2JZRA

Solution structure of the oxidized form (cys67-cys70) of the n-terminal domain of pilb from n. meningitidis.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
144
structure length
144
Chain Sequence
MVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Peptide methionine sulfoxide reductase msrA/msrB
publication title Solution structure and dynamics of the reduced and oxidized forms of the N-terminal domain of PilB from Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
total genus 32
structure length 144
sequence length 144
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2008-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2jzrA00
1GSQA 3KM6A 3DRNA 4KAEA 2GQLA 4I8BA 1G6YA 1GNWA 3LEFA 5HFGA 3GKKA 2J9HA 2WGRA 3LORA 1OC8A 1N2AA 1FVJA 2B5EA 5HR1A 5F8BA 1X9MB 5KN2A 2A2RA 5J3RA 1AXDA 3WGDA 1XWGA 3TKSC 1M9BA 4RQXA 1TOFA 4WF5A 2IMFA 3D6IA 3QAGA 2WJUA 4N0VA 1SL1B 2J23A 2KUCA 4K0GA 1TKDB 2VCXA 4DSQA 2HLSA 5ID2B 3VPTA 1U87A 3ZFLA 5G31A 1SL2B 2MBSA 1F37A 4OWYA 1ACVA 1A2MA 1X5CA 3KXOA 5D9TA 3I43A 1HNBA 2QC7A 1A24A 1ERVA 1XZOA 1QFNA 3GTUA 4OCEA 2CAQA 1EGRA 4MPFA 2H0HA 1F9MA 3H79A 2LRCA 2GDRA 3D0ZA 2LJRA 4E8HA 2AYTA 2R4VA 2VCQA 3EINA 2HSHA 1GTIA 2F9SA 3CTFA 4K7OA 1K3LA 4KCEA 2VL2C 5CRWA 3ZYWA 2R37A 1G7OA 3GMFA 1Z6MA 5IMDA 4JRRA 4EO3A 5B6NA 2EIOA 4EXJA 1G6WA 1K0OA 4GSNA 4BA7A 4GLTA 2JU5A 4ID0A 3ZL5A 2MYGA 5J4UA 2X99A 2H1AA 1Z6NA 1SKWB 4MABA 5ELAA 2FNOA 1TDIA 3D21A 3DGQA 4K0NA 2F51A 2JSZA 2VCTA 2WRTA 1GTBA 2KP1A 1J0FA 3ZMKA 5IOXA 3IAS2 2O7KA 1PN9A 4LMWA 1OE7A 4QL9A 4BVXA 3ZITA 5CNWA 1K0NA 1S3AA 3GRXA 3WD6A 4POLA 2GZPA 4IW9A 1XIYA 5DALA 4KNDA 3KMNA 4IHUA 2I3YA 5ECPB 1TP9A 2CZ2A 5DCHA 3ZRDA 1X0RA 2AHEA 3GL3A 4KA0A 1E2YA 2YZHA 3L9VA 2H75A 3BD2A 4WXTA 2IFQA 2WULA 4EC0A 3D4MA 4O7HA 1SKSB 1T4YA 3IPZA 3QPMA 1XOAA 1YJ6A 4MJBA 4IQ1A 2C0FA 5F0GA 2PU9C 5JWQB 4LMVA 1XW5A 3TJGA 5ABRA 4MA9A 2F8AA 4J2FA 3FZAA 1GNEA 4DEJA 4V2MA 2DC5A 4K2DA 5HFIA 1FB6A 1GP1A 3DYRA 3O3TA 4PQ1A 2CX3A 1ILOA 2C0DA 4NMUA 3C7MA 5ECMB 2B3SA 4V2LA 2YANA 1GSEA 5B8BA 3DWVA 1GRXA 3IR4A 3GURA 2O85A 1W4VA 1ABAA 1M7TA 3QMXA 3WT2A 3HZ8A 2H0GA 3G9BA 1FOVA 4GSTA 4YQMA 3HZ4A 3ZTLA 3UVHA 3HD5A 1ZOFA 1WIKA 2K18A 2VCZA 2CVDA 5INYA 17GSA 2JZSA 3BOAA 2OADA 4G19A 3GH9A 2DIYA 2HFDA 3ZMLA 4EL1A 3FY7A 5EL8A 1ZMAA 5H5RA 3HKRA 2NBSA 2JZRA 1Z3EA 4WF4A 1ERTA 1A8LA 1UVZA 2V1MA 4TOPA 3ERGA 1GLPA 1HQOA 1H4OA 1ZGNA 3WGEA 1TI3A 5ECLB 3C71A 1SU9A 2JACA 2H6XA 4HQSA 3IA1A 1S3CA 3DXBA 1XCCA 3TJKA 3GX0A 1TI1A 1M0UA 1XWBA 5IMFA 5KN3A 2L4CA 1PRXA 4KDUA 1WPIA 3CBUA 2LJAA 3U5RE 2L6DA 5AGYA 3F0IA 3ZIVA 3GTUB 1EGOA 5D9WA 5DQSA 1R5PA 4MH2A 2RUFA 2GLRA 1TTZA 2XC2A 2C8UA 3IRAA 3TRQA 1B4QA 2X64A 4KB3A 2E7PA 4ZL9A 1OC9B 2GSQA 3ZREA 4IJ3A 1K0MA 5FT3A 4ZBDA 5IMCA 1J9BA 1U3AA 1MDIA 3O76A 4JBBA 5CREA 3GYKA 5ECKB 1RW1A 2H19A 3J7Yb 3TOUA 5G30A 3VPQA 1WP0A 5ECQB 4KSOA 2N5AA 1ZL9A 4GTUA 3BBYA 2AV4A 2IMKA 1O7UA 2PMTA 4MJEA 3TRPA 1TU8A 2R6KA 1YF1A 1O85A 1BX9A 1EP7A 5AIVA 3GSTA 4WBRD 3DKSA 2ES7A 2DIZA 2PWJA 2M80A 3TRXA 2HSYA 2H72A 2GQKA 2R3XA 3TKSE 3GKMA 3FR9A 3TUEA 2KP2A 2MMOA 4IP6A 2GSRA 4TXVA 4PUFC 5GAND 2MMAA 6GSTA 4MLYA 3QCPA 2QSIA 3VWXA 3IDVA 2VUPA 4HEA2 4ML1A 1BEDA 3KCMA 4K6XA 4L5OA 3F9UA 4POBA 1WWJA 3VI7A 3WYWA 2NVLA 3PR8A 5CP1A 1F3AA 1Z7RA 4HJMA 1PX6A 2IJYA 5IM9A 5EPFA 2YP6A 1TRUA 2IL3A 1U3IA 3F3QA 1K0BA 2WDUA 4Q5NA 5J9BA 1V2AA 3BJ5A 2M72A 5HQPA 5GSSA 3A2XA 1AQXA 5E59A 5ELGA 2YWMA 5IO2A 2VD0A 2VOCA 1ZYQB 3GV1A 4XRDA 1TU7A 1SYRA 3GUSA 3VI5A 2O89A 2L5OA 5AIXA 3A2WA 2DJ3A 3LXZA 1ZCPA 2H1BA 2CT6A 2LJKA 4WETA 4N11A 1DBYA 2P5RA 2C80A 1V9WA 4HU7A 3HY2A 1FB0A 4KSMA 3APQA 1A8YA 3KH9A 1W89A 4KCAA 1K3YA 5IMZA 5IO0A 1ST9A 2FA4A 4GF0A 3QD9A 3FZ5A 3NIVA 4EKZA 3C1RA 2K8VA 3EMPA 2V2GA 5HR3A 2WCIA 1V57A 2H0IA 3LFLA 3P90A 1DE1A 1MD4A 2OE3A 1IYIA 1PL1A 3PH9A 3UL3A 4NV5A 4BWQA 1AQVA 5CO3A 1XXUA 2C0GA 3NOFA 3EURA 4I2TA 3HVXA 4K8MA 3CSHA 3I6AA 2FHEA 3HYPA 4G10A 3VWWA 4L5LA 6GSVA 3M8NA 3M1GA 3CTGA 1THXA 1WE0A 1WOUA 2YV7A 5JWOB 5FHIA 12GSA 4Z7XA 4TR4A 2XBIA 3F3RA 2YCDA 1QGVA 3FYGA 1FVKA 4ACSA 2YWNA 2PGTA 3TB2A 2FWEA 1K0AA 3E0UA 4O92A 1PA3A 3HVVA 2FY6A 1TRSA 3KD0A 4AJ7A 4ZILA 5LD0A 1B9YC 18GSA 2BJXA 4WR5A 3F4SA 2FA8A 3HJPA 3IXRA 4ECIA 3TJFA 4TXOB 1PD21 2PUKC 1U88A 3TDGA 2CVBA 3IAM2 5A4WA 6GSYA 4ML6A 1GUKA 2DSAA 2RLIA 1DUGA 3FRCA 1IYHA 2FWHA 3VFIA 2I81A 2N5BA 2H30A 3DVXA 3GKXA 4GSSA 4LA1A 2C3NA 1EEMA 2ZNMA 3FW2A 4EDYA 1OKTA 1F6MC 4PGTA 3FZ4A 3HJMA 4LLRA 5JCUA 5CAXA 2PN8A 1B9XC 4MPGA 3S9FA 4QL7A 3PGTA 2LNTA 2G2QA 2VL9A 3ZVJA 2NDOA 4JU5A 2DJ1A 2FCHA 3SWLA 5B8AA 5F07A 3LGCA 4ZB6A 3I69A 3RHBA 3LXTA 1I9DA 1K0CA 4X1UA 4XCSA 3Q6OA 1FO5A 1R5AA 3W8SA 3E3EA 2XBQA 3L78A 1QXHA 1HD2A 1T1VA 2ALBA 4PURA 1CQHA 2N5FA 4TN8A 3G7JA 3IV4A 4XHMA 2GZYA 5GAPD 1SJ6A 2I9HA 2GT6A 1UA5A 5H5QA 4DSSA 1SD8A 2HYXA 4D73B 3ZFBA 5IPHA 4F9ZA 11GSA 3IE3A 3EVIA 2XPDA 3VLNA 3KP9A 4OCFA 1T3BA 2H70A 2B7JA 1JLWA 2CAIA 1NW2A 4YQUA 2YN1A 4CDOA 3D5JA 3TKSA 4PUAA 1CQGA 2VCWA 3LQ7A 2HZEA 2JSYA 1YQ1A 4WBJA 2FD3A 1WJKA 3KZQA 4POMA 4H86A 1EP8A 3L0HA 5A4UA 2HNLA 4L0WA 4P3YB 3US3A 2XPEA 1FW1A 3KJYA 14GSA 1KNGA 1Z5YE 4TR1A 1UC7A 9GSSA 4ZXGA 2OBKA 1Q98A 4ILFA 6GSSA 5B7CA 2V41A 3TKQA 3FR3A 5DCGA 4NXIA 4TKYA 2LUSA 5KN1A 3RPNA 1EOHA 1QMVA 2VLTA 4I5QA 3TKPA 5ECRB 1AIUA 4XRAA 4JZQA 2H76A 3CXGA 1HYUA 5JWRB 2EIQA 1SYXA 3TCOA 2YJ7A 1N8JA 4NWYA 4BL7A 4GXZA 1O8XA 1ERUA 1GTAA 2IMDA 4G2EA 4HU9A 4HZ4A 1VRSD 4I6XA 5B6MA 6GSWA 2VM1A 1GSUA 2VL2A 5D96A 2C0EA 3MSZA 5D93A 4IKHA 1M2AA 4HUAA 1Y25A 3UIWA 1GSFA 2P5QA 3ME8A 5DVBA 4MF6A 2V6KA 5G5EA 2D2ZA 1GWCA 2B6MA 2C3TA 1GSSA 2H73A 2NPBA 2F8FA 1Z7PA 4V1Ag 4FO5A 1GUMA 4J56E 5IPGA 2LNSA 1GSDA 4MK3A 3L9SA 2PPTA 4XS1A 4X43A 4IBPA 8GSSA 4OFMA 3G7YA 1FG4A 1JHBA 2HXKA 2L59A 1VF3A 3F6FA 3IK9A 2H74A 1BJXA 1MEKA 2Z9SA 2HT9A 1R26A 3I9V2 4LL1B 5IQYA 2GVPA 3TGZA 2H6YA 1T4ZA 1TK5B 3F4RA 3ZIJA 5HFKA 2CVKA 1SD9A 4MCUA 5CRHA 4TW5A 1F3BA 2X8GA 4WR4A 1XWCA 4KH7A 4L0UA 3A2VA 2PVOC 5ENUA 2LTKA 3UAPA 1XBSA 2O87A 3P7XA 2K9FA 3KMOA 3N9JA 1BAYA 1EWXA 4NPBA 5ID2A 3W8JA 3O6TA 4WKWA 2R2JA 3DEXA 4MH3A 1MDKA 1AQWA 3GIXA 2DMLA 3GKNA 1X5DA 1HNCA 4KDXA 2GTUA 1YEPA 2I1UA 5G1KA 1LJRA 3QAVA 1PL2A 5C04A 3GNJA 1XOBA 1OC3A 1JZDA 1YF0A 4LL4B 1FHEA 1V98A 4DSRA 3K8NA 4I2UA 3KTBA 3WT1A 4OFTA 3QOUA 1M2BA 3CYNA 2DJ0A 1XPVA 4GQFA 1B48A 5DALB 5ECHB 2OBIA 5DAKA 2AAWA 2EC4A 2LEGA 5GSTA 2LQQA 3FR6A 4E8EA 3HXSA 1AUCA 2OKAA 4MF7A 4Q5QA 3VURA 1EOGA 3GX8A 5L71A 1QUWA 4TR1B 2IFQB 2YV9A 4GWRA 1YY7A 1RK4A 2GSTA 5J5NA 4WEYA 3F4TA 3FZ9A 1I5GA 4L8EA 4O5RA 4ZBAA 1A23A 3ERWA 5G1LA 3HVSA 3CMIA 1V58A 6GSUA 5KN0A 1H75A 4MJCA 4RI6A 3FKFA 4YAVA 4G9HA 2VD1A 4DVCA 1YEXA 1MDJA 3C73A 4TR0A 1URMA 4CHSA 1XW6A 3IC4A 1TXXA 3M3MA 2LSTA 1S3DA 1B8XA 4HZ2A 2LV3A 4PQHA 3TJBA 5D8IA 1C72A 2YPMA 2LKUA 4HOJA 3R2QA 3W6GA 2GS3A 5E4WA 3H8QA 4HS1A 1QQ2A 1BQ7A 3CRUA 3FK8A 1THOA 2IIYA 3APOA 1Z9HA 1BYEA 4JR4A 1A2LA 3UARA 2WB9A 1A0FA 4YQVA 3ZLPA 2WS2A 1UN2A 5EY6A 2HI7A 4FYCA 3P8WA 4TR3A 1YKAA 5DDLA 4J57E 1SL0B 3ISOA 3IHQA 1PKZA 4EE0A 2X8CA 4ZL7A 3MDKA 2CA8A 4NHWA 5DJMA 1JZOA 2IMEA 1NM3A 3HA9A 2YWIA 3APSA 4MJAA 3CSIA 3Q18A 3E9JB 3QR6A 2LS5A 3HDCA 3L4NA 3KGKA 2H1GA 1PSQA 1RQMA 3DIEA 1SENA 2OJLA 2DLXA 4KW6A 1SK2A 3HJOA 4OD7A 2VL3A 1DSBA 1VF2A 2B5YA 2H6ZA 3VWVA 4YAPA 3ERFA 5GZZB 4V1Ap 2OA7A 4CW9A 3HCZA 1OE8A 2B5XA 1O73A 1PKWA 2M46A 2C4JA 1EZKA 5LNKe 1NSWA 3WGXA 4YH2A 1KEBA 2KHPA 1Q4JA 1O6JA 2L6CA 2C3QA 2GZZA 1VF4A 4EVMA 4K7NA 4AF2A 2VIMA 4O32A 3Q74A 2IPAA 4KUNA 3VWUA 3ZZXA 3MWHA 4IN0A 4ZB9A 1TK8B 3J7Yk 4ZBBA 3FHKA 1GLQA 3QDNA 4IGJA 5H5SA 2OACA 2EIRA 4ECBA 2BMXA 1OC9A 1M2DA 2DMMA 1XVWA 1TRVA 4TVEA 3G7IA 4IELA 3UJ1A 6GSXA 3D22A 4MP4A 3EC3A 3UEMA 1XFLA 5DAKB 3KH7A 4F0BA 5COHA 4F2IA 2YOIA 1AAZA 3LYKA 2WZ9A 4XS4A 3F8UA 3TOTA 1ZYEA 3M0FA 1SKRB 5IIZA 2V6OA 5IMVA 4XS6A 4IQAA 2ZCTA 3JCML 2E2MA 2JL4A 2LRNA 20GSA 3TJJA 2QGVA 3GH6A 4F0CA 4HJ2A 1LBKA 2HRFA 1GH2A 4FYBA 3MAKA 1X9WB 3V1WA 4OMVA 1X9SB 7GSSA 2CV4A 2BTOT 4EDZA 2FLSA 5J41A 2JZTA 1SK0A 5LCZA 22GSA 4F82A 3M9JA 3UOMA 2IWTA 4HDEA 2WFCA 4ECJA 2QKEA 1KTEA 4PQIA 5IOWA 3ZVJD 2X8HA 4FIWA 1OKDA 3A5WA 13GSA 4HI7A 1SK1A 1YKCA 2MMZA 5C00A 2DJKA 1ML6A 3H93A 1USBA 4MZWA 2L5LA 1OYJA 2PVQA 4IS0A 2RM5A 5DBQA 2ZUPA 4MDCA 10GSA 2RM6A 3F6DA 4F03A 4OO4A 5G2ZA 5EVOA 1GUHA 3QFAC 2H66A 3EU3A 4JR6A 1JLVA 4ULXA 1ERWA 4HQZA 4IJIA 4ECCA 2MZCA 4TRXA 2G0FA 4ZB8A 3DVWA 4AJ6A 1V40A 2H8LA 1JZWA 2K8SA 2AJQB 4BWSA 1XVQA 4MMMA 1X5EA 3QFBC 3EWLA 3KP8A 2B1LA 2HZFA 2IMIA 3P2AA 4N10A 3IK7A 2VCVA 3RAZA 2E0QA 16GSA 1ON4A 2RUEA 4MZBA 2B7KA 3KTLA 4GQCA 2GQMA 1TW9A 2VLVA 4GRFA 4GCIA 1HNAA 2V32A 1WRYA 2MBTA 1A2JA 2PBJA 4AJ8A 2GT5A 3VK9A 4KGIA 2OE1A 4NV2A 1XW9A 4KE3A 2CQ9A 2A4VA 3C8EA 1SJZA 1M99A 2NTOA 2HRNA 5JCGA 4IP1A 4MZCA 4PNFA 5D9VA 2L57A 2VAFA 3BCKA 2GGTA 3BCIA 3GA4A 1MD3A 