9BA 3TRQA 4H86A 5AN1A 4XS4B 4YAPA 5JCWA 4ZB6A 3EMXA 5ID2B 4ISDA 2ON5A 3ERGA 2EC4A 2LRCA 3ZMLA 2TRXA 2FWFA 5H5RA 4V1Ap 2MZCA 1PRXA 3L9UA 1BAYA 5E4WA 5HR1A 4GSSA 3LW9A 3RPPA 1X9SB 1X5DA 3J7Yk 2YWMA 4MH3A 1M2BA 2X99A 3HYPA 1ACVA 5CRWA 2X64A 4AF2A 2RIIA 4XS4A 2H19A 2J23A 3C1RA 4HU7A 3FR3A 5ID2A 1SD9A 2I4AA 5D9TA 3E0UA 3GYKA 1A2JA 4MPGA 2AAWA 5D9XA 1X5EA 4NMUA 5J9CA 16GSA 5HFGA 2K9FA 1GH2A 2JADA 1SU9A 2GSRA 5IOXA 4IP6A 1E2YA 3C71A 2H0HA 5KOWA 4Q5QA 4MLYA 3UOMA 4L0WA 4AJ8A 4TR1B 3A5WA 1TRVA 1U3IA 4ZXGA 4BL7A 3H1NA 3V1WA 1SJZA 3IK7A 2ON7A 4TN8A 3FY7A 3GN3A 4Q5FA 5ECPB 3KP9A 2LS5A 3M3MA 5H5SA 2IMFA 1GNWA 4I8BA 4KE3A 5DAKA 4YAVA 1ERUA 2MBSA 1SD8A 2IMDA 4YQMA 22GSA 3PPUA 4G0KA 1M0UA 2X49A 4POLA 2LRNA 2DJ1A 1TK5B 2QA1A 3UEMA 3GV1A 1HQOA 4TOPA 2DMMA 3N5OA 1A2MA 3LEFA 4PGTA 2LRTA 4TRXA 5G30A 1PL1A 2IMIA 2QC7A 2N5BA 1R26A 1PKWA 4RQXA 3FK8A 2ZCTA 1TRSA 5DCGA 2OE3A 3ZTLA 5AIXA 2H76A 3CTFA 5G5EA 3BCKA 2H75A 2OACA 1DE2A 1S3DA 1LBKA 2GZYA 2JU5A 3DD3A 4FO5A 3SWLA 2XPEA 3GL3A 3RPNA 1H75A 1QK8A 4XS1A 4ZL9A 1X5CA 4FIWA 3KCMA 3ZLPA 4KSOA 1THOA 2A2PA 3TJBA 2HLSA 3QCPA 1MDKA 3KH9A 3IE3A 4POBA 2KP2A 4EVMA 1KEBA 2F3MA 3LFLA 3IC4A 1YZXA 4LL4B 4TVEA 5IQYA 1R5AA 1ZYQB 4CY8A 1N2AA 1AQWA 1O8WA 4N10A 1OC3A 4L5OA 4OFTA 4I2TA 5CNWA 5D9WA 4PQHA 18GSA 4IQ1A 2K8SA 3IR4A 4TW5A 2PBJA 2JZRA 3L0HA 1SK0A 1JZOA 1FAAA 3HVXA 3VI5A 1MD4A 1GTBA 2R4VA 2VLTA 1WPIA 3LGCA 2H74A 3Q74A 3LJRA 2B1KA 2LJRA 3GKXA 1EEMA 2HYXA 6GSTA 3M9KA 2WZ9A 1ZCPA 1WMJA 2YOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACS A;  1B8X A;  2B5Y A;  4EE0 A;  5CRH A;  1T00 A;  1B4P A;  2NTO A;  1VGL A;  3C73 A;  1BG5 A;  1TU7 A;  2H72 A;  1SK1 A;  3GKN A;  3QPM A;  4IS0 A;  4NAX A;  2V1M A;  2VL3 A;  2B5X A;  2YP6 A;  4GTU A;  4WR5 A;  3CXG A;  2VAF A;  5H5Q A;  2VL9 A;  4OO5 A;  4HQS A;  3LYK A;  2CV4 A;  5CO3 A;  1FOV A;  2E2G A;  2WRT A;  3MSZ A;  3KTL A;  3TJF A;  1GUH A;  3VPQ A;  3ERF A;  2C3T A;  5ELA A;  3FZ4 A;  4MA9 A;  3A2W A;  1B48 A;  4MCU A;  1FVJ A;  3GH9 A;  3GRX A;  1GSD A;  2E2M A;  3UAR A;  1WP0 A;  1FO5 A;  3KZQ A;  3GIX A;  1X9W B;  1XW5 A;  2MMO A;  3RDW A;  3O76 A;  1OE7 A;  1V58 A;  5G1K A;  4PUF C;  4O32 A;  2D2Z A;  2KUC A;  4I6X A;  3GH6 A;  5GZZ B;  4L5L A;  17GS A;  3IK9 A;  3FR9 A;  2CVK A;  1H4O A;  3KMO A;  4EXJ A;  4N30 A;  1JZW A;  4OD7 A;  1ERV A;  1OAZ A;  4HU9 A;  3IA1 A;  4GLT A;  3UJ1 A;  5EVO A;  4IHU A;  4V2M A;  1MDI A;  3VI7 A;  4MAB A;  4BWQ A;  3A2X A;  4JU5 A;  3ISO A;  3JCM L;  4MZB A;  3TGZ A;  2VOC A;  1GUM A;  4KA0 A;  2E0Q A;  2PMT A;  1XVQ A;  3HHV A;  3D6I A;  4ULX A;  2X8C A;  3W6G A;  1PMT A;  2LV3 A;  1GRX A;  2HSY A;  3I43 A;  2XBI A;  5IMZ A;  4X0X A;  1SKS B;  5ENU A;  2WFC A;  3EIN A;  4DEJ A;  1GSY A;  4ZB8 A;  5COH A;  4AJ7 A;  3ZMK A;  1SYX A;  1XBS A;  3ED3 A;  4J56 E;  2PGT A;  4ECI A;  4OO4 A;  1M9B A;  3WGX A;  1GSU A;  3H4K A;  4POM A;  3A2V A;  1Z3E A;  1V9W A;  3KGK A;  2DIY A;  3IRA A;  2NBS A;  3VWU A;  3LYP A;  1VF3 A;  5KN0 A;  1ERT A;  3KMN A;  2FHE A;  2J9H A;  3P2A A;  1DSB A;  4WF4 A;  2AHE A;  1A0F A;  4ECC A;  3KTB A;  3MWH A;  3W8J A;  2LUS A;  4PQI A;  2DLX A;  2JZS A;  2L5L A;  4IVF A;  3VFI A;  5L71 A;  1IYI A;  5ECS A;  1TKD B;  1FHE A;  2P5Q A;  4WEY A;  1AAZ A;  1Q4J A;  5DAL B;  4RI7 A;  1QFN A;  1ZGN A;  1QGV A;  3KP8 A;  3FZ5 A;  4BVX A;  2GT6 A;  3VLN A;  1MTC A;  1EV4 A;  1O6J A;  2ALB A;  2KOK A;  2VD1 A;  3O6T A;  1RW1 A;  3PH9 A;  3ME7 A;  3HJM A;  2PVO C;  2I3Y A;  3CRT A;  4Q5R A;  1FG4 A;  4XCS A;  3HJP A;  3ZIV A;  5DAL A;  3ZYW A;  5F8B A;  3HXS A;  4NV5 A;  2L4Q A;  4O5R A;  1A0R P;  3O3T A;  2A2S A;  1M9A A;  1GL8 A;  1A24 A;  2VM1 A;  4ZB9 A;  5IOW A;  2LST A;  5INY A;  3DVX A;  3ZFB A;  2GZP A;  4J57 E;  3EC3 A;  5HFI A;  1EV9 A;  3M0F A;  2OA7 A;  3LXZ A;  4MK3 A;  5EPF A;  4TR3 A;  3H79 A;  1O85 A;  2H1D A;  3TCO A;  5A4W A;  2HFD A;  2IWT A;  1OE8 A;  5D9V A;  3LSZ A;  5ECM B;  2QKE A;  5J41 A;  3J7Y b;  4G9H A;  4TXV A;  3D4T A;  3LG6 A;  4GSN A;  1C72 A;  2LQQ A;  2WB9 A;  5DQS A;  5FT3 A;  4I5Q A;  3U6V A;  2BMX A;  3BBY A;  5EL8 A;  4KND A;  4ZIJ A;  4MMM A;  1FVK A;  3HA9 A;  1Z5Y E;  4OCF A;  4OMV A;  4PXO A;  11GS A;  2CVB A;  1PQN A;  3WGD A;  3GSS A;  3UMA A;  3HCZ A;  4TR0 A;  2LNT A;  4MZC A;  4I2U A;  3F8U A;  1KTE A;  19GS A;  4ECB A;  1JHB A;  1PX6 A;  3HVS A;  2PER A;  1MEK A;  3TKS C;  4KDX A;  3ZIJ A;  4WKW A;  3TOT A;  2YZH A;  3TJG A;  3KEB A;  4MJC A;  2LEG A;  3WD6 A;  2L6D A;  4NV2 A;  2TIR A;  4OFN A;  2GDR A;  1NHO A;  3L4N A;  3TJJ A;  2MMA A;  2H6Y A;  5D8I A;  2FWH A;  3WT1 A;  3GNJ A;  4Q5N A;  3EU3 A;  1SKW B;  3UIW A;  5JCG A;  4ZBD A;  2B6M A;  1XWG A;  4WXT A;  4LMW A;  2HSH A;  3GKK A;  1SJI A;  4XHM A;  4LA1 A;  4XRA A;  4HZ4 A;  2C8U A;  2VO4 A;  3UBL A;  4MJE A;  2JAC A;  2HT9 A;  4K0G A;  5IO2 A;  4HS1 A;  4OWY A;  2XHF A;  5F05 A;  1GLQ A;  2L5O A;  2YJH A;  3HD5 A;  4V1A g;  5F07 A;  3UBK A;  1YF0 A;  3VPT A;  4WF5 A;  4DVC A;  1EWX A;  4TR1 A;  4FH8 A;  5G31 A;  1TTZ A;  2X8H A;  3UL3 A;  1DE1 A;  1PKZ A;  5DCH A;  1YEX A;  1DUG A;  4K7O A;  4KCA A;  1Z6M A;  4K2D A;  2DC5 A;  2MYG A;  4IQA A;  1M99 A;  1K3Y A;  5DQY A;  1VRS D;  4EL1 A;  1RK4 A;  2GST A;  8GSS A;  3LOR A;  1MDJ A;  3IHQ A;  4V2L A;  3TKS A;  1HNB A;  1Z7P A;  4HJ2 A;  2G0F A;  2H8L A;  2O7K A;  4KAE A;  2XBQ A;  4XIH A;  2GTU A;  1A2L A;  3FZA A;  4IGJ A;  4K6X A;  4ML6 A;  1UVZ A;  2L57 A;  1ZZY A;  2R2J A;  1XOA A;  5ECL B;  3QAW A;  2GT5 A;  4DSR A;  1GUK A;  1TDI A;  3E3E A;  5IMA A;  2FY6 A;  3APQ A;  3CSJ A;  3DGQ A;  3BD2 A;  1BJX A;  3M1G A;  2K8V A;  1GSS A;  2VD0 A;  3RHB A;  3D4M A;  2C0F