1GRXA

Structure of e. coli glutaredoxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYSVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
pubmed rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1993-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1grxA00
2YWMA 3GNJA 5GSSA 3U6VA 1WRYA 3TKSA 1X0RA 1LBKA 3M0FA 3TJJA 2DMMA 5GSTA 5IO0A 3VK9A 1E2YA 3ZFLA 5LCZA 2H66A 2O85A 2F51A 2WRTA 5C00A 1AC1A 1X9MB 2LRNA 1G6YA 1Q98A 1EP8A 2C0DA 2LTKA 4XRDA 1LJRA 2H1BA 3Q74A 3A2XA 4G19A 2H6ZA 3KD0A 3W6GA 2LKUA 5F0GA 2VOCA 4ZXGA 5B7CA 2B3SA 2PMTA 3FR6A 2E2MA 4EDZA 3RDWA 3I43A 3J7Yk 2G2QA 17GSA 4JR4A 2VCZA 3W8SA 1WPIA 10GSA 4GWRA 2GSRA 4XTSA 2JZSA 2GDRA 2FWEA 1XPVA 1QMVA 4MJEA 1WIKA 2KUCA 1A24A 2NBSA 3DWVA 1PMTA 2LS5A 5G5FA 3FYGA 2IMFA 1F9MA 3D4TA 4GSNA 4TVEA 3M8NA 1ZMAA 4RI7A 4NAXA 2PU9C 4KA0A 5ECIB 2L6CA 4GQFA 1QFNA 1AQWA 1X5EA 4I2UA 3KZQA 4DVCA 1JLWA 4MA9A 4HI7A 3LYPA 2HRFA 2B1LA 2ZNMA 5IMDA 3H93A 1EEJA 4IQAA 3P7XA 3HZ4A 2IMEA 4F82A 3F3QA 3LG6A 2VUPA 1QUWA 3L9VA 1EV4A 5KN1A 3D21A 3FW2A 3HD5A 3ZLPA 4ZB6A 2LUSA 1DE1A 2VAFA 2C0EA 3DMLA 3GX8A 1JZRA 1V98A 3GURA 2P31A 3IA1A 1HD2A 1SD8A 1ERUA 4KCAA 5J9CA 3DRNA 1A2MA 1SL1B 2AV4A 1B8XA 4TR1A 3VI5A 1K0NA 16GSA 4EVMA 3TKSC 5E4WA 2H6XA 4ZB9A 3F4SA 4YQUA 3KH9A 2M80A 3FZ9A 3GFKA 3HVXA 5L71A 2GZZA 2DJ3A 5EL8A 1JHBA 3KXOA 2K18A 4HQZA 5F07A 3ZITA 1SJ6A 1K0CA 5HR3A 2NDOA 2WFCA 3HDCA 3PGTA 1PX7A 2K8VA 4NV2A 5JCWA 3HJOA 4OFTA 1BG5A 3OR5A 3GKMA 2GS3A 1ABAA 3L78A 2HZFA 2Z9SA 1S3DA 3D5JA 4TXOB 1R26A 1BYEA 4YH2A 4H86A 3FRCA 3QMXA 2WDUA 3QR6A 4N10A 2H30A 4EDYA 2HYXA 1EGRA 1XZOA 1AUCA 4LL4B 2A2RA 1WMJA 3ISOA 3GUSA 3U5RE 5IIZA 1B4PA 3IE3A 4PXOA 1X5DA 3G7IA 5ECRB 1PRXA 1OC3A 1A23A 2CX4A 3H1NA 1EWXA 3UMAA 1THOA 5A4UA 1YEXA 5AGYA 3DXBA 1PN9A 4CDOA 1T8EB 7GSSA 2JSZA 2H74A 2JACA 1Z3EA 2VLTA 4WR5A 2H01A 3TJKA 1TJDA 4IGJA 1TTZA 2H8LA 2JZRA 3IAM2 3E3EA 4OD7A 2AB6A 4PX1A 4V1Ag 2FHEA 3CTGA 3F0IA 2YPMA 1U3IA 4MH3A 2KP2A 3RBTA 1AW9A 5JCUA 5D73A 1U3AA 2IFQB 3GHAA 4XHMA 1HNCA 5HFIA 4AJ6A 2AAWA 3UARA 2F9SA 1TKDB 2CV4A 1ERVA 5IM9A 3L9SA 5IO2A 2YNXA 2X8CA 6GSXA 2EC4A 2YJHA 4HJ2A 4AJ8A 5DALA 1F2EA 5IMAA 2YOIA 5D93A 2I1UA 5B6MA 5GZZB 3UBKA 4BVXA 4ECCA 5J5NA 2HSYA 1G0TA 2OBIA 2H0GA 2MBTA 4WEYA 4PNFA 3LWAA 1M9BA 4EC0A 4K7NA 1XVWA 2HI7A 2A4VA 3Q18A 5ECKB 4OCFA 3APQA 4MZWA 1GNEA 2H0HA 2AUVA 1MTCA 3FZAA 4V2LA 3IC4A 3F4TA 2DIZA 2C8UA 4KW6A 4TW5A 2V2GA 1EP7A 1Z7PA 3BD2A 5G1LA 3ZTLA 2ON7A 2GVPA 1BQ7A 5CO3A 3ZIVA 3KTBA 1ML6A 2B5EA 2DSAA 2MZCA 3LJRA 3KMNA 2EIRA 1BEDA 3KTLA 3WT2A 2K8SA 22GSA 1RQMA 4CW9A 1WP0A 3EURA 1YKAA 2IWTA 1TI3A 3H4KA 4WXTA 4DSSB 2NVLA 3DYRA 1O85A 3A3TA 4I5QA 2GGTA 1XVQA 3IV4A 5CRWA 5IPGA 4P3YB 4AJ7A 4NHWA 5G31A 3TUEA 1UN2A 3KM6A 3EC3A 3IBHA 4KE3A 1M9AA 1XWKA 1THXA 1YF0A 2L5OA 2PPTA 2R37A 2AJQB 2B1KA 3BCKA 3GTUA 4KSMA 3C71A 2OE3A 6GSUA 3UBLA 2C80A 4IW9A 3QDNA 2DJ1A 5INYA 1T3BA 1A0RP 1GLQA 3CSIA 1F6MC 1CQHA 3EU4A 3EVIA 1G7EA 3BCIA 2LNSA 3GKXA 1A8LA 2KHPA 2GSQA 2F8FA 5FT3A 5H5RA 2DLXA 3F6DA 2VD1A 2LNTA 1SK2A 2M72A 3UAPA 1TDIA 3KGKA 1KEBA 3NOFA 3GSTA 1K0DA 4D73A 2R3XA 2NPBA 1GTUA 1F3BA 3LSZA 2LRTA 4G10A 5IMVA 1Z6NA 4IVFA 3H79A 2D2ZA 5HR1A 4K0NA 4FYBA 1W89A 4L0UA 2PN8A 4KX4A 3TKQA 4TRXA 3HXSA 6GSSA 2C4JA 4JE1A 4TR3A 2E0QA 4OCEA 3GYKA 18GSA 4N30A 3UJ1A 2LRCA 3C1SA 1MDJA 4ACSA 2J23A 1O81A 4HJMA 2VL9A 4TXOA 2LQOA 3VPTA 2GQLA 4EKZA 2HSHA 3A2WA 2P5RA 5DQYA 1G7OA 5F06A 4KDUA 4RI6A 2IPAA 1FB6A 2RM5A 2X99A 3ZMLA 2MYGA 1XW6A 1SD9A 4MDCA 3QAVA 1OYJA 1YQ1A 2R6KA 5ECNB 1OE8A 3HJPA 1ON4A 4BWQA 3TB2A 3LEFA 2OACA 3HHVA 3LYKA 4KGIA 2O89A 3CRUA 1M2BA 5HR0A 4V1Ap 3DEXA 2GT6A 3O76A 1VF4A 1OAZA 5B6NA 2VIMA 4OFNA 1I9DA 4NMUA 4ID0A 4OWYA 4G2EA 2ON5A 2P5QA 1TW9A 1B48A 2VL2C 5D9XA 2CZ2A 4I8BA 3LQ7A 3L4NA 1MD3A 4XS4B 4WBJA 3KH7A 3HYPA 4IJ3A 3FR9A 4L5LA 1SJIA 2C3NA 2DJJA 2RM6A 2AYTA 5D9WA 1MDIA 1YEPA 4WBRD 2HZEB 1TXXA 1VF3A 3KEBA 2KLXA 2WULA 2OKAA 5EVOA 2ZCTA 4E8EA 4POBA 5ECMB 1RK4A 3APSA 1GTAA 2FNOA 5KN0A 2OADA 3EINA 5IMCA 4TOPA 3WGEA 1N2AA 1K0MA 2HLSA 2P0GA 3IK7A 14GSA 2LJRA 4MK3A 3KJYA 4CHSA 1H75A 1JZWA 2XBIA 2GLRA 4Q5QA 2BJXA 4ZILA 3TDGA 1EZKA 4TN8A 3ZFBA 8GSSA 5ECPB 1OC9A 2CVBA 3KP9A 5CRGA 2H1GA 2H0IA 5HFKA 3GIXA 5AN1A 1OKDA 4KB3A 4IS0A 1SL2B 2PWJA 2O8VB 3HVSA 1K3LA 4HU7A 4O92A 4WF5A 1FVJA 4F9ZA 5CP1A 4BA7A 1GULA 5HQPA 5D96A 3D4MA 5ELGA 1ZL9A 6GSWA 1EGOA 2DMLA 2CAQA 1XWAA 3LGCA 4K7OA 4GCIA 4K0GA 4EE0A 3FHKA 2YWIA 3MAKA 3UOMA 1FVKA 2IMKA 3QFAC 1O6JA 5KN2A 2VLVA 3TCOA 3FR3A 4IP6A 1PL1A 2VD0A 2YV7A 3VPQA 1ZGNA 5AIXA 2FUG2 2H71A 1PD21 2G0FA 2FA8A 3ME7A 1GSEA 3N5OA 2CT6A 2XC2A 4LMVA 4IN0A 2VCVA 5JWOB 4NPBA 4ZL8A 3BJ5A 2HNLA 1GNWA 1ACVA 1K0OA 3ZZXA 2VL3A 5ECQB 1A8YA 1JZOA 2YWNA 4N11A 5H5QA 6GSVA 1WJKA 4PNGA 5JWQB 4HDEA 4YQMA 1XFLA 4GF0A 3N9JA 4ZIJA 4XCSA 3WGXA 2KOKA 4TR4A 4OFMA 4RUVA 2LV3A 3CRTA 3EMPA 1EV9A 1XOAA 4ZBBA 3F3RA 2MMZA 1XWGA 3L0HA 1V40A 4YQVA 2J9HA 4WR4A 4X0XA 3M9KA 5IPHA 2MMOA 2JU5A 2DBCA 5DCGA 3QOUA 1H4OA 3F4RA 4I97A 1PKZA 4NV5A 5DCHA 2OBKA 4ECBA 3ERWA 5GAPD 2HT9A 1FAAA 3LXZA 3EE2A 4ML6A 5DAKA 1ZZYA 1PQNA 1XWCA 3NZNA 4K9ZA 5ECLB 4BVYA 5LD0A 13GSA 1U6TA 1GSYA 4PQIA 4IJIA 2N5BA 2BTOT 4X1UA 1NM3A 2VCXA 4BL7A 1BX9A 3V1WA 5D9TA 4WKWA 2L4QA 2ES7A 5ELAA 2XPEA 1Y6EA 5JCGA 4K2DA 1J0FA 4KUNA 2FLSA 1TK5B 1V2AA 2OE1A 1FW1A 5IMZA 2H6YA 2PGTA 3EMXA 2MMAA 1B4QA 3ZREA 1Z6MA 1SYXA 2V6OA 5G5EA 1UC7A 2JSYA 6GSYA 3G7YA 1TU8A 4ISDA 3GV1A 2IJYA 4IP1A 1NSWA 4JU5A 4HQSA 1SYRA 1R7HA 4L8EA 3HY2A 1XWBA 4ML1A 2HFDA 5B8AA 5FHIA 3GL5A 3UIWA 4PQHA 1QGVA 2IMIA 2C0FA 5B8BA 5J4UA 3GH6A 2H75A 4K8MA 3ZVJD 5ID2B 1GSFA 1O73A 3RHBA 1QQ2A 2L4CA 2VM1A 3HA9A 1FB0A 2R5GA 3KMOA 4N0VA 1YJ6A 4POMA 3W8JA 4PUAA 4F0CA 5G2ZA 1O8XA 4FIWA 11GSA 1UA5A 2R2JA 3ERFA 4MABA 2LSTA 4MF6A 2IIYA 2PVOC 3HVVA 3GX0A 2A2SA 4HUAA 3I6AA 3PH9A 1SENA 2DJ2A 2QSIA 4L5OA 2H72A 1RW1A 4LLRA 2FWHA 3H8QA 4KNDA 5IMFA 5ECSA 4FYUA 1TI1A 2B5YA 1USBA 3WD6A 3HCZA 2REMA 2VL2A 4O7HA 4LA1A 4POKA 1J08A 2DIYA 2KP1A 2YN1A 3CXGA 3TJGA 5LNKe 3SWLA 1OKTA 4RQRA 3BOAA 1K3OA 3CMIA 2H19A 4XS1A 3TKSE 2B7JA 2E2GA 3CBUA 1BAYA 3D0ZA 3UVHA 5CRDA 1M2AA 4OO4A 1ZYEA 1ILOA 4F2IA 4EF0A 2H1DA 4PQ1A 2R4VA 1ZYQB 2V41A 3GSSA 2X8HA 2H73A 2QGVA 3TRQA 3LORA 3LFLA 3WT1A 1E6BA 2HXKA 4FO5A 2H1AA 3ERGA 2FD3A 2VM2A 2AHEA 3QPMA 4F0BA 5A4VA 4YAPA 4YAVA 3NIVA 5G30A 2EIOA 2MMNA 5FWGA 4J57E 4MJAA 2GTUA 3F6FA 1VGLA 5F05A 3GRXA 2C3QA 4DEJA 4PGTA 1SK1A 4MZCA 4JZQA 1LU4A 3VI7A 4GSSA 3VFIA 1A0FA 4PURA 1VF1A 3S9FA 1MD4A 2MBSA 2FWFA 2GT5A 2YV9A 4KCEA 1X9WB 2F8AA 5DJMA 3US3A 5J41A 1MDKA 2N5FA 3FY7A 3HJMA 5DJLA 2GQMA 6GSTA 2BMXA 1DUGA 2C3TA 2L57A 2O87A 4ZB8A 3G7JA 5HR2A 3GN3A 3TJFA 3APOA 1SL0B 1SKWB 2FA4A 1K3YA 3C8EA 3MSZA 1V57A 2I4AA 1T00A 5DALB 1HYUA 1PL2A 1GP1A 2LJKA 2EIQA 3IAS2 4GLTA 1GLPA 3D6IA 4ILFA 1EOHA 4TXVA 3I69A 4G9HA 1S3AA 5E59A 1TP9A 1GUMA 4JBBA 4XRAA 2IFQA 2PUKC 4JR6A 4QL9A 1HNAA 1CQGA 2YZHA 1ZOFA 2OE0A 4MCUA 3TKPA 2WZ9A 5EPFA 4IELA 4QQ7A 2ZUPA 4EL1A 3O3TA 1MEKA 4O5RA 4EO3A 1V9WA 3R2QA 1AQXA 3KCMA 1GSSA 3GKKA 3ZVJA 5IOXA 2LEGA 3K8NA 3O6TA 1ERWA 2TRCP 1O8WA 4V2MA 4I2TA 1XBSA 2YANA 5CREA 4FYCA 3QCPA 1XW9A 3C1RA 4PUFC 4K6XA 4ECIA 4GTUA 1DE2A 3QD9A 1F37A 1SKRB 2GQKA 3C73A 3FZ4A 1T7PB 3UVTA 3VWWA 2VCWA 3CTFA 4MF5A 4IBPA 1U87A 2RLIA 2F3MA 3GTUB 1B9YC 2GSTA 4WETA 2QKEA 12GSA 2VCTA 1TRSA 1Q4JA 2VCQA 5IQYA 1AIUA 4ULXA 4DSSA 2LQQA 2E7PA 2XBQA 3ZRDA 3DD3A 2YJ7A 1XOBA 4AGSA 4Q5RA 4K1FA 2K6VA 3CYNA 3QFBC 5ID2A 4MPGA 5ABRA 3QAWA 5DQSA 5JWRB 1M2DA 2VLUA 4JRRA 3F63A 2K9FA 4MPFA 1GWCA 5J9BA 3ED3A 1GUKA 1GTIA 2PBJA 1GSDA 4GSTA 4MJCA 1R4WA 1EOGA 4HZ4A 2XHFA 1WOUA 3J7Yb 1SKSB 3E9JB 1EEMA 5AISA 2CZ3A 3F8UA 5D9VA 1GH2A 3D22A 4D73B 3ZYWA 2WB9A 3DVXA 4HU9A 4NHZA 4LMWA 1NW2A 2I81A 1PKWA 1JZDA 2L5LA 4MLYA 5CNWA 3IK9A 1K0AA 4TR0A 1IYHA 4KH7A 5IOWA 1KNGA 3TGZA 4HS1A 3GKNA 4MZBA 3F9UA 3RAZA 4ZL9A 3UL3A 5A4WA 2RUEA 1TOFA 4ZL7A 4ZBDA 2B6MA 2RUFA 2FWGA 2WCIA 1GUHA 2NTOA 4KSOA 2H70A 3FK8A 1YY7A 4K7IA 3CSHA 3Q19A 1K0BA 2WS2A 3E0UA 2QC7A 2B5XA 1Z9HA 3WYWA 4OMVA 3P8WA 3TRXA 4IKHA 3LXTA 3TRPA 4EXJA 1XW5A 4KDXA 1T4ZA 4L0WA 4HZ2A 5DDLA 3DKSA 2FY6A 2GZPA 5GAND 4J2FA 4XIHA 1XXUA 3DGQA 1AAZA 2TRXA 2B7KA 1ST9A 20GSA 2CX3A 3RPNA 2CQ9A 4MF7A 2LJAA 5CAXA 2O7KA 2DJKA 4AF2A 3IRAA 3HZ8A 2YCDA 3EWLA 4TKYA 1G6WA 1OE7A 4ZBAA 3RPPA 1GL8A 4Q5FA 2YWOA 4ECJA 3VWXA 2RIIA 3ZIJA 2DJ0A 1GSUA 1BJXA 3VURA 3CSJA 4E8HA 2WGRA 2X64A 3M9JA 3TOTA 3PINA 1M99A 1YF1A 5J3RA 1TK8B 2YP6A 3QAGA 1PSQA 3ZMKA 1PX6A 3RHCA 3TKRA 5CYYA 3KP8A 1WWJA 4WF4A 1XCCA 1TU7A 3MDKA 5DBQA 2ALBA 3VLNA 5D8IA 3UEMA 4BPYA 4X43A 1M0UA 1URMA 3I9V2 2DC5A 3MWHA 1PA3A 2HE3A 2X8GA 3MNGA 19GSA 2CAIA 5ENUA 4RQXA 1FO5A 4J56E 3IHQA 1IYIA 1SK0A 4O32A 4XS4A 1JFUA 1OC9B 2C0GA 5AIVA 3DVWA 1SU9A 2HZEA 3IR4A 1M7TA 3A5WA 4XS6A 5KEJA 3IOSA 1DBYA 1WE0A 2YZUA 1QXHA 2I3YA 1AQVA 1YDKA 5ECHB 4NWYA 1ERTA 2JADA 2TIRA 3GA4A 2GSSA 1F3AA 5HFGA 1X5CA 4TR1B 1TRUA 3WGDA 1X9SB 1VRSD 1T4YA 2OA7A 2WJUA 1R5PA 1QK8A 2N5AA 2V32A 3M1GA 1GSQA 2PERA 1C72A 1Z7RA 3SBCA 5G1KA 4GRFA 1NHYA 1O7UA 1JLVA 4POLA 1TRVA 4MMMA 3KIJA 2JL4A 4QL7A 2FCHA 3FEUA 1S3CA 2CA8A 3EYTA 4DSQA 2FGXA 3VWVA 4BWSA 1VF2A 4NXIA 1TK0B 4Q5NA 5ECOB 3FKFA 3HKRA 3JCML 1U88A 3P90A 3C7MA 4OO5A 1T1VA 1OC8A 3AY8A 2IMDA 1J9BA 3P2AA 3VWUA 2OJLA 1DSBA 4GXZA 3L9UA 3BBYA 4DSRA 5CRHA 1YKCA 2XPDA 1TRWA 1YZXA 1Y25A 2VO4A 1KTEA 5C04A 5EY6A 1W4VA 2L6DA 1AXDA 2CVDA 4JEDA 3IXRA 1OVNA 3M3MA 2IN3A 1B9XC 3IDVA 4I6XA 3GL3A 1HNBA 4KAEA 4MH2A 4HEA2 1N8JA 5KN3A 1GTBA 1NHOA 3G9BA 2L59A 5H5SA 1I5GA 3ZL5A 4N0ZA 1FG4A 2HRNA 3PR8A 4FH8A 4GQCA 5DVBA 1KBNA 4EUYA 1GRXA 3DIEA 2GZYA 3GMFA 4IQ1A 1PGTA 4IHUA 4V2NA 4HOJA 1R5AA 1FHEA 2JZTA 5DAKB 3IPZA 3A2VA 2V1MA 1FOVA 1V58A 2H76A 1ZCPA 4F03A 4MP4A 4MJBA 4KDYA 2M46A 1A2JA 2I9HA 1A2LA 1XIYA 3TJBA 1Z5YE 4Z7XA 3ME8A 2C1YA 5COHA 2IL3A 4LL1B 3TOUA 3Q6OA 5F8BA 2CVKA 2V6KA 2PVQA 9GSSA 5A5KA 1SJZA 1UVZA 3FZ5A 1HQOA 3EU3A 3GH9A