3LSZA 1PQNA 1GL8A 1PX7A 2MMNA 3F63A 2OE0A 5DQYA 2KLXA 2KOKA 2VM2A 2H01A 1O8WA 4RUVA 1Y6EA 2REMA 5HR0A 1G0TA 3FEUA 3UBLA 3MNGA 2YWOA 5A4VA 5J9CA 2H1DA 1OVNA 1VGLA 2I4AA 4OO5A 5AN1A 2B1KA 2TIRA 3LG6A 5ECOB 2P0GA 3HHVA 4PXOA 4V2NA 3U6VA 4TXOA 1WMJA 2K6VA 3EMXA 1GULA 5F05A 5IMAA 1U6TA 1G7EA 4BVYA 1PGTA 1VF1A 5A5KA 3AY8A 3ME7A 3QAWA 4BPYA 2TRXA 4RI7A 1TK0B 3PINA 1J08A 1JFUA 2L4QA 3GSSA 2VLUA 3EYTA 5FWGA 3NZNA 1YZXA 1GSYA 3EU4A 2CZ3A 5JCWA 4NAXA 3RDWA 3N5OA 5ECIB 1O81A 2F3MA 5DJLA 3RPPA 4DSSB 1LU4A 4K7IA 2PERA 4ISDA 2P31A 2AUVA 5HR2A 2FGXA 4XS4B 5D73A 1QK8A 3RBTA 19GSA 2YNXA 4I97A 4JE1A 3L9UA 5CRGA 4RQRA 4KX4A 1YDKA 4MF5A 2HZEB 1JZRA 1ZZYA 5ECSA 2RIIA 2IN3A 2XHFA 4OFNA 3LYPA 2AB6A 3OR5A 2A2SA 2HE3A 1TRWA 4FH8A 4X0XA 2VO4A 1K0DA 3LJRA 1BG5A 4D73A 1GTUA 3IBHA 2DBCA 3UVTA 3C1SA 1XWAA 3GL5A 1MTCA 4XIHA 3A3TA 1A0RP 1NHYA 2GSSA 3CSJA 1AW9A 1EEJA 4AGSA 4EF0A 3SBCA 5AISA 1EV9A 4N0ZA 2C1YA 4IVFA 5ECNB 2E2GA 3DD3A 3IOSA 4Q5FA 3KIJA 1FAAA 3EE2A 4ZL8A 5G5FA 3ED3A 2FWGA 4PX1A 4JEDA 2CX4A 3H4KA 1PMTA 4K9ZA 4PNGA 1T00A 2FUG2 1OAZA 4K1FA 3GN3A 3DMLA 5CRDA 1M9AA 4QQ7A 4POKA 3TKRA 1EV4A 2LRTA 2ON7A 4Q5RA 1AC1A 2H71A 2DJ2A 3CRTA 1R4WA 5F06A 3RHCA 1T7PB 2TRCP 1DE2A 1B4PA 3UMAA 1KBNA 2R5GA 1SJIA 1NHOA 1TJDA 4NHZA 2ON5A 3UBKA 2LQOA 4ZIJA 5KEJA 3Q19A 4FYUA 1XWKA 2O8VB 2YJHA 1F2EA 3D4TA 1T8EB 4N30A 3H1NA 3KEBA 3LWAA 3M9KA 1K3OA 3GFKA 2YZUA 4KDYA 5D9XA 3GHAA 1R7HA 1E6BA 2FWFA 2JADA 4XTSA 5CYYA 4EUYA 2DJJA
chains in the Genus database with same CATH superfamily
1GSQA 3KM6A 3DRNA 4KAEA 2GQLA 4I8BA 1G6YA 3IC8A 1GNWA 3LEFA 5HFGA 3GKKA 2J9HA 2WGRA 3LORA 1OC8A 1N2AA 1FVJA 2B5EA 5HR1A 5F8BA 1X9MB 5KN2A 2A2RA 5J3RA 1AXDA 3WGDA 1XWGA 3TKSC 1M9BA 4RQXA 1TOFA 4WF5A 2IMFA 3D6IA 3QAGA 2WJUA 4N0VA 1SL1B 2J23A 2KUCA 4K0GA 1TKDB 2VCXA 4DSQA 2HLSA 2HRKA 5ID2B 4G0LA 3VPTA 1U87A 3ZFLA 5G31A 1SL2B 2MBSA 1F37A 4OWYA 1ACVA 1A2MA 1X5CA 4BVYB 3KXOA 5D9TA 3I43A 1HNBA 2QC7A 1A24A 1ERVA 1XZOA 1QFNA 3GTUA 4OCEA 2CAQA 1EGRA 4MPFA 2H0HA 1F9MA 3H79A 2LRCA 2GDRA 3D0ZA 2LJRA 4E8HA 2AYTA 2R4VA 4YKFA 2VCQA 3EINA 2HSHA 1GTIA 2F9SA 3CTFA 4K7OA 4EIQA 1K3LA 4KCEA 2VL2C 5CRWA 3ZYWA 2R37A 1G7OA 3GMFA 1Z6MA 5IMDA 4JRRA 3MYDA 4EO3A 5B6NA 3A5IA 2EIOA 4EXJA 1G6WA 5BRTA 1K0OA 4GSNA 4BA7A 4GLTA 2JU5A 4ID0A 3ZL5A 2MYGA 5J4UA 2X99A 2H1AA 1Z6NA 1SKWB 4MABA 5ELAA 2FNOA 1TDIA 3D21A 3DGQA 4K0NA 2F51A 2JSZA 2VCTA 2WRTA 1GTBA 2KP1A 1J0FA 3ZMKA 5IOXA 3IAS2 2O7KA 1PN9A 4LMWA 1OE7A 4QL9A 4BVXA 3ZITA 5CNWA 1K0NA 1S3AA 3GRXA 3WD6A 4POLA 2GZPA 4IW9A 1XIYA 5DALA 4KNDA 3KMNA 4IHUA 2I3YA 5ECPB 1TP9A 2CZ2A 5DCHA 3ZRDA 1X0RA 2AHEA 3GL3A 4KA0A 1E2YA 2YZHA 3L9VA 2A2PA 2H75A 3BD2A 4WXTA 2IFQA 2WULA 4EC0A 2UZ8A 3D4MA 4O7HA 1SKSB 1T4YA 3IPZA 3QPMA 1XOAA 1YJ6A 4MJBA 4IQ1A 2C0FA 3EPTA 2PU9C 5F0GA 5JWQB 4LMVA 1XW5A 3TJGA 5ABRA 4MA9A 2F8AA 4J2FA 3FZAA 1GNEA 4DEJA 4V2MA 2DC5A 4K2DA 5HFIA 1FB6A 1GP1A 3DYRA 3O3TA 4PQ1A 2CX3A 1ILOA 2C0DA 4NMUA 3C7MA 5ECMB 2B3SA 4Z2UA 4V2LA 2YANA 1GSEA 5B8BA 3DWVA 1GRXA 3IR4A 3GURA 2O85A 1W4VA 1ABAA 1M7TA 3QMXA 3WT2A 3HZ8A 2H0GA 3G9BA 1FOVA 4GSTA 4YQMA 3HZ4A 3ZTLA 3UVHA 3HD5A 1ZOFA 1WIKA 2K18A 2VCZA 2CVDA 5INYA 17GSA 2JZSA 3BOAA 2OADA 4G19A 3GH9A 2DIYA 2HFDA 3ZMLA 4EL1A 3FY7A 5EL8A 1ZMAA 5H5RA 3HKRA 2NBSA 2JZRA 1Z3EA 4WF4A 1ERTA 1A8LA 1UVZA 2V1MA 4TOPA 3ERGA 1GLPA 1HQOA 1H4OA 1ZGNA 3WGEA 1TI3A 5ECLB 3C71A 1SU9A 2JACA 2H6XA 4HQSA 3IA1A 1S3CA 3DXBA 1XCCA 3TJKA 3GX0A 1TI1A 1M0UA 1XWBA 5IMFA 5KN3A 4K5RA 2L4CA 1PRXA 4KDUA 1WPIA 3CBUA 2LJAA 3U5RE 2L6DA 5AGYA 3F0IA 3ZIVA 3GTUB 1EGOA 1PFOA 5D9WA 5DQSA 1R5PA 4MH2A 2RUFA 2GLRA 1TTZA 2XC2A 2C8UA 3IRAA 3TRQA 1B4QA 2X64A 4KB3A 2E7PA 4ZL9A 1OC9B 2GSQA 3ZREA 4IJ3A 1K0MA 5FT3A 4ZBDA 5IMCA 1J9BA 1U3AA 1MDIA 3O76A 4JBBA 5CREA 3GYKA 5ECKB 1RW1A 2H19A 3J7Yb 3TOUA 5G30A 3VPQA 1WP0A 5ECQB 4KSOA 2N5AA 1ZL9A 4GTUA 3BBYA 2AV4A 1PN0A 2IMKA 1O7UA 2PMTA 4MJEA 3TRPA 1TU8A 2R6KA 1YF1A 1O85A 1BX9A 1EP7A 5AIVA 3GSTA 4WBRD 3DKSA 2ES7A 2DIZA 2PWJA 2M80A 3TRXA 2HSYA 2H72A 2GQKA 2R3XA 3TKSE 3GKMA 3FR9A 3TUEA 2KP2A 2MMOA 4IP6A 2GSRA 4TXVA 4PUFC 5GAND 2MMAA 6GSTA 4MLYA 3QCPA 2QSIA 3VWXA 3IDVA 2VUPA 4HEA2 4ML1A 1BEDA 3KCMA 4K6XA 4L5OA 3F9UA 4POBA 1WWJA 3VI7A 3WYWA 2NVLA 3PR8A 5CP1A 1F3AA 1Z7RA 4HJMA 1PX6A 2IJYA 5IM9A 5EPFA 2YP6A 1TRUA 2IL3A 1U3IA 3F3QA 1K0BA 2WDUA 4Q5NA 5J9BA 1V2AA 3BJ5A 2M72A 5HQPA 5GSSA 3A2XA 1AQXA 5E59A 5ELGA 2YWMA 5IO2A 2VD0A 2VOCA 1ZYQB 3GV1A 4XRDA 1TU7A 1SYRA 3GUSA 3VI5A 2O89A 2L5OA 5AIXA 3A2WA 2DJ3A 3LXZA 2X4AA 1ZCPA 2H1BA 2CT6A 2LJKA 4WETA 4N11A 1DBYA 2P5RA 2C80A 1V9WA 4HU7A 3HY2A 1FB0A 4KSMA 3APQA 1A8YA 3KH9A 1W89A 4KCAA 1K3YA 5IMZA 5IO0A 1ST9A 2FA4A 4GF0A 3QD9A 3FZ5A 3NIVA 4BIKA 4EKZA 3C1RA 2K8VA 3EMPA 2V2GA 5HR3A 2WCIA 1V57A 2H0IA 3LFLA 3P90A 1DE1A 1MD4A 2OE3A 1IYIA 1PL1A 3PH9A 3UL3A 4NV5A 4BWQA 1AQVA 5CO3A 1XXUA 2C0GA 3NOFA 3EURA 4I2TA 3HVXA 4K8MA 3CSHA 3I6AA 2FHEA 3HYPA 4G10A 3VWWA 4L5LA 6GSVA 3M8NA 3M1GA 3CTGA 1THXA 1WE0A 1WOUA 2YV7A 5JWOB 5FHIA 12GSA 4Z7XA 4TR4A 2XBIA 3F3RA 2YCDA 1QGVA 3FYGA 4X4JA 1FVKA 4ACSA 2YWNA 2PGTA 3TB2A 2FWEA 1K0AA 3E0UA 4O92A 1PA3A 3HVVA 2FY6A 1TRSA 3KD0A 4AJ7A 4ZILA 5LD0A 1B9YC 18GSA 2BJXA 4WR5A 3F4SA 2FA8A 3HJPA 3IXRA 4ECIA 3TJFA 4TXOB 1PD21 2PUKC 4KF9A 1U88A 3TDGA 2CVBA 3IAM2 5A4WA 6GSYA 4ML6A 1GUKA 2DSAA 2RLIA 1DUGA 3FRCA 1IYHA 2FWHA 3VFIA 2I81A 2N5BA 2H30A 3DVXA 3GKXA 4GSSA 4LA1A 2C3NA 1EEMA 2ZNMA 3FW2A 4EDYA 1OKTA 1F6MC 4PGTA 3FZ4A 3HJMA 4LLRA 5JCUA 3FMWA 5CAXA 2PN8A 1B9XC 1XG8A 4MPGA 3S9FA 4QL7A 3PGTA 2LNTA 2G2QA 2VL9A 3ZVJA 2NDOA 4JU5A 2DJ1A 2FCHA 3SWLA 5B8AA 5F07A 3LGCA 4ZB6A 3I69A 3RHBA 3LXTA 1I9DA 1K0CA 4X1UA 4XCSA 3Q6OA 1FO5A 1R5AA 3W8SA 3E3EA 2XBQA 3L78A 1QXHA 1HD2A 1T1VA 2ALBA 4PURA 1CQHA 2N5FA 4TN8A 3G7JA 3IV4A 4XHMA 2GZYA 5GAPD 1SJ6A 2I9HA 2GT6A 1UA5A 5H5QA 4DSSA 1SD8A 2HYXA 4D73B 3ZFBA 5IPHA 4F9ZA 11GSA 3IE3A 3EVIA 2XPDA 3VLNA 3KP9A 4OCFA 1T3BA 2H70A 2B7JA 1JLWA 2CAIA 1NW2A 4YQUA 4G0IA 2YN1A 1ZYNA 4CDOA 3D5JA 3TKSA 4PUAA 1CQGA 2VCWA 3LQ7A 2HZEA 2JSYA 1YQ1A 4WBJA 2FD3A 1WJKA 3KZQA 4POMA 4H86A 1EP8A 3L0HA 5A4UA 2HNLA 4L0WA 4P3YB 3US3A 2XPEA 1FW1A 3KJYA 14GSA 1KNGA 1Z5YE 4TR1A 1UC7A 4O5UA 4O5QA 9GSSA 4ZXGA 2OBKA 1Q98A 4ILFA 6GSSA 5B7CA 4CY8A 2V41A 3TKQA 3FR3A 5DCGA 4NXIA 4TKYA 2LUSA 5KN1A 3RPNA 1EOHA 1QMVA 4EIPA 2VLTA 4I5QA 3TKPA 1AIUA 5ECRB 4XRAA 4JZQA 2H76A 3CXGA 1HYUA 5JWRB 2EIQA 1SYXA 3TCOA 2YJ7A 1N8JA 4NWYA 4BL7A 4GXZA 1O8XA 1ERUA 1GTAA 2IMDA 4G2EA 4HU9A 4HZ4A 1VRSD 4Z2TA 4I6XA 5B6MA 2HRAA 6GSWA 2VM1A 1GSUA 2VL2A 4G0KA 5D96A 2C0EA 3MSZA 5D93A 4MNNA 4IKHA 1M2AA 4HUAA 1Y25A 3UIWA 1GSFA 2P5QA 3ME8A 5DVBA 4MF6A 2V6KA 5G5EA 2D2ZA 1GWCA 2B6MA 2C3TA 1GSSA 2H73A 2NPBA 2F8FA 1Z7PA 4V1Ag 4FO5A 1GUMA 4J56E 5IPGA 2LNSA 1GSDA 4MK3A 3L9SA 2PPTA 4XS1A 4X43A 4IBPA 8GSSA 4OFMA 3G7YA 1FG4A 1JHBA 2HXKA 2L59A 1VF3A 3F6FA 3IK9A 2H74A 1BJXA 1MEKA 2Z9SA 2HT9A 3PPUA 1R26A 3I9V2 4LL1B 5IQYA 2GVPA 3TGZA 2H6YA 1T4ZA 1TK5B 3F4RA 3ZIJA 5HFKA 2CVKA 1SD9A 4MCUA 5CRHA 4TW5A 1F3BA 2X8GA 4WR4A 1XWCA 2HSMA 4KH7A 4L0UA 3A2VA 2PVOC 5ENUA 2LTKA 3UAPA 1XBSA 2O87A 3P7XA 2K9FA 4ICYA 3KMOA 3N9JA 1BAYA 1EWXA 4NPBA 5ID2A 3W8JA 3O6TA 4WKWA 2R2JA 3DEXA 4MH3A 1MDKA 1AQWA 3GIXA 2DMLA 3GKNA 1X5DA 1HNCA 4KDXA 2GTUA 2QA1A 1YEPA 2I1UA 5G1KA 1LJRA 3QAVA 1FOHA 1PL2A 5C04A 3GNJA 5KOXA 1XOBA 1OC3A 1JZDA 1YF0A 4LL4B 1FHEA 1V98A 4DSRA 3K8NA 4I2UA 3KTBA 3WT1A 4OFTA 3QOUA 1M2BA 3CYNA 3MIXA 2DJ0A 4BVXB 1XPVA 4GQFA 1B48A 5DALB 5ECHB 2OBIA 5DAKA 2AAWA 2R0GA 2EC4A 2LEGA 5GSTA 2LQQA 3FR6A 4E8EA 3HXSA 1AUCA 2OKAA 4MF7A 4Q5QA 3VURA 1EOGA 3GX8A 5L71A 1QUWA 4TR1B 2IFQB 2YV9A 4GWRA 1YY7A 1RK4A 2GSTA 5J5NA 4WEYA 3F4TA 3FZ9A 1I5GA 4L8EA 4O5RA 4ZBAA 1A23A 3ERWA 5G1LA 3HVSA 3CMIA 1V58A 6GSUA 5KN0A 1H75A 2A4HA 4MJCA 4RI6A 3FKFA 4YAVA 4G9HA 2VD1A 4DVCA 1MDJA 1YEXA 3C73A 4TR0A 1URMA 4CHSA 1XW6A 3IC4A 1TXXA 3M3MA 2LSTA 1S3DA 4USSA 1B8XA 4HZ2A 4A5PA 2LV3A 4PQHA 3TJBA 5D8IA 1C72A 2YPMA 4BL7B 2LKUA 4HOJA 2QA2A 3R2QA 3W6GA 2GS3A 5E4WA 3H8QA 4HS1A 1QQ2A 1BQ7A 3CRUA 3FK8A 1THOA 2IIYA 3APOA 1Z9HA 1BYEA 4JR4A 1A2LA 3UARA 2WB9A 1A0FA 4YQVA 3ZLPA 2WS2A 1UN2A 5EY6A 2HI7A 5BMUA 4FYCA 3P8WA 4K5SA 4TR3A 1YKAA 5DDLA 4J57E 1SL0B 3ISOA 3IHQA 1PKZA 4EE0A 2X8CA 4ZL7A 3MDKA 1M3JA 1S3RA 2CA8A 4NHWA 5DJMA 1JZOA 2IMEA 1NM3A 3HA9A 2YWIA 3APSA 4MJAA 3CSIA 3Q18A 3E9JB 3QR6A 2LS5A 4YKGA 3HDCA 2X49A 3L4NA 3KGKA 2H1GA 1PSQA 1RQMA 3DIEA 1SENA 2OJLA 2R0CA 2DLXA 4KW6A 1SK2A 3HJOA 4OD7A 2VL3A 1DSBA 1VF2A 2B5YA 2H6ZA 3VWVA 4YAPA 3ERFA 5GZZB 4K2XA 4V1Ap 2OA7A 4CW9A 3HCZA 1OE8A 2B5XA 1O73A 1PKWA 2M46A 2C4JA 1EZKA 5LNKe 1NSWA 3WGXA 4YH2A 1KEBA 2KHPA 1Q4JA 1O6JA 2L6CA 2C3QA 2GZZA 1VF4A 4EVMA 4K7NA 4AF2A 2VIMA 4O32A 3Q74A 2IPAA 4KUNA 3VWUA 3ZZXA 3MWHA 4IN0A 4ZB9A 1TK8B 3J7Yk 4ZBBA 3FHKA 1GLQA 3QDNA 4IGJA 5H5SA 2OACA 2EIRA 4ECBA 2BMXA 1OC9A 1M2DA 2DMMA 1XVWA 