A;  2R3X A;  1TOF A;  4DSS B;  2REM A;  3BOA A;  3KM6 A;  5J5N A;  5J9B A;  1TP9 A;  1V40 A;  1OC9 B;  4EO3 A;  4HOJ A;  2VL2 C;  2NPB A;  2OE0 A;  1XPV A;  4CDO A;  3FRC A;  5ELG A;  3M8N A;  1T8E B;  3GTU B;  2C3N A;  1U3A A;  2LTK A;  4F9Z A;  1XXU A;  4ZBA A;  3WT2 A;  2CT6 A;  4NHW A;  3F3Q A;  1AQV A;  4KCE A;  2DIZ A;  1F37 A;  1WIK A;  3QOU A;  2KLX A;  4MJA A;  4BPY A;  1M2A A;  3Q18 A;  2AB6 A;  2B7J A;  2VCV A;  3A3T A;  4MF5 A;  3D5J A;  3GKM A;  2WJU A;  5CRD A;  5IPH A;  1GUL A;  1SEN A;  3PIN A;  1EZK A;  2YWN A;  2JL4 A;  5IM9 A;  1LU4 A;  3QD9 A;  1G6Y A;  3GTU A;  2CQ9 A;  4KSM A;  1G7O A;  2I1U A;  4MZW A;  4ZBB A;  2OAD A;  1FB0 A;  4XRD A;  1SL0 B;  2EIO A;  2H66 A;  4IN0 A;  5GSS A;  2YWI A;  1YQ1 A;  1T1V A;  2C0E A;  1AC1 A;  3RAZ A;  3QFA C;  1JZD A;  4MDC A;  2DJK A;  3QMX A;  5IMF A;  4OFM A;  4OCE A;  5D93 A;  1YEP A;  3I69 A;  3CSI A;  1K3L A;  2OBK A;  4TXO B;  4MH2 A;  3CRU A;  2IIY A;  1TI1 A;  4QQ7 A;  2VL2 A;  5G5F A;  1PA3 A;  2K6V A;  1Z9H A;  3Q19 A;  2MBT A;  3IXR A;  3TRX A;  1Y25 A;  1ABA A;  3NIV A;  3US3 A;  1PSQ A;  5AGY A;  1R5P A;  2YWO A;  3CSH A;  4MJB A;  5IPG A;  2LKU A;  2QGV A;  2GVP A;  4K8M A;  2P31 A;  3WYW A;  4RQR A;  2JSZ A;  3ZRE A;  3GA4 A;  4PQ1 A;  3CBU A;  4D73 B;  2FWG A;  5EY6 A;  3UAP A;  2GLR A;  3HY2 A;  2FLS A;  3VWV A;  4FYB A;  1R7H A;  1XWA A;  1F3B A;  2AUV A;  4ID0 A;  4NWY A;  2HXK A;  5CYY A;  5HR0 A;  14GS A;  4RI6 A;  1AUC A;  2C3Q A;  2VIM A;  3R2Q A;  2QSI A;  2YZU A;  6GSV A;  2C80 A;  4V2N A;  3ZRD A;  2HRF A;  2ES7 A;  1SL2 B;  1IYH A;  2YV9 A;  3GMF A;  2TRC P;  5A4V A;  5KEJ A;  5LCZ A;  3HJO A;  2N5A A;  3FR6 A;  4N0V A;  6GSW A;  7GSS A;  4PUA A;  5B7C A;  4LLR A;  2FWE A;  4I97 A;  2HRN A;  4EKZ A;  1U6T A;  3G9B A;  4GQF A;  3GUR A;  1TXX A;  1K0B A;  3MDK A;  1MD3 A;  2CZ3 A;  1U87 A;  3MNG A;  3H8Q A;  1EOG A;  2X8G A;  4JBB A;  3ZIT A;  4YH2 A;  1F3A A;  1GTI A;  4KDU A;  2V2G A;  1USB A;  4PX1 A;  4ZIL A;  4IP1 A;  1GSE A;  1B9Y C;  1BQ7 A;  2OKA A;  4G2E A;  3DML A;  2DBC A;  2B3S A;  3PGT A;  5ECO B;  2PWJ A;  3DKS A;  2H73 A;  4WR4 A;  5C04 A;  4QL9 A;  6GSX A;  3LQ7 A;  5FHI A;  2H30 A;  5ABR A;  3IOS A;  6GSY A;  1VF2 A;  5ECQ B;  4EDZ A;  2A2R A;  3APO A;  4GRF A;  3ZFL A;  3F0I A;  1N8J A;  3UVH A;  1TRU A;  1WJK A;  1S3C A;  2P5R A;  2HZE B;  1K0A A;  3ME8 A;  9GSS A;  1EP7 A;  2CZ2 A;  2GQM A;  3D0Z A;  2RUF A;  4F0C A;  2FA4 A;  3TOU A;  1XW9 A;  3F9U A;  4PNG A;  1PL2 A;  3EE2 A;  2CA8 A;  2H70 A;  2XPD A;  1O7U A;  5AIS A;  4BA7 A;  2IFQ B;  1URM A;  4KB3 A;  1A8L A;  3P90 A;  1TRW A;  2FGX A;  4IJ3 A;  4L8E A;  1GLP A;  1XWC A;  2RM6 A;  3C8E A;  3D22 A;  6GSS A;  1UN2 A;  3FKF A;  4CW9 A;  4JE1 A;  2PN8 A;  2CX4 A;  1WOU A;  1DBY A;  2OJL A;  3M9J A;  2WGR A;  2IFQ A;  4MF7 A;  3G7I A;  4JR6 A;  2H0I A;  2C1Y A;  1ERW A;  5CP1 A;  3DIE A;  2V32 A;  5AIV A;  1M2D A;  2AJQ B;  4JR4 A;  3F6D A;  3TKS E;  5HQP A;  2YV7 A;  1BYE A;  1OKT A;  4ECJ A;  3TUE A;  2BTO T;  2VLV A;  3P7X A;  1T4Z A;  5A4U A;  5IO0 A;  3HDC A;  2PPT A;  1W4V A;  5IMD A;  2DJ3 A;  1X9M B;  3Q6O A;  2C4J A;  2LQO A;  4NXI A;  4BVY A;  1AXD A;  2RLI A;  3AY8 A;  10GS A;  2FNO A;  1EP8 A;  5JCU A;  3QFB C;  5G1L A;  5C00 A;  2BJX A;  1BED A;  2NDO A;  3QAV A;  2PU9 C;  3WGE A;  2GSS A;  2V6O A;  2N5F A;  2O87 A;  3IAM 2;  2HI7 A;  1NHY A;  1G6W A;  2R5G A;  2C0G A;  2GGT A;  3IV4 A;  5D73 A;  2CAI A;  2GQK A;  2HE3 A;  2RM5 A;  1PN9 A;  3U5R E;  2JZT A;  3C7M A;  3ERW A;  3EMP A;  4NHZ A;  1XOB A;  3LWA A;  5DAK B;  5DDL A;  1YJ6 A;  2IL3 A;  2OE1 A;  1GWC A;  2I81 A;  4GQC A;  3F4T A;  1SKR B;  1KBN A;  1ST9 A;  1SYR A;  1EGO A;  1FB6 A;  5DJL A;  1NW2 A;  4JRR A;  3DEX A;  2EIR A;  1SL1 B;  2H1G A;  2FUG 2;  5GAP D;  1V2A A;  2LNS A;  3D21 A;  2FCH A;  3VUR A;  4NPB A;  1YF1 A;  3PR8 A;  2VCT A;  1ZOF A;  1K0N A;  1PGT A;  3QDN A;  4IJI A;  5F06 A;  4KX4 A;  2IME A;  3C1S A;  3EU4 A;  2MMN A;  2YCD A;  1ZYE A;  3EYT A;  1X0R A;  5F0G A;  2KP1 A;  1VF1 A;  5FWG A;  1QUW A;  4N11 A;  1ZMA A;  4F0B A;  4K9Z A;  2VCX A;  5ECN B;  2VLU A;  3UVT A;  2M46 A;  3KJY A;  2CAQ A;  2OBI A;  1SK2 A;  4AJ6 A;  3L9S A;  2F8A A;  2H1A A;  4KUN A;  3F63 A;  1XWK A;  1J0F A;  4N0Z A;  1G0T A;  2IJY A;  4X43 A;  3P8W A;  3I9V 2;  1S3A A;  3G7Y A;  3IBH A;  4LMV A;  2DSA A;  1K0O A;  1WWJ A;  3ZL5 A;  1A23 A;  2LJK A;  1K0C A;  2R6K A;  4G19 A;  4WBJ A;  1XW6 A;  4HUA A;  3QAG A;  3GHA A;  4QL7 A;  3TKQ A;  3N9J A;  1K0M A;  3HKR A;  1GSF A;  1ML6 A;  2YAN A;  1TU8 A;  5B6N A;  2M72 A;  2F8F A;  2PUK C;  4E8E A;  1RQM A;  3E9J B;  4TKY A;  5J4U A;  1V57 A;  4JED A;  4HZ2 A;  2A4V A;  1BX9 A;  5G2Z A;  3DXB A;  3ZVJ D;  1AW9 A;  2B5E A;  3OR5 A;  2V41 A;  2H0G A;  2DML A;  3IAS 2;  4FYU A;  1R4W A;  1UA5 A;  3CTG A;  3CYN A;  2EIQ A;  4HQZ A;  5HR3 A;  4XS6 A;  3S9F A;  5CRG A;  1GTA A;  2H6X A;  4BWS A;  3KH7 A;  4DSS A;  2P0G A;  1EGR A;  5LD0 A;  3KD0 A;  5A5K A;  2E7P A;  4X1U A;  1GP1 A;  6GSU A;  1OC9 A;  4K0N A;  5KN3 A;  5JWQ B;  5DVB A;  1TI3 A;  3TKP A;  1JLW A;  4E8H A;  3FW2 A;  1ON4 A;  2HNL A;  2XC2 A;  2VCZ A;  3RBT A;  4K7N A;  3F6F A;  3NOF A;  5ECR B;  1TJD A;  4XTS A;  1XCC A;  2YPM A;  4KGI A;  2WS2 A;  4GCI A;  1LJR A;  1J08 A;  2VUP A;  1XIY A;  1O81 A;  4MF6 A;  1YKC A;  1WE0 A;  5DJM A;  4L0U A;  3NZN A;  3DRN A;  5IIZ A;  2HZF A;  2O85 A;  4KH7 A;  1ILO A;  3DWV A;  4F82 A;  1T4Y A;  5KN1 A;  1Y6E A;  1T3B A;  1B9X C;  1K3O A;  1HNC A;  2PVQ A;  4IKH A;  4F03 A;  4F2I A;  2L6C A;  3TDG A;  4WET A;  1QQ2 A;  1U88 A;  2RUE A;  1Q98 A;  1W89 A;  4ILF A;  1GTU A;  