chains in the Genus database with same CATH superfamily
2YWMA 3GNJA 5GSSA 3U6VA 1WRYA 3TKSA 1X0RA 1LBKA 3M0FA 3TJJA 2DMMA 5GSTA 5IO0A 3VK9A 1E2YA 3ZFLA 5LCZA 2H66A 2O85A 2F51A 2WRTA 5C00A 1AC1A 3IHGA 1X9MB 2LRNA 1G6YA 1Q98A 3MIXA 1EP8A 2C0DA 2LTKA 4XRDA 1LJRA 2H1BA 3Q74A 3A2XA 4G19A 2H6ZA 3KD0A 3W6GA 2LKUA 5F0GA 2VOCA 4ZXGA 5B7CA 2B3SA 2PMTA 3FR6A 2E2MA 4EDZA 3RDWA 3I43A 3J7Yk 2G2QA 17GSA 4JR4A 2VCZA 3W8SA 1WPIA 10GSA 4GWRA 2GSRA 4XTSA 2JZSA 2GDRA 2FWEA 1XPVA 1QMVA 4MJEA 1WIKA 2KUCA 1A24A 2NBSA 3DWVA 1PMTA 2LS5A 5G5FA 3FYGA 2IMFA 1F9MA 3D4TA 4GSNA 4TVEA 3M8NA 1ZMAA 2R0CA 4RI7A 4NAXA 2PU9C 4KA0A 5ECIB 2L6CA 4GQFA 1QFNA 1AQWA 1X5EA 4I2UA 3KZQA 4DVCA 1JLWA 4MA9A 4HI7A 3LYPA 2HRFA 2B1LA 2ZNMA 5IMDA 3H93A 1EEJA 4IQAA 3P7XA 3HZ4A 2IMEA 4F82A 3F3QA 3LG6A 4ICYA 2VUPA 1QUWA 3L9VA 1EV4A 5KN1A 3D21A 3FW2A 3HD5A 3ZLPA 4ZB6A 2LUSA 1DE1A 2VAFA 2C0EA 3DMLA 3GX8A 1JZRA 1V98A 3GURA 2P31A 3IA1A 1HD2A 1SD8A 1ERUA 4KCAA 5J9CA 3DRNA 1A2MA 1SL1B 2AV4A 1B8XA 4TR1A 3VI5A 1K0NA 16GSA 4PTSA 4EVMA 3TKSC 5E4WA 2H6XA 4ZB9A 3F4SA 4YQUA 3KH9A 2M80A 3FZ9A 4USSA 3GFKA 4K5SA 3HVXA 5L71A 2GZZA 2DJ3A 5EL8A 1JHBA 3KXOA 2K18A 4HQZA 5F07A 3ZITA 1SJ6A 1K0CA 5HR3A 2NDOA 2WFCA 3HDCA 5KOWA 3PGTA 1PX7A 2K8VA 4NV2A 5JCWA 3HJOA 4OFTA 1BG5A 3OR5A 3GKMA 2GS3A 1ABAA 3L78A 4BIKA 2HZFA 2Z9SA 1S3DA 3D5JA 4TXOB 1R26A 1BYEA 4YH2A 4H86A 3FRCA 3QMXA 2WDUA 3QR6A 4N10A 2H30A 4EDYA 2HYXA 1EGRA 1XZOA 1AUCA 4LL4B 2A2RA 1WMJA 3ISOA 3GUSA 3U5RE 5IIZA 1B4PA 3IE3A 4PXOA 1X5DA 3G7IA 5ECRB 1PRXA 1OC3A 1A23A 2CX4A 3H1NA 1EWXA 3UMAA 1THOA 5A4UA 1YEXA 5AGYA 3DXBA 1PN9A 4CDOA 1T8EB 7GSSA 2JSZA 2H74A 2JACA 1Z3EA 2VLTA 4WR5A 2H01A 4KF9A 3TJKA 1TJDA 4IGJA 1TTZA 2H8LA 2JZRA 3IAM2 3E3EA 4OD7A 2AB6A 4PX1A 4V1Ag 2FHEA 3CTGA 3F0IA 2YPMA 1U3IA 4MH3A 2KP2A 3RBTA 1AW9A 5JCUA 5D73A 1U3AA 2IFQB 3GHAA 4HSCX 4XHMA 1HNCA 5HFIA 4AJ6A 2AAWA 3UARA 2F9SA 1TKDB 2CV4A 1ERVA 5IM9A 3L9SA 5IO2A 2YNXA 2X8CA 6GSXA 2EC4A 2YJHA 4HJ2A 4AJ8A 4EIPA 5DALA 1F2EA 5IMAA 2YOIA 5D93A 2I1UA 4G0KA 5B6MA 5GZZB 3UBKA 4BVXA 4ECCA 5J5NA 2HSYA 1G0TA 2OBIA 2H0GA 2MBTA 4WEYA 4PNFA 3LWAA 1M9BA 4EC0A 4K7NA 1XVWA 2HI7A 2A4VA 3Q18A 5ECKB 4OCFA 3APQA 4MZWA 1GNEA 2H0HA 2AUVA 1MTCA 3FZAA 4V2LA 3IC4A 3F4TA 2DIZA 2C8UA 4KW6A 4TW5A 2V2GA 1EP7A 1Z7PA 3BD2A 5G1LA 3ZTLA 2ON7A 2GVPA 1BQ7A 5CO3A 3ZIVA 3KTBA 1ML6A 2B5EA 2DSAA 2MZCA 3LJRA 3KMNA 2EIRA 1BEDA 1M3JA 3KTLA 3WT2A 2K8SA 22GSA 1RQMA 4CW9A 1WP0A 3EURA 1YKAA 2IWTA 1TI3A 3H4KA 4WXTA 4DSSB 2NVLA 3DYRA 1O85A 3A3TA 4I5QA 2GGTA 1XVQA 3IV4A 5CRWA 5IPGA 4P3YB 4AJ7A 4NHWA 5G31A 3TUEA 1UN2A 3KM6A 3EC3A 3IBHA 4KE3A 1M9AA 1XWKA 1THXA 1FOHA 1YF0A 2L5OA 4YKGA 2PPTA 2R37A 2AJQB 2B1KA 3BCKA 5BRTA 3GTUA 4KSMA 3C71A 2OE3A 6GSUA 3UBLA 2C80A 4IW9A 3QDNA 2DJ1A 5INYA 1T3BA 1A0RP 1GLQA 3CSIA 1F6MC 1CQHA 3EU4A 3EVIA 1G7EA 3BCIA 2LNSA 3GKXA 1A8LA 2KHPA 2GSQA 2F8FA 5FT3A 5H5RA 2DLXA 3F6DA 2VD1A 2LNTA 1SK2A 2M72A 4Z2TA 4O5UA 2A4HA 3UAPA 1TDIA 3KGKA 1KEBA 3NOFA 3GSTA 1K0DA 4D73A 2R3XA 2NPBA 1GTUA 1F3BA 3LSZA 2LRTA 4G10A 5IMVA 1Z6NA 4IVFA 3H79A 2D2ZA 5HR1A 4K0NA 4FYBA 1W89A 4L0UA 2PN8A 4KX4A 3TKQA 4TRXA 3HXSA 6GSSA 2C4JA 4JE1A 4TR3A 2E0QA 4OCEA 3GYKA 18GSA 4N30A 3UJ1A 2LRCA 3C1SA 1MDJA 4ACSA 2J23A 1O81A 4HJMA 2VL9A 4TXOA 4BVYB 2LQOA 3VPTA 2GQLA 4EKZA 2HRKA 2HSHA 3A2WA 2P5RA 5DQYA 1G7OA 5F06A 4KDUA 4RI6A 2IPAA 1FB6A 2RM5A 4BL7B 2X99A 3ZMLA 2MYGA 1XW6A 1SD9A 4MDCA 3QAVA 1M3IA 1OYJA 1YQ1A 2R6KA 5ECNB 1OE8A 3HJPA 1ON4A 4BWQA 3TB2A 3LEFA 2OACA 3HHVA 3LYKA 4KGIA 2O89A 3CRUA 1M2BA 5HR0A 4V1Ap 3DEXA 2GT6A 3O76A 1VF4A 1OAZA 5B6NA 2VIMA 4OFNA 1I9DA 4NMUA 4ID0A 4OWYA 4G2EA 1ZYNA 2ON5A 2P5QA 1TW9A 1B48A 4O5QA 2VL2C 5D9XA 2CZ2A 4I8BA 3LQ7A 3L4NA 1MD3A 4XS4B 3R3EA 4WBJA 3KH7A 3HYPA 3FR9A 4IJ3A 4L5LA 1SJIA 2C3NA 2DJJA 2HRAA 2RM6A 2AYTA 5D9WA 1MDIA 1YEPA 4WBRD 2HZEB 1TXXA 1VF3A 3KEBA 2KLXA 2WULA 1PFOA 2OKAA 5EVOA 2ZCTA 4E8EA 4POBA 5ECMB 1RK4A 3APSA 1GTAA 2FNOA 5KN0A 2OADA 2X49A 3EINA 5IMCA 4TOPA 3WGEA 1N2AA 1K0MA 2HLSA 2P0GA 3EPTA 3IK7A 14GSA 2LJRA 4MK3A 3KJYA 4CHSA 1H75A 1JZWA 2XBIA 2GLRA 4Q5QA 2BJXA 4ZILA 3TDGA 1EZKA 4TN8A 3ZFBA 8GSSA 5ECPB 1OC9A 2CVBA 3KP9A 5CRGA 2H1GA 2H0IA 5HFKA 3GIXA 5AN1A 1OKDA 4KB3A 4IS0A 1SL2B 2PWJA 2O8VB 3HVSA 1K3LA 4HU7A 4O92A 4WF5A 1FVJA 4MNNA 4F9ZA 5CP1A 4BA7A 1GULA 5HQPA 5D96A 3D4MA 5ELGA 1ZL9A 6GSWA 1EGOA 2DMLA 2CAQA 1XWAA 3LGCA 4K7OA 2HSMA 4GCIA 4K0GA 4EE0A 3FHKA 2YWIA 3MAKA 3UOMA 1FVKA 2IMKA 3QFAC 1O6JA 5KN2A 2VLVA 3TCOA 3FR3A 4IP6A 1PL1A 2VD0A 2YV7A 3FMWA 3VPQA 1ZGNA 5AIXA 2FUG2 2H71A 1PD21 2G0FA 2FA8A 2X4AA 1GSEA 3ME7A 3N5OA 2CT6A 2XC2A 4LMVA 4IN0A 2VCVA 5JWOB 4NPBA 4ZL8A 3BJ5A 2HNLA 1GNWA 1ACVA 1K0OA 3ZZXA 2VL3A 5ECQB 1A8YA 1JZOA 2YWNA 4N11A 5H5QA 6GSVA 1WJKA 4PNGA 5JWQB 4HDEA 4YQMA 1XFLA 4GF0A 3N9JA 4ZIJA 4XCSA 3WGXA 2KOKA 4TR4A 4OFMA 4RUVA 2LV3A 3CRTA 3LW9A 3EMPA 4K5RA 1EV9A 1XOAA 4ZBBA 3F3RA 2MMZA 1XWGA 3L0HA 1V40A 4YQVA 2J9HA 4WR4A 4X0XA 3M9KA 5IPHA 2MMOA 2JU5A 2DBCA 5DCGA 3QOUA 1H4OA 3F4RA 4I97A 1PKZA 4NV5A 5BMUA 5DCHA 2OBKA 4ECBA 3ERWA 5GAPD 2HT9A 1FAAA 3LXZA 3EE2A 4ML6A 1ZZYA 5DAKA 1PQNA 1XWCA 3NZNA 4K9ZA 5ECLB 4BVYA 5LD0A 13GSA 1U6TA 1GSYA 4PQIA 4FQUA 4IJIA 2N5BA 2BTOT 4X1UA 1NM3A 2VCXA 4BL7A 1BX9A 3V1WA 5D9TA 4WKWA 2L4QA 2ES7A 5ELAA 2XPEA 1Y6EA 5JCGA 4K2DA 1J0FA 4KUNA 2FLSA 1TK5B 1V2AA 2OE1A 1FW1A 5IMZA 2H6YA 2PGTA 3EMXA 2MMAA 1B4QA 3ZREA 1Z6MA 1SYXA 2V6OA 1XG8A 5G5EA 1UC7A 2JSYA 6GSYA 3G7YA 1TU8A 4ISDA 3GV1A 2IJYA 4IP1A 1NSWA 4JU5A 4HQSA 1SYRA 1R7HA 4L8EA 3HY2A 1XWBA 4ML1A 2HFDA 5B8AA 5FHIA 3GL5A 3UIWA 4PQHA 1QGVA 2IMIA 2C0FA 5B8BA 5J4UA 3GH6A 2H75A 4K8MA 1ZYPA 2R0GA 3ZVJD 5ID2B 1GSFA 1O73A 3RHBA 1QQ2A 1S3RA 2L4CA 2VM1A 3HA9A 1FB0A 2R5GA 3KMOA 4N0VA 1YJ6A 4POMA 3W8JA 4Z2UA 4PUAA 4F0CA 5G2ZA 1O8XA 4FIWA 11GSA 1UA5A 2R2JA 3ERFA 4MABA 2LSTA 4MF6A 2IIYA 2PVOC 3HVVA 3GX0A 2A2SA 4HUAA 3I6AA 3PH9A 1SENA 2DJ2A 2QSIA 4L5OA 2H72A 1RW1A 4LLRA 2FWHA 3H8QA 4KNDA 5IMFA 5ECSA 4FYUA 1TI1A 5KOXA 2B5YA 1USBA 3WD6A 3HCZA 2REMA 2VL2A 4O7HA 4LA1A 4POKA 1J08A 2DIYA 2KP1A 2YN1A 3CXGA 3TJGA 5LNKe 3SWLA 1OKTA 4RQRA 3BOAA 1K3OA 3CMIA 2H19A 4XS1A 3TKSE 2B7JA 2E2GA 3CBUA 1BAYA 3D0ZA 3UVHA 3CQFA 5CRDA 1M2AA 4OO4A 1ZYEA 1ILOA 4F2IA 4EF0A 4PQ1A 2H1DA 2QA2A 2R4VA 1ZYQB 2V41A 3GSSA 2X8HA 2H73A 2QGVA 3TRQA 3LORA 3LFLA 3WT1A 1E6BA 2HXKA 4FO5A 2H1AA 3ERGA 2FD3A 2VM2A 2AHEA 3QPMA 4F0BA 5A4VA 4YAPA 4YAVA 3NIVA 5G30A 2EIOA 2MMNA 5FWGA 4J57E 4MJAA 2GTUA 3F6FA 1VGLA 5F05A 3GRXA 2C3QA 4DEJA 4PGTA 1SK1A 4MZCA 4JZQA 1LU4A 4A5PA 3VI7A 4GSSA 3VFIA 3IC8A 1A0FA 4PURA 1VF1A 3S9FA 1MD4A 2MBSA 2FWFA 2GT5A 2YV9A 4KCEA 1X9WB 2F8AA 5DJMA 3US3A 5J41A 1MDKA 2N5FA 3FY7A 3HJMA 5DJLA 3HVNA 2GQMA 6GSTA 2BMXA 1DUGA 2C3TA 2L57A 2O87A 4ZB8A 3G7JA 5HR2A 3GN3A 3TJFA 3APOA 1SL0B 1SKWB 2FA4A 1K3YA 3C8EA 3MSZA 1V57A 2I4AA 1T00A 5DALB 1HYUA 1PL2A 1GP1A 2LJKA 2EIQA 3IAS2 4GLTA 1GLPA 3D6IA 4ILFA 1EOHA 4TXVA 3I69A 4G9HA 1S3AA 5E59A 1TP9A 1GUMA 4JBBA 4Z2RA 4XRAA 2IFQA 2PUKC 4JR6A 4QL9A 1HNAA 1CQGA 2YZHA 1ZOFA 2OE0A 4MCUA 3TKPA 2WZ9A 5EPFA 4IELA 4QQ7A 2ZUPA 4EL1A 3O3TA 1MEKA 3MYDA 2R0PA 4O5RA 4EO3A 1V9WA 3R2QA 1AQXA 3KCMA 1GSSA 3GKKA 3ZVJA 5IOXA 2LEGA 3K8NA 3O6TA 1ERWA 2TRCP 4K2XA 1O8WA 4V2MA 4I2TA 1XBSA 2YANA 5CREA 4FYCA 3QCPA 1XW9A 3C1RA 4PUFC 4K6XA 4ECIA 4GTUA 1DE2A 3QD9A 1F37A 1SKRB 2GQKA 3C73A 3FZ4A 1T7PB 3UVTA 3VWWA 2VCWA 4G0LA 3CTFA 4MF5A 4IBPA 1U87A 2RLIA 2F3MA 3GTUB 1B9YC 3A5IA 2GSTA 4WETA 2QKEA 12GSA 2VCTA 1TRSA 1Q4JA 2VCQA 5IQYA 1AIUA 4ULXA 4DSSA 2LQQA 2E7PA 2XBQA 3ZRDA 3DD3A 2YJ7A 1XOBA 4AGSA 4Q5RA 4K1FA 2K6VA 3CYNA 3QFBC 5ID2A 4MPGA 5ABRA 4G0IA 3QAWA 5DQSA 5JWRB 1M2DA 2VLUA 4JRRA 3F63A 2K9FA 4MPFA 1GWCA 5J9BA 3ED3A 1GUKA 4EIQA 1GTIA 2PBJA 1GSDA 4GSTA 4MJCA 1R4WA 1EOGA 4HZ4A 2XHFA 1WOUA 3J7Yb 1SKSB 3E9JB 1EEMA 5AISA 2CZ3A 3F8UA 5D9VA 1GH2A 3D22A 4D73B 3ZYWA 2WB9A 3DVXA 4HU9A 4NHZA 4LMWA 1NW2A 2I81A 1PKWA 1JZDA 2L5LA 4MLYA 5CNWA 3IK9A 1K0AA 4TR0A 1IYHA 4KH7A 5IOWA 1KNGA 3TGZA 4HS1A 3GKNA 2UZ8A 4MZBA 3F9UA 3RAZA 4ZL9A 3UL3A 5A4WA 2RUEA 1TOFA 4ZL7A 1PN0A 4ZBDA 2B6MA 2RUFA 2FWGA 2WCIA 1GUHA 2NTOA 4KSOA 2H70A 3FK8A 1YY7A 4K7IA 3CSHA 3Q19A 1K0BA 2WS2A 3E0UA 2QC7A 2B5XA 1Z9HA 3WYWA 4OMVA 3P8WA 3TRXA 4IKHA 3LXTA 3TRPA 4EXJA 1XW5A 4KDXA 1T4ZA 4L0WA 4HZ2A 5DDLA 3DKSA 2FY6A 2GZPA 5GAND 4J2FA 4XIHA 1XXUA 3DGQA 1AAZA 2TRXA 2B7KA 1ST9A 20GSA 2CX3A 3RPNA 2CQ9A 4MF7A 2LJAA 5CAXA 2O7KA 2DJKA 4AF2A 3IRAA 3HZ8A 2YCDA 3EWLA 4TKYA 1G6WA 1OE7A 4ZBAA 3RPPA 1GL8A 4Q5FA 2YWOA 4ECJA 3VWXA 2RIIA 3ZIJA 2DJ0A 1GSUA 1BJXA 3VURA 3CSJA 4E8HA 2WGRA 2X64A 3M9JA 3TOTA 3PINA 1M99A 1YF1A 5J3RA 1TK8B 2YP6A 3QAGA 1PSQA 3ZMKA 1PX6A 3RHCA 3TKRA 5CYYA 3KP8A 1WWJA 4WF4A 1XCCA 1TU7A 3MDKA 5DBQA 2ALBA 3VLNA 5D8IA 3UEMA 4BPYA 4X43A 1M0UA 1URMA 2A2PA 3I9V2 2DC5A 3MWHA 1PA3A 2HE3A 2X8GA 3MNGA 19GSA 2CAIA 5ENUA 4RQXA 1FO5A 4J56E 3IHQA 1IYIA 1SK0A 4O32A 4XS4A 1JFUA 1OC9B 2C0GA 5AIVA 3DVWA 1SU9A 2HZEA 3IR4A 1M7TA 3A5WA 4XS6A 5KEJA 3IOSA 1DBYA 1WE0A 2YZUA 1QXHA 2I3YA 1AQVA 1YDKA 5ECHB 4NWYA 1ERTA 2JADA 2TIRA 3GA4A 3PPUA 2GSSA 1F3AA 5HFGA 1X5CA 4TR1B 1TRUA 3WGDA 1X9SB 4YKFA 1VRSD 1T4YA 2OA7A 2WJUA 1R5PA 1QK8A 2N5AA 2V32A 3M1GA 1GSQA 2PERA 1C72A 1Z7RA 3SBCA 5G1KA 4GRFA 1NHYA 1O7UA 1JLVA 4POLA 1TRVA 4MMMA 3KIJA 2JL4A 4QL7A 2FCHA 3FEUA 1S3CA 2CA8A 3EYTA 4DSQA 2FGXA 3VWVA 4BWSA 1VF2A 4NXIA 1TK0B 4Q5NA 5ECOB 3FKFA 3HKRA 2QA1A 2DKHA 3JCML 1U88A 3P90A 3C7MA 4OO5A 1T1VA 1OC8A 3AY8A 2IMDA 1J9BA 3P2AA 3VWUA 2OJLA 1DSBA 4GXZA 3L9UA 3BBYA 4DSRA 5CRHA 1YKCA 2XPDA 1TRWA 1YZXA 1Y25A 2VO4A 1KTEA 5C04A 4CY8A 5EY6A 1W4VA 2L6DA 1AXDA 2CVDA 4JEDA 3IXRA 1OVNA 3M3MA 2IN3A 1B9XC 3IDVA 4I6XA 3GL3A 1HNBA 4KAEA 4MH2A 4HEA2 1N8JA 2DKIA 5KN3A 1GTBA 1NHOA 3G9BA 2L59A 5H5SA 1I5GA 3ZL5A 4N0ZA 1FG4A 2HRNA 3PR8A 4FH8A 4GQCA 5DVBA 1KBNA 4EUYA 1GRXA 3DIEA 2GZYA 3GMFA 4IQ1A 1PGTA 4IHUA 4V2NA 4HOJA 1R5AA 1FHEA 2JZTA 5DAKB 3IPZA 3A2VA 2V1MA 1FOVA 1V58A 2H76A 1ZCPA 4F03A 4MP4A 4MJBA 4KDYA 2M46A 1A2JA 2I9HA 1A2LA 1XIYA 3TJBA 1Z5YE 4Z7XA 3ME8A 2C1YA 5COHA 4X4JA 2IL3A 4LL1B 3TOUA 3Q6OA 5F8BA 2CVKA 2V6KA 2PVQA 9GSSA 5A5KA 1SJZA 4CY6A 1UVZA 3FZ5A 4BVXB 1HQOA 3EU3A 3GH9A