1TRVA 4TVEA 3G7IA 4IELA 3UJ1A 6GSXA 3D22A 4MP4A 3EC3A 3UEMA 1XFLA 5DAKB 3KH7A 4F0BA 5COHA 4F2IA 2YOIA 1AAZA 3LYKA 3IHGA 2WZ9A 4XS4A 3F8UA 3TOTA 1ZYEA 3M0FA 1SKRB 5IIZA 2V6OA 5IMVA 4XS6A 4IQAA 2ZCTA 3JCML 2E2MA 2JL4A 2LRNA 20GSA 3TJJA 2QGVA 3GH6A 4F0CA 4HJ2A 1LBKA 2HRFA 1GH2A 4FYBA 3MAKA 1X9WB 3V1WA 2DKHA 4OMVA 1X9SB 7GSSA 2CV4A 2BTOT 4EDZA 2FLSA 5J41A 2JZTA 1SK0A 5LCZA 22GSA 4F82A 3M9JA 3UOMA 2IWTA 4HDEA 2WFCA 4ECJA 2QKEA 1KTEA 4PQIA 5IOWA 3ZVJD 2X8HA 4FIWA 1OKDA 3A5WA 13GSA 4HI7A 1SK1A 1YKCA 2MMZA 5C00A 2DJKA 1ML6A 3H93A 1ZYPA 1USBA 4MZWA 2L5LA 1OYJA 2PVQA 4IS0A 2RM5A 5DBQA 2ZUPA 4MDCA 10GSA 2RM6A 3F6DA 4F03A 4HSCX 4OO4A 5G2ZA 5EVOA 1GUHA 3QFAC 2H66A 3EU3A 4JR6A 1JLVA 4ULXA 1ERWA 4HQZA 4IJIA 4ECCA 2MZCA 4TRXA 2G0FA 4ZB8A 3DVWA 4AJ6A 1V40A 2H8LA 1JZWA 2K8SA 2AJQB 4BWSA 1XVQA 4MMMA 1X5EA 3QFBC 3CQFA 3EWLA 3KP8A 2B1LA 2HZFA 2IMIA 3P2AA 4N10A 3IK7A 2VCVA 3RAZA 2E0QA 16GSA 1ON4A 2RUEA 4MZBA 2B7KA 3KTLA 4GQCA 2GQMA 1TW9A 2VLVA 4GRFA 4GCIA 1HNAA 2V32A 1WRYA 2MBTA 1A2JA 2PBJA 4AJ8A 2GT5A 3VK9A 4KGIA 2OE1A 4NV2A 1XW9A 4KE3A 2CQ9A 2A4VA 3C8EA 1SJZA 5KOWA 1M99A 2NTOA 2HRNA 5JCGA 4IP1A 4MZCA 4PNFA 5D9VA 2L57A 2VAFA 3BCKA 2GGTA 3BCIA 3GA4A 1MD3A 3LSZA 1PQNA 1GL8A 1PX7A 2MMNA 3F63A 2OE0A 5DQYA 2KLXA 2KOKA 2VM2A 2H01A 1O8WA 4RUVA 1Y6EA 2REMA 5HR0A 1G0TA 3FEUA 3UBLA 3MNGA 2YWOA 5A4VA 5J9CA 2H1DA 1OVNA 1VGLA 2I4AA 4OO5A 5AN1A 2B1KA 2TIRA 3LG6A 5ECOB 2P0GA 3HHVA 4PXOA 4V2NA 3U6VA 4TXOA 1WMJA 2K6VA 3EMXA 1GULA 5F05A 5IMAA 1U6TA 1G7EA 4BVYA 1PGTA 1VF1A 5A5KA 3AY8A 3ME7A 3QAWA 4BPYA 2TRXA 4RI7A 1TK0B 3PINA 1J08A 1JFUA 2L4QA 3GSSA 2VLUA 3EYTA 5FWGA 3NZNA 1YZXA 1GSYA 3EU4A 2CZ3A 5JCWA 4Z2RA 4NAXA 3RDWA 3N5OA 5ECIB 1O81A 2F3MA 3R3EA 5DJLA 3RPPA 4DSSB 1LU4A 4K7IA 2PERA 4ISDA 2P31A 2AUVA 5HR2A 2FGXA 4XS4B 5D73A 1QK8A 3RBTA 19GSA 2YNXA 1M3IA 4I97A 4JE1A 3L9UA 5CRGA 4RQRA 4KX4A 1YDKA 4MF5A 2HZEB 1JZRA 1ZZYA 5ECSA 2RIIA 2IN3A 2XHFA 4OFNA 3LYPA 2AB6A 3OR5A 2A2SA 2HE3A 1TRWA 4FH8A 4X0XA 2VO4A 1K0DA 2DKIA 3LJRA 1BG5A 4D73A 1GTUA 3IBHA 2DBCA 3UVTA 3C1SA 1XWAA 3GL5A 4PTSA 1MTCA 4XIHA 3A3TA 1A0RP 1NHYA 2GSSA 3CSJA 1AW9A 1EEJA 3HVNA 4AGSA 4EF0A 3SBCA 5AISA 1EV9A 4N0ZA 2C1YA 4IVFA 5ECNB 2E2GA 3DD3A 3IOSA 4Q5FA 3KIJA 4CY6A 1FAAA 3EE2A 4ZL8A 5G5FA 3ED3A 2FWGA 4PX1A 4JEDA 2CX4A 3H4KA 1PMTA 4K9ZA 4PNGA 1T00A 2FUG2 1OAZA 4K1FA 3GN3A 3DMLA 5CRDA 1M9AA 4QQ7A 4POKA 3TKRA 1EV4A 2LRTA 2R0PA 4FQUA 2ON7A 4Q5RA 1AC1A 2H71A 2DJ2A 3CRTA 1R4WA 5F06A 3RHCA 1T7PB 2TRCP 1DE2A 1B4PA 3UMAA 1KBNA 2R5GA 1SJIA 1NHOA 1TJDA 4NHZA 2ON5A 3UBKA 2LQOA 4ZIJA 5KEJA 3Q19A 4FYUA 1XWKA 2O8VB 2YJHA 1F2EA 3D4TA 1T8EB 4N30A 3H1NA 3KEBA 3LWAA 3M9KA 1K3OA 3GFKA 2YZUA 3LW9A 4KDYA 5D9XA 3GHAA 1R7HA 1E6BA 2FWFA 2JADA 4XTSA 5CYYA 4EUYA 2DJJA
chains in the Genus database with same CATH topology
1GSQA 3KM6A 3DRNA 4KAEA 2GQLA 4I8BA 1G6YA 3IC8A 1GNWA 3LEFA 5HFGA 3GKKA 2J9HA 2WGRA 3LORA 1OC8A 1N2AA 1FVJA 2B5EA 5HR1A 5F8BA 1X9MB 5KN2A 2A2RA 5J3RA 1AXDA 3WGDA 1XWGA 3TKSC 1M9BA 4RQXA 1TOFA 4WF5A 2IMFA 3D6IA 3QAGA 2WJUA 4N0VA 1SL1B 2J23A 2KUCA 4K0GA 1TKDB 2VCXA 4DSQA 2HLSA 2HRKA 5ID2B 4G0LA 3VPTA 1U87A 3ZFLA 5G31A 1SL2B 2MBSA 1F37A 4OWYA 1ACVA 1A2MA 1X5CA 4BVYB 3KXOA 5D9TA 3I43A 1HNBA 2QC7A 1A24A 1ERVA 1XZOA 1QFNA 3GTUA 4OCEA 2CAQA 1EGRA 4MPFA 2H0HA 1F9MA 3H79A 2LRCA 2GDRA 3D0ZA 2LJRA 4E8HA 2AYTA 2R4VA 4YKFA 2VCQA 3EINA 2HSHA 1GTIA 2F9SA 3CTFA 4K7OA 4EIQA 1K3LA 4KCEA 2VL2C 5CRWA 3ZYWA 2R37A 1G7OA 3GMFA 1Z6MA 5IMDA 4JRRA 3MYDA 4EO3A 5B6NA 3A5IA 2EIOA 4EXJA 1G6WA 5BRTA 1K0OA 4GSNA 4BA7A 4GLTA 2JU5A 4ID0A 3ZL5A 2MYGA 5J4UA 2X99A 2H1AA 1Z6NA 1SKWB 4MABA 5ELAA 2FNOA 1TDIA 3D21A 3DGQA 4K0NA 2F51A 2JSZA 2VCTA 2WRTA 1GTBA 2KP1A 1J0FA 3ZMKA 5IOXA 3IAS2 2O7KA 1PN9A 4LMWA 1OE7A 4QL9A 4BVXA 3ZITA 5CNWA 1K0NA 1S3AA 3GRXA 3WD6A 4POLA 2GZPA 4IW9A 1XIYA 5DALA 4KNDA 3KMNA 4IHUA 2I3YA 5ECPB 1TP9A 2CZ2A 5DCHA 3ZRDA 1X0RA 2AHEA 3GL3A 4KA0A 1E2YA 2YZHA 3L9VA 2A2PA 2H75A 3BD2A 4WXTA 2IFQA 2WULA 4EC0A 2UZ8A 3D4MA 4O7HA 1SKSB 1T4YA 3IPZA 3QPMA 1XOAA 1YJ6A 4MJBA 4IQ1A 2C0FA 3EPTA 2PU9C 5F0GA 5JWQB 4LMVA 1XW5A 3TJGA 5ABRA 4MA9A 2F8AA 4J2FA 3FZAA 1GNEA 4DEJA 4V2MA 2DC5A 4K2DA 5HFIA 1FB6A 1GP1A 3DYRA 3O3TA 4PQ1A 2CX3A 1ILOA 2C0DA 4NMUA 3C7MA 5ECMB 2B3SA 4Z2UA 4V2LA 2YANA 1GSEA 5B8BA 3DWVA 1GRXA 3IR4A 3GURA 2O85A 1W4VA 1ABAA 1M7TA 3QMXA 3WT2A 3HZ8A 2H0GA 3G9BA 1FOVA 4GSTA 4YQMA 3HZ4A 3ZTLA 3UVHA 3HD5A 1ZOFA 1WIKA 2K18A 2VCZA 2CVDA 5INYA 17GSA 2JZSA 3BOAA 2OADA 4G19A 3GH9A 2DIYA 2HFDA 3ZMLA 4EL1A 3FY7A 5EL8A 1ZMAA 5H5RA 3HKRA 2NBSA 2JZRA 1Z3EA 4WF4A 1ERTA 1A8LA 1UVZA 2V1MA 4TOPA 3ERGA 1GLPA 1HQOA 1H4OA 1ZGNA 3WGEA 1TI3A 5ECLB 3C71A 1SU9A 2JACA 2H6XA 4HQSA 3IA1A 1S3CA 3DXBA 1XCCA 3TJKA 3GX0A 1TI1A 1M0UA 1XWBA 5IMFA 5KN3A 4K5RA 2L4CA 1PRXA 4KDUA 1WPIA 3CBUA 2LJAA 3U5RE 2L6DA 5AGYA 3F0IA 3ZIVA 3GTUB 1EGOA 5D9WA 5DQSA 1R5PA 4MH2A 2RUFA 2GLRA 1TTZA 2XC2A 2C8UA 3IRAA 3TRQA 1B4QA 2X64A 4KB3A 2E7PA 4ZL9A 1OC9B 2GSQA 3ZREA 4IJ3A 1K0MA 5FT3A 4ZBDA 5IMCA 1J9BA 1U3AA 1MDIA 3O76A 4JBBA 5CREA 3GYKA 5ECKB 1RW1A 2H19A 3J7Yb 3TOUA 5G30A 3VPQA 1WP0A 5ECQB 4KSOA 2N5AA 1ZL9A 4GTUA 3BBYA 2AV4A 1PN0A 2IMKA 1O7UA 2PMTA 4MJEA 3TRPA 1TU8A 2R6KA 1YF1A 1O85A 1BX9A 1EP7A 5AIVA 3GSTA 4WBRD 3DKSA 2ES7A 2DIZA 2PWJA 2M80A 3TRXA 2HSYA 2H72A 2GQKA 2R3XA 3TKSE 3GKMA 3FR9A 3TUEA 2KP2A 2MMOA 4IP6A 2GSRA 4TXVA 4PUFC 5GAND 2MMAA 6GSTA 4MLYA 3QCPA 2QSIA 3VWXA 3IDVA 2VUPA 4HEA2 4ML1A 1BEDA 3KCMA 4K6XA 4L5OA 3F9UA 4POBA 1WWJA 3VI7A 3WYWA 2NVLA 3PR8A 5CP1A 1F3AA 1Z7RA 4HJMA 1PX6A 2IJYA 5IM9A 5EPFA 2YP6A 1TRUA 2IL3A 1U3IA 3F3QA 1K0BA 2WDUA 4Q5NA 5J9BA 1V2AA 3BJ5A 2M72A 5HQPA 5GSSA 3A2XA 1AQXA 5E59A 5ELGA 2YWMA 5IO2A 2VD0A 2VOCA 1ZYQB 3GV1A 4XRDA 1TU7A 1SYRA 3GUSA 3VI5A 2O89A 2L5OA 5AIXA 3A2WA 2DJ3A 3LXZA 2X4AA 1ZCPA 2H1BA 2CT6A 2LJKA 4WETA 4N11A 1DBYA 2P5RA 2C80A 1V9WA 4HU7A 3HY2A 1FB0A 4KSMA 3APQA 1A8YA 3KH9A 1W89A 4KCAA 1K3YA 5IMZA 5IO0A 1ST9A 2FA4A 4GF0A 3QD9A 3FZ5A 3NIVA 4EKZA 3C1RA 2K8VA 3EMPA 2V2GA 5HR3A 2WCIA 1V57A 2H0IA 3LFLA 3P90A 1DE1A 1MD4A 2OE3A 1IYIA 1PL1A 3PH9A 3UL3A 4NV5A 4BWQA 1AQVA 5CO3A 1XXUA 2C0GA 3NOFA 3EURA 4I2TA 3HVXA 4K8MA 3CSHA 3I6AA 2FHEA 3HYPA 4G10A 3VWWA 4L5LA 6GSVA 3M8NA 3M1GA 3CTGA 1THXA 1WE0A 1WOUA 2YV7A 5JWOB 5FHIA 12GSA 4Z7XA 4TR4A 2XBIA 3F3RA 2YCDA 1QGVA 3FYGA 4X4JA 1FVKA 4ACSA 2YWNA 2PGTA 3TB2A 2FWEA 1K0AA 3E0UA 4O92A 1PA3A 3HVVA 2FY6A 1TRSA 3KD0A 4AJ7A 4ZILA 5LD0A 1B9YC 18GSA 2BJXA 4WR5A 3F4SA 2FA8A 3HJPA 3IXRA 4ECIA 3TJFA 4TXOB 1PD21 2PUKC 4KF9A 1U88A 3TDGA 2CVBA 3IAM2 5A4WA 6GSYA 4ML6A 1GUKA 2DSAA 2RLIA 1DUGA 3FRCA 1IYHA 2FWHA 3VFIA 2I81A 2N5BA 2H30A 3DVXA 3GKXA 4GSSA 4LA1A 2C3NA 1EEMA 2ZNMA 3FW2A 4EDYA 1OKTA 1F6MC 4PGTA 3FZ4A 3HJMA 4LLRA 5JCUA 3FMWA 5CAXA 2PN8A 1B9XC 4MPGA 3S9FA 4QL7A 3PGTA 2LNTA 2G2QA 2VL9A 3ZVJA 2NDOA 4JU5A 2DJ1A 2FCHA 3SWLA 5B8AA 5F07A 3LGCA 4ZB6A 3I69A 3RHBA 3LXTA 1I9DA 1K0CA 4X1UA 4XCSA 3Q6OA 1FO5A 1R5AA 3W8SA 3E3EA 2XBQA 3L78A 1QXHA 1HD2A 1T1VA 2ALBA 4PURA 1CQHA 2N5FA 4TN8A 3G7JA 3IV4A 4XHMA 2GZYA 5GAPD 1SJ6A 2I9HA 2GT6A 1UA5A 5H5QA 4DSSA 1SD8A 2HYXA 4D73B 3ZFBA 5IPHA 4F9ZA 11GSA 3IE3A 3EVIA 2XPDA 3VLNA 3KP9A 4OCFA 1T3BA 2H70A 2B7JA 1JLWA 2CAIA 1NW2A 4YQUA 4G0IA 2YN1A 1ZYNA 4CDOA 3D5JA 3TKSA 4PUAA 1CQGA 2VCWA 3LQ7A 2HZEA 2JSYA 1YQ1A 4WBJA 2FD3A 1WJKA 3KZQA 4POMA 4H86A 1EP8A 3L0HA 5A4UA 2HNLA 4L0WA 4P3YB 3US3A 2XPEA 1FW1A 3KJYA 14GSA 1KNGA 1Z5YE 4TR1A 1UC7A 4O5UA 4O5QA 9GSSA 4ZXGA 2OBKA 1Q98A 4ILFA 6GSSA 5B7CA 4CY8A 2V41A 3TKQA 3FR3A 5DCGA 4NXIA 4TKYA 2LUSA 5KN1A 3RPNA 1EOHA 1QMVA 4EIPA 2VLTA 4I5QA 3TKPA 1AIUA 5ECRB 4XRAA 4JZQA 2H76A 3CXGA 1HYUA 5JWRB 2EIQA 1SYXA 3TCOA 2YJ7A 1N8JA 4NWYA 4BL7A 4GXZA 1O8XA 1ERUA 1GTAA 2IMDA 4G2EA 4HU9A 4HZ4A 1VRSD 4Z2TA 4I6XA 5B6MA 2HRAA 6GSWA 2VM1A 1GSUA 2VL2A 4G0KA 5D96A 2C0EA 3MSZA 5D93A 4MNNA 4IKHA 1M2AA 4HUAA 1Y25A 3UIWA 1GSFA 2P5QA 3ME8A 5DVBA 4MF6A 2V6KA 5G5EA 2D2ZA 1GWCA 2B6MA 2C3TA 1GSSA 2H73A 2NPBA 2F8FA 1Z7PA 4V1Ag 4FO5A 1GUMA 4J56E 5IPGA 2LNSA 1GSDA 4MK3A 3L9SA 2PPTA 4XS1A 4X43A 4IBPA 8GSSA 4OFMA 3G7YA 1FG4A 1JHBA 2HXKA 2L59A 1VF3A 3F6FA 3IK9A 2H74A 1BJXA 1MEKA 2Z9SA 2HT9A 3PPUA 1R26A 3I9V2 4LL1B 5IQYA 2GVPA 3TGZA 2H6YA 1T4ZA 1TK5B 3F4RA 3ZIJA 5HFKA 2CVKA 1SD9A 4MCUA 5CRHA 4TW5A 1F3BA 2X8GA 4WR4A 1XWCA 2HSMA 4KH7A 4L0UA 3A2VA 2PVOC 5ENUA 2LTKA 3UAPA 1XBSA 2O87A 3P7XA 2K9FA 4ICYA 3KMOA 3N9JA 1BAYA 1EWXA 4NPBA 5ID2A 3W8JA 3O6TA 4WKWA 2R2JA 3DEXA 4MH3A 1MDKA 1AQWA 3GIXA 2DMLA 3GKNA 1X5DA 1HNCA 4KDXA 2GTUA 2QA1A 1YEPA 2I1UA 5G1KA 1LJRA 3QAVA 1FOHA 1PL2A 5C04A 3GNJA 5KOXA 1XOBA 1OC3A 1JZDA 1YF0A 4LL4B 1FHEA 1V98A 4DSRA 3K8NA 4I2UA 3KTBA 3WT1A 4OFTA 3QOUA 1M2BA 3CYNA 3MIXA 2DJ0A 4BVXB 1XPVA 4GQFA 1B48A 5DALB 5ECHB 2OBIA 5DAKA 2AAWA 2R0GA 2EC4A 2LEGA 5GSTA 2LQQA 3FR6A 4E8EA 3HXSA 1AUCA 2OKAA 4MF7A 4Q5QA 3VURA 1EOGA 3GX8A 