4K7I A;  4YQV A;  4FYC A;  1Z6N A;  2VM2 A;  3GX8 A;  5B6M A;  3F4R A;  2B1L A;  2R37 A;  1K0D A;  1THX A;  2AV4 A;  3W8S A;  5CAX A;  4TXO A;  4MPF A;  2L4C A;  5HR2 A;  3IDV A;  4JZQ A;  5JWR B;  3KXO A;  3TB2 A;  4HI7 A;  4HDE A;  4ML1 A;  1Z7R A;  3VK9 A;  2H71 A;  1NM3 A;  5DBQ A;  20GS A;  3EUR A;  2YNX A;  3CMI A;  2I9H A;  2DJ0 A;  3K8N A;  1EEJ A;  3SBC A;  5IMV A;  1AQX A;  2O89 A;  2FA8 A;  5ECH B;  3ZZX A;  3DVW A;  4AGS A;  1CQG A;  1OVN A;  1B4Q A;  1O73 A;  2GZZ A;  1JLV A;  4D73 A;  1XWB A;  5ECK B;  4J2F A;  5B8B A;  2LJA A;  2V6K A;  3APS A;  5ECI B;  1GSQ A;  1OC8 A;  2Z9S A;  3IPZ A;  3TKR A;  2AYT A;  3HZ8 A;  2WUL A;  3MAK A;  4GF0 A;  3FHK A;  3L9V A;  2G2Q A;  1FW1 A;  1OKD A;  2DJJ A;  4O7H A;  3FZ9 A;  1KNG A;  2GSQ A;  4KW6 A;  2H6Z A;  4ZL8 A;  3GST A;  3TRP A;  2B7K A;  2GQL A;  4POK A;  4HEA 2;  2GS3 A;  3I6A A;  3GL5 A;  4ZL7 A;  5GAN D;  1G7E A;  4CHS A;  2WCI A;  1NSW A;  2F51 A;  4GST A;  2YJ7 A;  1A8Y A;  3L78 A;  4YQU A;  3BCI A;  3HZ4 A;  4DSQ A;  1OYJ A;  4WBR D;  2F9S A;  1YY7 A;  1JZR A;  1XVW A;  1VF4 A;  2C0D A;  1TW9 A;  4Z7X A;  3FYG A;  1HNA A;  5IMC A;  2L59 A;  2IPA A;  3VWX A;  12GS A;  1YKA A;  3ZVJ A;  5B8A A;  13GS A;  4K1F A;  1AIU A;  3F3R A;  4IBP A;  4PNF A;  2DJ2 A;  4EF0 A;  3VWW A;  1TK0 B;  1F9M A;  1UC7 A;  3QR6 A;  4LL1 B;  1E6B A;  4G10 A;  3HVV A;  5D96 A;  3GUS A;  2IN3 A;  2VCW A;  5CRE A;  4GWR A;  1F2E A;  1QXH A;  2YN1 A;  4P3Y B;  1QMV A;  3EWL A;  2CX3 A;  4O92 A;  3BJ5 A;  1PD2 1;  2CVD A;  2VCQ A;  2WDU A;  3H93 A;  1GNE A;  2FD3 A;  1JFU A;  3G7J A;  4PUR A;  1HYU A;  4IW9 A;  2KHP A;  4GXZ A;  3FEU A;  1EOH A;  4EUY A;  1XFL A;  3TJK A;  1PX7 A;  2HZE A;  2JSY A;  4MP4 A;  1HD2 A;  2IMK A;  5JWO B;  1V98 A;  4TR4 A;  5E59 A;  2NVL A;  1ZL9 A;  1T7P B;  4KDY A;  3RHC A;  3GX0 A;  3DYR A;  2O8V B;  5HFK A;  3F4S A;  5LNK e;  2M80 A;  4HJM A;  4RUV A;  2H1B A;  3EVI A;  1SJ6 A;  2K18 A;  1O8X A;  4EDY A;  3GFK A;  3LXT A;  1M7T A;  1F6M C;  2H01 A;  1WRY A;  1I9D A;  4EC0 A;  1I5G A;  1CQH A;  2MMZ A;  2ZNM A;  1XZO A;  1YDK A;  3KIJ A;  2ZUP A;  1TK8 B;  5KN2 A;  5GST A;  4IEL A;  5J3R A;  1J9B A;  3TRQ A;  4H86 A;  5AN1 A;  4XS4 B;  4YAP A;  5JCW A;  4ZB6 A;  3EMX A;  5ID2 B;  4ISD A;  2ON5 A;  3ERG A;  2EC4 A;  2LRC A;  3ZML A;  2TRX A;  2FWF A;  5H5R A;  4V1A p;  2MZC A;  1PRX A;  3L9U A;  1BAY A;  5E4W A;  5HR1 A;  4GSS A;  3RPP A;  1X9S B;  1X5D A;  3J7Y k;  2YWM A;  4MH3 A;  1M2B A;  2X99 A;  3HYP A;  1ACV A;  5CRW A;  2X64 A;  4AF2 A;  2RII A;  4XS4 A;  2H19 A;  2J23 A;  3C1R A;  4HU7 A;  3FR3 A;  5ID2 A;  1SD9 A;  2I4A A;  5D9T A;  3E0U A;  3GYK A;  1A2J A;  4MPG A;  2AAW A;  5D9X A;  1X5E A;  4NMU A;  5J9C A;  16GS A;  5HFG A;  2K9F A;  1GH2 A;  2JAD A;  1SU9 A;  2GSR A;  5IOX A;  4IP6 A;  1E2Y A;  3C71 A;  2H0H A;  4Q5Q A;  4MLY A;  3UOM A;  4L0W A;  4AJ8 A;  4TR1 B;  3A5W A;  1TRV A;  1U3I A;  4ZXG A;  4BL7 A;  3H1N A;  3V1W A;  1SJZ A;  3IK7 A;  2ON7 A;  4TN8 A;  3FY7 A;  3GN3 A;  4Q5F A;  5ECP B;  3KP9 A;  2LS5 A;  3M3M A;  5H5S A;  2IMF A;  1GNW A;  4I8B A;  4KE3 A;  5DAK A;  4YAV A;  1ERU A;  2MBS A;  1SD8 A;  2IMD A;  4YQM A;  22GS A;  1M0U A;  4POL A;  2LRN A;  2DJ1 A;  1TK5 B;  3UEM A;  3GV1 A;  1HQO A;  4TOP A;  2DMM A;  3N5O A;  1A2M A;  3LEF A;  4PGT A;  2LRT A;  4TRX A;  5G30 A;  1PL1 A;  2IMI A;  2QC7 A;  2N5B A;  1R26 A;  1PKW A;  4RQX A;  3FK8 A;  2ZCT A;  1TRS A;  5DCG A;  2OE3 A;  3ZTL A;  5AIX A;  2H76 A;  3CTF A;  5G5E A;  3BCK A;  2H75 A;  2OAC A;  1DE2 A;  1S3D A;  1LBK A;  2GZY A;  2JU5 A;  3DD3 A;  4FO5 A;  3SWL A;  2XPE A;  3GL3 A;  3RPN A;  1H75 A;  1QK8 A;  4XS1 A;  4ZL9 A;  1X5C A;  4FIW A;  3KCM A;  3ZLP A;  4KSO A;  1THO A;  3TJB A;  2HLS A;  3QCP A;  1MDK A;  3KH9 A;  3IE3 A;  4POB A;  2KP2 A;  4EVM A;  1KEB A;  2F3M A;  3LFL A;  3IC4 A;  1YZX A;  4LL4 B;  4TVE A;  5IQY A;  1R5A A;  1ZYQ B;  1N2A A;  1AQW A;  1O8W A;  4N10 A;  1OC3 A;  4L5O A;  4OFT A;  4I2T A;  5CNW A;  5D9W A;  4PQH A;  18GS A;  4IQ1 A;  2K8S A;  3IR4 A;  4TW5 A;  2PBJ A;  2JZR A;  3L0H A;  1SK0 A;  1JZO A;  1FAA A;  3HVX A;  3VI5 A;  1MD4 A;  1GTB A;  2R4V A;  2VLT A;  1WPI A;  3LGC A;  2H74 A;  3Q74 A;  3LJR A;  2B1K A;  2LJR A;  3GKX A;  1EEM A;  2HYX A;  6GST A;  3M9K A;  2WZ9 A;  1ZCP A;  1WMJ A;  2YOI A; 
#chains in the Genus database with same CATH topology
 4ACS A;  1B8X A;  2B5Y A;  2DKH A;  4EE0 A;  5CRH A;  1T00 A;  1B4P A;  2NTO A;  1VGL A;  3C73 A;  1BG5 A;  1TU7 A;  2H72 A;  1SK1 A;  3GKN A;  3QPM A;  4IS0 A;  4NAX A;  2V1M A;  2VL3 A;  2B5X A;  2YP6 A;  4GTU A;  4WR5 A;  3CXG A;  2VAF A;  5H5Q A;  2VL9 A;  4OO5 A;  4HQS A;  3LYK A;  2CV4 A;  5CO3 A;  1FOV A;  2E2G A;  2WRT A;  3MSZ A;  1S3R A;  3IHG A;  3KTL A;  3TJF A;  1GUH A;  3VPQ A;  3ERF A;  2C3T A;  5ELA A;  3FZ4 A;  4MA9 A;  3A2W A;  1B48 A;  4MCU A;  1FVJ A;  3GH9 A;  3GRX A;  1GSD A;  2E2M A;  3UAR A;  1WP0 A;  1FO5 A;  3KZQ A;  3GIX A;  1X9W B;  1XW5 A;  2MMO A;  3RDW A;  3O76 A;  1OE7 A;  1V58 A;  5G1K A;  4PUF C;  4O32 A;  2D2Z A;  2KUC A;  4I6X A;  3GH6 A;  5GZZ B;  4L5L A;  17GS A;  2R0C A;  3IK9 A;  3FR9 A;  2CVK A;  1H4O A;  3KMO A;  4EXJ A;  4N30 A;  1JZW A;  4OD7 A;  1ERV A;  4K5S A;  1OAZ A;  4HU9 A;  1M3I A;  3IA1 A;  4GLT A;  3UJ1 A;  5EVO A;  4IHU A;  4V2M A;  1MDI A;  3VI7 A;  4MAB A;  4BWQ A;  3A2X A;  4JU5 A;  3ISO A;  3JCM L;  4MZB A;  3TGZ A;  2VOC A;  1GUM A;  4KA0 A;  2E0Q A;  2PMT A;  1XVQ A;  3HHV A;  3D6I A;  4ULX A;  2X8C A;  3W6G A;  1PMT A;  2LV3 A;  1GRX A;  2HSY A;  3I43 A;  2XBI A;  5IMZ A;  4X0X A;  1SKS B;  3IC8 A;  5ENU A;  2WFC A;  3EIN A;  4DEJ A;  1GSY