chains in the Genus database with same CATH topology
2YWMA 3GNJA 5GSSA 3U6VA 1WRYA 3TKSA 1X0RA 1LBKA 3M0FA 3TJJA 2DMMA 5GSTA 5IO0A 3VK9A 1E2YA 3ZFLA 5LCZA 2H66A 2O85A 2F51A 2WRTA 5C00A 1AC1A 3IHGA 1X9MB 2LRNA 1G6YA 1Q98A 3MIXA 1EP8A 2C0DA 2LTKA 4XRDA 1LJRA 2H1BA 3Q74A 3A2XA 4G19A 2H6ZA 3KD0A 3W6GA 2LKUA 5F0GA 2VOCA 4ZXGA 5B7CA 2B3SA 2PMTA 3FR6A 2E2MA 4EDZA 3RDWA 3I43A 3J7Yk 2G2QA 17GSA 4JR4A 2VCZA 3W8SA 1WPIA 10GSA 4GWRA 2GSRA 4XTSA 2JZSA 2GDRA 2FWEA 1XPVA 1QMVA 4MJEA 1WIKA 2KUCA 1A24A 2NBSA 3DWVA 1PMTA 2LS5A 5G5FA 3FYGA 2IMFA 1F9MA 3D4TA 4GSNA 4TVEA 3M8NA 1ZMAA 2R0CA 4RI7A 4NAXA 2PU9C 4KA0A 5ECIB 2L6CA 4GQFA 1QFNA 1AQWA 1X5EA 4I2UA 3KZQA 4DVCA 1JLWA 4MA9A 4HI7A 3LYPA 2HRFA 2B1LA 2ZNMA 5IMDA 3H93A 1EEJA 4IQAA 3P7XA 3HZ4A 2IMEA 4F82A 3F3QA 3LG6A 4ICYA 2VUPA 1QUWA 3L9VA 1EV4A 5KN1A 3D21A 3FW2A 3HD5A 3ZLPA 4ZB6A 2LUSA 1DE1A 2VAFA 2C0EA 3DMLA 3GX8A 1JZRA 1V98A 3GURA 2P31A 3IA1A 1HD2A 1SD8A 1ERUA 4KCAA 5J9CA 3DRNA 1A2MA 1SL1B 2AV4A 1B8XA 4TR1A 3VI5A 1K0NA 16GSA 4PTSA 4EVMA 3TKSC 5E4WA 2H6XA 4ZB9A 3F4SA 4YQUA 3KH9A 2M80A 3FZ9A 4USSA 3GFKA 4K5SA 3HVXA 5L71A 2GZZA 2DJ3A 5EL8A 1JHBA 3KXOA 2K18A 4HQZA 5F07A 3ZITA 1SJ6A 1K0CA 5HR3A 2NDOA 2WFCA 3HDCA 5KOWA 3PGTA 1PX7A 2K8VA 4NV2A 5JCWA 3HJOA 4OFTA 1BG5A 3OR5A 3GKMA 2GS3A 1ABAA 3L78A 2HZFA 2Z9SA 1S3DA 3D5JA 4TXOB 1R26A 1BYEA 4YH2A 4H86A 3FRCA 3QMXA 2WDUA 3QR6A 4N10A 2H30A 4EDYA 2HYXA 1EGRA 1XZOA 1AUCA 4LL4B 2A2RA 1WMJA 3ISOA 3GUSA 3U5RE 5IIZA 1B4PA 3IE3A 4PXOA 1X5DA 3G7IA 5ECRB 1PRXA 1OC3A 1A23A 2CX4A 3H1NA 1EWXA 3UMAA 1THOA 5A4UA 1YEXA 5AGYA 3DXBA 1PN9A 4CDOA 1T8EB 7GSSA 2JSZA 2H74A 2JACA 1Z3EA 2VLTA 4WR5A 2H01A 4KF9A 3TJKA 1TJDA 4IGJA 1TTZA 2H8LA 2JZRA 3IAM2 3E3EA 4OD7A 2AB6A 4PX1A 4V1Ag 2FHEA 3CTGA 3F0IA 2YPMA 1U3IA 4MH3A 2KP2A 3RBTA 1AW9A 5JCUA 5D73A 1U3AA 2IFQB 3GHAA 4XHMA 1HNCA 5HFIA 4AJ6A 2AAWA 3UARA 2F9SA 1TKDB 2CV4A 1ERVA 5IM9A 3L9SA 5IO2A 2YNXA 2X8CA 6GSXA 2EC4A 2YJHA 4HJ2A 4AJ8A 4EIPA 5DALA 1F2EA 5IMAA 2YOIA 5D93A 2I1UA 4G0KA 5B6MA 5GZZB 3UBKA 4BVXA 4ECCA 5J5NA 2HSYA 1G0TA 2OBIA 2H0GA 2MBTA 4WEYA 4PNFA 3LWAA 1M9BA 4EC0A 4K7NA 1XVWA 2HI7A 2A4VA 3Q18A 5ECKB 4OCFA 3APQA 4MZWA 1GNEA 2H0HA 2AUVA 1MTCA 3FZAA 4V2LA 3IC4A 3F4TA 2DIZA 2C8UA 4KW6A 4TW5A 2V2GA 1EP7A 1Z7PA 3BD2A 5G1LA 3ZTLA 2ON7A 2GVPA 1BQ7A 5CO3A 3ZIVA 3KTBA 1ML6A 2B5EA 2DSAA 2MZCA 3LJRA 3KMNA 2EIRA 1BEDA 3KTLA 3WT2A 2K8SA 22GSA 1RQMA 4CW9A 1WP0A 3EURA 1YKAA 2IWTA 1TI3A 3H4KA 4WXTA 4DSSB 2NVLA 3DYRA 1O85A 3A3TA 4I5QA 2GGTA 1XVQA 3IV4A 5CRWA 5IPGA 4P3YB 4AJ7A 4NHWA 5G31A 3TUEA 1UN2A 3KM6A 3EC3A 3IBHA 4KE3A 1M9AA 1XWKA 1THXA 1FOHA 1YF0A 2L5OA 4YKGA 2PPTA 2R37A 2AJQB 2B1KA 3BCKA 5BRTA 3GTUA 4KSMA 3C71A 2OE3A 6GSUA 3UBLA 2C80A 4IW9A 3QDNA 2DJ1A 5INYA 1T3BA 1A0RP 1GLQA 3CSIA 1F6MC 1CQHA 3EU4A 3EVIA 1G7EA 3BCIA 2LNSA 3GKXA 1A8LA 2KHPA 2GSQA 2F8FA 5FT3A 5H5RA 2DLXA 3F6DA 2VD1A 2LNTA 1SK2A 2M72A 4Z2TA 4O5UA 2A4HA 3UAPA 1TDIA 3KGKA 1KEBA 3NOFA 3GSTA 1K0DA 4D73A 2R3XA 2NPBA 1GTUA 1F3BA 3LSZA 2LRTA 4G10A 5IMVA 1Z6NA 4IVFA 3H79A 2D2ZA 5HR1A 4K0NA 4FYBA 1W89A 4L0UA 2PN8A 4KX4A 3TKQA 4TRXA 3HXSA 6GSSA 2C4JA 4JE1A 4TR3A 2E0QA 4OCEA 3GYKA 18GSA 4N30A 3UJ1A 2LRCA 3C1SA 1MDJA 4ACSA 2J23A 1O81A 4HJMA 2VL9A 4TXOA 4BVYB 2LQOA 3VPTA 2GQLA 4EKZA 2HRKA 2HSHA 3A2WA 2P5RA 5DQYA 1G7OA 5F06A 4KDUA 4RI6A 2IPAA 1FB6A 2RM5A 4BL7B 2X99A 3ZMLA 2MYGA 1XW6A 1SD9A 4MDCA 3QAVA 1OYJA 1YQ1A 2R6KA 5ECNB 1OE8A 3HJPA 1ON4A 4BWQA 3TB2A 3LEFA 2OACA 3HHVA 3LYKA 4KGIA 2O89A 3CRUA 1M2BA 5HR0A 4V1Ap 3DEXA 2GT6A 3O76A 1VF4A 1OAZA 5B6NA 2VIMA 4OFNA 1I9DA 4NMUA 4ID0A 4OWYA 4G2EA 1ZYNA 2ON5A 2P5QA 1TW9A 1B48A 4O5QA 2VL2C 5D9XA 2CZ2A 4I8BA 3LQ7A 3L4NA 1MD3A 4XS4B 3R3EA 4WBJA 3KH7A 3HYPA 3FR9A 4IJ3A 4L5LA 1SJIA 2C3NA 2DJJA 2HRAA 2RM6A 2AYTA 5D9WA 1MDIA 1YEPA 4WBRD 2HZEB 1TXXA 1VF3A 3KEBA 2KLXA 2WULA 2OKAA 5EVOA 2ZCTA 4E8EA 4POBA 5ECMB 1RK4A 3APSA 1GTAA 2FNOA 5KN0A 2OADA 2X49A 3EINA 5IMCA 4TOPA 3WGEA 1N2AA 1K0MA 2HLSA 2P0GA 3EPTA 3IK7A 14GSA 2LJRA 4MK3A 3KJYA 4CHSA 1H75A 1JZWA 2XBIA 2GLRA 4Q5QA 2BJXA 4ZILA 3TDGA 1EZKA 4TN8A 3ZFBA 8GSSA 5ECPB 1OC9A 2CVBA 3KP9A 5CRGA 2H1GA 2H0IA 5HFKA 3GIXA 5AN1A 1OKDA 4KB3A 4IS0A 1SL2B 2PWJA 2O8VB 3HVSA 1K3LA 4HU7A 4O92A 4WF5A 1FVJA 4MNNA 4F9ZA 5CP1A 4BA7A 1GULA 5HQPA 5D96A 3D4MA 5ELGA 1ZL9A 6GSWA 1EGOA 2DMLA 2CAQA 1XWAA 3LGCA 4K7OA 2HSMA 4GCIA 4K0GA 4EE0A 3FHKA 2YWIA 3MAKA 3UOMA 1FVKA 2IMKA 3QFAC 1O6JA 5KN2A 2VLVA 3TCOA 3FR3A 4IP6A 1PL1A 2VD0A 2YV7A 3FMWA 3VPQA 1ZGNA 5AIXA 2FUG2 2H71A 1PD21 2G0FA 2FA8A 2X4AA 1GSEA 3ME7A 3N5OA 2CT6A 2XC2A 4LMVA 4IN0A 2VCVA 5JWOB 4NPBA 4ZL8A 3BJ5A 2HNLA 1GNWA 1ACVA 1K0OA 3ZZXA 2VL3A 5ECQB 1A8YA 1JZOA 2YWNA 4N11A 5H5QA 6GSVA 1WJKA 4PNGA 5JWQB 4HDEA 4YQMA 1XFLA 4GF0A 3N9JA 4ZIJA 4XCSA 3WGXA 2KOKA 4TR4A 4OFMA 4RUVA 2LV3A 3CRTA 3LW9A 3EMPA 4K5RA 1EV9A 1XOAA 4ZBBA 3F3RA 2MMZA 1XWGA 3L0HA 1V40A 4YQVA 2J9HA 4WR4A 4X0XA 3M9KA 5IPHA 2MMOA 2JU5A 2DBCA 5DCGA 3QOUA 1H4OA 3F4RA 4I97A 1PKZA 4NV5A 5BMUA 5DCHA 2OBKA 4ECBA 3ERWA 5GAPD 2HT9A 1FAAA 3LXZA 3EE2A 4ML6A 1ZZYA 5DAKA 1PQNA 1XWCA 3NZNA 4K9ZA 5ECLB 4BVYA 5LD0A 13GSA 1U6TA 1GSYA 4PQIA 4FQUA 4IJIA 2N5BA 2BTOT 4X1UA 1NM3A 2VCXA 4BL7A 1BX9A 3V1WA 5D9TA 4WKWA 2L4QA 2ES7A 5ELAA 2XPEA 1Y6EA 5JCGA 4K2DA 1J0FA 4KUNA 2FLSA 1TK5B 1V2AA 2OE1A 1FW1A 5IMZA 2H6YA 2PGTA 3EMXA 2MMAA 1B4QA 3ZREA 1Z6MA 1SYXA 2V6OA 5G5EA 1UC7A 2JSYA 6GSYA 3G7YA 1TU8A 4ISDA 3GV1A 2IJYA 4IP1A 1NSWA 4JU5A 4HQSA 1SYRA 1R7HA 4L8EA 3HY2A 1XWBA 4ML1A 2HFDA 5B8AA 5FHIA 3GL5A 3UIWA 4PQHA 1QGVA 2IMIA 2C0FA 5B8BA 5J4UA 3GH6A 2H75A 4K8MA 1ZYPA 2R0GA 3ZVJD 5ID2B 1GSFA 1O73A 3RHBA 1QQ2A 2L4CA 2VM1A 3HA9A 1FB0A 2R5GA 3KMOA 4N0VA 1YJ6A 4POMA 3W8JA 4Z2UA 4PUAA 4F0CA 5G2ZA 1O8XA 4FIWA 11GSA 1UA5A 2R2JA 3ERFA 4MABA 2LSTA 4MF6A 2IIYA 2PVOC 3HVVA 3GX0A 2A2SA 4HUAA 3I6AA 3PH9A 1SENA 2DJ2A 2QSIA 4L5OA 2H72A 1RW1A 4LLRA 2FWHA 3H8QA 4KNDA 5IMFA 5ECSA 4FYUA 1TI1A 5KOXA 2B5YA 1USBA 3WD6A 3HCZA 2REMA 2VL2A 4O7HA 4LA1A 4POKA 1J08A 2DIYA 2KP1A 2YN1A 3CXGA 3TJGA 5LNKe 3SWLA 1OKTA 4RQRA 3BOAA 1K3OA 3CMIA 2H19A 4XS1A 3TKSE 2B7JA 2E2GA 3CBUA 1BAYA 3D0ZA 3UVHA 5CRDA 1M2AA 4OO4A 1ZYEA 1ILOA 4F2IA 4EF0A 4PQ1A 2H1DA 2QA2A 2R4VA 1ZYQB 2V41A 3GSSA 2X8HA 2H73A 2QGVA 3TRQA 3LORA 3LFLA 3WT1A 1E6BA 2HXKA 4FO5A 2H1AA 3ERGA 2FD3A 2VM2A 2AHEA 3QPMA 4F0BA 5A4VA 4YAPA 4YAVA 3NIVA 5G30A 2EIOA 2MMNA 5FWGA 4J57E 4MJAA 2GTUA 3F6FA 1VGLA 5F05A 3GRXA 2C3QA 4DEJA 4PGTA 1SK1A 4MZCA 4JZQA 1LU4A 4A5PA 3VI7A 4GSSA 3VFIA 3IC8A 1A0FA 4PURA 1VF1A 3S9FA 1MD4A 2MBSA 2FWFA 2GT5A 2YV9A 4KCEA 1X9WB 2F8AA 5DJMA 3US3A 5J41A 1MDKA 2N5FA 3FY7A 3HJMA 5DJLA 2GQMA 6GSTA 2BMXA 1DUGA 2C3TA 2L57A 2O87A 4ZB8A 3G7JA 5HR2A 3GN3A 3TJFA 3APOA 1SL0B 1SKWB 2FA4A 1K3YA 3C8EA 3MSZA 1V57A 2I4AA 1T00A 5DALB 1HYUA 1PL2A 1GP1A 2LJKA 2EIQA 3IAS2 4GLTA 1GLPA 3D6IA 4ILFA 1EOHA 4TXVA 3I69A 4G9HA 1S3AA 5E59A 1TP9A 1GUMA 4JBBA 4Z2RA 4XRAA 2IFQA 2PUKC 4JR6A 4QL9A 1HNAA 1CQGA 2YZHA 1ZOFA 2OE0A 4MCUA 3TKPA 2WZ9A 5EPFA 4IELA 4QQ7A 2ZUPA 4EL1A 3O3TA 1MEKA 3MYDA 2R0PA 4O5RA 4EO3A 1V9WA 3R2QA 1AQXA 3KCMA 1GSSA 3GKKA 3ZVJA 5IOXA 2LEGA 3K8NA 3O6TA 1ERWA 2TRCP 4K2XA 1O8WA 4V2MA 4I2TA 1XBSA 2YANA 5CREA 4FYCA 3QCPA 1XW9A 3C1RA 4PUFC 4K6XA 4ECIA 4GTUA 1DE2A 3QD9A 1F37A 1SKRB 2GQKA 3C73A 3FZ4A 1T7PB 3UVTA 3VWWA 2VCWA 4G0LA 3CTFA 4MF5A 4IBPA 1U87A 2RLIA 2F3MA 3GTUB 1B9YC 3A5IA 2GSTA 4WETA 2QKEA 12GSA 2VCTA 1TRSA 1Q4JA 2VCQA 5IQYA 1AIUA 4ULXA 4DSSA 2LQQA 2E7PA 2XBQA 3ZRDA 3DD3A 2YJ7A 1XOBA 4AGSA 4Q5RA 4K1FA 2K6VA 3CYNA 3QFBC 5ID2A 4MPGA 5ABRA 4G0IA 3QAWA 5DQSA 5JWRB 1M2DA 2VLUA 4JRRA 3F63A 2K9FA 4MPFA 1GWCA 5J9BA 3ED3A 1GUKA 4EIQA 1GTIA 2PBJA 1GSDA 4GSTA 4MJCA 1R4WA 1EOGA 4HZ4A 2XHFA 1WOUA 3J7Yb 1SKSB 3E9JB 1EEMA 5AISA 2CZ3A 3F8UA 5D9VA 1GH2A 3D22A 4D73B 3ZYWA 2WB9A 3DVXA 4HU9A 4NHZA 4LMWA 1NW2A 2I81A 1PKWA 1JZDA 2L5LA 4MLYA 5CNWA 3IK9A 1K0AA 4TR0A 1IYHA 4KH7A 5IOWA 1KNGA 3TGZA 4HS1A 3GKNA 2UZ8A 4MZBA 3F9UA 3RAZA 4ZL9A 3UL3A 5A4WA 2RUEA 1TOFA 4ZL7A 1PN0A 4ZBDA 2B6MA 2RUFA 2FWGA 2WCIA 1GUHA 2NTOA 4KSOA 2H70A 