5L71A 1QUWA 4TR1B 2IFQB 2YV9A 4GWRA 1YY7A 1RK4A 2GSTA 5J5NA 4WEYA 3F4TA 3FZ9A 1I5GA 4L8EA 4O5RA 4ZBAA 1A23A 3ERWA 5G1LA 3HVSA 3CMIA 1V58A 6GSUA 5KN0A 1H75A 2A4HA 4MJCA 4RI6A 3FKFA 4YAVA 4G9HA 2VD1A 4DVCA 1YEXA 1MDJA 3C73A 4TR0A 1URMA 4CHSA 1XW6A 3IC4A 1TXXA 3M3MA 2LSTA 1S3DA 4USSA 1B8XA 4HZ2A 4A5PA 2LV3A 4PQHA 3TJBA 5D8IA 1C72A 2YPMA 4BL7B 2LKUA 4HOJA 2QA2A 3R2QA 3W6GA 2GS3A 5E4WA 3H8QA 4HS1A 1QQ2A 1BQ7A 3CRUA 3FK8A 1THOA 2IIYA 3APOA 1Z9HA 1BYEA 4JR4A 1A2LA 3UARA 2WB9A 1A0FA 4YQVA 3ZLPA 2WS2A 1UN2A 5EY6A 2HI7A 5BMUA 4FYCA 3P8WA 4K5SA 4TR3A 1YKAA 5DDLA 4J57E 1SL0B 3ISOA 3IHQA 1PKZA 4EE0A 2X8CA 4ZL7A 3MDKA 2CA8A 4NHWA 5DJMA 1JZOA 2IMEA 1NM3A 3HA9A 2YWIA 3APSA 4MJAA 3CSIA 3Q18A 3E9JB 3QR6A 2LS5A 4YKGA 3HDCA 2X49A 3L4NA 3KGKA 2H1GA 1PSQA 1RQMA 3DIEA 1SENA 2OJLA 2R0CA 2DLXA 4KW6A 1SK2A 3HJOA 4OD7A 2VL3A 1DSBA 1VF2A 2B5YA 2H6ZA 3VWVA 4YAPA 3ERFA 5GZZB 4K2XA 4V1Ap 2OA7A 4CW9A 3HCZA 1OE8A 2B5XA 1O73A 1PKWA 2M46A 2C4JA 1EZKA 5LNKe 1NSWA 3WGXA 4YH2A 1KEBA 2KHPA 1Q4JA 1O6JA 2L6CA 2C3QA 2GZZA 1VF4A 4EVMA 4K7NA 4AF2A 2VIMA 4O32A 3Q74A 2IPAA 4KUNA 3VWUA 3ZZXA 3MWHA 4IN0A 4ZB9A 1TK8B 3J7Yk 4ZBBA 3FHKA 1GLQA 3QDNA 4IGJA 5H5SA 2OACA 2EIRA 4ECBA 2BMXA 1OC9A 1M2DA 2DMMA 1XVWA 1TRVA 4TVEA 3G7IA 4IELA 3UJ1A 6GSXA 3D22A 4MP4A 3EC3A 3UEMA 1XFLA 5DAKB 3KH7A 4F0BA 5COHA 4F2IA 2YOIA 1AAZA 3LYKA 3IHGA 2WZ9A 4XS4A 3F8UA 3TOTA 1ZYEA 3M0FA 1SKRB 5IIZA 2V6OA 5IMVA 4XS6A 4IQAA 2ZCTA 3JCML 2E2MA 2JL4A 2LRNA 20GSA 3TJJA 2QGVA 3GH6A 4F0CA 4HJ2A 1LBKA 2HRFA 1GH2A 4FYBA 3MAKA 1X9WB 3V1WA 2DKHA 4OMVA 1X9SB 7GSSA 2CV4A 2BTOT 4EDZA 2FLSA 5J41A 2JZTA 1SK0A 5LCZA 22GSA 4F82A 3M9JA 3UOMA 2IWTA 4HDEA 2WFCA 4ECJA 2QKEA 1KTEA 4PQIA 5IOWA 3ZVJD 2X8HA 4FIWA 1OKDA 3A5WA 13GSA 4HI7A 1SK1A 1YKCA 2MMZA 5C00A 2DJKA 1ML6A 3H93A 1ZYPA 1USBA 4MZWA 2L5LA 1OYJA 2PVQA 4IS0A 2RM5A 5DBQA 2ZUPA 4MDCA 10GSA 2RM6A 3F6DA 4F03A 4OO4A 5G2ZA 5EVOA 1GUHA 3QFAC 2H66A 3EU3A 4JR6A 1JLVA 4ULXA 1ERWA 4HQZA 4IJIA 4ECCA 2MZCA 4TRXA 2G0FA 4ZB8A 3DVWA 4AJ6A 1V40A 2H8LA 1JZWA 2K8SA 2AJQB 4BWSA 1XVQA 4MMMA 1X5EA 3QFBC 3EWLA 3KP8A 2B1LA 2HZFA 2IMIA 3P2AA 4N10A 3IK7A 2VCVA 3RAZA 2E0QA 16GSA 1ON4A 2RUEA 4MZBA 2B7KA 3KTLA 4GQCA 2GQMA 1TW9A 2VLVA 4GRFA 4GCIA 1HNAA 2V32A 1WRYA 2MBTA 1A2JA 2PBJA 4AJ8A 2GT5A 3VK9A 4KGIA 2OE1A 4NV2A 1XW9A 4KE3A 2CQ9A 2A4VA 3C8EA 1SJZA 5KOWA 1M99A 2NTOA 2HRNA 5JCGA 4IP1A 4MZCA 4PNFA 5D9VA 2L57A 2VAFA 3BCKA 2GGTA 3BCIA 3GA4A 1MD3A 3LSZA 1PQNA 1GL8A 1PX7A 2MMNA 3F63A 2OE0A 5DQYA 2KLXA 2KOKA 2VM2A 2H01A 1O8WA 4RUVA 1Y6EA 2REMA 5HR0A 1G0TA 3FEUA 3UBLA 3MNGA 2YWOA 5A4VA 5J9CA 2H1DA 1OVNA 1VGLA 2I4AA 4OO5A 5AN1A 2B1KA 2TIRA 3LG6A 5ECOB 2P0GA 3HHVA 4PXOA 4V2NA 3U6VA 4TXOA 1WMJA 2K6VA 3EMXA 1GULA 5F05A 5IMAA 1U6TA 1G7EA 4BVYA 1PGTA 1VF1A 5A5KA 3AY8A 3ME7A 3QAWA 4BPYA 2TRXA 4RI7A 1TK0B 3PINA 1J08A 1JFUA 2L4QA 3GSSA 2VLUA 3EYTA 5FWGA 3NZNA 1YZXA 1GSYA 3EU4A 2CZ3A 5JCWA 4Z2RA 4NAXA 3RDWA 3N5OA 5ECIB 1O81A 2F3MA 3R3EA 5DJLA 3RPPA 4DSSB 1LU4A 4K7IA 2PERA 4ISDA 2P31A 2AUVA 5HR2A 2FGXA 4XS4B 5D73A 1QK8A 3RBTA 19GSA 2YNXA 4I97A 4JE1A 3L9UA 5CRGA 4RQRA 4KX4A 1YDKA 4MF5A 2HZEB 1JZRA 1ZZYA 5ECSA 2RIIA 2IN3A 2XHFA 4OFNA 3LYPA 2AB6A 3OR5A 2A2SA 2HE3A 1TRWA 4FH8A 4X0XA 2VO4A 1K0DA 2DKIA 3LJRA 1BG5A 4D73A 1GTUA 3IBHA 2DBCA 3UVTA 3C1SA 1XWAA 3GL5A 4PTSA 1MTCA 4XIHA 3A3TA 1A0RP 1NHYA 2GSSA 3CSJA 1AW9A 1EEJA 4AGSA 4EF0A 3SBCA 5AISA 1EV9A 4N0ZA 2C1YA 4IVFA 5ECNB 2E2GA 3DD3A 3IOSA 4Q5FA 3KIJA 4CY6A 1FAAA 3EE2A 4ZL8A 5G5FA 3ED3A 2FWGA 4PX1A 4JEDA 2CX4A 3H4KA 1PMTA 4K9ZA 4PNGA 1T00A 2FUG2 1OAZA 4K1FA 3GN3A 3DMLA 5CRDA 1M9AA 4QQ7A 4POKA 3TKRA 1EV4A 2LRTA 2R0PA 4FQUA 2ON7A 4Q5RA 1AC1A 2H71A 2DJ2A 3CRTA 1R4WA 5F06A 3RHCA 1T7PB 2TRCP 1DE2A 1B4PA 3UMAA 1KBNA 2R5GA 1SJIA 1NHOA 1TJDA 4NHZA 2ON5A 3UBKA 2LQOA 4ZIJA 5KEJA 3Q19A 4FYUA 1XWKA 2O8VB 2YJHA 1F2EA 3D4TA 1T8EB 4N30A 3H1NA 3KEBA 3LWAA 3M9KA 1K3OA 3GFKA 2YZUA 3LW9A 4KDYA 5D9XA 3GHAA 1R7HA 1E6BA 2FWFA 2JADA 4XTSA 5CYYA 4EUYA 2DJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSQ A;  3KM6 A;  3DRN A;  4KAE A;  2GQL A;  4I8B A;  1G6Y A;  1GNW A;  3LEF A;  5HFG A;  3GKK A;  2J9H A;  2WGR A;  3LOR A;  1OC8 A;  1N2A A;  1FVJ A;  2B5E A;  5HR1 A;  5F8B A;  1X9M B;  5KN2 A;  2A2R A;  5J3R A;  1AXD A;  3WGD A;  1XWG A;  3TKS C;  1M9B A;  4RQX A;  1TOF A;  4WF5 A;  2IMF A;  3D6I A;  3QAG A;  2WJU A;  4N0V A;  1SL1 B;  2J23 A;  2KUC A;  4K0G A;  1TKD B;  2VCX A;  4DSQ A;  2HLS A;  5ID2 B;  3VPT A;  1U87 A;  3ZFL A;  5G31 A;  1SL2 B;  2MBS A;  1F37 A;  4OWY A;  1ACV A;  1A2M A;  1X5C A;  3KXO A;  5D9T A;  3I43 A;  1HNB A;  2QC7 A;  1A24 A;  1ERV A;  1XZO A;  1QFN A;  3GTU A;  4OCE A;  2CAQ A;  1EGR A;  4MPF A;  2H0H A;  1F9M A;  3H79 A;  2LRC A;  2GDR A;  3D0Z A;  2LJR A;  4E8H A;  2AYT A;  2R4V A;  2VCQ A;  3EIN A;  2HSH A;  1GTI A;  2F9S A;  3CTF A;  4K7O A;  1K3L A;  4KCE A;  2VL2 C;  5CRW A;  3ZYW A;  2R37 A;  1G7O A;  3GMF A;  1Z6M A;  5IMD A;  4JRR A;  4EO3 A;  5B6N A;  2EIO A;  4EXJ A;  1G6W A;  1K0O A;  4GSN A;  4BA7 A;  4GLT A;  2JU5 A;  4ID0 A;  3ZL5 A;  2MYG A;  5J4U A;  2X99 A;  2H1A A;  1Z6N A;  1SKW B;  4MAB A;  5ELA A;  2FNO A;  1TDI A;  3D21 A;  3DGQ A;  4K0N A;  2F51 A;  2JSZ A;  2VCT A;  2WRT A;  1GTB A;  2KP1 A;  1J0F A;  3ZMK A;  5IOX A;  3IAS 2;  2O7K A;  1PN9 A;  4LMW A;  1OE7 A;  4QL9 A;  4BVX A;  3ZIT A;  5CNW A;  1K0N A;  1S3A A;  3GRX A;  3WD6 A;  4POL A;  2GZP A;  4IW9 A;  1XIY A;  5DAL A;  4KND A;  3KMN A;  4IHU A;  2I3Y A;  5ECP B;  1TP9 A;  2CZ2 A;  5DCH A;  3ZRD A;  1X0R A;  2AHE A;  3GL3 A;  4KA0 A;  1E2Y A;  2YZH A;  3L9V A;  2H75 A;  3BD2 A;  4WXT A;  2IFQ A;  2WUL A;  4EC0 A;  3D4M A;  4O7H A;  1SKS B;  1T4Y A;  3IPZ A;  3QPM A;  1XOA A;  1YJ6 A;  4MJB A;  4IQ1 A;  2C0F A;  5F0G A;  2PU9 C;  5JWQ B;  4LMV A;  1XW5 A;  3TJG A;  5ABR A;  4MA9 A;  2F8A A;  4J2F A;  3FZA A;  1GNE A;  4DEJ A;  4V2M A;  2DC5 A;  4K2D A;  5HFI A;  1FB6 A;  1GP1 A;  3DYR A;  3O3T A;  4PQ1 A;  2CX3 A;  1ILO A;  2C0D A;  4NMU A;  3C7M A;  5ECM B;  2B3S A;  4V2L A;  2YAN A;  1GSE A;  5B8B A;  3DWV A;  1GRX A;  3IR4 A;  3GUR A;  2O85 A;  1W4V A;  1ABA A;  1M7T A;  3QMX A;  3WT2 A;  3HZ8 A;  2H0G A;  3G9B A;  1FOV A;  4GST A;  4YQM A;  3HZ4 A;  3ZTL A;  3UVH A;  3HD5 A;  1ZOF A;  1WIK A;  2K18 A;  2VCZ A;  2CVD A;  5INY A;  17GS A;  2JZS A;  3BOA A;  2OAD A;  4G19 A;  3GH9 A;  2DIY A;  2HFD A;  3ZML A;  4EL1 A;  3FY7 A;  5EL8 A;  1ZMA A;  5H5R A;  3HKR A;  2NBS A;  2JZR A;  1Z3E A;  4WF4 A;  1ERT A;  1A8L A;  1UVZ A;  2V1M A;  4TOP A;  3ERG A;  1GLP A;  1HQO A;  1H4O A;  1ZGN A;  3WGE A;  1TI3 A;  5ECL B;  3C71 A;  1SU9 A;  2JAC A;  2H6X A;  4HQS A;  3IA1 A;  1S3C A;  3DXB A;  1XCC A;  3TJK A;  3GX0 A;  1TI1 A;  1M0U A;  1XWB A;  5IMF A;  5KN3 A;  2L4C A;  1PRX A;  4KDU A;  1WPI A;  3CBU A;  2LJA A;  3U5R E;  2L6D A;  5AGY A;  3F0I A;  3ZIV A;  3GTU B;  1EGO A;  5D9W A;  5DQS A;  1R5P A;  4MH2 A;  2RUF A;  2GLR A;  1TTZ A;  2XC2 A;  2C8U A;  3IRA A;  3TRQ A;  1B4Q A;  2X64 A;  4KB3 A;  2E7P A;  4ZL9 A;  1OC9 B;  2GSQ A;  3ZRE A;  4IJ3 A;  1K0M A;  5FT3 A;  4ZBD A;  5IMC A;  1J9B A;  1U3A A;  1MDI A;  3O76 A;  4JBB A;  5CRE A;  3GYK A;  5ECK B;  1RW1 A;  2H19 A;  3J7Y b;  3TOU A;  5G30 A;  3VPQ A;  1WP0 A;  5ECQ B;  4KSO A;  2N5A A;  1ZL9 A;  4GTU A;  3BBY A;  2AV4 A;  2IMK A;  1O7U A;  2PMT A;  4MJE A;  3TRP A;  1TU8 A;  2R6K A;  1YF1 A;  1O85 A;  1BX9 A;  1EP7 A;  5AIV A;  3GST A;  4WBR D;  3DKS A;  2ES7 A;  2DIZ A;  2PWJ A;  2M80 A;  3TRX A;  2HSY A;  2H72 A;  2GQK A;  2R3X A;  3TKS E;  3GKM A;  3FR9 A;  3TUE A;  2KP2 A;  2MMO A;  4IP6 A;  2GSR A;  4TXV A;  4PUF C;  5GAN D;  2MMA A;  6GST A;  4MLY A;  3QCP A;  2QSI A;  3VWX A;  3IDV A;  2VUP A;  4HEA 2;  4ML1 A;  1BED A;  3KCM A;  4K6X A;  4L5O A;  3F9U A;  4POB A;  1WWJ A;  3VI7 A;  3WYW A;  2NVL A;  3PR8 A;  5CP1 A;  1F3A A;  1Z7R A;  4HJM A;  1PX6 A;  2IJY A;  5IM9 A;  5EPF A;  2YP6 A;  1TRU A;  2IL3 A;  1U3I A;  3F3Q A;  1K0B A;  2WDU A;  4Q5N A;  5J9B A;  1V2A A;  3BJ5 A;  2M72 A;  5HQP A;  5GSS A;  3A2X A;  1AQX A;  5E59 A;  5ELG A;  2YWM A;  5IO2 A;  2VD0 A;  2VOC A;  1ZYQ B;  3GV1 A;  4XRD A;  1TU7 A;  1SYR A;  3GUS A;  3VI5 A;  2O89 A;  2L5O A;  5AIX A;  3A2W A;  2DJ3 A;  3LXZ A;  1ZCP A;  2H1B A;  2CT6 A;  2LJK A;  4WET A;  4N11 A;  1DBY A;  2P5R A;  2C80 A;  1V9W A;  4HU7 A;  3HY2 A;  1FB0 A;  4KSM A;  3APQ A;  1A8Y A;  3KH9 A;  1W89 A;  4KCA A;  1K3Y A;  5IMZ A;  5IO0 A;  1ST9 A;  2FA4 A;  4GF0 A;  3QD9 A;  3FZ5 A;  3NIV A;  4EKZ A;  3C1R A;  2K8V A;  3EMP A;  2V2G A;  5HR3 A;  2WCI A;  1V57 A;  2H0I A;  3LFL A;  3P90 A;  1DE1 A;  1MD4 A;  2OE3 A;  1IYI A;  1PL1 A;  3PH9 A;  3UL3 A;  4NV5 A;  4BWQ A;  1AQV A;  5CO3 A;  1XXU A;  2C0G