A;  4ZB8 A;  5COH A;  4AJ7 A;  3ZMK A;  1SYX A;  1XBS A;  3ED3 A;  4J56 E;  2PGT A;  4ECI A;  4OO4 A;  1M9B A;  3WGX A;  1GSU A;  3H4K A;  4POM A;  3A2V A;  1Z3E A;  1V9W A;  3KGK A;  2DIY A;  3IRA A;  2NBS A;  3VWU A;  4BVX B;  3LYP A;  1VF3 A;  5KN0 A;  1ERT A;  3KMN A;  2FHE A;  2J9H A;  3P2A A;  1DSB A;  4WF4 A;  2AHE A;  1A0F A;  4ECC A;  3KTB A;  3MWH A;  3W8J A;  2LUS A;  4PQI A;  2DLX A;  2JZS A;  2L5L A;  4IVF A;  3VFI A;  5L71 A;  1IYI A;  5ECS A;  1TKD B;  1FHE A;  2P5Q A;  4WEY A;  1AAZ A;  1Q4J A;  5DAL B;  4RI7 A;  1QFN A;  1ZGN A;  1QGV A;  3KP8 A;  3FZ5 A;  4BVX A;  2GT6 A;  3VLN A;  1MTC A;  4YKF A;  1EV4 A;  1O6J A;  2ALB A;  2KOK A;  2VD1 A;  3O6T A;  1RW1 A;  3PH9 A;  4O5Q A;  3ME7 A;  3FMW A;  3HJM A;  2PVO C;  2I3Y A;  3CRT A;  4Q5R A;  1FG4 A;  4XCS A;  3HJP A;  3ZIV A;  5DAL A;  3ZYW A;  3HXS A;  4NV5 A;  5F8B A;  2L4Q A;  4O5R A;  1A0R P;  3O3T A;  2A2S A;  1M9A A;  1GL8 A;  1A24 A;  2VM1 A;  4ZB9 A;  5IOW A;  2LST A;  5INY A;  3DVX A;  3ZFB A;  2GZP A;  4J57 E;  1ZYN A;  3EC3 A;  5HFI A;  1EV9 A;  3M0F A;  1M3J A;  2OA7 A;  3LXZ A;  4MK3 A;  5EPF A;  4TR3 A;  3H79 A;  4O5U A;  1O85 A;  2H1D A;  3TCO A;  5A4W A;  2HFD A;  2IWT A;  1OE8 A;  5D9V A;  3LSZ A;  5ECM B;  2QKE A;  5J41 A;  3J7Y b;  4G0I A;  4G9H A;  4TXV A;  3D4T A;  4BVY B;  4Z2T A;  3LG6 A;  4GSN A;  1C72 A;  2LQQ A;  2WB9 A;  5DQS A;  5FT3 A;  4I5Q A;  3U6V A;  2BMX A;  3BBY A;  5EL8 A;  4KND A;  4ZIJ A;  4MMM A;  1FVK A;  3HA9 A;  1Z5Y E;  4OCF A;  4OMV A;  4PXO A;  11GS A;  2CVB A;  1PQN A;  3WGD A;  3GSS A;  3UMA A;  3HCZ A;  5BMU A;  4TR0 A;  2LNT A;  4MZC A;  4I2U A;  3F8U A;  1KTE A;  19GS A;  4ECB A;  2DKI A;  1JHB A;  1PX6 A;  3HVS A;  2PER A;  1MEK A;  3TKS C;  4KDX A;  3ZIJ A;  4WKW A;  3TOT A;  2YZH A;  3TJG A;  3KEB A;  4MJC A;  2LEG A;  3WD6 A;  2L6D A;  4NV2 A;  2TIR A;  4OFN A;  2GDR A;  1NHO A;  3L4N A;  3TJJ A;  2MMA A;  2H6Y A;  5D8I A;  2FWH A;  3WT1 A;  3GNJ A;  4K5R A;  4Q5N A;  3EU3 A;  1SKW B;  3UIW A;  5JCG A;  4ZBD A;  2B6M A;  1XWG A;  4WXT A;  4G0L A;  4LMW A;  2HSH A;  3GKK A;  1SJI A;  4XHM A;  4LA1 A;  4XRA A;  4HZ4 A;  2C8U A;  2VO4 A;  3UBL A;  4MJE A;  2JAC A;  2HT9 A;  4K0G A;  5IO2 A;  4HS1 A;  4OWY A;  2XHF A;  5F05 A;  1GLQ A;  2L5O A;  2YJH A;  3HD5 A;  4V1A g;  5F07 A;  3UBK A;  1YF0 A;  3VPT A;  4WF5 A;  4DVC A;  1EWX A;  4TR1 A;  4FH8 A;  5G31 A;  1TTZ A;  2X8H A;  3UL3 A;  1DE1 A;  1PKZ A;  5DCH A;  1YEX A;  1DUG A;  4K7O A;  4KCA A;  1Z6M A;  4K2D A;  2DC5 A;  2MYG A;  4IQA A;  1M99 A;  1K3Y A;  5DQY A;  1VRS D;  4EL1 A;  1RK4 A;  2GST A;  8GSS A;  3LOR A;  1MDJ A;  3IHQ A;  4V2L A;  3TKS A;  1HNB A;  1Z7P A;  4HJ2 A;  2G0F A;  2H8L A;  2O7K A;  4KAE A;  2XBQ A;  4XIH A;  2GTU A;  1A2L A;  3FZA A;  4IGJ A;  4K6X A;  4ML6 A;  1UVZ A;  2L57 A;  1ZZY A;  2R2J A;  1XOA A;  5ECL B;  3QAW A;  2GT5 A;  4DSR A;  4YKG A;  1GUK A;  1TDI A;  3E3E A;  5IMA A;  2FY6 A;  3APQ A;  3CSJ A;  3DGQ A;  3BD2 A;  1BJX A;  3M1G A;  2K8V A;  1GSS A;  2VD0 A;  3RHB A;  3D4M A;  2C0F A;  2R3X A;  1TOF A;  4DSS B;  2REM A;  3BOA A;  3KM6 A;  5J5N A;  5J9B A;  1TP9 A;  1V40 A;  1OC9 B;  4EO3 A;  4HOJ A;  2VL2 C;  2NPB A;  2OE0 A;  1XPV A;  4CDO A;  3FRC A;  5ELG A;  3M8N A;  1T8E B;  3GTU B;  2C3N A;  1U3A A;  2LTK A;  4F9Z A;  1XXU A;  4ZBA A;  3WT2 A;  2CT6 A;  4NHW A;  3F3Q A;  1AQV A;  4KCE A;  2DIZ A;  1F37 A;  1WIK A;  3QOU A;  2KLX A;  4MJA A;  4BPY A;  1M2A A;  3Q18 A;  2AB6 A;  2B7J A;  2VCV A;  3A3T A;  4MF5 A;  3D5J A;  3GKM A;  2WJU A;  5CRD A;  5IPH A;  1GUL A;  1SEN A;  3PIN A;  1EZK A;  2YWN A;  2JL4 A;  5IM9 A;  1LU4 A;  3QD9 A;  1G6Y A;  3GTU A;  2CQ9 A;  4KSM A;  1G7O A;  2I1U A;  4MZW A;  4ZBB A;  2OAD A;  1FB0 A;  4XRD A;  1SL0 B;  2EIO A;  2H66 A;  4IN0 A;  5GSS A;  2YWI A;  1YQ1 A;  1T1V A;  2C0E A;  1AC1 A;  3RAZ A;  3A5I A;  3QFA C;  1JZD A;  4MDC A;  2DJK A;  3QMX A;  5IMF A;  4OFM A;  4OCE A;  5D93 A;  2UZ8 A;  1YEP A;  3I69 A;  3CSI A;  1K3L A;  2OBK A;  4TXO B;  4MH2 A;  3CRU A;  2IIY A;  1TI1 A;  4QQ7 A;  2VL2 A;  5G5F A;  1PA3 A;  2K6V A;  1Z9H A;  3Q19 A;  2MBT A;  3IXR A;  3TRX A;  1Y25 A;  1ABA A;  3NIV A;  3US3 A;  1PSQ A;  5AGY A;  1R5P A;  2YWO A;  3CSH A;  4MJB A;  5IPG A;  2LKU A;  2QGV A;  2GVP A;  4K8M A;  4MNN A;  2P31 A;  3WYW A;  4RQR A;  2JSZ A;  3ZRE A;  3GA4 A;  4PQ1 A;  3CBU A;  4D73 B;  2FWG A;  2R0P A;  5EY6 A;  3UAP A;  2GLR A;  3HY2 A;  2FLS A;  2X4A A;  3VWV A;  4FYB A;  1R7H A;  1XWA A;  1F3B A;  2AUV A;  4ID0 A;  4NWY A;  2HXK A;  5CYY A;  5HR0 A;  14GS A;  4RI6 A;  1AUC A;  2C3Q A;  2VIM A;  3R2Q A;  2QSI A;  2YZU A;  6GSV A;  2C80 A;  4V2N A;  3ZRD A;  2HRF A;  2ES7 A;  1SL2 B;  1IYH A;  2YV9 A;  3GMF A;  2TRC P;  5A4V A;  5KEJ A;  5LCZ A;  3HJO A;  2N5A A;  3FR6 A;  4N0V A;  2A4H A;  6GSW A;  7GSS A;  4PUA A;  5B7C A;  4LLR A;  2FWE A;  4I97 A;  2HRN A;  4EKZ A;  1U6T A;  3G9B A;  4GQF A;  3GUR A;  1TXX A;  1K0B A;  3MDK A;  1MD3 A;  5KOX A;  2CZ3 A;  1U87 A;  3MNG A;  3H8Q A;  1EOG A;  2X8G A;  4JBB A;  3ZIT A;  4YH2 A;  1F3A A;  1GTI A;  4KDU A;  2V2G A;  1USB A;  4PX1 A;  4ZIL A;  4X4J A;  4IP1 A;  1GSE A;  1B9Y C;  1PN0 A;  1BQ7 A;  2OKA A;  4G2E A;  3DML A;  2DBC A;  2B3S A;  3PGT A;  5ECO B;  3R3E A;  2PWJ A;  3DKS A;  2H73 A;  4WR4 A;  5C04 A;  4EIQ A;  4QL9 A;  6GSX A;  3LQ7 A;  5FHI A;  2H30 A;  5ABR A;  3IOS A;  4Z2U A;  6GSY A;  1VF2 A;  5ECQ B;  4EDZ A;  2A2R A;  3APO A;  4GRF A;  3ZFL A;  3F0I A;  1N8J A;  3UVH A;  1TRU A;  1WJK A;  1S3C A;  2P5R A;  2HZE B;  2HRA A;  1K0A A;  3ME8 A;  9GSS A;  1EP7 A;  2CZ2 A;  2GQM A;  3D0Z A;  2RUF A;  4F0C A;  2FA4 A;  3TOU A;  1XW9 