3FK8A 1YY7A 4K7IA 3CSHA 3Q19A 1K0BA 2WS2A 3E0UA 2QC7A 2B5XA 1Z9HA 3WYWA 4OMVA 3P8WA 3TRXA 4IKHA 3LXTA 3TRPA 4EXJA 1XW5A 4KDXA 1T4ZA 4L0WA 4HZ2A 5DDLA 3DKSA 2FY6A 2GZPA 5GAND 4J2FA 4XIHA 1XXUA 3DGQA 1AAZA 2TRXA 2B7KA 1ST9A 20GSA 2CX3A 3RPNA 2CQ9A 4MF7A 2LJAA 5CAXA 2O7KA 2DJKA 4AF2A 3IRAA 3HZ8A 2YCDA 3EWLA 4TKYA 1G6WA 1OE7A 4ZBAA 3RPPA 1GL8A 4Q5FA 2YWOA 4ECJA 3VWXA 2RIIA 3ZIJA 2DJ0A 1GSUA 1BJXA 3VURA 3CSJA 4E8HA 2WGRA 2X64A 3M9JA 3TOTA 3PINA 1M99A 1YF1A 5J3RA 1TK8B 2YP6A 3QAGA 1PSQA 3ZMKA 1PX6A 3RHCA 3TKRA 5CYYA 3KP8A 1WWJA 4WF4A 1XCCA 1TU7A 3MDKA 5DBQA 2ALBA 3VLNA 5D8IA 3UEMA 4BPYA 4X43A 1M0UA 1URMA 2A2PA 3I9V2 2DC5A 3MWHA 1PA3A 2HE3A 2X8GA 3MNGA 19GSA 2CAIA 5ENUA 4RQXA 1FO5A 4J56E 3IHQA 1IYIA 1SK0A 4O32A 4XS4A 1JFUA 1OC9B 2C0GA 5AIVA 3DVWA 1SU9A 2HZEA 3IR4A 1M7TA 3A5WA 4XS6A 5KEJA 3IOSA 1DBYA 1WE0A 2YZUA 1QXHA 2I3YA 1AQVA 1YDKA 5ECHB 4NWYA 1ERTA 2JADA 2TIRA 3GA4A 3PPUA 2GSSA 1F3AA 5HFGA 1X5CA 4TR1B 1TRUA 3WGDA 1X9SB 4YKFA 1VRSD 1T4YA 2OA7A 2WJUA 1R5PA 1QK8A 2N5AA 2V32A 3M1GA 1GSQA 2PERA 1C72A 1Z7RA 3SBCA 5G1KA 4GRFA 1NHYA 1O7UA 1JLVA 4POLA 1TRVA 4MMMA 3KIJA 2JL4A 4QL7A 2FCHA 3FEUA 1S3CA 2CA8A 3EYTA 4DSQA 2FGXA 3VWVA 4BWSA 1VF2A 4NXIA 1TK0B 4Q5NA 5ECOB 3FKFA 3HKRA 2QA1A 2DKHA 3JCML 1U88A 3P90A 3C7MA 4OO5A 1T1VA 1OC8A 3AY8A 2IMDA 1J9BA 3P2AA 3VWUA 2OJLA 1DSBA 4GXZA 3L9UA 3BBYA 4DSRA 5CRHA 1YKCA 2XPDA 1TRWA 1YZXA 1Y25A 2VO4A 1KTEA 5C04A 4CY8A 5EY6A 1W4VA 2L6DA 1AXDA 2CVDA 4JEDA 3IXRA 1OVNA 3M3MA 2IN3A 1B9XC 3IDVA 4I6XA 3GL3A 1HNBA 4KAEA 4MH2A 4HEA2 1N8JA 2DKIA 5KN3A 1GTBA 1NHOA 3G9BA 2L59A 5H5SA 1I5GA 3ZL5A 4N0ZA 1FG4A 2HRNA 3PR8A 4FH8A 4GQCA 5DVBA 1KBNA 4EUYA 1GRXA 3DIEA 2GZYA 3GMFA 4IQ1A 1PGTA 4IHUA 4V2NA 4HOJA 1R5AA 1FHEA 2JZTA 5DAKB 3IPZA 3A2VA 2V1MA 1FOVA 1V58A 2H76A 1ZCPA 4F03A 4MP4A 4MJBA 4KDYA 2M46A 1A2JA 2I9HA 1A2LA 1XIYA 3TJBA 1Z5YE 4Z7XA 3ME8A 2C1YA 5COHA 4X4JA 2IL3A 4LL1B 3TOUA 3Q6OA 5F8BA 2CVKA 2V6KA 2PVQA 9GSSA 5A5KA 1SJZA 4CY6A 1UVZA 3FZ5A 4BVXB 1HQOA 3EU3A 3GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWM A;  3GNJ A;  5GSS A;  3U6V A;  1WRY A;  3TKS A;  1X0R A;  1LBK A;  3M0F A;  3TJJ A;  2DMM A;  5GST A;  5IO0 A;  3VK9 A;  1E2Y A;  3ZFL A;  5LCZ A;  2H66 A;  2O85 A;  2F51 A;  2WRT A;  5C00 A;  1AC1 A;  1X9M B;  2LRN A;  1G6Y A;  1Q98 A;  1EP8 A;  2C0D A;  2LTK A;  4XRD A;  1LJR A;  2H1B A;  3Q74 A;  3A2X A;  4G19 A;  2H6Z A;  3KD0 A;  3W6G A;  2LKU A;  5F0G A;  2VOC A;  4ZXG A;  5B7C A;  2B3S A;  2PMT A;  3FR6 A;  2E2M A;  4EDZ A;  3RDW A;  3I43 A;  3J7Y k;  2G2Q A;  17GS A;  4JR4 A;  2VCZ A;  3W8S A;  1WPI A;  10GS A;  4GWR A;  2GSR A;  4XTS A;  2JZS A;  2GDR A;  2FWE A;  1XPV A;  1QMV A;  4MJE A;  1WIK A;  2KUC A;  1A24 A;  2NBS A;  3DWV A;  1PMT A;  2LS5 A;  5G5F A;  3FYG A;  2IMF A;  1F9M A;  3D4T A;  4GSN A;  4TVE A;  3M8N A;  1ZMA A;  4RI7 A;  4NAX A;  2PU9 C;  4KA0 A;  5ECI B;  2L6C A;  4GQF A;  1QFN A;  1AQW A;  1X5E A;  4I2U A;  3KZQ A;  4DVC A;  1JLW A;  4MA9 A;  4HI7 A;  3LYP A;  2HRF A;  2B1L A;  2ZNM A;  5IMD A;  3H93 A;  1EEJ A;  4IQA A;  3P7X A;  3HZ4 A;  2IME A;  4F82 A;  3F3Q A;  3LG6 A;  2VUP A;  1QUW A;  3L9V A;  1EV4 A;  5KN1 A;  3D21 A;  3FW2 A;  3HD5 A;  3ZLP A;  4ZB6 A;  2LUS A;  1DE1 A;  2VAF A;  2C0E A;  3DML A;  3GX8 A;  1JZR A;  1V98 A;  3GUR A;  2P31 A;  3IA1 A;  1HD2 A;  1SD8 A;  1ERU A;  4KCA A;  5J9C A;  3DRN A;  1A2M A;  1SL1 B;  2AV4 A;  1B8X A;  4TR1 A;  3VI5 A;  1K0N A;  16GS A;  4EVM A;  3TKS C;  5E4W A;  2H6X A;  4ZB9 A;  3F4S A;  4YQU A;  3KH9 A;  2M80 A;  3FZ9 A;  3GFK A;  3HVX A;  5L71 A;  2GZZ A;  2DJ3 A;  5EL8 A;  1JHB A;  3KXO A;  2K18 A;  4HQZ A;  5F07 A;  3ZIT A;  1SJ6 A;  1K0C A;  5HR3 A;  2NDO A;  2WFC A;  3HDC A;  3PGT A;  1PX7 A;  2K8V A;  4NV2 A;  5JCW A;  3HJO A;  4OFT A;  1BG5 A;  3OR5 A;  3GKM A;  2GS3 A;  1ABA A;  3L78 A;  2HZF A;  2Z9S A;  1S3D A;  3D5J A;  4TXO B;  1R26 A;  1BYE A;  4YH2 A;  4H86 A;  3FRC A;  3QMX A;  2WDU A;  3QR6 A;  4N10 A;  2H30 A;  4EDY A;  2HYX A;  1EGR A;  1XZO A;  1AUC A;  4LL4 B;  2A2R A;  1WMJ A;  3ISO A;  3GUS A;  3U5R E;  5IIZ A;  1B4P A;  3IE3 A;  4PXO A;  1X5D A;  3G7I A;  5ECR B;  1PRX A;  1OC3 A;  1A23 A;  2CX4 A;  3H1N A;  1EWX A;  3UMA A;  1THO A;  5A4U A;  1YEX A;  5AGY A;  3DXB A;  1PN9 A;  4CDO A;  1T8E B;  7GSS A;  2JSZ A;  2H74 A;  2JAC A;  1Z3E A;  2VLT A;  4WR5 A;  2H01 A;  3TJK A;  1TJD A;  4IGJ A;  1TTZ A;  2H8L A;  2JZR A;  3IAM 2;  3E3E A;  4OD7 A;  2AB6 A;  4PX1 A;  4V1A g;  2FHE A;  3CTG A;  3F0I A;  2YPM A;  1U3I A;  4MH3 A;  2KP2 A;  3RBT A;  1AW9 A;  5JCU A;  5D73 A;  1U3A A;  2IFQ B;  3GHA A;  4XHM A;  1HNC A;  5HFI A;  4AJ6 A;  2AAW A;  3UAR A;  2F9S A;  1TKD B;  2CV4 A;  1ERV A;  5IM9 A;  3L9S A;  5IO2 A;  2YNX A;  2X8C A;  6GSX A;  2EC4 A;  2YJH A;  4HJ2 A;  4AJ8 A;  5DAL A;  1F2E A;  5IMA A;  2YOI A;  5D93 A;  2I1U A;  5B6M A;  5GZZ B;  3UBK A;  4BVX A;  4ECC A;  5J5N A;  2HSY A;  1G0T A;  2OBI A;  2H0G A;  2MBT A;  4WEY A;  4PNF A;  3LWA A;  1M9B A;  4EC0 A;  4K7N A;  1XVW A;  2HI7 A;  2A4V A;  3Q18 A;  5ECK B;  4OCF A;  3APQ A;  4MZW A;  1GNE A;  2H0H A;  2AUV A;  1MTC A;  3FZA A;  4V2L A;  3IC4 A;  3F4T A;  2DIZ A;  2C8U A;  4KW6 A;  4TW5 A;  2V2G A;  1EP7 A;  1Z7P A;  3BD2 A;  5G1L A;  3ZTL A;  2ON7 A;  2GVP A;  1BQ7 A;  5CO3 A;  3ZIV A;  3KTB A;  1ML6 A;  2B5E A;  2DSA A;  2MZC A;  3LJR A;  3KMN A;  2EIR A;  1BED A;  3KTL A;  3WT2 A;  2K8S A;  22GS A;  1RQM A;  4CW9 A;  1WP0 A;  3EUR A;  1YKA A;  2IWT A;  1TI3 A;  3H4K A;  4WXT A;  4DSS B;  2NVL A;  3DYR A;  1O85 A;  3A3T A;  4I5Q A;  2GGT A;  1XVQ A;  3IV4 A;  5CRW A;  5IPG A;  4P3Y B;  4AJ7 A;  4NHW A;  5G31 A;  3TUE A;  1UN2 A;  3KM6 A;  3EC3 A;  3IBH A;  4KE3 A;  1M9A A;  1XWK A;  1THX A;  1YF0 A;  2L5O A;  2PPT A;  2R37 A;  2AJQ B;  2B1K A;  3BCK A;  3GTU A;  4KSM A;  3C71 A;  2OE3 A;  6GSU A;  3UBL A;  2C80 A;  4IW9 A;  3QDN A;  2DJ1 A;  5INY A;  1T3B A;  1A0R P;  1GLQ A;  3CSI A;  1F6M C;  1CQH A;  3EU4 A;  3EVI A;  1G7E A;  3BCI A;  2LNS A;  3GKX A;  1A8L A;  2KHP A;  2GSQ A;  2F8F A;  5FT3 A;  5H5R A;  2DLX A;  3F6D A;  2VD1 A;  2LNT A;  1SK2 A;  2M72 A;  3UAP A;  1TDI A;  3KGK A;  1KEB A;  3NOF A;  3GST A;  1K0D A;  4D73 A;  2R3X A;  2NPB A;  1GTU A;  1F3B A;  3LSZ A;  2LRT A;  4G10 A;  5IMV A;  1Z6N A;  4IVF A;  3H79 A;  2D2Z A;  5HR1 A;  4K0N A;  4FYB A;  1W89 A;  4L0U A;  2PN8 A;  4KX4 A;  3TKQ A;  4TRX A;  3HXS A;  6GSS A;  2C4J A;  4JE1 A;  4TR3 A;  2E0Q A;  4OCE A;  3GYK A;  18GS A;  4N30 A;  3UJ1 A;  2LRC A;  3C1S A;  1MDJ A;  4ACS A;  2J23 A;  1O81 A;  4HJM A;  2VL9 A;  4TXO A;  2LQO A;  3VPT A;  2GQL A;  4EKZ A;  2HSH A;  3A2W A;  2P5R A;  5DQY A;  1G7O A;  5F06 A;  4KDU A;  4RI6 A;  2IPA A;  1FB6 A;  2RM5 A;  2X99 A;  3ZML A;  2MYG A;  1XW6 A;  1SD9 A;  4MDC A;  3QAV A;  1OYJ A;  1YQ1 A;  2R6K A;  5ECN B;  1OE8 A;  3HJP A;  1ON4 A;  4BWQ A;  3TB2 A;  3LEF A;  2OAC A;  3HHV A;  3LYK A;  4KGI A;  2O89 A;  3CRU A;  1M2B A;  5HR0 A;  4V1A p;  3DEX A;  2GT6 A;  3O76 A;  1VF4 A;  1OAZ A;  5B6N A;  2VIM A;  4OFN A;  1I9D A;  4NMU A;  4ID0 A;  4OWY A;  4G2E A;  2ON5 A;  2P5Q A;  1TW9 A;  1B48 A;  2VL2 C;  5D9X A;  2CZ2 A;  4I8B A;  3LQ7 A;  3L4N A;  1MD3 A;  4XS4 B;  4WBJ A;  3KH7 A;  3HYP A;  4IJ3 A;  3FR9 A;  4L5L A;  1SJI A;  2C3N A;  2DJJ A;  2RM6 A;  2AYT A;  5D9W A;  1MDI A;  1YEP A;  4WBR D;  2HZE B;  1TXX A;  1VF3 A;  3KEB A;  2KLX A;  2WUL A;  2OKA A;  5EVO A;  2ZCT A;  4E8E A;  4POB A;  5ECM B;  1RK4 A;  3APS A;  1GTA A;  2FNO A;  5KN0 A;  2OAD A;  3EIN A;  5IMC A;  4TOP A;  3WGE A;  1N2A A;  1K0M A;  2HLS A;  2P0G A;  3IK7 A;  14GS A;  2LJR A;  4MK3 A;  3KJY A;  4CHS A;  1H75 A;  1JZW A;  2XBI A;  2GLR A;  4Q5Q A;  2BJX A;  4ZIL A;  3TDG A;  1EZK A;  4TN8 A;  3ZFB A;  8GSS A;  5ECP B;  1OC9 A;  2CVB A;  3KP9 A;  5CRG A;  2H1G A;  2H0I A;  5HFK A;  3GIX A;  5AN1 A;  1OKD A;  4KB3 A;  4IS0 A;  1SL2 B;  2PWJ A;  2O8V B;  3HVS A;  1K3L A;  4HU7 A;  4O92 A;  4WF5 A;  1FVJ A;  4F9Z A;  5CP1 A;  4BA7 A;  1GUL A;  5HQP A;  5D96 A;  3D4M A;  5ELG A;  1ZL9 A;  6GSW A;  1EGO A;  2DML A;  2CAQ A;  1XWA A;  3LGC A;  4K7O A;  4GCI A;  4K0G A;  4EE0 A;  3FHK A;  2YWI A;  3MAK A;  3UOM A;  1FVK A;  2IMK A;  3QFA C;  1O6J A;  5KN2 A;  2VLV A;  3TCO A;  3FR3 A;  4IP6 A;  1PL1 A;  2VD0 A;  2YV7 A;  3VPQ A;  1ZGN A;  5AIX A;  2FUG 2;  2H71 A;  1PD2 1;  2G0F A;  2FA8 A;  3ME7 A;  1GSE A;  3N5O A;  2CT6 A;  2XC2 A;  4LMV A;  4IN0 A;  2VCV A;  5JWO B;  4NPB A;  4ZL8 A;  3BJ5 A;  2HNL A;  1GNW A;  1ACV A;  1K0O A;  3ZZX A;  2VL3 A;  5ECQ B;  1A8Y A;  1JZO A;  2YWN A;  4N11 A;  5H5Q A;  6GSV A;  1WJK A;  4PNG A;  5JWQ B;  4HDE A;  4YQM A;  1XFL A;  4GF0 A;  3N9J A;  4ZIJ A;  4XCS A;  3WGX A;  2KOK A;  4TR4 A;  4OFM A;  4RUV A;  2LV3 A;  3CRT A;  3EMP A;  1EV9 A;  1XOA A;  4ZBB A;  3F3R A;  2MMZ A;  1XWG A;  3L0H A;  1V40 A;  4YQV A;  2J9H A;  4WR4 A;  4X0X A;  3M9K A;  5IPH A;  2MMO A;  2JU5 A;  2DBC A;  5DCG A;  3QOU A;  1H4O A;  3F4R A;  4I97 A;  1PKZ A;  4NV5 A;  5DCH A;  2OBK A;  4ECB A;  3ERW A;  5GAP D;  2HT9 A;  1FAA A;  3LXZ A;  3EE2 A;  4ML6 A;  5DAK A;  1ZZY A;  1PQN A;  1XWC A;  3NZN A;  4K9Z A;  5ECL B;  4BVY A;  5LD0 A;  13GS A;  1U6T