A;  3NOF A;  3EUR A;  4I2T A;  3HVX A;  4K8M A;  3CSH A;  3I6A A;  2FHE A;  3HYP A;  4G10 A;  3VWW A;  4L5L A;  6GSV A;  3M8N A;  3M1G A;  3CTG A;  1THX A;  1WE0 A;  1WOU A;  2YV7 A;  5JWO B;  5FHI A;  12GS A;  4Z7X A;  4TR4 A;  2XBI A;  3F3R A;  2YCD A;  1QGV A;  3FYG A;  1FVK A;  4ACS A;  2YWN A;  2PGT A;  3TB2 A;  2FWE A;  1K0A A;  3E0U A;  4O92 A;  1PA3 A;  3HVV A;  2FY6 A;  1TRS A;  3KD0 A;  4AJ7 A;  4ZIL A;  5LD0 A;  1B9Y C;  18GS A;  2BJX A;  4WR5 A;  3F4S A;  2FA8 A;  3HJP A;  3IXR A;  4ECI A;  3TJF A;  4TXO B;  1PD2 1;  2PUK C;  1U88 A;  3TDG A;  2CVB A;  3IAM 2;  5A4W A;  6GSY A;  4ML6 A;  1GUK A;  2DSA A;  2RLI A;  1DUG A;  3FRC A;  1IYH A;  2FWH A;  3VFI A;  2I81 A;  2N5B A;  2H30 A;  3DVX A;  3GKX A;  4GSS A;  4LA1 A;  2C3N A;  1EEM A;  2ZNM A;  3FW2 A;  4EDY A;  1OKT A;  1F6M C;  4PGT A;  3FZ4 A;  3HJM A;  4LLR A;  5JCU A;  5CAX A;  2PN8 A;  1B9X C;  4MPG A;  3S9F A;  4QL7 A;  3PGT A;  2LNT A;  2G2Q A;  2VL9 A;  3ZVJ A;  2NDO A;  4JU5 A;  2DJ1 A;  2FCH A;  3SWL A;  5B8A A;  5F07 A;  3LGC A;  4ZB6 A;  3I69 A;  3RHB A;  3LXT A;  1I9D A;  1K0C A;  4X1U A;  4XCS A;  3Q6O A;  1FO5 A;  1R5A A;  3W8S A;  3E3E A;  2XBQ A;  3L78 A;  1QXH A;  1HD2 A;  1T1V A;  2ALB A;  4PUR A;  1CQH A;  2N5F A;  4TN8 A;  3G7J A;  3IV4 A;  4XHM A;  2GZY A;  5GAP D;  1SJ6 A;  2I9H A;  2GT6 A;  1UA5 A;  5H5Q A;  4DSS A;  1SD8 A;  2HYX A;  4D73 B;  3ZFB A;  5IPH A;  4F9Z A;  11GS A;  3IE3 A;  3EVI A;  2XPD A;  3VLN A;  3KP9 A;  4OCF A;  1T3B A;  2H70 A;  2B7J A;  1JLW A;  2CAI A;  1NW2 A;  4YQU A;  2YN1 A;  4CDO A;  3D5J A;  3TKS A;  4PUA A;  1CQG A;  2VCW A;  3LQ7 A;  2HZE A;  2JSY A;  1YQ1 A;  4WBJ A;  2FD3 A;  1WJK A;  3KZQ A;  4POM A;  4H86 A;  1EP8 A;  3L0H A;  5A4U A;  2HNL A;  4L0W A;  4P3Y B;  3US3 A;  2XPE A;  1FW1 A;  3KJY A;  14GS A;  1KNG A;  1Z5Y E;  4TR1 A;  1UC7 A;  9GSS A;  4ZXG A;  2OBK A;  1Q98 A;  4ILF A;  6GSS A;  5B7C A;  2V41 A;  3TKQ A;  3FR3 A;  5DCG A;  4NXI A;  4TKY A;  2LUS A;  5KN1 A;  3RPN A;  1EOH A;  1QMV A;  2VLT A;  4I5Q A;  3TKP A;  5ECR B;  1AIU A;  4XRA A;  4JZQ A;  2H76 A;  3CXG A;  1HYU A;  5JWR B;  2EIQ A;  1SYX A;  3TCO A;  2YJ7 A;  1N8J A;  4NWY A;  4BL7 A;  4GXZ A;  1O8X A;  1ERU A;  1GTA A;  2IMD A;  4G2E A;  4HU9 A;  4HZ4 A;  1VRS D;  4I6X A;  5B6M A;  6GSW A;  2VM1 A;  1GSU A;  2VL2 A;  5D96 A;  2C0E A;  3MSZ A;  5D93 A;  4IKH A;  1M2A A;  4HUA A;  1Y25 A;  3UIW A;  1GSF A;  2P5Q A;  3ME8 A;  5DVB A;  4MF6 A;  2V6K A;  5G5E A;  2D2Z A;  1GWC A;  2B6M A;  2C3T A;  1GSS A;  2H73 A;  2NPB A;  2F8F A;  1Z7P A;  4V1A g;  4FO5 A;  1GUM A;  4J56 E;  5IPG A;  2LNS A;  1GSD A;  4MK3 A;  3L9S A;  2PPT A;  4XS1 A;  4X43 A;  4IBP A;  8GSS A;  4OFM A;  3G7Y A;  1FG4 A;  1JHB A;  2HXK A;  2L59 A;  1VF3 A;  3F6F A;  3IK9 A;  2H74 A;  1BJX A;  1MEK A;  2Z9S A;  2HT9 A;  1R26 A;  3I9V 2;  4LL1 B;  5IQY A;  2GVP A;  3TGZ A;  2H6Y A;  1T4Z A;  1TK5 B;  3F4R A;  3ZIJ A;  5HFK A;  2CVK A;  1SD9 A;  4MCU A;  5CRH A;  4TW5 A;  1F3B A;  2X8G A;  4WR4 A;  1XWC A;  4KH7 A;  4L0U A;  3A2V A;  2PVO C;  5ENU A;  2LTK A;  3UAP A;  1XBS A;  2O87 A;  3P7X A;  2K9F A;  3KMO A;  3N9J A;  1BAY A;  1EWX A;  4NPB A;  5ID2 A;  3W8J A;  3O6T A;  4WKW A;  2R2J A;  3DEX A;  4MH3 A;  1MDK A;  1AQW A;  3GIX A;  2DML A;  3GKN A;  1X5D A;  1HNC A;  4KDX A;  2GTU A;  1YEP A;  2I1U A;  5G1K A;  1LJR A;  3QAV A;  1PL2 A;  5C04 A;  3GNJ A;  1XOB A;  1OC3 A;  1JZD A;  1YF0 A;  4LL4 B;  1FHE A;  1V98 A;  4DSR A;  3K8N A;  4I2U A;  3KTB A;  3WT1 A;  4OFT A;  3QOU A;  1M2B A;  3CYN A;  2DJ0 A;  1XPV A;  4GQF A;  1B48 A;  5DAL B;  5ECH B;  2OBI A;  5DAK A;  2AAW A;  2EC4 A;  2LEG A;  5GST A;  2LQQ A;  3FR6 A;  4E8E A;  3HXS A;  1AUC A;  2OKA A;  4MF7 A;  4Q5Q A;  3VUR A;  1EOG A;  3GX8 A;  5L71 A;  1QUW A;  4TR1 B;  2IFQ B;  2YV9 A;  4GWR A;  1YY7 A;  1RK4 A;  2GST A;  5J5N A;  4WEY A;  3F4T A;  3FZ9 A;  1I5G A;  4L8E A;  4O5R A;  4ZBA A;  1A23 A;  3ERW A;  5G1L A;  3HVS A;  3CMI A;  1V58 A;  6GSU A;  5KN0 A;  1H75 A;  4MJC A;  4RI6 A;  3FKF A;  4YAV A;  4G9H A;  2VD1 A;  4DVC A;  1YEX A;  1MDJ A;  3C73 A;  4TR0 A;  1URM A;  4CHS A;  1XW6 A;  3IC4 A;  1TXX A;  3M3M A;  2LST A;  1S3D A;  1B8X A;  4HZ2 A;  2LV3 A;  4PQH A;  3TJB A;  5D8I A;  1C72 A;  2YPM A;  2LKU A;  4HOJ A;  3R2Q A;  3W6G A;  2GS3 A;  5E4W A;  3H8Q A;  4HS1 A;  1QQ2 A;  1BQ7 A;  3CRU A;  3FK8 A;  1THO A;  2IIY A;  3APO A;  1Z9H A;  1BYE A;  4JR4 A;  1A2L A;  3UAR A;  2WB9 A;  1A0F A;  4YQV A;  3ZLP A;  2WS2 A;  1UN2 A;  5EY6 A;  2HI7 A;  4FYC A;  3P8W A;  4TR3 A;  1YKA A;  5DDL A;  4J57 E;  1SL0 B;  3ISO A;  3IHQ A;  1PKZ A;  4EE0 A;  2X8C A;  4ZL7 A;  3MDK A;  2CA8 A;  4NHW A;  5DJM A;  1JZO A;  2IME A;  1NM3 A;  3HA9 A;  2YWI A;  3APS A;  4MJA A;  3CSI A;  3Q18 A;  3E9J B;  3QR6 A;  2LS5 A;  3HDC A;  3L4N A;  3KGK A;  2H1G A;  1PSQ A;  1RQM A;  3DIE A;  1SEN A;  2OJL A;  2DLX A;  4KW6 A;  1SK2 A;  3HJO A;  4OD7 A;  2VL3 A;  1DSB A;  1VF2 A;  2B5Y A;  2H6Z A;  3VWV A;  4YAP A;  3ERF A;  5GZZ B;  4V1A p;  2OA7 A;  4CW9 A;  3HCZ A;  1OE8 A;  2B5X A;  1O73 A;  1PKW A;  2M46 A;  2C4J A;  1EZK A;  5LNK e;  1NSW A;  3WGX A;  4YH2 A;  1KEB A;  2KHP A;  1Q4J A;  1O6J A;  2L6C A;  2C3Q A;  2GZZ A;  1VF4 A;  4EVM A;  4K7N A;  4AF2 A;  2VIM A;  4O32 A;  3Q74 A;  2IPA A;  4KUN A;  3VWU A;  3ZZX A;  3MWH A;  4IN0 A;  4ZB9 A;  1TK8 B;  3J7Y k;  4ZBB A;  3FHK A;  1GLQ A;  3QDN A;  4IGJ A;  5H5S A;  2OAC A;  2EIR A;  4ECB A;  2BMX A;  1OC9 A;  1M2D A;  2DMM A;  1XVW A;  1TRV A;  4TVE A;  3G7I A;  4IEL A;  3UJ1 A;  6GSX A;  3D22 A;  4MP4 A;  3EC3 A;  3UEM A;  1XFL A;  5DAK B;  3KH7 A;  4F0B A;  5COH A;  4F2I A;  2YOI A;  1AAZ A;  3LYK A;  2WZ9 A;  4XS4 A;  3F8U A;  3TOT A;  1ZYE A;  3M0F A;  1SKR B;  5IIZ A;  2V6O A;  5IMV A;  4XS6 A;  4IQA A;  2ZCT A;  3JCM L;  2E2M A;  2JL4 A;  2LRN A;  20GS A;  3TJJ A;  2QGV A;  3GH6 A;  4F0C A;  4HJ2 A;  1LBK A;  2HRF A;  1GH2 A;  4FYB A;  3MAK A;  1X9W B;  3V1W A;  4OMV A;  1X9S B;  7GSS A;  2CV4 A;  2BTO T;  4EDZ A;  2FLS A;  5J41 A;  2JZT A;  1SK0 A;  5LCZ A;  22GS A;  4F82 A;  3M9J A;  3UOM A;  2IWT A;  4HDE A;  2WFC A;  4ECJ A;  2QKE A;  1KTE A;  4PQI A;  5IOW A;  3ZVJ D;  2X8H A;  4FIW A;  1OKD A;  3A5W A;  13GS A;  4HI7 A;  1SK1 A;  1YKC A;  2MMZ A;  5C00 A;  2DJK A;  1ML6 A;  3H93 A;  1USB A;  4MZW A;  2L5L A;  1OYJ A;  2PVQ A;  4IS0 A;  2RM5 A;  5DBQ A;  2ZUP A;  4MDC A;  10GS A;  2RM6 A;  3F6D A;  4F03 A;  4OO4 A;  5G2Z A;  5EVO A;  1GUH A;  3QFA C;  2H66 A;  3EU3 A;  4JR6 A;  1JLV A;  4ULX A;  1ERW A;  4HQZ A;  4IJI A;  4ECC A;  2MZC A;  4TRX A;  2G0F A;  4ZB8 A;  3DVW A;  4AJ6 A;  1V40 A;  2H8L A;  1JZW A;  2K8S A;  2AJQ B;  4BWS A;  1XVQ A;  4MMM A;  1X5E A;  3QFB C;  3EWL A;  3KP8 A;  2B1L A;  2HZF A;  2IMI A;  3P2A A;  4N10 A;  3IK7 A;  2VCV A;  3RAZ A;  2E0Q A;  16GS A;  1ON4 A;  2RUE A;  4MZB A;  2B7K A;  3KTL A;  4GQC A;  2GQM A;  1TW9 A;  2VLV A;  4GRF A;  4GCI A;  1HNA A;  2V32 A;  1WRY A;  2MBT A;  1A2J A;  2PBJ A;  4AJ8 A;  2GT5 A;  3VK9 A;  4KGI A;  2OE1 A;  4NV2 A;  1XW9 A;  4KE3 A;  2CQ9 A;  2A4V A;  3C8E A;  1SJZ A;  1M99 A;  2NTO A;  2HRN A;  5JCG A;  4IP1 A;  4MZC A;  4PNF A;  5D9V A;  2L57 A;  2VAF A;  3BCK A;  2GGT A;  3BCI A;  3GA4 A;  1MD3 A;  3LSZ A;  1PQN A;  1GL8 A;  1PX7 A;  2MMN A;  3F63 A;  2OE0 A;  5DQY A;  2KLX A;  2KOK A;  2VM2 A;  2H01 A;  1O8W A;  4RUV A;  1Y6E A;  2REM A;  5HR0 A;  1G0T A;  3FEU A;  3UBL A;  3MNG A;  2YWO A;  5A4V A;  5J9C A;  2H1D A;  1OVN A;  1VGL A;  2I4A A;  4OO5 A;  5AN1 A;  2B1K A;  2TIR A;  3LG6 A;  5ECO B;  2P0G A;  3HHV A;  4PXO A;  4V2N A;  3U6V A;  4TXO A;  1WMJ A;  2K6V A;  3EMX A;  1GUL A;  5F05 A;  5IMA A;  1U6T A;  1G7E A;  4BVY A;  1PGT A;  1VF1 A;  5A5K A;  3AY8 A;  3ME7 A;  3QAW A;  4BPY A;  2TRX A;  4RI7 A;  1TK0 B;  3PIN A;  1J08 A;  1JFU A;  2L4Q A;  3GSS A;  2VLU A;  3EYT A;  5FWG A;  3NZN A;  1YZX A;  1GSY A;  3EU4 A;  2CZ3 A;  5JCW A;  4NAX A;  3RDW A;  3N5O A;  5ECI B;  1O81 A;  2F3M A;  5DJL A;  3RPP A;  4DSS B;  1LU4 A;  4K7I A;  2PER A;  4ISD A;  2P31 A;  2AUV A;  5HR2 A;  2FGX A;  4XS4 B;  5D73 A;  1QK8 A;  3RBT A;  19GS A;  2YNX A;  4I97 A;  4JE1 A;  3L9U A;  5CRG A;  4RQR A;  4KX4 A;  1YDK A;  4MF5 A;  2HZE B;  1JZR A;  1ZZY A;  5ECS A;  2RII A;  2IN3 A;  2XHF A;  4OFN A;  3LYP A;  2AB6 A;  3OR5 A;  2A2S A;  2HE3 A;  1TRW A;  4FH8 A;  4X0X A;  2VO4 A;  1K0D A;  3LJR A;  1BG5 A;  4D73 A;  1GTU A;  3IBH A;  2DBC A;  3UVT A;  3C1S A;  1XWA A;  3GL5 A;  1MTC A;  4XIH A;  3A3T A;  1A0R P;  1NHY A;  2GSS A;  3CSJ A;  1AW9 A;  1EEJ A;  4AGS A;  4EF0 A;  3SBC A;  5AIS A;  1EV9 A;  4N0Z A;  2C1Y A;  4IVF A;  5ECN B;  2E2G A;  3DD3 A;  3IOS A;  4Q5F A;  3KIJ A;  1FAA A;  3EE2 A;  4ZL8 A;  5G5F A;  3ED3 A;  2FWG A;  4PX1 A;  4JED A;  2CX4 A;  3H4K A;  1PMT A;  4K9Z A;  4PNG A;  1T00 A;  2FUG 2;  1OAZ A;  4K1F A;  3GN3 A;  3DML A;  5CRD A;  1M9A A;  4QQ7 A;  4POK A;  3TKR A;  1EV4 A;  2LRT A;  2ON7 A;  4Q5R A;  1AC1 A;  2H71 A;  2DJ2 A;  3CRT A;  1R4W A;  5F06 A;  3RHC A;  1T7P B;  2TRC P;  1DE2 A;  1B4P A;  3UMA A;  1KBN A;  2R5G A;  1SJI A;  1NHO A;  1TJD A;  4NHZ A;  2ON5 A;  3UBK A;  2LQO A;  4ZIJ A;  5KEJ A;  3Q19 A;  4FYU A;  1XWK A;  2O8V B;  2YJH A;  1F2E A;  3D4T A;  1T8E B;  4N30 A;  3H1N A;  3KEB A;  3LWA A;  3M9K A;  1K3O A;  3GFK A;  2YZU A;  4KDY A;  5D9X A;  3GHA A;  1R7H A;  1E6B A;  2FWF A;  2JAD A;  4XTS A;  5CYY A;  4EUY A;  2DJJ A; 