A;  3F9U A;  4PNG A;  1PL2 A;  3EE2 A;  2CA8 A;  2H70 A;  2XPD A;  3CQF A;  1O7U A;  5AIS A;  4BA7 A;  2IFQ B;  1URM A;  4KB3 A;  1A8L A;  3P90 A;  1TRW A;  2FGX A;  4IJ3 A;  4L8E A;  1GLP A;  1XWC A;  2RM6 A;  3C8E A;  3D22 A;  6GSS A;  1UN2 A;  1XG8 A;  3FKF A;  4CW9 A;  4JE1 A;  2PN8 A;  2CX4 A;  1WOU A;  1DBY A;  2OJL A;  3M9J A;  2WGR A;  2IFQ A;  4MF7 A;  3G7I A;  4JR6 A;  2H0I A;  2C1Y A;  1ERW A;  5CP1 A;  3DIE A;  2V32 A;  5AIV A;  1M2D A;  2AJQ B;  4JR4 A;  3F6D A;  3TKS E;  5HQP A;  2YV7 A;  1BYE A;  1OKT A;  4ECJ A;  3TUE A;  2BTO T;  2VLV A;  3P7X A;  1T4Z A;  5A4U A;  5IO0 A;  3HDC A;  2PPT A;  1W4V A;  5IMD A;  2DJ3 A;  1X9M B;  3Q6O A;  2C4J A;  2LQO A;  4NXI A;  4BVY A;  1AXD A;  2RLI A;  3AY8 A;  10GS A;  2FNO A;  1EP8 A;  5JCU A;  3QFB C;  5G1L A;  5C00 A;  2BJX A;  1BED A;  2NDO A;  3QAV A;  2PU9 C;  3WGE A;  2GSS A;  2V6O A;  2N5F A;  2O87 A;  3IAM 2;  2HI7 A;  1NHY A;  1G6W A;  2R5G A;  2C0G A;  2GGT A;  3IV4 A;  4BL7 B;  5D73 A;  2CAI A;  2GQK A;  2HE3 A;  2RM5 A;  1PN9 A;  3U5R E;  2JZT A;  3C7M A;  2HSM A;  3ERW A;  3EMP A;  4NHZ A;  1XOB A;  3LWA A;  5DAK B;  5DDL A;  1YJ6 A;  2IL3 A;  2OE1 A;  1GWC A;  2I81 A;  4GQC A;  3F4T A;  1SKR B;  1KBN A;  1ST9 A;  1SYR A;  1EGO A;  1FB6 A;  5DJL A;  1NW2 A;  4JRR A;  3DEX A;  2EIR A;  1SL1 B;  2H1G A;  2FUG 2;  5GAP D;  1V2A A;  2LNS A;  3D21 A;  2FCH A;  3VUR A;  4NPB A;  1YF1 A;  1ZYP A;  3PR8 A;  2VCT A;  1ZOF A;  1K0N A;  1PGT A;  3QDN A;  4IJI A;  5F06 A;  4KX4 A;  2IME A;  3C1S A;  3EU4 A;  2MMN A;  2YCD A;  1ZYE A;  3EYT A;  1X0R A;  5F0G A;  2KP1 A;  1VF1 A;  5FWG A;  1QUW A;  4N11 A;  1ZMA A;  5BRT A;  4F0B A;  4K9Z A;  2VCX A;  5ECN B;  2VLU A;  3UVT A;  2M46 A;  3KJY A;  2CAQ A;  4ICY A;  2OBI A;  1SK2 A;  4AJ6 A;  3L9S A;  2F8A A;  2H1A A;  4KUN A;  3F63 A;  1XWK A;  1J0F A;  4N0Z A;  1G0T A;  2IJY A;  4X43 A;  3P8W A;  1FOH A;  3I9V 2;  1S3A A;  3G7Y A;  3IBH A;  4LMV A;  2DSA A;  1K0O A;  1WWJ A;  3ZL5 A;  1A23 A;  2LJK A;  1K0C A;  2R6K A;  4G19 A;  4WBJ A;  1XW6 A;  4HUA A;  3QAG A;  3GHA A;  4QL7 A;  3TKQ A;  3N9J A;  1K0M A;  3HKR A;  1GSF A;  1ML6 A;  2YAN A;  1TU8 A;  5B6N A;  2M72 A;  2F8F A;  2PUK C;  4E8E A;  1RQM A;  3E9J B;  4TKY A;  5J4U A;  1V57 A;  4JED A;  4HZ2 A;  2A4V A;  1BX9 A;  5G2Z A;  3DXB A;  3ZVJ D;  1AW9 A;  2B5E A;  3OR5 A;  2V41 A;  2H0G A;  2DML A;  3IAS 2;  4FYU A;  1R4W A;  1UA5 A;  3CTG A;  3CYN A;  2EIQ A;  4HQZ A;  5HR3 A;  4XS6 A;  3MYD A;  3S9F A;  5CRG A;  1GTA A;  2H6X A;  4BWS A;  3KH7 A;  4DSS A;  4Z2R A;  2P0G A;  1EGR A;  5LD0 A;  4K2X A;  3KD0 A;  5A5K A;  2E7P A;  4X1U A;  1GP1 A;  6GSU A;  1OC9 A;  4K0N A;  5KN3 A;  5JWQ B;  5DVB A;  1TI3 A;  3TKP A;  1JLW A;  4E8H A;  3FW2 A;  1ON4 A;  2HNL A;  2XC2 A;  2VCZ A;  3RBT A;  4K7N A;  3F6F A;  3NOF A;  5ECR B;  1TJD A;  4XTS A;  1XCC A;  2YPM A;  4KGI A;  2WS2 A;  4GCI A;  1LJR A;  1J08 A;  2VUP A;  1XIY A;  1O81 A;  4MF6 A;  1YKC A;  1WE0 A;  5DJM A;  4L0U A;  3NZN A;  3DRN A;  5IIZ A;  2HZF A;  2O85 A;  4KH7 A;  1ILO A;  3DWV A;  4PTS A;  4F82 A;  1T4Y A;  5KN1 A;  1Y6E A;  1T3B A;  1B9X C;  1K3O A;  1HNC A;  2PVQ A;  4IKH A;  4F03 A;  2QA2 A;  4F2I A;  2L6C A;  3TDG A;  4WET A;  1QQ2 A;  1U88 A;  2RUE A;  1Q98 A;  1W89 A;  4ILF A;  1GTU A;  4K7I A;  4YQV A;  4FYC A;  1Z6N A;  2VM2 A;  3GX8 A;  5B6M A;  3F4R A;  2B1L A;  2R37 A;  4FQU A;  1K0D A;  1THX A;  2AV4 A;  3W8S A;  5CAX A;  4TXO A;  4MPF A;  2L4C A;  5HR2 A;  3IDV A;  4JZQ A;  5JWR B;  3KXO A;  3TB2 A;  4HI7 A;  4HDE A;  4ML1 A;  1Z7R A;  3VK9 A;  2H71 A;  2HRK A;  1NM3 A;  5DBQ A;  20GS A;  3EUR A;  2YNX A;  4USS A;  3CMI A;  2I9H A;  2DJ0 A;  3K8N A;  1EEJ A;  3SBC A;  5IMV A;  1AQX A;  2O89 A;  2FA8 A;  5ECH B;  3ZZX A;  3DVW A;  4AGS A;  1CQG A;  1OVN A;  1B4Q A;  1O73 A;  2GZZ A;  1JLV A;  4D73 A;  1XWB A;  5ECK B;  4J2F A;  5B8B A;  2LJA A;  2V6K A;  3APS A;  5ECI B;  1GSQ A;  1OC8 A;  2Z9S A;  3IPZ A;  3TKR A;  2AYT A;  3HZ8 A;  2WUL A;  3MAK A;  4GF0 A;  3FHK A;  3L9V A;  2G2Q A;  1FW1 A;  1OKD A;  2DJJ A;  4O7H A;  3FZ9 A;  1KNG A;  2GSQ A;  4KW6 A;  2H6Z A;  4ZL8 A;  3GST A;  3TRP A;  2B7K A;  2GQL A;  4POK A;  4HEA 2;  2GS3 A;  3I6A A;  3GL5 A;  4ZL7 A;  5GAN D;  4BIK A;  1G7E A;  4CHS A;  2WCI A;  1NSW A;  2F51 A;  4GST A;  2YJ7 A;  1A8Y A;  4KF9 A;  3L78 A;  4YQU A;  3MIX A;  3BCI A;  3HZ4 A;  4DSQ A;  1OYJ A;  4WBR D;  2F9S A;  1YY7 A;  1JZR A;  1XVW A;  1VF4 A;  2C0D A;  1TW9 A;  4Z7X A;  3FYG A;  1HNA A;  3EPT A;  2L59 A;  5IMC A;  2IPA A;  3VWX A;  12GS A;  1YKA A;  3ZVJ A;  5B8A A;  13GS A;  4K1F A;  1AIU A;  3F3R A;  4IBP A;  4PNF A;  2DJ2 A;  4EIP A;  4EF0 A;  3VWW A;  1TK0 B;  1F9M A;  1UC7 A;  3QR6 A;  4LL1 B;  1E6B A;  4G10 A;  3HVV A;  5D96 A;  3GUS A;  2IN3 A;  2VCW A;  5CRE A;  4GWR A;  2R0G A;  1F2E A;  1QXH A;  2YN1 A;  4P3Y B;  1QMV A;  3EWL A;  2CX3 A;  4O92 A;  3BJ5 A;  1PD2 1;  2CVD A;  2VCQ A;  2WDU A;  3H93 A;  1GNE A;  2FD3 A;  1JFU A;  3G7J A;  4PUR A;  1HYU A;  1PFO A;  2KHP A;  4GXZ A;  4IW9 A;  4A5P A;  3FEU A;  1EOH A;  4EUY A;  1XFL A;  3TJK A;  1PX7 A;  2HZE A;  2JSY A;  4MP4 A;  1HD2 A;  2IMK A;  5JWO B;  1V98 A;  4TR4 A;  5E59 A;  2NVL A;  1ZL9 A;  1T7P B;  4KDY A;  3RHC A;  3GX0 A;  3DYR A;  2O8V B;  5HFK A;  3F4S A;  5LNK e;  2M80 A;  4HJM A;  4RUV A;  2H1B A;  3EVI A;  1SJ6 A;  2K18 A;  1O8X A;  4EDY A;  3GFK A;  3LXT A;  1M7T A;  1F6M C;  2H01 A;  1WRY A;  1I9D A;  4EC0 A;  1I5G A;  1CQH A;  4CY6 A;  2MMZ A;  2ZNM A;  1XZO A;  1YDK A;  3KIJ A;  2ZUP A;  1TK8 B;  5KN2 A;  5GST A;  4IEL A;  5J3R A;  1J9B A;  3TRQ A;  4H86 A;  5AN1 A;  4XS4 B;  4YAP A;  5JCW A;  