A;  1GSY A;  4PQI A;  4IJI A;  2N5B A;  2BTO T;  4X1U A;  1NM3 A;  2VCX A;  4BL7 A;  1BX9 A;  3V1W A;  5D9T A;  4WKW A;  2L4Q A;  2ES7 A;  5ELA A;  2XPE A;  1Y6E A;  5JCG A;  4K2D A;  1J0F A;  4KUN A;  2FLS A;  1TK5 B;  1V2A A;  2OE1 A;  1FW1 A;  5IMZ A;  2H6Y A;  2PGT A;  3EMX A;  2MMA A;  1B4Q A;  3ZRE A;  1Z6M A;  1SYX A;  2V6O A;  5G5E A;  1UC7 A;  2JSY A;  6GSY A;  3G7Y A;  1TU8 A;  4ISD A;  3GV1 A;  2IJY A;  4IP1 A;  1NSW A;  4JU5 A;  4HQS A;  1SYR A;  1R7H A;  4L8E A;  3HY2 A;  1XWB A;  4ML1 A;  2HFD A;  5B8A A;  5FHI A;  3GL5 A;  3UIW A;  4PQH A;  1QGV A;  2IMI A;  2C0F A;  5B8B A;  5J4U A;  3GH6 A;  2H75 A;  4K8M A;  3ZVJ D;  5ID2 B;  1GSF A;  1O73 A;  3RHB A;  1QQ2 A;  2L4C A;  2VM1 A;  3HA9 A;  1FB0 A;  2R5G A;  3KMO A;  4N0V A;  1YJ6 A;  4POM A;  3W8J A;  4PUA A;  4F0C A;  5G2Z A;  1O8X A;  4FIW A;  11GS A;  1UA5 A;  2R2J A;  3ERF A;  4MAB A;  2LST A;  4MF6 A;  2IIY A;  2PVO C;  3HVV A;  3GX0 A;  2A2S A;  4HUA A;  3I6A A;  3PH9 A;  1SEN A;  2DJ2 A;  2QSI A;  4L5O A;  2H72 A;  1RW1 A;  4LLR A;  2FWH A;  3H8Q A;  4KND A;  5IMF A;  5ECS A;  4FYU A;  1TI1 A;  2B5Y A;  1USB A;  3WD6 A;  3HCZ A;  2REM A;  2VL2 A;  4O7H A;  4LA1 A;  4POK A;  1J08 A;  2DIY A;  2KP1 A;  2YN1 A;  3CXG A;  3TJG A;  5LNK e;  3SWL A;  1OKT A;  4RQR A;  3BOA A;  1K3O A;  3CMI A;  2H19 A;  4XS1 A;  3TKS E;  2B7J A;  2E2G A;  3CBU A;  1BAY A;  3D0Z A;  3UVH A;  5CRD A;  1M2A A;  4OO4 A;  1ZYE A;  1ILO A;  4F2I A;  4EF0 A;  2H1D A;  4PQ1 A;  2R4V A;  1ZYQ B;  2V41 A;  3GSS A;  2X8H A;  2H73 A;  2QGV A;  3TRQ A;  3LOR A;  3LFL A;  3WT1 A;  1E6B A;  2HXK A;  4FO5 A;  2H1A A;  3ERG A;  2FD3 A;  2VM2 A;  2AHE A;  3QPM A;  4F0B A;  5A4V A;  4YAP A;  4YAV A;  3NIV A;  5G30 A;  2EIO A;  2MMN A;  5FWG A;  4J57 E;  4MJA A;  2GTU A;  3F6F A;  1VGL A;  5F05 A;  3GRX A;  2C3Q A;  4DEJ A;  4PGT A;  1SK1 A;  4MZC A;  4JZQ A;  1LU4 A;  3VI7 A;  4GSS A;  3VFI A;  1A0F A;  4PUR A;  1VF1 A;  3S9F A;  1MD4 A;  2MBS A;  2FWF A;  2GT5 A;  2YV9 A;  4KCE A;  1X9W B;  2F8A A;  5DJM A;  3US3 A;  5J41 A;  1MDK A;  2N5F A;  3FY7 A;  3HJM A;  5DJL A;  2GQM A;  6GST A;  2BMX A;  1DUG A;  2C3T A;  2L57 A;  2O87 A;  4ZB8 A;  3G7J A;  5HR2 A;  3GN3 A;  3TJF A;  3APO A;  1SL0 B;  1SKW B;  2FA4 A;  1K3Y A;  3C8E A;  3MSZ A;  1V57 A;  2I4A A;  1T00 A;  5DAL B;  1HYU A;  1PL2 A;  1GP1 A;  2LJK A;  2EIQ A;  3IAS 2;  4GLT A;  1GLP A;  3D6I A;  4ILF A;  1EOH A;  4TXV A;  3I69 A;  4G9H A;  1S3A A;  5E59 A;  1TP9 A;  1GUM A;  4JBB A;  4XRA A;  2IFQ A;  2PUK C;  4JR6 A;  4QL9 A;  1HNA A;  1CQG A;  2YZH A;  1ZOF A;  2OE0 A;  4MCU A;  3TKP A;  2WZ9 A;  5EPF A;  4IEL A;  4QQ7 A;  2ZUP A;  4EL1 A;  3O3T A;  1MEK A;  4O5R A;  4EO3 A;  1V9W A;  3R2Q A;  1AQX A;  3KCM A;  1GSS A;  3GKK A;  3ZVJ A;  5IOX A;  2LEG A;  3K8N A;  3O6T A;  1ERW A;  2TRC P;  1O8W A;  4V2M A;  4I2T A;  1XBS A;  2YAN A;  5CRE A;  4FYC A;  3QCP A;  1XW9 A;  3C1R A;  4PUF C;  4K6X A;  4ECI A;  4GTU A;  1DE2 A;  3QD9 A;  1F37 A;  1SKR B;  2GQK A;  3C73 A;  3FZ4 A;  1T7P B;  3UVT A;  3VWW A;  2VCW A;  3CTF A;  4MF5 A;  4IBP A;  1U87 A;  2RLI A;  2F3M A;  3GTU B;  1B9Y C;  2GST A;  4WET A;  2QKE A;  12GS A;  2VCT A;  1TRS A;  1Q4J A;  2VCQ A;  5IQY A;  1AIU A;  4ULX A;  4DSS A;  2LQQ A;  2E7P A;  2XBQ A;  3ZRD A;  3DD3 A;  2YJ7 A;  1XOB A;  4AGS A;  4Q5R A;  4K1F A;  2K6V A;  3CYN A;  3QFB C;  5ID2 A;  4MPG A;  5ABR A;  3QAW A;  5DQS A;  5JWR B;  1M2D A;  2VLU A;  4JRR A;  3F63 A;  2K9F A;  4MPF A;  1GWC A;  5J9B A;  3ED3 A;  1GUK A;  1GTI A;  2PBJ A;  1GSD A;  4GST A;  4MJC A;  1R4W A;  1EOG A;  4HZ4 A;  2XHF A;  1WOU A;  3J7Y b;  1SKS B;  3E9J B;  1EEM A;  5AIS A;  2CZ3 A;  3F8U A;  5D9V A;  1GH2 A;  3D22 A;  4D73 B;  3ZYW A;  2WB9 A;  3DVX A;  4HU9 A;  4NHZ A;  4LMW A;  1NW2 A;  2I81 A;  1PKW A;  1JZD A;  2L5L A;  4MLY A;  5CNW A;  3IK9 A;  1K0A A;  4TR0 A;  1IYH A;  4KH7 A;  5IOW A;  1KNG A;  3TGZ A;  4HS1 A;  3GKN A;  4MZB A;  3F9U A;  3RAZ A;  4ZL9 A;  3UL3 A;  5A4W A;  2RUE A;  1TOF A;  4ZL7 A;  4ZBD A;  2B6M A;  2RUF A;  2FWG A;  2WCI A;  1GUH A;  2NTO A;  4KSO A;  2H70 A;  3FK8 A;  1YY7 A;  4K7I A;  3CSH A;  3Q19 A;  1K0B A;  2WS2 A;  3E0U A;  2QC7 A;  2B5X A;  1Z9H A;  3WYW A;  4OMV A;  3P8W A;  3TRX A;  4IKH A;  3LXT A;  3TRP A;  4EXJ A;  1XW5 A;  4KDX A;  1T4Z A;  4L0W A;  4HZ2 A;  5DDL A;  3DKS A;  2FY6 A;  2GZP A;  5GAN D;  4J2F A;  4XIH A;  1XXU A;  3DGQ A;  1AAZ A;  2TRX A;  2B7K A;  1ST9 A;  20GS A;  2CX3 A;  3RPN A;  2CQ9 A;  4MF7 A;  2LJA A;  5CAX A;  2O7K A;  2DJK A;  4AF2 A;  3IRA A;  3HZ8 A;  2YCD A;  3EWL A;  4TKY A;  1G6W A;  1OE7 A;  4ZBA A;  3RPP A;  1GL8 A;  4Q5F A;  2YWO A;  4ECJ A;  3VWX A;  2RII A;  3ZIJ A;  2DJ0 A;  1GSU A;  1BJX A;  3VUR A;  3CSJ A;  4E8H A;  2WGR A;  2X64 A;  3M9J A;  3TOT A;  3PIN A;  1M99 A;  1YF1 A;  5J3R A;  1TK8 B;  2YP6 A;  3QAG A;  1PSQ A;  3ZMK A;  1PX6 A;  3RHC A;  3TKR A;  5CYY A;  3KP8 A;  1WWJ A;  4WF4 A;  1XCC A;  1TU7 A;  3MDK A;  5DBQ A;  2ALB A;  3VLN A;  5D8I A;  3UEM A;  4BPY A;  4X43 A;  1M0U A;  1URM A;  3I9V 2;  2DC5 A;  3MWH A;  1PA3 A;  2HE3 A;  2X8G A;  3MNG A;  19GS A;  2CAI A;  5ENU A;  4RQX A;  1FO5 A;  4J56 E;  3IHQ A;  1IYI A;  1SK0 A;  4O32 A;  4XS4 A;  1JFU A;  1OC9 B;  2C0G A;  5AIV A;  3DVW A;  1SU9 A;  2HZE A;  3IR4 A;  1M7T A;  3A5W A;  4XS6 A;  5KEJ A;  3IOS A;  1DBY A;  1WE0 A;  2YZU A;  1QXH A;  2I3Y A;  1AQV A;  1YDK A;  5ECH B;  4NWY A;  1ERT A;  2JAD A;  2TIR A;  3GA4 A;  2GSS A;  1F3A A;  5HFG A;  1X5C A;  4TR1 B;  1TRU A;  3WGD A;  1X9S B;  1VRS D;  1T4Y A;  2OA7 A;  2WJU A;  1R5P A;  1QK8 A;  2N5A A;  2V32 A;  3M1G A;  1GSQ A;  2PER A;  1C72 A;  1Z7R A;  3SBC A;  5G1K A;  4GRF A;  1NHY A;  1O7U A;  1JLV A;  4POL A;  1TRV A;  4MMM A;  3KIJ A;  2JL4 A;  4QL7 A;  2FCH A;  3FEU A;  1S3C A;  2CA8 A;  3EYT A;  4DSQ A;  2FGX A;  3VWV A;  4BWS A;  1VF2 A;  4NXI A;  1TK0 B;  4Q5N A;  5ECO B;  3FKF A;  3HKR A;  3JCM L;  1U88 A;  3P90 A;  3C7M A;  4OO5 A;  1T1V A;  1OC8 A;  3AY8 A;  2IMD A;  1J9B A;  3P2A A;  3VWU A;  2OJL A;  1DSB A;  4GXZ A;  3L9U A;  3BBY A;  4DSR A;  5CRH A;  1YKC A;  2XPD A;  1TRW A;  1YZX A;  1Y25 A;  2VO4 A;  1KTE A;  5C04 A;  5EY6 A;  1W4V A;  2L6D A;  1AXD A;  2CVD A;  4JED A;  3IXR A;  1OVN A;  3M3M A;  2IN3 A;  1B9X C;  3IDV A;  4I6X A;  3GL3 A;  1HNB A;  4KAE A;  4MH2 A;  4HEA 2;  1N8J A;  5KN3 A;  1GTB A;  1NHO A;  3G9B A;  2L59 A;  5H5S A;  1I5G A;  3ZL5 A;  4N0Z A;  1FG4 A;  2HRN A;  3PR8 A;  4FH8 A;  4GQC A;  5DVB A;  1KBN A;  4EUY A;  1GRX A;  3DIE A;  2GZY A;  3GMF A;  4IQ1 A;  1PGT A;  4IHU A;  4V2N A;  4HOJ A;  1R5A A;  1FHE A;  2JZT A;  5DAK B;  3IPZ A;  3A2V A;  2V1M A;  1FOV A;  1V58 A;  2H76 A;  1ZCP A;  4F03 A;  4MP4 A;  4MJB A;  4KDY A;  2M46 A;  1A2J A;  2I9H A;  1A2L A;  1XIY A;  3TJB A;  1Z5Y E;  4Z7X A;  3ME8 A;  2C1Y A;  5COH A;  2IL3 A;  4LL1 B;  3TOU A;  3Q6O A;  5F8B A;  2CVK A;  2V6K A;  2PVQ A;  9GSS A;  5A5K A;  1SJZ A;  1UVZ A;  3FZ5 A;  1HQO A;  3EU3 A;  3GH9 A; 
#chains in the Genus database with same CATH topology
 2YWM A;  3GNJ A;  5GSS A;  3U6V A;  1WRY A;  3TKS A;  1X0R A;  1LBK A;  3M0F A;  3TJJ A;  2DMM A;  5GST A;  5IO0 A;  3VK9 A;  1E2Y A;  3ZFL A;  5LCZ A;  2H66 A;  2O85 A;  2F51 A;  2WRT A;  5C00 A;  1AC1 A;  3IHG A;  1X9M B;  2LRN A;  1G6Y A;  1Q98 A;  3MIX A;  1EP8 A;  2C0D A;  2LTK A;  4XRD A;  1LJR A;  2H1B A;  3Q74 A;  3A2X A;  4G19 A;  2H6Z A;  3KD0 A;  3W6G A;  2LKU A;  5F0G A;  2VOC A;  4ZXG A;  5B7C A;  2B3S A;  2PMT A;  3FR6 A;  2E2M A;  4EDZ A;  3RDW A;  3I43 A;  3J7Y k;  2G2Q A;  17GS A;  4JR4 A;  2VCZ A;  3W8S A;  1WPI A;  10GS A;  4GWR A;  2GSR A;  4XTS A;  2JZS A;  2GDR A;  2FWE A;  1XPV A;  1QMV A;  4MJE A;  1WIK A;  2KUC A;  1A24 A;  2NBS A;  3DWV A;  1PMT A;  2LS5 A;  5G5F A;  3FYG A;  2IMF A;  1F9M A;  3D4T A;  4GSN A;  4TVE A;  3M8N A;  1ZMA A;  2R0C A;  4RI7 A;  4NAX A;  2PU9 C;  4KA0 A;  5ECI B;  2L6C A;  4GQF A;  1QFN A;  1AQW A;  1X5E A;  4I2U A;  3KZQ A;  4DVC A;  1JLW A;  4MA9 A;  4HI7 A;  3LYP A;  2HRF A;  2B1L A;  2ZNM A;  5IMD A;  3H93 A;  1EEJ A;  4IQA A;  3P7X A;  3HZ4 A;  2IME A;  4F82 A;  3F3Q A;  3LG6 A;  4ICY A;  2VUP A;  1QUW A;  3L9V A;  1EV4 A;  5KN1 A;  3D21 A;  3FW2 A;  3HD5 A;  3ZLP A;  4ZB6 A;  2LUS A;  1DE1 A;  2VAF A;  2C0E A;  3DML A;  3GX8 A;  1JZR A;  1V98 A;  3GUR A;  2P31 A;  3IA1 A;  1HD2 A;  1SD8 A;  1ERU A;  4KCA A;  5J9C A;  3DRN A;  1A2M A;  1SL1 B;  2AV4 A;  1B8X A;  4TR1 A;  3VI5 A;  1K0N A;  16GS A;  4PTS A;  4EVM A;  3TKS C;  5E4W A;  2H6X A;  4ZB9 A;  3F4S A;  4YQU A;  3KH9 A;  2M80 A;  3FZ9 A;  4USS A;  3GFK A;  4K5S A;  3HVX A;  5L71 A;  2GZZ A;  2DJ3 A;  5EL8 A;  1JHB A;  3KXO A;  2K18 A;  4HQZ A;  5F07 A;  3ZIT A;  1SJ6 A;  1K0C A;  5HR3 A;  2NDO A;  2WFC A;  3HDC A;  5KOW A;  3PGT A;  1PX7 A;  2K8V A;  4NV2 A;  5JCW A;  3HJO A;  4OFT A;  1BG5 A;  3OR5 A;  3GKM A;  2GS3 A;  1ABA A;  3L78 A;  4BIK A;  2HZF A;  2Z9S A;  1S3D A;  3D5J A;  4TXO B;  1R26 A;  1BYE A;  4YH2 A;  4H86 A;  3FRC A;  3QMX A;  2WDU A;  3QR6 A;  4N10 A;  2H30 A;  4EDY A;  2HYX A;  1EGR A;  1XZO A;  1AUC A;  4LL4 B;  2A2R A;  1WMJ A;  3ISO A;  3GUS A;  3U5R