#chains in the Genus database with same CATH topology
 1GSQ A;  3KM6 A;  3DRN A;  4KAE A;  2GQL A;  4I8B A;  1G6Y A;  3IC8 A;  1GNW A;  3LEF A;  5HFG A;  3GKK A;  2J9H A;  2WGR A;  3LOR A;  1OC8 A;  1N2A A;  1FVJ A;  2B5E A;  5HR1 A;  5F8B A;  1X9M B;  5KN2 A;  2A2R A;  5J3R A;  1AXD A;  3WGD A;  1XWG A;  3TKS C;  1M9B A;  4RQX A;  1TOF A;  4WF5 A;  2IMF A;  3D6I A;  3QAG A;  2WJU A;  4N0V A;  1SL1 B;  2J23 A;  2KUC A;  4K0G A;  1TKD B;  2VCX A;  4DSQ A;  2HLS A;  2HRK A;  5ID2 B;  4G0L A;  3VPT A;  1U87 A;  3ZFL A;  5G31 A;  1SL2 B;  2MBS A;  1F37 A;  4OWY A;  1ACV A;  1A2M A;  1X5C A;  4BVY B;  3KXO A;  5D9T A;  3I43 A;  1HNB A;  2QC7 A;  1A24 A;  1ERV A;  1XZO A;  1QFN A;  3GTU A;  4OCE A;  2CAQ A;  1EGR A;  4MPF A;  2H0H A;  1F9M A;  3H79 A;  2LRC A;  2GDR A;  3D0Z A;  2LJR A;  4E8H A;  2AYT A;  2R4V A;  4YKF A;  2VCQ A;  3EIN A;  2HSH A;  1GTI A;  2F9S A;  3CTF A;  4K7O A;  4EIQ A;  1K3L A;  4KCE A;  2VL2 C;  5CRW A;  3ZYW A;  2R37 A;  1G7O A;  3GMF A;  1Z6M A;  5IMD A;  4JRR A;  3MYD A;  4EO3 A;  5B6N A;  3A5I A;  2EIO A;  4EXJ A;  1G6W A;  5BRT A;  1K0O A;  4GSN A;  4BA7 A;  4GLT A;  2JU5 A;  4ID0 A;  3ZL5 A;  2MYG A;  5J4U A;  2X99 A;  2H1A A;  1Z6N A;  1SKW B;  4MAB A;  5ELA A;  2FNO A;  1TDI A;  3D21 A;  3DGQ A;  4K0N A;  2F51 A;  2JSZ A;  2VCT A;  2WRT A;  1GTB A;  2KP1 A;  1J0F A;  3ZMK A;  5IOX A;  3IAS 2;  2O7K A;  1PN9 A;  4LMW A;  1OE7 A;  4QL9 A;  4BVX A;  3ZIT A;  5CNW A;  1K0N A;  1S3A A;  3GRX A;  3WD6 A;  4POL A;  2GZP A;  4IW9 A;  1XIY A;  5DAL A;  4KND A;  3KMN A;  4IHU A;  2I3Y A;  5ECP B;  1TP9 A;  2CZ2 A;  5DCH A;  3ZRD A;  1X0R A;  2AHE A;  3GL3 A;  4KA0 A;  1E2Y A;  2YZH A;  3L9V A;  2A2P A;  2H75 A;  3BD2 A;  4WXT A;  2IFQ A;  2WUL A;  4EC0 A;  2UZ8 A;  3D4M A;  4O7H A;  1SKS B;  1T4Y A;  3IPZ A;  3QPM A;  1XOA A;  1YJ6 A;  4MJB A;  4IQ1 A;  2C0F A;  3EPT A;  2PU9 C;  5F0G A;  5JWQ B;  4LMV A;  1XW5 A;  3TJG A;  5ABR A;  4MA9 A;  2F8A A;  4J2F A;  3FZA A;  1GNE A;  4DEJ A;  4V2M A;  2DC5 A;  4K2D A;  5HFI A;  1FB6 A;  1GP1 A;  3DYR A;  3O3T A;  4PQ1 A;  2CX3 A;  1ILO A;  2C0D A;  4NMU A;  3C7M A;  5ECM B;  2B3S A;  4Z2U A;  4V2L A;  2YAN A;  1GSE A;  5B8B A;  3DWV A;  1GRX A;  3IR4 A;  3GUR A;  2O85 A;  1W4V A;  1ABA A;  1M7T A;  3QMX A;  3WT2 A;  3HZ8 A;  2H0G A;  3G9B A;  1FOV A;  4GST A;  4YQM A;  3HZ4 A;  3ZTL A;  3UVH A;  3HD5 A;  1ZOF A;  1WIK A;  2K18 A;  2VCZ A;  2CVD A;  5INY A;  17GS A;  2JZS A;  3BOA A;  2OAD A;  4G19 A;  3GH9 A;  2DIY A;  2HFD A;  3ZML A;  4EL1 A;  3FY7 A;  5EL8 A;  1ZMA A;  5H5R A;  3HKR A;  2NBS A;  2JZR A;  1Z3E A;  4WF4 A;  1ERT A;  1A8L A;  1UVZ A;  2V1M A;  4TOP A;  3ERG A;  1GLP A;  1HQO A;  1H4O A;  1ZGN A;  3WGE A;  1TI3 A;  5ECL B;  3C71 A;  1SU9 A;  2JAC A;  2H6X A;  4HQS A;  3IA1 A;  1S3C A;  3DXB A;  1XCC A;  3TJK A;  3GX0 A;  1TI1 A;  1M0U A;  1XWB A;  5IMF A;  5KN3 A;  4K5R A;  2L4C A;  1PRX A;  4KDU A;  1WPI A;  3CBU A;  2LJA A;  3U5R E;  2L6D A;  5AGY A;  3F0I A;  3ZIV A;  3GTU B;  1EGO A;  1PFO A;  5D9W A;  5DQS A;  1R5P A;  4MH2 A;  2RUF A;  2GLR A;  1TTZ A;  2XC2 A;  2C8U A;  3IRA A;  3TRQ A;  1B4Q A;  2X64 A;  4KB3 A;  2E7P A;  4ZL9 A;  1OC9 B;  2GSQ A;  3ZRE A;  4IJ3 A;  1K0M A;  5FT3 A;  4ZBD A;  5IMC A;  1J9B A;  1U3A A;  1MDI A;  3O76 A;  4JBB A;  5CRE A;  3GYK A;  5ECK B;  1RW1 A;  2H19 A;  3J7Y b;  3TOU A;  5G30 A;  3VPQ A;  1WP0 A;  5ECQ B;  4KSO A;  2N5A A;  1ZL9 A;  4GTU A;  3BBY A;  2AV4 A;  1PN0 A;  2IMK A;  1O7U A;  2PMT A;  4MJE A;  3TRP A;  1TU8 A;  2R6K A;  1YF1 A;  1O85 A;  1BX9 A;  1EP7 A;  5AIV A;  3GST A;  4WBR D;  3DKS A;  2ES7 A;  2DIZ A;  2PWJ A;  2M80 A;  3TRX A;  2HSY A;  2H72 A;  2GQK A;  2R3X A;  3TKS E;  3GKM A;  3FR9 A;  3TUE A;  2KP2 A;  2MMO A;  4IP6 A;  2GSR A;  4TXV A;  4PUF C;  5GAN D;  2MMA A;  6GST A;  4MLY A;  3QCP A;  2QSI A;  3VWX A;  3IDV A;  2VUP A;  4HEA 2;  4ML1 A;  1BED A;  3KCM A;  4K6X A;  4L5O A;  3F9U A;  4POB A;  1WWJ A;  3VI7 A;  3WYW A;  2NVL A;  3PR8 A;  5CP1 A;  1F3A A;  1Z7R A;  4HJM A;  1PX6 A;  2IJY A;  5IM9 A;  5EPF A;  2YP6 A;  1TRU A;  2IL3 A;  1U3I A;  3F3Q A;  1K0B A;  2WDU A;  4Q5N A;  5J9B A;  1V2A A;  3BJ5 A;  2M72 A;  5HQP A;  5GSS A;  3A2X A;  1AQX A;  5E59 A;  5ELG A;  2YWM A;  5IO2 A;  2VD0 A;  2VOC A;  1ZYQ B;  3GV1 A;  4XRD A;  1TU7 A;  1SYR A;  3GUS A;  3VI5 A;  2O89 A;  2L5O A;  5AIX A;  3A2W A;  2DJ3 A;  3LXZ A;  2X4A A;  1ZCP A;  2H1B A;  2CT6 A;  2LJK A;  4WET A;  4N11 A;  1DBY A;  2P5R A;  2C80 A;  1V9W A;  4HU7 A;  3HY2 A;  1FB0 A;  4KSM A;  3APQ A;  1A8Y A;  3KH9 A;  1W89 A;  4KCA A;  1K3Y A;  5IMZ A;  5IO0 A;  1ST9 A;  2FA4 A;  4GF0 A;  3QD9 A;  3FZ5 A;  3NIV A;  4BIK A;  4EKZ A;  3C1R A;  2K8V A;  3EMP A;  2V2G A;  5HR3 A;  2WCI A;  1V57 A;  2H0I A;  3LFL A;  3P90 A;  1DE1 A;  1MD4 A;  2OE3 A;  1IYI A;  1PL1 A;  3PH9 A;  3UL3 A;  4NV5 A;  4BWQ A;  1AQV A;  5CO3 A;  1XXU A;  2C0G A;  3NOF A;  3EUR A;  4I2T A;  3HVX A;  4K8M A;  3CSH A;  3I6A A;  2FHE A;  3HYP A;  4G10 A;  3VWW A;  4L5L A;  6GSV A;  3M8N A;  3M1G A;  3CTG A;  1THX A;  1WE0 A;  1WOU A;  2YV7 A;  5JWO B;  5FHI A;  12GS A;  4Z7X A;  4TR4 A;  2XBI A;  3F3R A;  2YCD A;  1QGV A;  3FYG A;  4X4J A;  1FVK A;  4ACS A;  2YWN A;  2PGT A;  3TB2 A;  2FWE A;  1K0A A;  3E0U A;  4O92 A;  1PA3 A;  3HVV A;  2FY6 A;  1TRS A;  3KD0 A;  4AJ7 A;  4ZIL A;  5LD0 A;  1B9Y C;  18GS A;  2BJX A;  4WR5 A;  3F4S A;  2FA8 A;  3HJP A;  3IXR A;  4ECI A;  3TJF A;  4TXO B;  1PD2 1;  2PUK C;  4KF9 A;  1U88 A;  3TDG A;  2CVB A;  3IAM 2;  5A4W A;  6GSY A;  4ML6 A;  1GUK A;  2DSA A;  2RLI A;  1DUG A;  3FRC A;  1IYH A;  2FWH A;  3VFI A;  2I81 A;  2N5B A;  2H30 A;  3DVX A;  3GKX A;  4GSS A;  4LA1 A;  2C3N A;  1EEM A;  2ZNM A;  3FW2 A;  4EDY A;  1OKT A;  1F6M C;  4PGT A;  3FZ4 A;  3HJM A;  4LLR A;  5JCU A;  3FMW A;  5CAX A;  2PN8 A;  1B9X C;  1XG8 A;  4MPG A;  3S9F A;  4QL7 A;  3PGT A;  2LNT A;  2G2Q A;  2VL9 A;  3ZVJ A;  2NDO A;  4JU5 A;  2DJ1 A;  2FCH A;  3SWL A;  5B8A A;  5F07 A;  3LGC A;  4ZB6 A;  3I69 A;  3RHB A;  3LXT A;  1I9D A;  1K0C A;  4X1U A;  4XCS A;  3Q6O A;  1FO5 A;  1R5A A;  3W8S A;  3E3E A;  2XBQ A;  3L78 A;  1QXH A;  1HD2 A;  1T1V A;  2ALB A;  4PUR A;  1CQH A;  2N5F A;  4TN8 A;  3G7J A;  3IV4 A;  4XHM A;  2GZY A;  5GAP D;  1SJ6 A;  2I9H A;  2GT6 A;  1UA5 A;  5H5Q A;  4DSS A;  1SD8 A;  2HYX A;  4D73 B;  3ZFB A;  5IPH A;  4F9Z A;  11GS A;  3IE3 A;  3EVI A;  2XPD A;  3VLN A;  3KP9 A;  4OCF A;  1T3B A;  2H70 A;  2B7J A;  1JLW A;  2CAI A;  1NW2 A;  4YQU A;  4G0I A;  2YN1 A;  1ZYN A;  4CDO A;  3D5J A;  3TKS A;  4PUA A;  1CQG A;  2VCW A;  3LQ7 A;  2HZE A;  2JSY A;  1YQ1 A;  4WBJ A;  2FD3 A;  1WJK A;  3KZQ A;  4POM A;  4H86 A;  1EP8 A;  3L0H A;  5A4U A;  2HNL A;  4L0W A;  4P3Y B;  3US3 A;  2XPE A;  1FW1 A;  3KJY A;  14GS A;  1KNG A;  1Z5Y E;  4TR1 A;  1UC7 A;  4O5U A;  4O5Q A;  9GSS A;  4ZXG A;  2OBK A;  1Q98 A;  4ILF A;  6GSS A;  5B7C A;  4CY8 A;  2V41 A;  3TKQ A;  3FR3 A;  5DCG A;  4NXI A;  4TKY A;  2LUS A;  5KN1 A;  3RPN A;  1EOH A;  1QMV A;  4EIP A;  2VLT A;  4I5Q A;  3TKP A;  1AIU A;  5ECR B;  4XRA A;  4JZQ A;  2H76 A;  3CXG A;  1HYU A;  5JWR B;  2EIQ A;  1SYX A;  3TCO A;  2YJ7 A;  1N8J A;  4NWY A;  4BL7 A;  4GXZ A;  1O8X A;  1ERU A;  1GTA A;  2IMD A;  4G2E A;  4HU9 A;  4HZ4 A;  1VRS D;  4Z2T A;  4I6X A;  5B6M A;  2HRA A;  6GSW A;  2VM1 A;  1GSU A;  2VL2 A;  4G0K A;  5D96 A;  2C0E A;  3MSZ A;  5D93 A;  4MNN A;  4IKH A;  1M2A A;  4HUA A;  1Y25 A;  3UIW A;  1GSF A;  2P5Q A;  3ME8 A;  5DVB A;  4MF6 A;  2V6K A;  5G5E A;  2D2Z A;  1GWC A;  2B6M A;  2C3T A;  1GSS A;  2H73 A;  2NPB A;  2F8F A;  1Z7P A;  4V1A g;  4FO5 A;  1GUM A;  4J56 E;  5IPG A;  2LNS A;  1GSD A;  4MK3 A;  3L9S A;  2PPT A;  4XS1 A;  4X43 A;  4IBP A;  8GSS A;  4OFM A;  3G7Y A;  1FG4 A;  1JHB A;  2HXK A;  2L59 A;  1VF3 A;  3F6F A;  3IK9 A;  2H74 A;  1BJX A;  1MEK