4ZB6 A;  3EMX A;  5ID2 B;  4ISD A;  2ON5 A;  3ERG A;  2EC4 A;  2LRC A;  3ZML A;  2TRX A;  2FWF A;  5H5R A;  4V1A p;  2MZC A;  1PRX A;  3L9U A;  1BAY A;  5E4W A;  5HR1 A;  4GSS A;  3LW9 A;  3RPP A;  1X9S B;  1X5D A;  3J7Y k;  2YWM A;  4MH3 A;  1M2B A;  2X99 A;  3HYP A;  1ACV A;  5CRW A;  2X64 A;  4AF2 A;  2RII A;  4XS4 A;  2H19 A;  2J23 A;  3C1R A;  4HU7 A;  3FR3 A;  5ID2 A;  1SD9 A;  2I4A A;  5D9T A;  3E0U A;  3GYK A;  1A2J A;  4MPG A;  2AAW A;  5D9X A;  3HVN A;  1X5E A;  4NMU A;  5J9C A;  16GS A;  5HFG A;  2K9F A;  4HSC X;  1GH2 A;  2JAD A;  1SU9 A;  2GSR A;  5IOX A;  4IP6 A;  1E2Y A;  3C71 A;  2H0H A;  5KOW A;  4Q5Q A;  4MLY A;  3UOM A;  4L0W A;  4AJ8 A;  4TR1 B;  3A5W A;  1TRV A;  1U3I A;  4ZXG A;  4BL7 A;  3H1N A;  3V1W A;  1SJZ A;  3IK7 A;  2ON7 A;  4TN8 A;  3FY7 A;  3GN3 A;  4Q5F A;  5ECP B;  3KP9 A;  2LS5 A;  3M3M A;  5H5S A;  2IMF A;  1GNW A;  4I8B A;  4KE3 A;  5DAK A;  4YAV A;  1ERU A;  2MBS A;  1SD8 A;  2IMD A;  4YQM A;  22GS A;  3PPU A;  4G0K A;  1M0U A;  2X49 A;  4POL A;  2LRN A;  2DJ1 A;  1TK5 B;  2QA1 A;  3UEM A;  3GV1 A;  1HQO A;  4TOP A;  2DMM A;  3N5O A;  1A2M A;  3LEF A;  4PGT A;  2LRT A;  4TRX A;  5G30 A;  1PL1 A;  2IMI A;  2QC7 A;  2N5B A;  1R26 A;  1PKW A;  4RQX A;  3FK8 A;  2ZCT A;  1TRS A;  5DCG A;  2OE3 A;  3ZTL A;  5AIX A;  2H76 A;  3CTF A;  5G5E A;  3BCK A;  2H75 A;  2OAC A;  1DE2 A;  1S3D A;  1LBK A;  2GZY A;  2JU5 A;  3DD3 A;  4FO5 A;  3SWL A;  2XPE A;  3GL3 A;  3RPN A;  1H75 A;  1QK8 A;  4XS1 A;  4ZL9 A;  1X5C A;  4FIW A;  3KCM A;  3ZLP A;  4KSO A;  1THO A;  2A2P A;  3TJB A;  2HLS A;  3QCP A;  1MDK A;  3KH9 A;  3IE3 A;  4POB A;  2KP2 A;  4EVM A;  1KEB A;  2F3M A;  3LFL A;  3IC4 A;  1YZX A;  4LL4 B;  4TVE A;  5IQY A;  1R5A A;  1ZYQ B;  4CY8 A;  1N2A A;  1AQW A;  1O8W A;  4N10 A;  1OC3 A;  4L5O A;  4OFT A;  4I2T A;  5CNW A;  5D9W A;  4PQH A;  18GS A;  4IQ1 A;  2K8S A;  3IR4 A;  4TW5 A;  2PBJ A;  2JZR A;  3L0H A;  1SK0 A;  1JZO A;  1FAA A;  3HVX A;  3VI5 A;  1MD4 A;  1GTB A;  2R4V A;  2VLT A;  1WPI A;  3LGC A;  2H74 A;  3Q74 A;  3LJR A;  2B1K A;  2LJR A;  3GKX A;  1EEM A;  2HYX A;  6GST A;  3M9K A;  2WZ9 A;  1ZCP A;  1WMJ A;  2YOI A; 
#chains in the Genus database with same CATH homology
 4ACS A;  1B8X A;  2B5Y A;  2DKH A;  4EE0 A;  5CRH A;  1T00 A;  1B4P A;  2NTO A;  1VGL A;  3C73 A;  1BG5 A;  1TU7 A;  2H72 A;  1SK1 A;  3GKN A;  3QPM A;  4IS0 A;  4NAX A;  2V1M A;  2VL3 A;  2B5X A;  2YP6 A;  4GTU A;  4WR5 A;  3CXG A;  2VAF A;  5H5Q A;  2VL9 A;  4OO5 A;  4HQS A;  3LYK A;  2CV4 A;  5CO3 A;  1FOV A;  2E2G A;  2WRT A;  3MSZ A;  3IHG A;  3KTL A;  3TJF A;  1GUH A;  3VPQ A;  3ERF A;  2C3T A;  5ELA A;  3FZ4 A;  4MA9 A;  3A2W A;  1B48 A;  4MCU A;  1FVJ A;  3GH9 A;  3GRX A;  1GSD A;  2E2M A;  3UAR A;  1WP0 A;  1FO5 A;  3KZQ A;  3GIX A;  1X9W B;  1XW5 A;  2MMO A;  3RDW A;  3O76 A;  1OE7 A;  1V58 A;  5G1K A;  4PUF C;  4O32 A;  2D2Z A;  2KUC A;  4I6X A;  3GH6 A;  5GZZ B;  4L5L A;  17GS A;  2R0C A;  3IK9 A;  3FR9 A;  2CVK A;  1H4O A;  3KMO A;  4EXJ A;  4N30 A;  1JZW A;  4OD7 A;  1ERV A;  4K5S A;  1OAZ A;  4HU9 A;  3IA1 A;  4GLT A;  3UJ1 A;  5EVO A;  4IHU A;  4V2M A;  1MDI A;  3VI7 A;  4MAB A;  4BWQ A;  3A2X A;  4JU5 A;  3ISO A;  3JCM L;  4MZB A;  3TGZ A;  2VOC A;  1GUM A;  4KA0 A;  2E0Q A;  2PMT A;  1XVQ A;  3HHV A;  3D6I A;  4ULX A;  2X8C A;  3W6G A;  1PMT A;  2LV3 A;  1GRX A;  2HSY A;  3I43 A;  2XBI A;  5IMZ A;  4X0X A;  1SKS B;  3IC8 A;  5ENU A;  2WFC A;  3EIN A;  4DEJ A;  1GSY A;  4ZB8 A;  5COH A;  4AJ7 A;  3ZMK A;  1SYX A;  1XBS A;  3ED3 A;  4J56 E;  2PGT A;  4ECI A;  4OO4 A;  1M9B A;  3WGX A;  1GSU A;  3H4K A;  4POM A;  3A2V A;  1Z3E A;  1V9W A;  3KGK A;  2DIY A;  3IRA A;  2NBS A;  3VWU A;  4BVX B;  3LYP A;  1VF3 A;  5KN0 A;  1ERT A;  3KMN A;  2FHE A;  2J9H A;  3P2A A;  1DSB A;  4WF4 A;  2AHE A;  1A0F A;  4ECC A;  3KTB A;  3MWH A;  3W8J A;  2LUS A;  4PQI A;  2DLX A;  2JZS A;  2L5L A;  4IVF A;  3VFI A;  5L71 A;  1IYI A;  5ECS A;  1TKD B;  1FHE A;  2P5Q A;  4WEY A;  1AAZ A;  1Q4J A;  5DAL B;  4RI7 A;  1QFN A;  1ZGN A;  1QGV A;  3KP8 A;  3FZ5 A;  4BVX A;  2GT6 A;  3VLN A;  1MTC A;  4YKF A;  1EV4 A;  1O6J A;  2ALB A;  2KOK A;  2VD1 A;  3O6T A;  1RW1 A;  3PH9 A;  4O5Q A;  3ME7 A;  3FMW A;  3HJM A;  2PVO C;  2I3Y A;  3CRT A;  4Q5R A;  1FG4 A;  4XCS A;  3HJP A;  3ZIV A;  5DAL A;  3ZYW A;  3HXS A;  4NV5 A;  5F8B A;  2L4Q A;  4O5R A;  1A0R P;  3O3T A;  2A2S A;  1M9A A;  1GL8 A;  1A24 A;  2VM1 A;  4ZB9 A;  5IOW A;  2LST A;  5INY A;  3DVX A;  3ZFB A;  2GZP A;  4J57 E;  1ZYN A;  3EC3 A;  5HFI A;  1EV9 A;  3M0F A;  2OA7 A;  3LXZ A;  4MK3 A;  5EPF A;  4TR3 A;  3H79 A;  4O5U A;  1O85 A;  2H1D A;  3TCO A;  5A4W A;  2HFD A;  2IWT A;  1OE8 A;  5D9V A;  3LSZ A;  5ECM B;  2QKE A;  5J41 A;  3J7Y b;  4G0I A;  4G9H A;  4TXV A;  3D4T A;  4BVY B;  4Z2T A;  3LG6 A;  4GSN A;  1C72 A;  2LQQ A;  2WB9 A;  5DQS A;  5FT3 A;  4I5Q A;  3U6V A;  2BMX A;  3BBY A;  5EL8 A;  4KND A;  4ZIJ A;  4MMM A;  1FVK A;  3HA9 A;  1Z5Y E;  4OCF A;  4OMV A;  4PXO A;  11GS A;  2CVB A;  1PQN A;  3WGD A;  3GSS A;  3UMA A;  3HCZ A;  5BMU A;  4TR0 A;  2LNT A;  4MZC A;  4I2U A;  3F8U A;  1KTE A;  19GS A;  4ECB A;  2DKI A;  1JHB A;  1PX6 A;  3HVS A;  2PER A;  1MEK A;  3TKS C;  4KDX A;  3ZIJ A;  4WKW A;  3TOT A;  2YZH A;  3TJG A;  3KEB A;  4MJC A;  2LEG A;  3WD6 A;  2L6D A;  4NV2 A;  2TIR A;  4OFN A;  2GDR A;  1NHO A;  3L4N A;  3TJJ A;  2MMA A;  2H6Y A;  5D8I A;  2FWH A;  3WT1 A;  3GNJ A;  4K5R A;  4Q5N A;  3EU3 A;  1SKW B;  3UIW A;  5JCG A;  4ZBD A;  2B6M A;  1XWG A;  4WXT A;  4G0L A;  4LMW A;  2HSH A;  3GKK A;  1SJI A;  4XHM A;  4LA1 A;  4XRA A;  4HZ4 A;  2C8U A;  2VO4 A;  3UBL