E;  5IIZ A;  1B4P A;  3IE3 A;  4PXO A;  1X5D A;  3G7I A;  5ECR B;  1PRX A;  1OC3 A;  1A23 A;  2CX4 A;  3H1N A;  1EWX A;  3UMA A;  1THO A;  5A4U A;  1YEX A;  5AGY A;  3DXB A;  1PN9 A;  4CDO A;  1T8E B;  7GSS A;  2JSZ A;  2H74 A;  2JAC A;  1Z3E A;  2VLT A;  4WR5 A;  2H01 A;  4KF9 A;  3TJK A;  1TJD A;  4IGJ A;  1TTZ A;  2H8L A;  2JZR A;  3IAM 2;  3E3E A;  4OD7 A;  2AB6 A;  4PX1 A;  4V1A g;  2FHE A;  3CTG A;  3F0I A;  2YPM A;  1U3I A;  4MH3 A;  2KP2 A;  3RBT A;  1AW9 A;  5JCU A;  5D73 A;  1U3A A;  2IFQ B;  3GHA A;  4HSC X;  4XHM A;  1HNC A;  5HFI A;  4AJ6 A;  2AAW A;  3UAR A;  2F9S A;  1TKD B;  2CV4 A;  1ERV A;  5IM9 A;  3L9S A;  5IO2 A;  2YNX A;  2X8C A;  6GSX A;  2EC4 A;  2YJH A;  4HJ2 A;  4AJ8 A;  4EIP A;  5DAL A;  1F2E A;  5IMA A;  2YOI A;  5D93 A;  2I1U A;  4G0K A;  5B6M A;  5GZZ B;  3UBK A;  4BVX A;  4ECC A;  5J5N A;  2HSY A;  1G0T A;  2OBI A;  2H0G A;  2MBT A;  4WEY A;  4PNF A;  3LWA A;  1M9B A;  4EC0 A;  4K7N A;  1XVW A;  2HI7 A;  2A4V A;  3Q18 A;  5ECK B;  4OCF A;  3APQ A;  4MZW A;  1GNE A;  2H0H A;  2AUV A;  1MTC A;  3FZA A;  4V2L A;  3IC4 A;  3F4T A;  2DIZ A;  2C8U A;  4KW6 A;  4TW5 A;  2V2G A;  1EP7 A;  1Z7P A;  3BD2 A;  5G1L A;  3ZTL A;  2ON7 A;  2GVP A;  1BQ7 A;  5CO3 A;  3ZIV A;  3KTB A;  1ML6 A;  2B5E A;  2DSA A;  2MZC A;  3LJR A;  3KMN A;  2EIR A;  1BED A;  1M3J A;  3KTL A;  3WT2 A;  2K8S A;  22GS A;  1RQM A;  4CW9 A;  1WP0 A;  3EUR A;  1YKA A;  2IWT A;  1TI3 A;  3H4K A;  4WXT A;  4DSS B;  2NVL A;  3DYR A;  1O85 A;  3A3T A;  4I5Q A;  2GGT A;  1XVQ A;  3IV4 A;  5CRW A;  5IPG A;  4P3Y B;  4AJ7 A;  4NHW A;  5G31 A;  3TUE A;  1UN2 A;  3KM6 A;  3EC3 A;  3IBH A;  4KE3 A;  1M9A A;  1XWK A;  1THX A;  1FOH A;  1YF0 A;  2L5O A;  4YKG A;  2PPT A;  2R37 A;  2AJQ B;  2B1K A;  3BCK A;  5BRT A;  3GTU A;  4KSM A;  3C71 A;  2OE3 A;  6GSU A;  3UBL A;  2C80 A;  4IW9 A;  3QDN A;  2DJ1 A;  5INY A;  1T3B A;  1A0R P;  1GLQ A;  3CSI A;  1F6M C;  1CQH A;  3EU4 A;  3EVI A;  1G7E A;  3BCI A;  2LNS A;  3GKX A;  1A8L A;  2KHP A;  2GSQ A;  2F8F A;  5FT3 A;  5H5R A;  2DLX A;  3F6D A;  2VD1 A;  2LNT A;  1SK2 A;  2M72 A;  4Z2T A;  4O5U A;  2A4H A;  3UAP A;  1TDI A;  3KGK A;  1KEB A;  3NOF A;  3GST A;  1K0D A;  4D73 A;  2R3X A;  2NPB A;  1GTU A;  1F3B A;  3LSZ A;  2LRT A;  4G10 A;  5IMV A;  1Z6N A;  4IVF A;  3H79 A;  2D2Z A;  5HR1 A;  4K0N A;  4FYB A;  1W89 A;  4L0U A;  2PN8 A;  4KX4 A;  3TKQ A;  4TRX A;  3HXS A;  6GSS A;  2C4J A;  4JE1 A;  4TR3 A;  2E0Q A;  4OCE A;  3GYK A;  18GS A;  4N30 A;  3UJ1 A;  2LRC A;  3C1S A;  1MDJ A;  4ACS A;  2J23 A;  1O81 A;  4HJM A;  2VL9 A;  4TXO A;  4BVY B;  2LQO A;  3VPT A;  2GQL A;  4EKZ A;  2HRK A;  2HSH A;  3A2W A;  2P5R A;  5DQY A;  1G7O A;  5F06 A;  4KDU A;  4RI6 A;  2IPA A;  1FB6 A;  2RM5 A;  4BL7 B;  2X99 A;  3ZML A;  2MYG A;  1XW6 A;  1SD9 A;  4MDC A;  3QAV A;  1M3I A;  1OYJ A;  1YQ1 A;  2R6K A;  5ECN B;  1OE8 A;  3HJP A;  1ON4 A;  4BWQ A;  3TB2 A;  3LEF A;  2OAC A;  3HHV A;  3LYK A;  4KGI A;  2O89 A;  3CRU A;  1M2B A;  5HR0 A;  4V1A p;  3DEX A;  2GT6 A;  3O76 A;  1VF4 A;  1OAZ A;  5B6N A;  2VIM A;  4OFN A;  1I9D A;  4NMU A;  4ID0 A;  4OWY A;  4G2E A;  1ZYN A;  2ON5 A;  2P5Q A;  1TW9 A;  1B48 A;  4O5Q A;  2VL2 C;  5D9X A;  2CZ2 A;  4I8B A;  3LQ7 A;  3L4N A;  1MD3 A;  4XS4 B;  3R3E A;  4WBJ A;  3KH7 A;  3HYP A;  3FR9 A;  4IJ3 A;  4L5L A;  1SJI A;  2C3N A;  2DJJ A;  2HRA A;  2RM6 A;  2AYT A;  5D9W A;  1MDI A;  1YEP A;  4WBR D;  2HZE B;  1TXX A;  1VF3 A;  3KEB A;  2KLX A;  2WUL A;  1PFO A;  2OKA A;  5EVO A;  2ZCT A;  4E8E A;  4POB A;  5ECM B;  1RK4 A;  3APS A;  1GTA A;  2FNO A;  5KN0 A;  2OAD A;  2X49 A;  3EIN A;  5IMC A;  4TOP A;  3WGE A;  1N2A A;  1K0M A;  2HLS A;  2P0G A;  3EPT A;  3IK7 A;  14GS A;  2LJR A;  4MK3 A;  3KJY A;  4CHS A;  1H75 A;  1JZW A;  2XBI A;  2GLR A;  4Q5Q A;  2BJX A;  4ZIL A;  3TDG A;  1EZK A;  4TN8 A;  3ZFB A;  8GSS A;  5ECP B;  1OC9 A;  2CVB A;  3KP9 A;  5CRG A;  2H1G A;  2H0I A;  5HFK A;  3GIX A;  5AN1 A;  1OKD A;  4KB3 A;  4IS0 A;  1SL2 B;  2PWJ A;  2O8V B;  3HVS A;  1K3L A;  4HU7 A;  4O92 A;  4WF5 A;  1FVJ A;  4MNN A;  4F9Z A;  5CP1 A;  4BA7 A;  1GUL A;  5HQP A;  5D96 A;  3D4M A;  5ELG A;  1ZL9 A;  6GSW A;  1EGO A;  2DML A;  2CAQ A;  1XWA A;  3LGC A;  4K7O A;  2HSM A;  4GCI A;  4K0G A;  4EE0 A;  3FHK A;  2YWI A;  3MAK A;  3UOM A;  1FVK A;  2IMK A;  3QFA C;  1O6J A;  5KN2 A;  2VLV A;  3TCO A;  3FR3 A;  4IP6 A;  1PL1 A;  2VD0 A;  2YV7 A;  3FMW A;  3VPQ A;  1ZGN A;  5AIX A;  2FUG 2;  2H71 A;  1PD2 1;  2G0F A;  2FA8 A;  2X4A A;  1GSE A;  3ME7 A;  3N5O A;  2CT6 A;  2XC2 A;  4LMV A;  4IN0 A;  2VCV A;  5JWO B;  4NPB A;  4ZL8 A;  3BJ5 A;  2HNL A;  1GNW A;  1ACV A;  1K0O A;  3ZZX A;  2VL3 A;  5ECQ B;  1A8Y A;  1JZO A;  2YWN A;  4N11 A;  5H5Q A;  6GSV A;  1WJK A;  4PNG A;  5JWQ B;  4HDE A;  4YQM A;  1XFL A;  4GF0 A;  3N9J A;  4ZIJ A;  4XCS A;  3WGX A;  2KOK A;  4TR4 A;  4OFM A;  4RUV A;  2LV3 A;  3CRT A;  3LW9 A;  3EMP A;  4K5R A;  1EV9 A;  1XOA A;  4ZBB A;  3F3R A;  2MMZ A;  1XWG A;  3L0H A;  1V40 A;  4YQV A;  2J9H A;  4WR4 A;  4X0X A;  3M9K A;  5IPH A;  2MMO A;  2JU5 A;  2DBC A;  5DCG A;  3QOU A;  1H4O A;  3F4R A;  4I97 A;  1PKZ A;  4NV5 A;  5BMU A;  5DCH A;  2OBK A;  4ECB A;  3ERW A;  5GAP D;  2HT9 A;  1FAA A;  3LXZ A;  3EE2 A;  4ML6 A;  1ZZY A;  5DAK A;  1PQN A;  1XWC A;  3NZN A;  4K9Z A;  5ECL B;  4BVY A;  5LD0 A;  13GS A;  1U6T A;  1GSY A;  4PQI A;  4FQU A;  4IJI A;  2N5B A;  2BTO T;  4X1U A;  1NM3 A;  2VCX A;  4BL7 A;  1BX9 A;  3V1W A;  5D9T A;  4WKW A;  2L4Q A;  2ES7 A;  5ELA A;  2XPE A;  1Y6E A;  5JCG A;  4K2D A;  1J0F A;  4KUN A;  2FLS A;  1TK5 B;  1V2A A;  2OE1 A;  1FW1 A;  5IMZ A;  2H6Y A;  2PGT A;  3EMX A;  2MMA A;  1B4Q A;  3ZRE A;  1Z6M A;  1SYX A;  2V6O A;  1XG8 A;  5G5E A;  1UC7 A;  2JSY A;  6GSY A;  3G7Y A;  1TU8 A;  4ISD A;  3GV1 A;  2IJY A;  4IP1 A;  1NSW A;  4JU5 A;  4HQS A;  1SYR A;  1R7H A;  4L8E A;  3HY2 A;  1XWB A;  4ML1 A;  2HFD A;  5B8A A;  5FHI A;  3GL5 A;  3UIW A;  4PQH A;  1QGV A;  2IMI A;  2C0F A;  5B8B A;  5J4U A;  3GH6 A;  2H75 A;  4K8M A;  1ZYP A;  2R0G A;  3ZVJ D;  5ID2 B;  1GSF A;  1O73 A;  3RHB A;  1QQ2 A;  1S3R A;  2L4C A;  2VM1 A;  3HA9 A;  1FB0 A;  2R5G A;  3KMO A;  4N0V A;  1YJ6 A;  4POM A;  3W8J A;  4Z2U A;  4PUA A;  4F0C A;  5G2Z A;  1O8X A;  4FIW A;  11GS A;  1UA5 A;  2R2J A;  3ERF A;  4MAB A;  2LST A;  4MF6 A;  2IIY A;  2PVO C;  3HVV A;  3GX0 A;  2A2S A;  4HUA A;  3I6A A;  3PH9 A;  1SEN A;  2DJ2 A;  2QSI A;  4L5O A;  2H72 A;  1RW1 A;  4LLR A;  2FWH A;  3H8Q A;  4KND A;  5IMF A;  5ECS A;  4FYU A;  1TI1 A;  5KOX A;  2B5Y A;  1USB A;  3WD6 A;  3HCZ A;  2REM A;  2VL2 A;  4O7H A;  4LA1 A;  4POK A;  1J08 A;  2DIY A;  2KP1 A;  2YN1 A;  3CXG A;  3TJG A;  5LNK e;  3SWL A;  1OKT A;  4RQR A;  3BOA A;  1K3O A;  3CMI A;  2H19 A;  4XS1 A;  3TKS E;  2B7J A;  2E2G A;  3CBU A;  1BAY A;  3D0Z A;  3UVH A;  3CQF A;  5CRD A;  1M2A A;  4OO4 A;  1ZYE A;  1ILO A;  4F2I A;  4EF0 A;  4PQ1 A;  2H1D A;  2QA2 A;  2R4V A;  1ZYQ B;  2V41 A;  3GSS A;  2X8H A;  2H73 A;  2QGV A;  3TRQ A;  3LOR A;  3LFL A;  3WT1 A;  1E6B A;  2HXK A;  4FO5 A;  2H1A A;  3ERG A;  2FD3 A;  2VM2 A;  2AHE A;  3QPM A;  4F0B A;  5A4V A;  4YAP A;  4YAV A;  3NIV A;  5G30 A;  2EIO A;  2MMN A;  5FWG A;  4J57 E;  4MJA A;  2GTU A;  3F6F A;  1VGL A;  5F05 A;  3GRX A;  2C3Q A;  4DEJ A;  4PGT A;  1SK1 A;  4MZC A;  4JZQ A;  1LU4 A;  4A5P A;  3VI7 A;  4GSS A;  3VFI A;  3IC8 A;  1A0F A;  4PUR A;  1VF1 A;  3S9F A;  1MD4 A;  2MBS A;  2FWF A;  2GT5 A;  2YV9 A;  4KCE A;  1X9W B;  2F8A A;  5DJM A;  3US3 A;  5J41 A;  1MDK A;  2N5F A;  3FY7 A;  3HJM A;  5DJL A;  3HVN A;  2GQM A;  6GST A;  2BMX A;  1DUG A;  2C3T A;  2L57 A;  2O87 A;  4ZB8 A;  3G7J A;  5HR2 A;  3GN3 A;  3TJF A;  3APO A;  1SL0 B;  1SKW B;  2FA4 A;  1K3Y A;  3C8E A;  3MSZ A;  1V57 A;  2I4A A;  1T00 A;  5DAL B;  1HYU A;  1PL2 A;  1GP1 A;  2LJK A;  2EIQ A;  3IAS 2;  4GLT A;  1GLP A;  3D6I A;  4ILF A;  1EOH A;  4TXV A;  3I69 A;  4G9H A;  1S3A A;  5E59 A;  1TP9 A;  1GUM A;  4JBB A;  4Z2R A;  4XRA A;  2IFQ A;  2PUK C;  4JR6 A;  4QL9 A;  1HNA A;  1CQG A;  2YZH A;  1ZOF A;  2OE0 A;  4MCU A;  3TKP A;  2WZ9 A;  5EPF A;  4IEL A;  4QQ7 A;  2ZUP A;  4EL1 A;  3O3T A;  1MEK A;  3MYD A;  2R0P A;  4O5R A;  4EO3 A;  1V9W A;  3R2Q A;  1AQX A;  3KCM A;  1GSS A;  3GKK A;  3ZVJ A;  5IOX A;  2LEG A;  3K8N A;  3O6T A;  1ERW A;  2TRC P;  4K2X A;  1O8W A;  4V2M A;  4I2T A;  1XBS A;  2YAN A;  5CRE A;  4FYC A;  3QCP A;  1XW9 A;  3C1R A;  4PUF C;  4K6X A;  4ECI A;  4GTU A;  1DE2 A;  3QD9 A;  1F37 A;  1SKR B;  2GQK A;  3C73 A;  3FZ4 A;  1T7P B;  3UVT A;  3VWW A;  2VCW A;  4G0L A;  3CTF A;  4MF5 A;  4IBP A;  1U87 A;  2RLI A;  2F3M A;  3GTU B;  1B9Y C;  3A5I A;  2GST A;  4WET A;  2QKE A;  12GS A;  2VCT A;  1TRS A;  1Q4J A;  2VCQ A;  5IQY A;  1AIU A;  4ULX A;  4DSS A;  2LQQ A;  2E7P A;  2XBQ A;  3ZRD A;  3DD3 A;  2YJ7 A;  1XOB A;  4AGS A;  4Q5R A;  4K1F A;  2K6V A;  3CYN A;  3QFB C;  5ID2 A;  4MPG A;  5ABR A;  4G0I A;  3QAW A;  5DQS A;  5JWR B;  1M2D A;  2VLU A;  4JRR A;  3F63 A;  2K9F A;  4MPF A;  1GWC A;  5J9B A;  3ED3 A;  1GUK A;  4EIQ A;  1GTI A;  2PBJ A;  1GSD A;  4GST A;  4MJC A;  1R4W A;  1EOG