A;  2Z9S A;  2HT9 A;  3PPU A;  1R26 A;  3I9V 2;  4LL1 B;  5IQY A;  2GVP A;  3TGZ A;  2H6Y A;  1T4Z A;  1TK5 B;  3F4R A;  3ZIJ A;  5HFK A;  2CVK A;  1SD9 A;  4MCU A;  5CRH A;  4TW5 A;  1F3B A;  2X8G A;  4WR4 A;  1XWC A;  2HSM A;  4KH7 A;  4L0U A;  3A2V A;  2PVO C;  5ENU A;  2LTK A;  3UAP A;  1XBS A;  2O87 A;  3P7X A;  2K9F A;  4ICY A;  3KMO A;  3N9J A;  1BAY A;  1EWX A;  4NPB A;  5ID2 A;  3W8J A;  3O6T A;  4WKW A;  2R2J A;  3DEX A;  4MH3 A;  1MDK A;  1AQW A;  3GIX A;  2DML A;  3GKN A;  1X5D A;  1HNC A;  4KDX A;  2GTU A;  2QA1 A;  1YEP A;  2I1U A;  5G1K A;  1LJR A;  3QAV A;  1FOH A;  1PL2 A;  5C04 A;  3GNJ A;  5KOX A;  1XOB A;  1OC3 A;  1JZD A;  1YF0 A;  4LL4 B;  1FHE A;  1V98 A;  4DSR A;  3K8N A;  4I2U A;  3KTB A;  3WT1 A;  4OFT A;  3QOU A;  1M2B A;  3CYN A;  3MIX A;  2DJ0 A;  4BVX B;  1XPV A;  4GQF A;  1B48 A;  5DAL B;  5ECH B;  2OBI A;  5DAK A;  2AAW A;  2R0G A;  2EC4 A;  2LEG A;  5GST A;  2LQQ A;  3FR6 A;  4E8E A;  3HXS A;  1AUC A;  2OKA A;  4MF7 A;  4Q5Q A;  3VUR A;  1EOG A;  3GX8 A;  5L71 A;  1QUW A;  4TR1 B;  2IFQ B;  2YV9 A;  4GWR A;  1YY7 A;  1RK4 A;  2GST A;  5J5N A;  4WEY A;  3F4T A;  3FZ9 A;  1I5G A;  4L8E A;  4O5R A;  4ZBA A;  1A23 A;  3ERW A;  5G1L A;  3HVS A;  3CMI A;  1V58 A;  6GSU A;  5KN0 A;  1H75 A;  2A4H A;  4MJC A;  4RI6 A;  3FKF A;  4YAV A;  4G9H A;  2VD1 A;  4DVC A;  1MDJ A;  1YEX A;  3C73 A;  4TR0 A;  1URM A;  4CHS A;  1XW6 A;  3IC4 A;  1TXX A;  3M3M A;  2LST A;  1S3D A;  4USS A;  1B8X A;  4HZ2 A;  4A5P A;  2LV3 A;  4PQH A;  3TJB A;  5D8I A;  1C72 A;  2YPM A;  4BL7 B;  2LKU A;  4HOJ A;  2QA2 A;  3R2Q A;  3W6G A;  2GS3 A;  5E4W A;  3H8Q A;  4HS1 A;  1QQ2 A;  1BQ7 A;  3CRU A;  3FK8 A;  1THO A;  2IIY A;  3APO A;  1Z9H A;  1BYE A;  4JR4 A;  1A2L A;  3UAR A;  2WB9 A;  1A0F A;  4YQV A;  3ZLP A;  2WS2 A;  1UN2 A;  5EY6 A;  2HI7 A;  5BMU A;  4FYC A;  3P8W A;  4K5S A;  4TR3 A;  1YKA A;  5DDL A;  4J57 E;  1SL0 B;  3ISO A;  3IHQ A;  1PKZ A;  4EE0 A;  2X8C A;  4ZL7 A;  3MDK A;  1M3J A;  1S3R A;  2CA8 A;  4NHW A;  5DJM A;  1JZO A;  2IME A;  1NM3 A;  3HA9 A;  2YWI A;  3APS A;  4MJA A;  3CSI A;  3Q18 A;  3E9J B;  3QR6 A;  2LS5 A;  4YKG A;  3HDC A;  2X49 A;  3L4N A;  3KGK A;  2H1G A;  1PSQ A;  1RQM A;  3DIE A;  1SEN A;  2OJL A;  2R0C A;  2DLX A;  4KW6 A;  1SK2 A;  3HJO A;  4OD7 A;  2VL3 A;  1DSB A;  1VF2 A;  2B5Y A;  2H6Z A;  3VWV A;  4YAP A;  3ERF A;  5GZZ B;  4K2X A;  4V1A p;  2OA7 A;  4CW9 A;  3HCZ A;  1OE8 A;  2B5X A;  1O73 A;  1PKW A;  2M46 A;  2C4J A;  1EZK A;  5LNK e;  1NSW A;  3WGX A;  4YH2 A;  1KEB A;  2KHP A;  1Q4J A;  1O6J A;  2L6C A;  2C3Q A;  2GZZ A;  1VF4 A;  4EVM A;  4K7N A;  4AF2 A;  2VIM A;  4O32 A;  3Q74 A;  2IPA A;  4KUN A;  3VWU A;  3ZZX A;  3MWH A;  4IN0 A;  4ZB9 A;  1TK8 B;  3J7Y k;  4ZBB A;  3FHK A;  1GLQ A;  3QDN A;  4IGJ A;  5H5S A;  2OAC A;  2EIR A;  4ECB A;  2BMX A;  1OC9 A;  1M2D A;  2DMM A;  1XVW A;  1TRV A;  4TVE A;  3G7I A;  4IEL A;  3UJ1 A;  6GSX A;  3D22 A;  4MP4 A;  3EC3 A;  3UEM A;  1XFL A;  5DAK B;  3KH7 A;  4F0B A;  5COH A;  4F2I A;  2YOI A;  1AAZ A;  3LYK A;  3IHG A;  2WZ9 A;  4XS4 A;  3F8U A;  3TOT A;  1ZYE A;  3M0F A;  1SKR B;  5IIZ A;  2V6O A;  5IMV A;  4XS6 A;  4IQA A;  2ZCT A;  3JCM L;  2E2M A;  2JL4 A;  2LRN A;  20GS A;  3TJJ A;  2QGV A;  3GH6 A;  4F0C A;  4HJ2 A;  1LBK A;  2HRF A;  1GH2 A;  4FYB A;  3MAK A;  1X9W B;  3V1W A;  2DKH A;  4OMV A;  1X9S B;  7GSS A;  2CV4 A;  2BTO T;  4EDZ A;  2FLS A;  5J41 A;  2JZT A;  1SK0 A;  5LCZ A;  22GS A;  4F82 A;  3M9J A;  3UOM A;  2IWT A;  4HDE A;  2WFC A;  4ECJ A;  2QKE A;  1KTE A;  4PQI A;  5IOW A;  3ZVJ D;  2X8H A;  4FIW A;  1OKD A;  3A5W A;  13GS A;  4HI7 A;  1SK1 A;  1YKC A;  2MMZ A;  5C00 A;  2DJK A;  1ML6 A;  3H93 A;  1ZYP A;  1USB A;  4MZW A;  2L5L A;  1OYJ A;  2PVQ A;  4IS0 A;  2RM5 A;  5DBQ A;  2ZUP A;  4MDC A;  10GS A;  2RM6 A;  3F6D A;  4F03 A;  4HSC X;  4OO4 A;  5G2Z A;  5EVO A;  1GUH A;  3QFA C;  2H66 A;  3EU3 A;  4JR6 A;  1JLV A;  4ULX A;  1ERW A;  4HQZ A;  4IJI A;  4ECC A;  2MZC A;  4TRX A;  2G0F A;  4ZB8 A;  3DVW A;  4AJ6 A;  1V40 A;  2H8L A;  1JZW A;  2K8S A;  2AJQ B;  4BWS A;  1XVQ A;  4MMM A;  1X5E A;  3QFB C;  3CQF A;  3EWL A;  3KP8 A;  2B1L A;  2HZF A;  2IMI A;  3P2A A;  4N10 A;  3IK7 A;  2VCV A;  3RAZ A;  2E0Q A;  16GS A;  1ON4 A;  2RUE A;  4MZB A;  2B7K A;  3KTL A;  4GQC A;  2GQM A;  1TW9 A;  2VLV A;  4GRF A;  4GCI A;  1HNA A;  2V32 A;  1WRY A;  2MBT A;  1A2J A;  2PBJ A;  4AJ8 A;  2GT5 A;  3VK9 A;  4KGI A;  2OE1 A;  4NV2 A;  1XW9 A;  4KE3 A;  2CQ9 A;  2A4V A;  3C8E A;  1SJZ A;  5KOW A;  1M99 A;  2NTO A;  2HRN A;  5JCG A;  4IP1 A;  4MZC A;  4PNF A;  5D9V A;  2L57 A;  2VAF A;  3BCK A;  2GGT A;  3BCI A;  3GA4 A;  1MD3 A;  3LSZ A;  1PQN A;  1GL8 A;  1PX7 A;  2MMN A;  3F63 A;  2OE0 A;  5DQY A;  2KLX A;  2KOK A;  2VM2 A;  2H01 A;  1O8W A;  4RUV A;  1Y6E A;  2REM A;  5HR0 A;  1G0T A;  3FEU A;  3UBL A;  3MNG A;  2YWO A;  5A4V A;  5J9C A;  2H1D A;  1OVN A;  1VGL A;  2I4A A;  4OO5 A;  5AN1 A;  2B1K A;  2TIR A;  3LG6 A;  5ECO B;  2P0G A;  3HHV A;  4PXO A;  4V2N A;  3U6V A;  4TXO A;  1WMJ A;  2K6V A;  3EMX A;  1GUL A;  5F05 A;  5IMA A;  1U6T A;  1G7E A;  4BVY A;  1PGT A;  1VF1 A;  5A5K A;  3AY8 A;  3ME7 A;  3QAW A;  4BPY A;  2TRX A;  4RI7 A;  1TK0 B;  3PIN A;  1J08 A;  1JFU A;  2L4Q A;  3GSS A;  2VLU A;  3EYT A;  5FWG A;  3NZN A;  1YZX A;  1GSY A;  3EU4 A;  2CZ3 A;  5JCW A;  4Z2R A;  4NAX A;  3RDW A;  3N5O A;  5ECI B;  1O81 A;  2F3M A;  3R3E A;  5DJL A;  3RPP A;  4DSS B;  1LU4 A;  4K7I A;  2PER A;  4ISD A;  2P31 A;  2AUV A;  5HR2 A;  2FGX A;  4XS4 B;  5D73 A;  1QK8 A;  3RBT A;  19GS A;  2YNX A;  1M3I A;  4I97 A;  4JE1 A;  3L9U A;  5CRG A;  4RQR A;  4KX4 A;  1YDK A;  4MF5 A;  2HZE B;  1JZR A;  1ZZY A;  5ECS A;  2RII A;  2IN3 A;  2XHF A;  4OFN A;  3LYP A;  2AB6 A;  3OR5 A;  2A2S A;  2HE3 A;  1TRW A;  4FH8 A;  4X0X A;  2VO4 A;  1K0D A;  2DKI A;  3LJR A;  1BG5 A;  4D73 A;  1GTU A;  3IBH A;  2DBC A;  3UVT A;  3C1S A;  1XWA A;  3GL5 A;  4PTS A;  1MTC A;  4XIH A;  3A3T A;  1A0R P;  1NHY A;  2GSS A;  3CSJ A;  1AW9 A;  1EEJ A;  3HVN A;  4AGS A;  4EF0 A;  3SBC A;  5AIS A;  1EV9 A;  4N0Z A;  2C1Y A;  4IVF A;  5ECN B;  2E2G A;  3DD3 A;  3IOS A;  4Q5F A;  3KIJ A;  4CY6 A;  1FAA A;  3EE2 A;  4ZL8 A;  5G5F A;  3ED3 A;  2FWG A;  4PX1 A;  4JED A;  2CX4 A;  3H4K A;  1PMT A;  4K9Z A;  4PNG A;  1T00 A;  2FUG 2;  1OAZ A;  4K1F A;  3GN3 A;  3DML A;  5CRD A;  1M9A A;  4QQ7 A;  4POK A;  3TKR A;  1EV4 A;  2LRT A;  2R0P A;  4FQU A;  2ON7 A;  4Q5R A;  1AC1 A;  2H71 A;  2DJ2 A;  3CRT A;  1R4W A;  5F06 A;  3RHC A;  1T7P B;  2TRC P;  1DE2 A;  1B4P A;  3UMA A;  1KBN A;  2R5G A;  1SJI A;  1NHO A;  1TJD A;  4NHZ A;  2ON5 A;  3UBK A;  2LQO A;  4ZIJ A;  5KEJ A;  3Q19 A;  4FYU A;  1XWK A;  2O8V B;  2YJH A;  1F2E A;  3D4T A;  1T8E B;  4N30 A;  3H1N A;  3KEB A;  3LWA A;  3M9K A;  1K3O A;  3GFK A;  2YZU A;  3LW9 A;  4KDY A;  5D9X A;  3GHA A;  1R7H A;  1E6B A;  2FWF A;  2JAD A;  4XTS A;  5CYY A;  4EUY A;  2DJJ A; 
#chains in the Genus database with same CATH homology
 1GSQ A;  3KM6 A;  3DRN A;  4KAE A;  2GQL A;  4I8B A;  1G6Y A;  3IC8 A;  1GNW A;  3LEF A;  5HFG A;  3GKK A;  2J9H A;  2WGR A;  3LOR A;  1OC8 A;  1N2A A;  1FVJ A;  2B5E A;  5HR1 A;  5F8B A;  1X9M B;  5KN2 A;  2A2R A;  5J3R A;  1AXD A;  3WGD A;  1XWG A;  3TKS C;  1M9B A;  4RQX A;  1TOF A;  4WF5 A;  2IMF A;  3D6I A;  3QAG A;  2WJU A;  4N0V A;  1SL1 B;  2J23 A;  2KUC A;  4K0G A;  1TKD B;  2VCX A;  4DSQ A;  2HLS A;  2HRK A;  5ID2 B;  4G0L A;  3VPT A;  1U87 A;  3ZFL A;  5G31 A;  1SL2 B;  2MBS A;  1F37 A;  4OWY A;  1ACV A;  1A2M A;  1X5C A;  4BVY B;  3KXO A;  5D9T A;  3I43 A;  1HNB A;  2QC7 A;  1A24 A;  1ERV A;  1XZO A;  1QFN A;  3GTU A;  4OCE A;  2CAQ A;  1EGR A;  4MPF A;  2H0H A;  1F9M A;  3H79 A;  2LRC A;  2GDR A;  3D0Z A;  2LJR A;  4E8H A;  2AYT A;  2R4V A;  4YKF A;  2VCQ A;  3EIN A;  2HSH A;  1GTI A;  2F9S A;  3CTF A;  4K7O A;  4EIQ A;  1K3L A;  4KCE A;  2VL2 C;  5CRW A;  3ZYW A;  2R37 A;  1G7O A;  3GMF A;  1Z6M A;  5IMD A;  4JRR A;  3MYD A;  4EO3 A;  5B6N A;  3A5I A;  2EIO A;  4EXJ A;  1G6W A;  5BRT A;  1K0O A;  4GSN A;  4BA7 A;  4GLT A;  2JU5 A;  4ID0 A;  3ZL5 A;  2MYG A;  5J4U A;  2X99 A;  2H1A A;  1Z6N A;  1SKW B;  4MAB A;  5ELA A;  2FNO A;  1TDI A;  3D21 A;  3DGQ A;  4K0N A;  2F51 A;  2JSZ A;  2VCT A;  2WRT A;  1GTB A;  2KP1 A;  1J0F A;  3ZMK A;  5IOX A;  3IAS 2;  2O7K A;  1PN9 A;  4LMW A;  1OE7 A;  4QL9 A;  4BVX A;  3ZIT A;  5CNW A;  1K0N A;  1S3A A;  3GRX A;  3WD6 A;  4POL A;  2GZP A;  4IW9 A;  1XIY A;  5DAL A;  4KND A;  3KMN A;  4IHU A;  2I3Y A;  5ECP B;  1TP9 A;  2CZ2 A;  5DCH A;  3ZRD A;  1X0R A;  2AHE A;  3GL3 A;  4KA0 A;  1E2Y