A;  4MJE A;  2JAC A;  2HT9 A;  4K0G A;  5IO2 A;  4HS1 A;  4OWY A;  2XHF A;  5F05 A;  1GLQ A;  2L5O A;  2YJH A;  3HD5 A;  4V1A g;  5F07 A;  3UBK A;  1YF0 A;  3VPT A;  4WF5 A;  4DVC A;  1EWX A;  4TR1 A;  4FH8 A;  5G31 A;  1TTZ A;  2X8H A;  3UL3 A;  1DE1 A;  1PKZ A;  5DCH A;  1YEX A;  1DUG A;  4K7O A;  4KCA A;  1Z6M A;  4K2D A;  2DC5 A;  2MYG A;  4IQA A;  1M99 A;  1K3Y A;  5DQY A;  1VRS D;  4EL1 A;  1RK4 A;  2GST A;  8GSS A;  3LOR A;  1MDJ A;  3IHQ A;  4V2L A;  3TKS A;  1HNB A;  1Z7P A;  4HJ2 A;  2G0F A;  2H8L A;  2O7K A;  4KAE A;  2XBQ A;  4XIH A;  2GTU A;  1A2L A;  3FZA A;  4IGJ A;  4K6X A;  4ML6 A;  1UVZ A;  2L57 A;  1ZZY A;  2R2J A;  1XOA A;  5ECL B;  3QAW A;  2GT5 A;  4DSR A;  4YKG A;  1GUK A;  1TDI A;  3E3E A;  5IMA A;  2FY6 A;  3APQ A;  3CSJ A;  3DGQ A;  3BD2 A;  1BJX A;  3M1G A;  2K8V A;  1GSS A;  2VD0 A;  3RHB A;  3D4M A;  2C0F A;  2R3X A;  1TOF A;  4DSS B;  2REM A;  3BOA A;  3KM6 A;  5J5N A;  5J9B A;  1TP9 A;  1V40 A;  1OC9 B;  4EO3 A;  4HOJ A;  2VL2 C;  2NPB A;  2OE0 A;  1XPV A;  4CDO A;  3FRC A;  5ELG A;  3M8N A;  1T8E B;  3GTU B;  2C3N A;  1U3A A;  2LTK A;  4F9Z A;  1XXU A;  4ZBA A;  3WT2 A;  2CT6 A;  4NHW A;  3F3Q A;  1AQV A;  4KCE A;  2DIZ A;  1F37 A;  1WIK A;  3QOU A;  2KLX A;  4MJA A;  4BPY A;  1M2A A;  3Q18 A;  2AB6 A;  2B7J A;  2VCV A;  3A3T A;  4MF5 A;  3D5J A;  3GKM A;  2WJU A;  5CRD A;  5IPH A;  1GUL A;  1SEN A;  3PIN A;  1EZK A;  2YWN A;  2JL4 A;  5IM9 A;  1LU4 A;  3QD9 A;  1G6Y A;  3GTU A;  2CQ9 A;  4KSM A;  1G7O A;  2I1U A;  4MZW A;  4ZBB A;  2OAD A;  1FB0 A;  4XRD A;  1SL0 B;  2EIO A;  2H66 A;  4IN0 A;  5GSS A;  2YWI A;  1YQ1 A;  1T1V A;  2C0E A;  1AC1 A;  3RAZ A;  3A5I A;  3QFA C;  1JZD A;  4MDC A;  2DJK A;  3QMX A;  5IMF A;  4OFM A;  4OCE A;  5D93 A;  2UZ8 A;  1YEP A;  3I69 A;  3CSI A;  1K3L A;  2OBK A;  4TXO B;  4MH2 A;  3CRU A;  2IIY A;  1TI1 A;  4QQ7 A;  2VL2 A;  5G5F A;  1PA3 A;  2K6V A;  1Z9H A;  3Q19 A;  2MBT A;  3IXR A;  3TRX A;  1Y25 A;  1ABA A;  3NIV A;  3US3 A;  1PSQ A;  5AGY A;  1R5P A;  2YWO A;  3CSH A;  4MJB A;  5IPG A;  2LKU A;  2QGV A;  2GVP A;  4K8M A;  4MNN A;  2P31 A;  3WYW A;  4RQR A;  2JSZ A;  3ZRE A;  3GA4 A;  4PQ1 A;  3CBU A;  4D73 B;  2FWG A;  2R0P A;  5EY6 A;  3UAP A;  2GLR A;  3HY2 A;  2FLS A;  2X4A A;  3VWV A;  4FYB A;  1R7H A;  1XWA A;  1F3B A;  2AUV A;  4ID0 A;  4NWY A;  2HXK A;  5CYY A;  5HR0 A;  14GS A;  4RI6 A;  1AUC A;  2C3Q A;  2VIM A;  3R2Q A;  2QSI A;  2YZU A;  6GSV A;  2C80 A;  4V2N A;  3ZRD A;  2HRF A;  2ES7 A;  1SL2 B;  1IYH A;  2YV9 A;  3GMF A;  2TRC P;  5A4V A;  5KEJ A;  5LCZ A;  3HJO A;  2N5A A;  3FR6 A;  4N0V A;  2A4H A;  6GSW A;  7GSS A;  4PUA A;  5B7C A;  4LLR A;  2FWE A;  4I97 A;  2HRN A;  4EKZ A;  1U6T A;  3G9B A;  4GQF A;  3GUR A;  1TXX A;  1K0B A;  3MDK A;  1MD3 A;  5KOX A;  2CZ3 A;  1U87 A;  3MNG A;  3H8Q A;  1EOG A;  2X8G A;  4JBB A;  3ZIT A;  4YH2 A;  1F3A A;  1GTI A;  4KDU A;  2V2G A;  1USB A;  4PX1 A;  4ZIL A;  4X4J A;  4IP1 A;  1GSE A;  1B9Y C;  1PN0 A;  1BQ7 A;  2OKA A;  4G2E A;  3DML A;  2DBC A;  2B3S A;  3PGT A;  5ECO B;  3R3E A;  2PWJ A;  3DKS A;  2H73 A;  4WR4 A;  5C04 A;  4EIQ A;  4QL9 A;  6GSX A;  3LQ7 A;  5FHI A;  2H30 A;  5ABR A;  3IOS A;  4Z2U A;  6GSY A;  1VF2 A;  5ECQ B;  4EDZ A;  2A2R A;  3APO A;  4GRF A;  3ZFL A;  3F0I A;  1N8J A;  3UVH A;  1TRU A;  1WJK A;  1S3C A;  2P5R A;  2HZE B;  2HRA A;  1K0A A;  3ME8 A;  9GSS A;  1EP7 A;  2CZ2 A;  2GQM A;  3D0Z A;  2RUF A;  4F0C A;  2FA4 A;  3TOU A;  1XW9 A;  3F9U A;  4PNG A;  1PL2 A;  3EE2 A;  2CA8 A;  2H70 A;  2XPD A;  1O7U A;  5AIS A;  4BA7 A;  2IFQ B;  1URM A;  4KB3 A;  1A8L A;  3P90 A;  1TRW A;  2FGX A;  4IJ3 A;  4L8E A;  1GLP A;  1XWC A;  2RM6 A;  3C8E A;  3D22 A;  6GSS A;  1UN2 A;  3FKF A;  4CW9 A;  4JE1 A;  2PN8 A;  2CX4 A;  1WOU A;  1DBY A;  2OJL A;  3M9J A;  2WGR A;  2IFQ A;  4MF7 A;  3G7I A;  4JR6 A;  2H0I A;  2C1Y A;  1ERW A;  5CP1 A;  3DIE A;  2V32 A;  5AIV A;  1M2D A;  2AJQ B;  4JR4 A;  3F6D A;  3TKS E;  5HQP A;  2YV7 A;  1BYE A;  1OKT A;  4ECJ A;  3TUE A;  2BTO T;  2VLV A;  3P7X A;  1T4Z A;  5A4U A;  5IO0 A;  3HDC A;  2PPT A;  1W4V A;  5IMD A;  2DJ3 A;  1X9M B;  3Q6O A;  2C4J A;  2LQO A;  4NXI A;  4BVY A;  1AXD A;  2RLI A;  3AY8 A;  10GS A;  2FNO A;  1EP8 A;  5JCU A;  3QFB C;  5G1L A;  5C00 A;  2BJX A;  1BED A;  2NDO A;  3QAV A;  2PU9 C;  3WGE A;  2GSS A;  2V6O A;  2N5F A;  2O87 A;  3IAM 2;  2HI7 A;  1NHY A;  1G6W A;  2R5G A;  2C0G A;  2GGT A;  3IV4 A;  4BL7 B;  5D73 A;  2CAI A;  2GQK A;  2HE3 A;  2RM5 A;  1PN9 A;  3U5R E;  2JZT A;  3C7M A;  2HSM A;  3ERW A;  3EMP A;  4NHZ A;  1XOB A;  3LWA A;  5DAK B;  5DDL A;  1YJ6 A;  2IL3 A;  2OE1 A;  1GWC A;  2I81 A;  4GQC A;  3F4T A;  1SKR B;  1KBN A;  1ST9 A;  1SYR A;  1EGO A;  1FB6 A;  5DJL A;  1NW2 A;  4JRR A;  3DEX A;  2EIR A;  1SL1 B;  2H1G A;  2FUG 2;  5GAP D;  1V2A A;  2LNS A;  3D21 A;  2FCH A;  3VUR A;  4NPB A;  1YF1 A;  1ZYP A;  3PR8 A;  2VCT A;  1ZOF A;  1K0N A;  1PGT A;  3QDN A;  4IJI A;  5F06 A;  4KX4 A;  2IME A;  3C1S A;  3EU4 A;  2MMN A;  2YCD A;  1ZYE A;  3EYT A;  1X0R A;  5F0G A;  2KP1 A;  1VF1 A;  5FWG A;  1QUW A;  4N11 A;  1ZMA A;  5BRT A;  4F0B A;  4K9Z A;  2VCX A;  5ECN B;  2VLU A;  3UVT A;  2M46 A;  3KJY A;  2CAQ A;  4ICY A;  2OBI A;  1SK2 A;  4AJ6 A;  3L9S A;  2F8A A;  2H1A A;  4KUN A;  3F63 A;  1XWK A;  1J0F A;  4N0Z A;  1G0T A;  2IJY A;  4X43 A;  3P8W A;  1FOH A;  3I9V 2;  1S3A A;  3G7Y A;  3IBH A;  4LMV A;  2DSA A;  1K0O A;  1WWJ A;  3ZL5 A;  1A23 A;  2LJK A;  1K0C A;  2R6K A;  4G19 A;  4WBJ A;  1XW6 A;  4HUA A;  3QAG A;  3GHA A;  4QL7 A;  3TKQ A;  3N9J A;  1K0M A;  3HKR A;  1GSF A;  1ML6 A;  2YAN A;  1TU8 A;  5B6N A;  2M72 A;  