A;  4HZ4 A;  2XHF A;  1WOU A;  3J7Y b;  1SKS B;  3E9J B;  1EEM A;  5AIS A;  2CZ3 A;  3F8U A;  5D9V A;  1GH2 A;  3D22 A;  4D73 B;  3ZYW A;  2WB9 A;  3DVX A;  4HU9 A;  4NHZ A;  4LMW A;  1NW2 A;  2I81 A;  1PKW A;  1JZD A;  2L5L A;  4MLY A;  5CNW A;  3IK9 A;  1K0A A;  4TR0 A;  1IYH A;  4KH7 A;  5IOW A;  1KNG A;  3TGZ A;  4HS1 A;  3GKN A;  2UZ8 A;  4MZB A;  3F9U A;  3RAZ A;  4ZL9 A;  3UL3 A;  5A4W A;  2RUE A;  1TOF A;  4ZL7 A;  1PN0 A;  4ZBD A;  2B6M A;  2RUF A;  2FWG A;  2WCI A;  1GUH A;  2NTO A;  4KSO A;  2H70 A;  3FK8 A;  1YY7 A;  4K7I A;  3CSH A;  3Q19 A;  1K0B A;  2WS2 A;  3E0U A;  2QC7 A;  2B5X A;  1Z9H A;  3WYW A;  4OMV A;  3P8W A;  3TRX A;  4IKH A;  3LXT A;  3TRP A;  4EXJ A;  1XW5 A;  4KDX A;  1T4Z A;  4L0W A;  4HZ2 A;  5DDL A;  3DKS A;  2FY6 A;  2GZP A;  5GAN D;  4J2F A;  4XIH A;  1XXU A;  3DGQ A;  1AAZ A;  2TRX A;  2B7K A;  1ST9 A;  20GS A;  2CX3 A;  3RPN A;  2CQ9 A;  4MF7 A;  2LJA A;  5CAX A;  2O7K A;  2DJK A;  4AF2 A;  3IRA A;  3HZ8 A;  2YCD A;  3EWL A;  4TKY A;  1G6W A;  1OE7 A;  4ZBA A;  3RPP A;  1GL8 A;  4Q5F A;  2YWO A;  4ECJ A;  3VWX A;  2RII A;  3ZIJ A;  2DJ0 A;  1GSU A;  1BJX A;  3VUR A;  3CSJ A;  4E8H A;  2WGR A;  2X64 A;  3M9J A;  3TOT A;  3PIN A;  1M99 A;  1YF1 A;  5J3R A;  1TK8 B;  2YP6 A;  3QAG A;  1PSQ A;  3ZMK A;  1PX6 A;  3RHC A;  3TKR A;  5CYY A;  3KP8 A;  1WWJ A;  4WF4 A;  1XCC A;  1TU7 A;  3MDK A;  5DBQ A;  2ALB A;  3VLN A;  5D8I A;  3UEM A;  4BPY A;  4X43 A;  1M0U A;  1URM A;  2A2P A;  3I9V 2;  2DC5 A;  3MWH A;  1PA3 A;  2HE3 A;  2X8G A;  3MNG A;  19GS A;  2CAI A;  5ENU A;  4RQX A;  1FO5 A;  4J56 E;  3IHQ A;  1IYI A;  1SK0 A;  4O32 A;  4XS4 A;  1JFU A;  1OC9 B;  2C0G A;  5AIV A;  3DVW A;  1SU9 A;  2HZE A;  3IR4 A;  1M7T A;  3A5W A;  4XS6 A;  5KEJ A;  3IOS A;  1DBY A;  1WE0 A;  2YZU A;  1QXH A;  2I3Y A;  1AQV A;  1YDK A;  5ECH B;  4NWY A;  1ERT A;  2JAD A;  2TIR A;  3GA4 A;  3PPU A;  2GSS A;  1F3A A;  5HFG A;  1X5C A;  4TR1 B;  1TRU A;  3WGD A;  1X9S B;  4YKF A;  1VRS D;  1T4Y A;  2OA7 A;  2WJU A;  1R5P A;  1QK8 A;  2N5A A;  2V32 A;  3M1G A;  1GSQ A;  2PER A;  1C72 A;  1Z7R A;  3SBC A;  5G1K A;  4GRF A;  1NHY A;  1O7U A;  1JLV A;  4POL A;  1TRV A;  4MMM A;  3KIJ A;  2JL4 A;  4QL7 A;  2FCH A;  3FEU A;  1S3C A;  2CA8 A;  3EYT A;  4DSQ A;  2FGX A;  3VWV A;  4BWS A;  1VF2 A;  4NXI A;  1TK0 B;  4Q5N A;  5ECO B;  3FKF A;  3HKR A;  2QA1 A;  2DKH A;  3JCM L;  1U88 A;  3P90 A;  3C7M A;  4OO5 A;  1T1V A;  1OC8 A;  3AY8 A;  2IMD A;  1J9B A;  3P2A A;  3VWU A;  2OJL A;  1DSB A;  4GXZ A;  3L9U A;  3BBY A;  4DSR A;  5CRH A;  1YKC A;  2XPD A;  1TRW A;  1YZX A;  1Y25 A;  2VO4 A;  1KTE A;  5C04 A;  4CY8 A;  5EY6 A;  1W4V A;  2L6D A;  1AXD A;  2CVD A;  4JED A;  3IXR A;  1OVN A;  3M3M A;  2IN3 A;  1B9X C;  3IDV A;  4I6X A;  3GL3 A;  1HNB A;  4KAE A;  4MH2 A;  4HEA 2;  1N8J A;  2DKI A;  5KN3 A;  1GTB A;  1NHO A;  3G9B A;  2L59 A;  5H5S A;  1I5G A;  3ZL5 A;  4N0Z A;  1FG4 A;  2HRN A;  3PR8 A;  4FH8 A;  4GQC A;  5DVB A;  1KBN A;  4EUY A;  1GRX A;  3DIE A;  2GZY A;  3GMF A;  4IQ1 A;  1PGT A;  4IHU A;  4V2N A;  4HOJ A;  1R5A A;  1FHE A;  2JZT A;  5DAK B;  3IPZ A;  3A2V A;  2V1M A;  1FOV A;  1V58 A;  2H76 A;  1ZCP A;  4F03 A;  4MP4 A;  4MJB A;  4KDY A;  2M46 A;  1A2J A;  2I9H A;  1A2L A;  1XIY A;  3TJB A;  1Z5Y E;  4Z7X A;  3ME8 A;  2C1Y A;  5COH A;  4X4J A;  2IL3 A;  4LL1 B;  3TOU A;  3Q6O A;  5F8B A;  2CVK A;  2V6K A;  2PVQ A;  9GSS A;  5A5K A;  1SJZ A;  4CY6 A;  1UVZ A;  3FZ5 A;  4BVX B;  1HQO A;  3EU3 A;  3GH9 A; 
#chains in the Genus database with same CATH homology
 2YWM A;  3GNJ A;  5GSS A;  3U6V A;  1WRY A;  3TKS A;  1X0R A;  1LBK A;  3M0F A;  3TJJ A;  2DMM A;  5GST A;  5IO0 A;  3VK9 A;  1E2Y A;  3ZFL A;  5LCZ A;  2H66 A;  2O85 A;  2F51 A;  2WRT A;  5C00 A;  1AC1 A;  3IHG A;  1X9M B;  2LRN A;  1G6Y A;  1Q98 A;  3MIX A;  1EP8 A;  2C0D A;  2LTK A;  4XRD A;  1LJR A;  2H1B A;  3Q74 A;  3A2X A;  4G19 A;  2H6Z A;  3KD0 A;  3W6G A;  2LKU A;  5F0G A;  2VOC A;  4ZXG A;  5B7C A;  2B3S A;  2PMT A;  3FR6 A;  2E2M A;  4EDZ A;  3RDW A;  3I43 A;  3J7Y k;  2G2Q A;  17GS A;  4JR4 A;  2VCZ A;  3W8S A;  1WPI A;  10GS A;  4GWR A;  2GSR A;  4XTS A;  2JZS A;  2GDR A;  2FWE A;  1XPV A;  1QMV A;  4MJE A;  1WIK A;  2KUC A;  1A24 A;  2NBS A;  3DWV A;  1PMT A;  2LS5 A;  5G5F A;  3FYG A;  2IMF A;  1F9M A;  3D4T A;  4GSN A;  4TVE A;  3M8N A;  1ZMA A;  2R0C A;  4RI7 A;  4NAX A;  2PU9 C;  4KA0 A;  5ECI B;  2L6C A;  4GQF A;  1QFN A;  1AQW A;  1X5E A;  4I2U A;  3KZQ A;  4DVC A;  1JLW A;  4MA9 A;  4HI7 A;  3LYP A;  2HRF A;  2B1L A;  2ZNM A;  5IMD A;  3H93 A;  1EEJ A;  4IQA A;  3P7X A;  3HZ4 A;  2IME A;  4F82 A;  3F3Q A;  3LG6 A;  4ICY A;  2VUP A;  1QUW A;  3L9V A;  1EV4 A;  5KN1 A;  3D21 A;  3FW2 A;  3HD5 A;  3ZLP A;  4ZB6 A;  2LUS A;  1DE1 A;  2VAF A;  2C0E A;  3DML A;  3GX8 A;  1JZR A;  1V98 A;  3GUR A;  2P31 A;  3IA1 A;  1HD2 A;  1SD8 A;  1ERU A;  4KCA A;  5J9C A;  3DRN A;  1A2M A;  1SL1 B;  2AV4 A;  1B8X A;  4TR1 A;  3VI5 A;  1K0N A;  16GS A;  4PTS A;  4EVM A;  3TKS C;  5E4W A;  2H6X A;  4ZB9 A;  3F4S A;  4YQU A;  3KH9 A;  2M80 A;  3FZ9 A;  4USS A;  3GFK A;  4K5S A;  3HVX A;  5L71 A;  2GZZ A;  2DJ3 A;  5EL8 A;  1JHB A;  3KXO A;  2K18 A;  4HQZ A;  5F07 A;  3ZIT A;  1SJ6 A;  1K0C A;  5HR3 A;  2NDO A;  2WFC A;  3HDC A;  5KOW A;  3PGT A;  1PX7 A;  2K8V A;  4NV2 A;  5JCW A;  3HJO A;  4OFT A;  1BG5 A;  3OR5 A;  3GKM A;  2GS3 A;  1ABA A;  3L78 A;  2HZF A;  2Z9S A;  1S3D A;  3D5J A;  4TXO B;  1R26 A;  1BYE A;  4YH2 A;  4H86 A;  3FRC A;  3QMX A;  2WDU A;  3QR6 A;  4N10 A;  2H30 A;  4EDY A;  2HYX A;  1EGR A;  1XZO A;  1AUC A;  4LL4 B;  2A2R A;  1WMJ A;  3ISO A;  3GUS A;  3U5R E;  5IIZ A;  1B4P A;  3IE3 A;  4PXO A;  1X5D A;  3G7I A;  5ECR B;  1PRX A;  1OC3 A;  1A23 A;  2CX4 A;  3H1N A;  1EWX A;  3UMA A;  1THO A;  5A4U A;  1YEX A;  5AGY A;  3DXB A;  1PN9 A;  4CDO A;  1T8E B;  7GSS A;  2JSZ A;  2H74 A;  2JAC A;  1Z3E A;  2VLT A;  4WR5 A;  2H01 A;  4KF9 A;  3TJK A;  1TJD A;  4IGJ A;  1TTZ A;  2H8L A;  2JZR A;  3IAM 2;  3E3E A;  4OD7 A;  2AB6 A;  4PX1 A;  4V1A g;  2FHE A;  3CTG A;  3F0I A;  2YPM A;  1U3I A;  4MH3 A;  2KP2 A;  3RBT A;  1AW9 A;  5JCU A;  5D73 A;  1U3A A;  2IFQ B;  3GHA A;  4XHM A;  1HNC A;  5HFI A;  4AJ6 A;  2AAW A;  3UAR A;  2F9S A;  1TKD B;  2CV4 A;  1ERV A;  5IM9 A;  3L9S A;  5IO2 A;  2YNX A;  2X8C A;  6GSX A;  2EC4 A;  2YJH A;  4HJ2 A;  4AJ8 A;  4EIP A;  5DAL A;  1F2E A;  5IMA A;  2YOI A;  5D93 A;  2I1U A;  4G0K A;  5B6M A;  5GZZ B;  3UBK A;  4BVX A;  4ECC A;  5J5N A;  2HSY A;  1G0T A;  2OBI A;  2H0G A;  2MBT A;  4WEY A;  4PNF A;  3LWA A;  1M9B A;  4EC0 A;  4K7N A;  1XVW A;  2HI7 A;  2A4V A;  3Q18 A;  5ECK B;  4OCF A;  3APQ A;  4MZW A;  1GNE A;  2H0H A;  2AUV A;  1MTC A;  3FZA A;  4V2L A;  3IC4 A;  3F4T A;  2DIZ A;  2C8U A;  4KW6 A;  4TW5 A;  2V2G A;  1EP7 A;  1Z7P A;  3BD2 A;  5G1L A;  3ZTL A;  2ON7 A;  2GVP A;  1BQ7 A;  5CO3 A;  3ZIV A;  3KTB A;  1ML6 A;  2B5E A;  2DSA A;  2MZC A;  3LJR A;  3KMN A;  2EIR A;  1BED A;  3KTL A;  3WT2 A;  2K8S A;  22GS A;  1RQM A;  4CW9 A;  1WP0 A;  3EUR A;  1YKA A;  2IWT A;  1TI3 A;  3H4K A;  4WXT A;  4DSS B;  2NVL A;  3DYR A;  1O85 A;  3A3T A;  4I5Q A;  2GGT A;  1XVQ A;  3IV4 A;  5CRW A;  5IPG A;  4P3Y B;  4AJ7 A;  4NHW A;  5G31 A;  3TUE A;  1UN2 A;  3KM6 A;  3EC3 A;  3IBH A;  4KE3 A;  1M9A A;  1XWK A;  1THX A;  1FOH A;  1YF0 A;  2L5O A;  4YKG A;  2PPT A;  2R37 A;  2AJQ B;  2B1K A;  3BCK A;  5BRT A;  3GTU A;  4KSM A;  3C71 A;  2OE3 A;  6GSU A;  3UBL A;  2C80 A;  4IW9 A;  3QDN A;  2DJ1 A;  5INY A;  1T3B A;  1A0R P;  1GLQ A;  3CSI A;  1F6M C;  1CQH A;  3EU4 A;  3EVI A;  1G7E A;  3BCI A;  2LNS A;  3GKX A;  1A8L A;  2KHP A;  2GSQ A;  2F8F A;  5FT3 A;  5H5R A;  2DLX A;  3F6D A;  2VD1 A;  2LNT A;  1SK2 A;  2M72 A;  4Z2T A;  4O5U A;  2A4H A;  3UAP A;  1TDI A;  3KGK A;  1KEB A;  3NOF A;  3GST A;  1K0D A;  4D73 A;  2R3X A;  2NPB A;  1GTU A;  1F3B A;  3LSZ A;  2LRT A;  4G10 A;  5IMV A;  1Z6N A;  4IVF A;  3H79 A;  2D2Z A;  5HR1 A;  4K0N A;  4FYB A;  1W89 A;  4L0U A;  2PN8 A;  4KX4 A;  3TKQ A;  4TRX A;  3HXS A;  6GSS A;  2C4J A;  4JE1 A;  4TR3 A;  2E0Q A;  4OCE A;  3GYK A;  18GS A;  4N30 A;  3UJ1 A;  2LRC A;  3C1S A;  1MDJ A;  4ACS A;  2J23 A;  1O81 A;  4HJM A;  2VL9 A;  4TXO A;  4BVY B;  2LQO A;  3VPT A;  2GQL A;  4EKZ A;  2HRK A;  2HSH A;  3A2W A;  2P5R A;  5DQY A;  1G7O A;  5F06 A;  4KDU A;  4RI6 A;  2IPA A;  1FB6 A;  2RM5 A;  4BL7 B;  2X99 A;  3ZML A;  2MYG A;  1XW6 A;  1SD9 A;  4MDC A;  3QAV A;  1OYJ A;  1YQ1 A;  2R6K A;  5ECN B;  1OE8 A;  3HJP A;  1ON4 A;  4BWQ A;  3TB2 A;  3LEF A;  2OAC A;  3HHV A;  3LYK A;  4KGI A;  2O89 A;  3CRU A;  1M2B A;  5HR0 A;  4V1A p;  3DEX A;  2GT6 A;  3O76 A;  1VF4 A;  1OAZ A;  5B6N A;  2VIM A;  4OFN A;  1I9D A;  4NMU A;  4ID0 A;  4OWY A;  4G2E A;  1ZYN A;  2ON5 A;  2P5Q A;  1TW9 A;  1B48 A;  4O5Q A;  2VL2 C;  5D9X A;  2CZ2 A;  4I8B A;  3LQ7 A;  3L4N A;  1MD3 A;  4XS4 B;  3R3E A;  4WBJ A;  3KH7 A;  3HYP A;  3FR9 A;  4IJ3 A;  4L5L A;  1SJI A;  2C3N A;  2DJJ A;  2HRA A;  2RM6 A;  2AYT A;  5D9W A;  1MDI A;  1YEP A;  4WBR D;  2HZE B;  1TXX A;  1VF3 A;  3KEB A;  2KLX A;  2WUL A;  2OKA A;  5EVO A;  2ZCT