2F8F A;  2PUK C;  4E8E A;  1RQM A;  3E9J B;  4TKY A;  5J4U A;  1V57 A;  4JED A;  4HZ2 A;  2A4V A;  1BX9 A;  5G2Z A;  3DXB A;  3ZVJ D;  1AW9 A;  2B5E A;  3OR5 A;  2V41 A;  2H0G A;  2DML A;  3IAS 2;  4FYU A;  1R4W A;  1UA5 A;  3CTG A;  3CYN A;  2EIQ A;  4HQZ A;  5HR3 A;  4XS6 A;  3MYD A;  3S9F A;  5CRG A;  1GTA A;  2H6X A;  4BWS A;  3KH7 A;  4DSS A;  4Z2R A;  2P0G A;  1EGR A;  5LD0 A;  4K2X A;  3KD0 A;  5A5K A;  2E7P A;  4X1U A;  1GP1 A;  6GSU A;  1OC9 A;  4K0N A;  5KN3 A;  5JWQ B;  5DVB A;  1TI3 A;  3TKP A;  1JLW A;  4E8H A;  3FW2 A;  1ON4 A;  2HNL A;  2XC2 A;  2VCZ A;  3RBT A;  4K7N A;  3F6F A;  3NOF A;  5ECR B;  1TJD A;  4XTS A;  1XCC A;  2YPM A;  4KGI A;  2WS2 A;  4GCI A;  1LJR A;  1J08 A;  2VUP A;  1XIY A;  1O81 A;  4MF6 A;  1YKC A;  1WE0 A;  5DJM A;  4L0U A;  3NZN A;  3DRN A;  5IIZ A;  2HZF A;  2O85 A;  4KH7 A;  1ILO A;  3DWV A;  4PTS A;  4F82 A;  1T4Y A;  5KN1 A;  1Y6E A;  1T3B A;  1B9X C;  1K3O A;  1HNC A;  2PVQ A;  4IKH A;  4F03 A;  2QA2 A;  4F2I A;  2L6C A;  3TDG A;  4WET A;  1QQ2 A;  1U88 A;  2RUE A;  1Q98 A;  1W89 A;  4ILF A;  1GTU A;  4K7I A;  4YQV A;  4FYC A;  1Z6N A;  2VM2 A;  3GX8 A;  5B6M A;  3F4R A;  2B1L A;  2R37 A;  4FQU A;  1K0D A;  1THX A;  2AV4 A;  3W8S A;  5CAX A;  4TXO A;  4MPF A;  2L4C A;  5HR2 A;  3IDV A;  4JZQ A;  5JWR B;  3KXO A;  3TB2 A;  4HI7 A;  4HDE A;  4ML1 A;  1Z7R A;  3VK9 A;  2H71 A;  2HRK A;  1NM3 A;  5DBQ A;  20GS A;  3EUR A;  2YNX A;  4USS A;  3CMI A;  2I9H A;  2DJ0 A;  3K8N A;  1EEJ A;  3SBC A;  5IMV A;  1AQX A;  2O89 A;  2FA8 A;  5ECH B;  3ZZX A;  3DVW A;  4AGS A;  1CQG A;  1OVN A;  1B4Q A;  1O73 A;  2GZZ A;  1JLV A;  4D73 A;  1XWB A;  5ECK B;  4J2F A;  5B8B A;  2LJA A;  2V6K A;  3APS A;  5ECI B;  1GSQ A;  1OC8 A;  2Z9S A;  3IPZ A;  3TKR A;  2AYT A;  3HZ8 A;  2WUL A;  3MAK A;  4GF0 A;  3FHK A;  3L9V A;  2G2Q A;  1FW1 A;  1OKD A;  2DJJ A;  4O7H A;  3FZ9 A;  1KNG A;  2GSQ A;  4KW6 A;  2H6Z A;  4ZL8 A;  3GST A;  3TRP A;  2B7K A;  2GQL A;  4POK A;  4HEA 2;  2GS3 A;  3I6A A;  3GL5 A;  4ZL7 A;  5GAN D;  1G7E A;  4CHS A;  2WCI A;  1NSW A;  2F51 A;  4GST A;  2YJ7 A;  1A8Y A;  4KF9 A;  3L78 A;  4YQU A;  3MIX A;  3BCI A;  3HZ4 A;  4DSQ A;  1OYJ A;  4WBR D;  2F9S A;  1YY7 A;  1JZR A;  1XVW A;  1VF4 A;  2C0D A;  1TW9 A;  4Z7X A;  3FYG A;  1HNA A;  3EPT A;  2L59 A;  5IMC A;  2IPA A;  3VWX A;  12GS A;  1YKA A;  3ZVJ A;  5B8A A;  13GS A;  4K1F A;  1AIU A;  3F3R A;  4IBP A;  4PNF A;  2DJ2 A;  4EIP A;  4EF0 A;  3VWW A;  1TK0 B;  1F9M A;  1UC7 A;  3QR6 A;  4LL1 B;  1E6B A;  4G10 A;  3HVV A;  5D96 A;  3GUS A;  2IN3 A;  2VCW A;  5CRE A;  4GWR A;  2R0G A;  1F2E A;  1QXH A;  2YN1 A;  4P3Y B;  1QMV A;  3EWL A;  2CX3 A;  4O92 A;  3BJ5 A;  1PD2 1;  2CVD A;  2VCQ A;  2WDU A;  3H93 A;  1GNE A;  2FD3 A;  1JFU A;  3G7J A;  4PUR A;  1HYU A;  4IW9 A;  2KHP A;  4GXZ A;  4A5P A;  3FEU A;  1EOH A;  4EUY A;  1XFL A;  3TJK A;  1PX7 A;  2HZE A;  2JSY A;  4MP4 A;  1HD2 A;  2IMK A;  5JWO B;  1V98 A;  4TR4 A;  5E59 A;  2NVL A;  1ZL9 A;  1T7P B;  4KDY A;  3RHC A;  3GX0 A;  3DYR A;  2O8V B;  5HFK A;  3F4S A;  5LNK e;  2M80 A;  4HJM A;  4RUV A;  2H1B A;  3EVI A;  1SJ6 A;  2K18 A;  1O8X A;  4EDY A;  3GFK A;  3LXT A;  1M7T A;  1F6M C;  2H01 A;  1WRY A;  1I9D A;  4EC0 A;  1I5G A;  1CQH A;  4CY6 A;  2MMZ A;  2ZNM A;  1XZO A;  1YDK A;  3KIJ A;  2ZUP A;  1TK8 B;  5KN2 A;  5GST A;  4IEL A;  5J3R A;  1J9B A;  3TRQ A;  4H86 A;  5AN1 A;  4XS4 B;  4YAP A;  5JCW A;  4ZB6 A;  3EMX A;  5ID2 B;  4ISD A;  2ON5 A;  3ERG A;  2EC4 A;  2LRC A;  3ZML A;  2TRX A;  2FWF A;  5H5R A;  4V1A p;  2MZC A;  1PRX A;  3L9U A;  1BAY A;  5E4W A;  5HR1 A;  4GSS A;  3LW9 A;  3RPP A;  1X9S B;  1X5D A;  3J7Y k;  2YWM A;  4MH3 A;  1M2B A;  2X99 A;  3HYP A;  1ACV A;  5CRW A;  2X64 A;  4AF2 A;  2RII A;  4XS4 A;  2H19 A;  2J23 A;  3C1R A;  4HU7 A;  3FR3 A;  5ID2 A;  1SD9 A;  2I4A A;  5D9T A;  3E0U A;  3GYK A;  1A2J A;  4MPG A;  2AAW A;  5D9X A;  1X5E A;  4NMU A;  5J9C A;  16GS A;  5HFG A;  2K9F A;  1GH2 A;  2JAD A;  1SU9 A;  2GSR A;  5IOX A;  4IP6 A;  1E2Y A;  3C71 A;  2H0H A;  5KOW A;  4Q5Q A;  4MLY A;  3UOM A;  4L0W A;  4AJ8 A;  4TR1 B;  3A5W A;  1TRV A;  1U3I A;  4ZXG A;  4BL7 A;  3H1N A;  3V1W A;  1SJZ A;  3IK7 A;  2ON7 A;  4TN8 A;  3FY7 A;  3GN3 A;  4Q5F A;  5ECP B;  3KP9 A;  2LS5 A;  3M3M A;  5H5S A;  2IMF A;  1GNW A;  4I8B A;  4KE3 A;  5DAK A;  4YAV A;  1ERU A;  2MBS A;  1SD8 A;  2IMD A;  4YQM A;  22GS A;  3PPU A;  4G0K A;  1M0U A;  2X49 A;  4POL A;  2LRN A;  2DJ1 A;  1TK5 B;  2QA1 A;  3UEM A;  3GV1 A;  1HQO A;  4TOP A;  2DMM A;  3N5O A;  1A2M A;  3LEF A;  4PGT A;  2LRT A;  4TRX A;  5G30 A;  1PL1 A;  2IMI A;  2QC7 A;  2N5B A;  1R26 A;  1PKW A;  4RQX A;  3FK8 A;  2ZCT A;  1TRS A;  5DCG A;  2OE3 A;  3ZTL A;  5AIX A;  2H76 A;  3CTF A;  5G5E A;  3BCK A;  2H75 A;  2OAC A;  1DE2 A;  1S3D A;  1LBK A;  2GZY A;  2JU5 A;  3DD3 A;  4FO5 A;  3SWL A;  2XPE A;  3GL3 A;  3RPN A;  1H75 A;  1QK8 A;  4XS1 A;  4ZL9 A;  1X5C A;  4FIW A;  3KCM A;  3ZLP A;  4KSO A;  1THO A;  2A2P A;  3TJB A;  2HLS A;  3QCP A;  1MDK A;  3KH9 A;  3IE3 A;  4POB A;  2KP2 A;  4EVM A;  1KEB A;  2F3M A;  3LFL A;  3IC4 A;  1YZX A;  4LL4 B;  4TVE A;  5IQY A;  1R5A A;  1ZYQ B;  4CY8 A;  1N2A A;  1AQW A;  1O8W A;  4N10 A;  1OC3 A;  4L5O A;  4OFT A;  4I2T A;  5CNW A;  5D9W A;  4PQH A;  18GS A;  4IQ1 A;  2K8S A;  3IR4 A;  4TW5 A;  2PBJ A;  2JZR A;  3L0H A;  1SK0 A;  1JZO A;  1FAA A;  3HVX A;  3VI5 A;  1MD4 A;  1GTB A;  2R4V A;  2VLT A;  1WPI A;  3LGC A;  2H74 A;  3Q74 A;  3LJR A;  2B1K A;  2LJR A;  3GKX A;  1EEM A;  2HYX A;  6GST A;  3M9K A;  2WZ9 A;  1ZCP A;  1WMJ A;  2YOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...