A;  4E8E A;  4POB A;  5ECM B;  1RK4 A;  3APS A;  1GTA A;  2FNO A;  5KN0 A;  2OAD A;  2X49 A;  3EIN A;  5IMC A;  4TOP A;  3WGE A;  1N2A A;  1K0M A;  2HLS A;  2P0G A;  3EPT A;  3IK7 A;  14GS A;  2LJR A;  4MK3 A;  3KJY A;  4CHS A;  1H75 A;  1JZW A;  2XBI A;  2GLR A;  4Q5Q A;  2BJX A;  4ZIL A;  3TDG A;  1EZK A;  4TN8 A;  3ZFB A;  8GSS A;  5ECP B;  1OC9 A;  2CVB A;  3KP9 A;  5CRG A;  2H1G A;  2H0I A;  5HFK A;  3GIX A;  5AN1 A;  1OKD A;  4KB3 A;  4IS0 A;  1SL2 B;  2PWJ A;  2O8V B;  3HVS A;  1K3L A;  4HU7 A;  4O92 A;  4WF5 A;  1FVJ A;  4MNN A;  4F9Z A;  5CP1 A;  4BA7 A;  1GUL A;  5HQP A;  5D96 A;  3D4M A;  5ELG A;  1ZL9 A;  6GSW A;  1EGO A;  2DML A;  2CAQ A;  1XWA A;  3LGC A;  4K7O A;  2HSM A;  4GCI A;  4K0G A;  4EE0 A;  3FHK A;  2YWI A;  3MAK A;  3UOM A;  1FVK A;  2IMK A;  3QFA C;  1O6J A;  5KN2 A;  2VLV A;  3TCO A;  3FR3 A;  4IP6 A;  1PL1 A;  2VD0 A;  2YV7 A;  3FMW A;  3VPQ A;  1ZGN A;  5AIX A;  2FUG 2;  2H71 A;  1PD2 1;  2G0F A;  2FA8 A;  2X4A A;  1GSE A;  3ME7 A;  3N5O A;  2CT6 A;  2XC2 A;  4LMV A;  4IN0 A;  2VCV A;  5JWO B;  4NPB A;  4ZL8 A;  3BJ5 A;  2HNL A;  1GNW A;  1ACV A;  1K0O A;  3ZZX A;  2VL3 A;  5ECQ B;  1A8Y A;  1JZO A;  2YWN A;  4N11 A;  5H5Q A;  6GSV A;  1WJK A;  4PNG A;  5JWQ B;  4HDE A;  4YQM A;  1XFL A;  4GF0 A;  3N9J A;  4ZIJ A;  4XCS A;  3WGX A;  2KOK A;  4TR4 A;  4OFM A;  4RUV A;  2LV3 A;  3CRT A;  3LW9 A;  3EMP A;  4K5R A;  1EV9 A;  1XOA A;  4ZBB A;  3F3R A;  2MMZ A;  1XWG A;  3L0H A;  1V40 A;  4YQV A;  2J9H A;  4WR4 A;  4X0X A;  3M9K A;  5IPH A;  2MMO A;  2JU5 A;  2DBC A;  5DCG A;  3QOU A;  1H4O A;  3F4R A;  4I97 A;  1PKZ A;  4NV5 A;  5BMU A;  5DCH A;  2OBK A;  4ECB A;  3ERW A;  5GAP D;  2HT9 A;  1FAA A;  3LXZ A;  3EE2 A;  4ML6 A;  1ZZY A;  5DAK A;  1PQN A;  1XWC A;  3NZN A;  4K9Z A;  5ECL B;  4BVY A;  5LD0 A;  13GS A;  1U6T A;  1GSY A;  4PQI A;  4FQU A;  4IJI A;  2N5B A;  2BTO T;  4X1U A;  1NM3 A;  2VCX A;  4BL7 A;  1BX9 A;  3V1W A;  5D9T A;  4WKW A;  2L4Q A;  2ES7 A;  5ELA A;  2XPE A;  1Y6E A;  5JCG A;  4K2D A;  1J0F A;  4KUN A;  2FLS A;  1TK5 B;  1V2A A;  2OE1 A;  1FW1 A;  5IMZ A;  2H6Y A;  2PGT A;  3EMX A;  2MMA A;  1B4Q A;  3ZRE A;  1Z6M A;  1SYX A;  2V6O A;  5G5E A;  1UC7 A;  2JSY A;  6GSY A;  3G7Y A;  1TU8 A;  4ISD A;  3GV1 A;  2IJY A;  4IP1 A;  1NSW A;  4JU5 A;  4HQS A;  1SYR A;  1R7H A;  4L8E A;  3HY2 A;  1XWB A;  4ML1 A;  2HFD A;  5B8A A;  5FHI A;  3GL5 A;  3UIW A;  4PQH A;  1QGV A;  2IMI A;  2C0F A;  5B8B A;  5J4U A;  3GH6 A;  2H75 A;  4K8M A;  1ZYP A;  2R0G A;  3ZVJ D;  5ID2 B;  1GSF A;  1O73 A;  3RHB A;  1QQ2 A;  2L4C A;  2VM1 A;  3HA9 A;  1FB0 A;  2R5G A;  3KMO A;  4N0V A;  1YJ6 A;  4POM A;  3W8J A;  4Z2U A;  4PUA A;  4F0C A;  5G2Z A;  1O8X A;  4FIW A;  11GS A;  1UA5 A;  2R2J A;  3ERF A;  4MAB A;  2LST A;  4MF6 A;  2IIY A;  2PVO C;  3HVV A;  3GX0 A;  2A2S A;  4HUA A;  3I6A A;  3PH9 A;  1SEN A;  2DJ2 A;  2QSI A;  4L5O A;  2H72 A;  1RW1 A;  4LLR A;  2FWH A;  3H8Q A;  4KND A;  5IMF A;  5ECS A;  4FYU A;  1TI1 A;  5KOX A;  2B5Y A;  1USB A;  3WD6 A;  3HCZ A;  2REM A;  2VL2 A;  4O7H A;  4LA1 A;  4POK A;  1J08 A;  2DIY A;  2KP1 A;  2YN1 A;  3CXG A;  3TJG A;  5LNK e;  3SWL A;  1OKT A;  4RQR A;  3BOA A;  1K3O A;  3CMI A;  2H19 A;  4XS1 A;  3TKS E;  2B7J A;  2E2G A;  3CBU A;  1BAY A;  3D0Z A;  3UVH A;  5CRD A;  1M2A A;  4OO4 A;  1ZYE A;  1ILO A;  4F2I A;  4EF0 A;  4PQ1 A;  2H1D A;  2QA2 A;  2R4V A;  1ZYQ B;  2V41 A;  3GSS A;  2X8H A;  2H73 A;  2QGV A;  3TRQ A;  3LOR A;  3LFL A;  3WT1 A;  1E6B A;  2HXK A;  4FO5 A;  2H1A A;  3ERG A;  2FD3 A;  2VM2 A;  2AHE A;  3QPM A;  4F0B A;  5A4V A;  4YAP A;  4YAV A;  3NIV A;  5G30 A;  2EIO A;  2MMN A;  5FWG A;  4J57 E;  4MJA A;  2GTU A;  3F6F A;  1VGL A;  5F05 A;  3GRX A;  2C3Q A;  4DEJ A;  4PGT A;  1SK1 A;  4MZC A;  4JZQ A;  1LU4 A;  4A5P A;  3VI7 A;  4GSS A;  3VFI A;  3IC8 A;  1A0F A;  4PUR A;  1VF1 A;  3S9F A;  1MD4 A;  2MBS A;  2FWF A;  2GT5 A;  2YV9 A;  4KCE A;  1X9W B;  2F8A A;  5DJM A;  3US3 A;  5J41 A;  1MDK A;  2N5F A;  3FY7 A;  3HJM A;  5DJL A;  2GQM A;  6GST A;  2BMX A;  1DUG A;  2C3T A;  2L57 A;  2O87 A;  4ZB8 A;  3G7J A;  5HR2 A;  3GN3 A;  3TJF A;  3APO A;  1SL0 B;  1SKW B;  2FA4 A;  1K3Y A;  3C8E A;  3MSZ A;  1V57 A;  2I4A A;  1T00 A;  5DAL B;  1HYU A;  1PL2 A;  1GP1 A;  2LJK A;  2EIQ A;  3IAS 2;  4GLT A;  1GLP A;  3D6I A;  4ILF A;  1EOH A;  4TXV A;  3I69 A;  4G9H A;  1S3A A;  5E59 A;  1TP9 A;  1GUM A;  4JBB A;  4Z2R A;  4XRA A;  2IFQ A;  2PUK C;  4JR6 A;  4QL9 A;  1HNA A;  1CQG A;  2YZH A;  1ZOF A;  2OE0 A;  4MCU A;  3TKP A;  2WZ9 A;  5EPF A;  4IEL A;  4QQ7 A;  2ZUP A;  4EL1 A;  3O3T A;  1MEK A;  3MYD A;  2R0P A;  4O5R A;  4EO3 A;  1V9W A;  3R2Q A;  1AQX A;  3KCM A;  1GSS A;  3GKK A;  3ZVJ A;  5IOX A;  2LEG A;  3K8N A;  3O6T A;  1ERW A;  2TRC P;  4K2X A;  1O8W A;  4V2M A;  4I2T A;  1XBS A;  2YAN A;  5CRE A;  4FYC A;  3QCP A;  1XW9 A;  3C1R A;  4PUF C;  4K6X A;  4ECI A;  4GTU A;  1DE2 A;  3QD9 A;  1F37 A;  1SKR B;  2GQK A;  3C73 A;  3FZ4 A;  1T7P B;  3UVT A;  3VWW A;  2VCW A;  4G0L A;  3CTF A;  4MF5 A;  4IBP A;  1U87 A;  2RLI A;  2F3M A;  3GTU B;  1B9Y C;  3A5I A;  2GST A;  4WET A;  2QKE A;  12GS A;  2VCT A;  1TRS A;  1Q4J A;  2VCQ A;  5IQY A;  1AIU A;  4ULX A;  4DSS A;  2LQQ A;  2E7P A;  2XBQ A;  3ZRD A;  3DD3 A;  2YJ7 A;  1XOB A;  4AGS A;  4Q5R A;  4K1F A;  2K6V A;  3CYN A;  3QFB C;  5ID2 A;  4MPG A;  5ABR A;  4G0I A;  3QAW A;  5DQS A;  5JWR B;  1M2D A;  2VLU A;  4JRR A;  3F63 A;  2K9F A;  4MPF A;  1GWC A;  5J9B A;  3ED3 A;  1GUK A;  4EIQ A;  1GTI A;  2PBJ A;  1GSD A;  4GST A;  4MJC A;  1R4W A;  1EOG A;  4HZ4 A;  2XHF A;  1WOU A;  3J7Y b;  1SKS B;  3E9J B;  1EEM A;  5AIS A;  2CZ3 A;  3F8U A;  5D9V A;  1GH2 A;  3D22 A;  4D73 B;  3ZYW A;  2WB9 A;  3DVX A;  4HU9 A;  4NHZ A;  4LMW A;  1NW2 A;  2I81 A;  1PKW A;  1JZD A;  2L5L A;  4MLY A;  5CNW A;  3IK9 A;  1K0A A;  4TR0 A;  1IYH A;  4KH7 A;  5IOW A;  1KNG A;  3TGZ A;  4HS1 A;  3GKN A;  2UZ8 A;  4MZB A;  3F9U A;  3RAZ A;  4ZL9 A;  3UL3 A;  5A4W A;  2RUE A;  1TOF A;  4ZL7 A;  1PN0 A;  4ZBD A;  2B6M A;  2RUF A;  2FWG A;  2WCI A;  1GUH A;  2NTO A;  4KSO A;  2H70 A;  3FK8 A;  1YY7 A;  4K7I A;  3CSH A;  3Q19 A;  1K0B A;  2WS2 A;  3E0U A;  2QC7 A;  2B5X A;  1Z9H A;  3WYW A;  4OMV A;  3P8W A;  3TRX A;  4IKH A;  3LXT A;  3TRP A;  4EXJ A;  1XW5 A;  4KDX A;  1T4Z A;  4L0W A;  4HZ2 A;  5DDL A;  3DKS A;  2FY6 A;  2GZP A;  5GAN D;  4J2F A;  4XIH A;  1XXU A;  3DGQ A;  1AAZ A;  2TRX A;  2B7K A;  1ST9 A;  20GS A;  2CX3 A;  3RPN A;  2CQ9 A;  4MF7 A;  2LJA A;  5CAX A;  2O7K A;  2DJK A;  4AF2 A;  3IRA A;  3HZ8 A;  2YCD A;  3EWL A;  4TKY A;  1G6W A;  1OE7 A;  4ZBA A;  3RPP A;  1GL8 A;  4Q5F A;  2YWO A;  4ECJ A;  3VWX A;  2RII A;  3ZIJ A;  2DJ0 A;  1GSU A;  1BJX A;  3VUR A;  3CSJ A;  4E8H A;  2WGR A;  2X64 A;  3M9J A;  3TOT A;  3PIN A;  1M99 A;  1YF1 A;  5J3R A;  1TK8 B;  2YP6 A;  3QAG A;  1PSQ A;  3ZMK A;  1PX6 A;  3RHC A;  3TKR A;  5CYY A;  3KP8 A;  1WWJ A;  4WF4 A;  1XCC A;  1TU7 A;  3MDK A;  5DBQ A;  2ALB A;  3VLN A;  5D8I A;  3UEM A;  4BPY A;  4X43 A;  1M0U A;  1URM A;  2A2P A;  3I9V 2;  2DC5 A;  3MWH A;  1PA3 A;  2HE3 A;  2X8G A;  3MNG A;  19GS A;  2CAI A;  5ENU A;  4RQX A;  1FO5 A;  4J56 E;  3IHQ A;  1IYI A;  1SK0 A;  4O32 A;  4XS4 A;  1JFU A;  1OC9 B;  2C0G A;  5AIV A;  3DVW A;  1SU9 A;  2HZE A;  3IR4 A;  1M7T A;  3A5W A;  4XS6 A;  5KEJ A;  3IOS A;  1DBY A;  1WE0 A;  2YZU A;  1QXH A;  2I3Y A;  1AQV A;  1YDK A;  5ECH B;  4NWY A;  1ERT A;  2JAD A;  2TIR A;  3GA4 A;  3PPU A;  2GSS A;  1F3A A;  5HFG A;  1X5C A;  4TR1 B;  1TRU A;  3WGD A;  1X9S B;  4YKF A;  1VRS D;  1T4Y A;  2OA7 A;  2WJU A;  1R5P A;  1QK8 A;  2N5A A;  2V32 A;  3M1G A;  1GSQ A;  2PER A;  1C72 A;  1Z7R A;  3SBC A;  5G1K A;  4GRF A;  1NHY A;  1O7U A;  1JLV A;  4POL A;  1TRV A;  4MMM A;  3KIJ A;  2JL4 A;  4QL7 A;  2FCH A;  3FEU A;  1S3C A;  2CA8 A;  3EYT A;  4DSQ A;  2FGX A;  3VWV A;  4BWS A;  1VF2 A;  4NXI A;  1TK0 B;  4Q5N A;  5ECO B;  3FKF A;  3HKR A;  2QA1 A;  2DKH A;  3JCM L;  1U88 A;  3P90 A;  3C7M A;  4OO5 A;  1T1V A;  1OC8 A;  3AY8 A;  2IMD A;  1J9B A;  3P2A A;  3VWU A;  2OJL A;  1DSB A;  4GXZ A;  3L9U A;  3BBY A;  4DSR A;  5CRH A;  1YKC A;  2XPD A;  1TRW A;  1YZX A;  1Y25 A;  2VO4 A;  1KTE A;  5C04 A;  4CY8 A;  5EY6 A;  1W4V A;  2L6D A;  1AXD A;  2CVD A;  4JED A;  3IXR A;  1OVN A;  3M3M A;  2IN3 A;  1B9X C;  3IDV A;  4I6X A;  3GL3 A;  1HNB A;  4KAE A;  4MH2 A;  4HEA 2;  1N8J A;  2DKI A;  5KN3 A;  1GTB A;  1NHO A;  3G9B A;  2L59 A;  5H5S A;  1I5G A;  3ZL5 A;  4N0Z A;  1FG4 A;  2HRN A;  3PR8 A;  4FH8 A;  4GQC A;  5DVB A;  1KBN A;  4EUY A;  1GRX A;  3DIE A;  2GZY A;  3GMF A;  4IQ1 A;  1PGT A;  4IHU A;  4V2N A;  4HOJ A;  1R5A A;  1FHE A;  2JZT A;  5DAK B;  3IPZ A;  3A2V A;  2V1M A;  1FOV A;  1V58 A;  2H76 A;  1ZCP A;  4F03 A;  4MP4 A;  4MJB A;  4KDY A;  2M46 A;  1A2J A;  2I9H A;  1A2L A;  1XIY A;  3TJB A;  1Z5Y E;  4Z7X A;  3ME8 A;  2C1Y A;  5COH A;  4X4J A;  2IL3 A;  4LL1 B;  3TOU A;  3Q6O A;  5F8B A;  2CVK A;  2V6K A;  2PVQ A;  9GSS A;  5A5K A;  1SJZ A;  4CY6 A;  1UVZ A;  3FZ5 A;  4BVX B;  1HQO A;  3EU3 A;  3GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...