A;  2YZH A;  3L9V A;  2A2P A;  2H75 A;  3BD2 A;  4WXT A;  2IFQ A;  2WUL A;  4EC0 A;  2UZ8 A;  3D4M A;  4O7H A;  1SKS B;  1T4Y A;  3IPZ A;  3QPM A;  1XOA A;  1YJ6 A;  4MJB A;  4IQ1 A;  2C0F A;  3EPT A;  2PU9 C;  5F0G A;  5JWQ B;  4LMV A;  1XW5 A;  3TJG A;  5ABR A;  4MA9 A;  2F8A A;  4J2F A;  3FZA A;  1GNE A;  4DEJ A;  4V2M A;  2DC5 A;  4K2D A;  5HFI A;  1FB6 A;  1GP1 A;  3DYR A;  3O3T A;  4PQ1 A;  2CX3 A;  1ILO A;  2C0D A;  4NMU A;  3C7M A;  5ECM B;  2B3S A;  4Z2U A;  4V2L A;  2YAN A;  1GSE A;  5B8B A;  3DWV A;  1GRX A;  3IR4 A;  3GUR A;  2O85 A;  1W4V A;  1ABA A;  1M7T A;  3QMX A;  3WT2 A;  3HZ8 A;  2H0G A;  3G9B A;  1FOV A;  4GST A;  4YQM A;  3HZ4 A;  3ZTL A;  3UVH A;  3HD5 A;  1ZOF A;  1WIK A;  2K18 A;  2VCZ A;  2CVD A;  5INY A;  17GS A;  2JZS A;  3BOA A;  2OAD A;  4G19 A;  3GH9 A;  2DIY A;  2HFD A;  3ZML A;  4EL1 A;  3FY7 A;  5EL8 A;  1ZMA A;  5H5R A;  3HKR A;  2NBS A;  2JZR A;  1Z3E A;  4WF4 A;  1ERT A;  1A8L A;  1UVZ A;  2V1M A;  4TOP A;  3ERG A;  1GLP A;  1HQO A;  1H4O A;  1ZGN A;  3WGE A;  1TI3 A;  5ECL B;  3C71 A;  1SU9 A;  2JAC A;  2H6X A;  4HQS A;  3IA1 A;  1S3C A;  3DXB A;  1XCC A;  3TJK A;  3GX0 A;  1TI1 A;  1M0U A;  1XWB A;  5IMF A;  5KN3 A;  4K5R A;  2L4C A;  1PRX A;  4KDU A;  1WPI A;  3CBU A;  2LJA A;  3U5R E;  2L6D A;  5AGY A;  3F0I A;  3ZIV A;  3GTU B;  1EGO A;  5D9W A;  5DQS A;  1R5P A;  4MH2 A;  2RUF A;  2GLR A;  1TTZ A;  2XC2 A;  2C8U A;  3IRA A;  3TRQ A;  1B4Q A;  2X64 A;  4KB3 A;  2E7P A;  4ZL9 A;  1OC9 B;  2GSQ A;  3ZRE A;  4IJ3 A;  1K0M A;  5FT3 A;  4ZBD A;  5IMC A;  1J9B A;  1U3A A;  1MDI A;  3O76 A;  4JBB A;  5CRE A;  3GYK A;  5ECK B;  1RW1 A;  2H19 A;  3J7Y b;  3TOU A;  5G30 A;  3VPQ A;  1WP0 A;  5ECQ B;  4KSO A;  2N5A A;  1ZL9 A;  4GTU A;  3BBY A;  2AV4 A;  1PN0 A;  2IMK A;  1O7U A;  2PMT A;  4MJE A;  3TRP A;  1TU8 A;  2R6K A;  1YF1 A;  1O85 A;  1BX9 A;  1EP7 A;  5AIV A;  3GST A;  4WBR D;  3DKS A;  2ES7 A;  2DIZ A;  2PWJ A;  2M80 A;  3TRX A;  2HSY A;  2H72 A;  2GQK A;  2R3X A;  3TKS E;  3GKM A;  3FR9 A;  3TUE A;  2KP2 A;  2MMO A;  4IP6 A;  2GSR A;  4TXV A;  4PUF C;  5GAN D;  2MMA A;  6GST A;  4MLY A;  3QCP A;  2QSI A;  3VWX A;  3IDV A;  2VUP A;  4HEA 2;  4ML1 A;  1BED A;  3KCM A;  4K6X A;  4L5O A;  3F9U A;  4POB A;  1WWJ A;  3VI7 A;  3WYW A;  2NVL A;  3PR8 A;  5CP1 A;  1F3A A;  1Z7R A;  4HJM A;  1PX6 A;  2IJY A;  5IM9 A;  5EPF A;  2YP6 A;  1TRU A;  2IL3 A;  1U3I A;  3F3Q A;  1K0B A;  2WDU A;  4Q5N A;  5J9B A;  1V2A A;  3BJ5 A;  2M72 A;  5HQP A;  5GSS A;  3A2X A;  1AQX A;  5E59 A;  5ELG A;  2YWM A;  5IO2 A;  2VD0 A;  2VOC A;  1ZYQ B;  3GV1 A;  4XRD A;  1TU7 A;  1SYR A;  3GUS A;  3VI5 A;  2O89 A;  2L5O A;  5AIX A;  3A2W A;  2DJ3 A;  3LXZ A;  2X4A A;  1ZCP A;  2H1B A;  2CT6 A;  2LJK A;  4WET A;  4N11 A;  1DBY A;  2P5R A;  2C80 A;  1V9W A;  4HU7 A;  3HY2 A;  1FB0 A;  4KSM A;  3APQ A;  1A8Y A;  3KH9 A;  1W89 A;  4KCA A;  1K3Y A;  5IMZ A;  5IO0 A;  1ST9 A;  2FA4 A;  4GF0 A;  3QD9 A;  3FZ5 A;  3NIV A;  4EKZ A;  3C1R A;  2K8V A;  3EMP A;  2V2G A;  5HR3 A;  2WCI A;  1V57 A;  2H0I A;  3LFL A;  3P90 A;  1DE1 A;  1MD4 A;  2OE3 A;  1IYI A;  1PL1 A;  3PH9 A;  3UL3 A;  4NV5 A;  4BWQ A;  1AQV A;  5CO3 A;  1XXU A;  2C0G A;  3NOF A;  3EUR A;  4I2T A;  3HVX A;  4K8M A;  3CSH A;  3I6A A;  2FHE A;  3HYP A;  4G10 A;  3VWW A;  4L5L A;  6GSV A;  3M8N A;  3M1G A;  3CTG A;  1THX A;  1WE0 A;  1WOU A;  2YV7 A;  5JWO B;  5FHI A;  12GS A;  4Z7X A;  4TR4 A;  2XBI A;  3F3R A;  2YCD A;  1QGV A;  3FYG A;  4X4J A;  1FVK A;  4ACS A;  2YWN A;  2PGT A;  3TB2 A;  2FWE A;  1K0A A;  3E0U A;  4O92 A;  1PA3 A;  3HVV A;  2FY6 A;  1TRS A;  3KD0 A;  4AJ7 A;  4ZIL A;  5LD0 A;  1B9Y C;  18GS A;  2BJX A;  4WR5 A;  3F4S A;  2FA8 A;  3HJP A;  3IXR A;  4ECI A;  3TJF A;  4TXO B;  1PD2 1;  2PUK C;  4KF9 A;  1U88 A;  3TDG A;  2CVB A;  3IAM 2;  5A4W A;  6GSY A;  4ML6 A;  1GUK A;  2DSA A;  2RLI A;  1DUG A;  3FRC A;  1IYH A;  2FWH A;  3VFI A;  2I81 A;  2N5B A;  2H30 A;  3DVX A;  3GKX A;  4GSS A;  4LA1 A;  2C3N A;  1EEM A;  2ZNM A;  3FW2 A;  4EDY A;  1OKT A;  1F6M C;  4PGT A;  3FZ4 A;  3HJM A;  4LLR A;  5JCU A;  3FMW A;  5CAX A;  2PN8 A;  1B9X C;  4MPG A;  3S9F A;  4QL7 A;  3PGT A;  2LNT A;  2G2Q A;  2VL9 A;  3ZVJ A;  2NDO A;  4JU5 A;  2DJ1 A;  2FCH A;  3SWL A;  5B8A A;  5F07 A;  3LGC A;  4ZB6 A;  3I69 A;  3RHB A;  3LXT A;  1I9D A;  1K0C A;  4X1U A;  4XCS A;  3Q6O A;  1FO5 A;  1R5A A;  3W8S A;  3E3E A;  2XBQ A;  3L78 A;  1QXH A;  1HD2 A;  1T1V A;  2ALB A;  4PUR A;  1CQH A;  2N5F A;  4TN8 A;  3G7J A;  3IV4 A;  4XHM A;  2GZY A;  5GAP D;  1SJ6 A;  2I9H A;  2GT6 A;  1UA5 A;  5H5Q A;  4DSS A;  1SD8 A;  2HYX A;  4D73 B;  3ZFB A;  5IPH A;  4F9Z A;  11GS A;  3IE3 A;  3EVI A;  2XPD A;  3VLN A;  3KP9 A;  4OCF A;  1T3B A;  2H70 A;  2B7J A;  1JLW A;  2CAI A;  1NW2 A;  4YQU A;  4G0I A;  2YN1 A;  1ZYN A;  4CDO A;  3D5J A;  3TKS A;  4PUA A;  1CQG A;  2VCW A;  3LQ7 A;  2HZE A;  2JSY A;  1YQ1 A;  4WBJ A;  2FD3 A;  1WJK A;  3KZQ A;  4POM A;  4H86 A;  1EP8 A;  3L0H A;  5A4U A;  2HNL A;  4L0W A;  4P3Y B;  3US3 A;  2XPE A;  1FW1 A;  3KJY A;  14GS A;  1KNG A;  1Z5Y E;  4TR1 A;  1UC7 A;  4O5U A;  4O5Q A;  9GSS A;  4ZXG A;  2OBK A;  1Q98 A;  4ILF A;  6GSS A;  5B7C A;  4CY8 A;  2V41 A;  3TKQ A;  3FR3 A;  5DCG A;  4NXI A;  4TKY A;  2LUS A;  5KN1 A;  3RPN A;  1EOH A;  1QMV A;  4EIP A;  2VLT A;  4I5Q A;  3TKP A;  1AIU A;  5ECR B;  4XRA A;  4JZQ A;  2H76 A;  3CXG A;  1HYU A;  5JWR B;  2EIQ A;  1SYX A;  3TCO A;  2YJ7 A;  1N8J A;  4NWY A;  4BL7 A;  4GXZ A;  1O8X A;  1ERU A;  1GTA A;  2IMD A;  4G2E A;  4HU9 A;  4HZ4 A;  1VRS D;  4Z2T A;  4I6X A;  5B6M A;  2HRA A;  6GSW A;  2VM1 A;  1GSU A;  2VL2 A;  4G0K A;  5D96 A;  2C0E A;  3MSZ A;  5D93 A;  4MNN A;  4IKH A;  1M2A A;  4HUA A;  1Y25 A;  3UIW A;  1GSF A;  2P5Q A;  3ME8 A;  5DVB A;  4MF6 A;  2V6K A;  5G5E A;  2D2Z A;  1GWC A;  2B6M A;  2C3T A;  1GSS A;  2H73 A;  2NPB A;  2F8F A;  1Z7P A;  4V1A g;  4FO5 A;  1GUM A;  4J56 E;  5IPG A;  2LNS A;  1GSD A;  4MK3 A;  3L9S A;  2PPT A;  4XS1 A;  4X43 A;  4IBP A;  8GSS A;  4OFM A;  3G7Y A;  1FG4 A;  1JHB A;  2HXK A;  2L59 A;  1VF3 A;  3F6F A;  3IK9 A;  2H74 A;  1BJX A;  1MEK A;  2Z9S A;  2HT9 A;  3PPU A;  1R26 A;  3I9V 2;  4LL1 B;  5IQY A;  2GVP A;  3TGZ A;  2H6Y A;  1T4Z A;  1TK5 B;  3F4R A;  3ZIJ A;  5HFK A;  2CVK A;  1SD9 A;  4MCU A;  5CRH A;  4TW5 A;  1F3B A;  2X8G A;  4WR4 A;  1XWC A;  2HSM A;  4KH7 A;  4L0U A;  3A2V A;  2PVO C;  5ENU A;  2LTK A;  3UAP A;  1XBS A;  2O87 A;  3P7X A;  2K9F A;  4ICY A;  3KMO A;  3N9J A;  1BAY A;  1EWX A;  4NPB A;  5ID2 A;  3W8J A;  3O6T A;  4WKW A;  2R2J A;  3DEX A;  4MH3 A;  1MDK A;  1AQW A;  3GIX A;  2DML A;  3GKN A;  1X5D A;  1HNC A;  4KDX A;  2GTU A;  2QA1 A;  1YEP A;  2I1U A;  5G1K A;  1LJR A;  3QAV A;  1FOH A;  1PL2 A;  5C04 A;  3GNJ A;  5KOX A;  1XOB A;  1OC3 A;  1JZD A;  1YF0 A;  4LL4 B;  1FHE A;  1V98 A;  4DSR A;  3K8N A;  4I2U A;  3KTB A;  3WT1 A;  4OFT A;  3QOU A;  1M2B A;  3CYN A;  3MIX A;  2DJ0 A;  4BVX B;  1XPV A;  4GQF A;  1B48 A;  5DAL B;  5ECH B;  2OBI A;  5DAK A;  2AAW A;  2R0G A;  2EC4 A;  2LEG A;  5GST A;  2LQQ A;  3FR6 A;  4E8E A;  3HXS A;  1AUC A;  2OKA A;  4MF7 A;  4Q5Q A;  3VUR A;  1EOG A;  3GX8 A;  5L71 A;  1QUW A;  4TR1 B;  2IFQ B;  2YV9 A;  4GWR A;  1YY7 A;  1RK4 A;  2GST A;  5J5N A;  4WEY A;  3F4T A;  3FZ9 A;  1I5G A;  4L8E A;  4O5R A;  4ZBA A;  1A23 A;  3ERW A;  5G1L A;  3HVS A;  3CMI A;  1V58 A;  6GSU A;  5KN0 A;  1H75 A;  2A4H A;  4MJC A;  4RI6 A;  3FKF A;  4YAV A;  4G9H A;  2VD1 A;  4DVC A;  1YEX A;  1MDJ A;  3C73 A;  4TR0 A;  1URM A;  4CHS A;  1XW6 A;  3IC4 A;  1TXX A;  3M3M A;  2LST A;  1S3D A;  4USS A;  1B8X A;  4HZ2 A;  4A5P A;  2LV3 A;  4PQH A;  3TJB A;  5D8I A;  1C72 A;  2YPM A;  4BL7 B;  2LKU A;  4HOJ A;  2QA2 A;  3R2Q A;  3W6G A;  2GS3 A;  5E4W A;  3H8Q A;  4HS1 A;  1QQ2 A;  1BQ7 A;  3CRU A;  3FK8 A;  1THO A;  2IIY A;  3APO A;  1Z9H A;  1BYE A;  4JR4 A;  1A2L A;  3UAR A;  2WB9 A;  1A0F A;  4YQV A;  3ZLP A;  2WS2 A;  1UN2 A;  5EY6 A;  2HI7 A;  5BMU A;  4FYC A;  3P8W A;  4K5S A;  4TR3 A;  1YKA A;  5DDL A;  4J57 E;  1SL0 B;  3ISO A;  3IHQ A;  1PKZ A;  4EE0 A;  2X8C A;  4ZL7 A;  3MDK A;  2CA8 A;  4NHW A;  5DJM A;  1JZO A;  2IME A;  1NM3 A;  3HA9 A;  2YWI A;  3APS A;  4MJA A;  3CSI A;  3Q18 A;  3E9J B;  3QR6 A;  2LS5 A;  4YKG A;  3HDC A;  2X49 A;  3L4N A;  3KGK A;  2H1G A;  1PSQ A;  1RQM A;  3DIE A;  1SEN A;  2OJL A;  2R0C A;  2DLX A;  4KW6 A;  1SK2 A;  3HJO A;  4OD7 A;  2VL3 A;  1DSB A;  1VF2 A;  2B5Y A;  2H6Z A;  3VWV A;  4YAP A;  3ERF A;  5GZZ B;  4K2X A;  4V1A p;  2OA7 A;  4CW9 A;  3HCZ A;  1OE8 A;  2B5X A;  1O73 A;  1PKW A;  2M46 A;  2C4J A;  1EZK A;  5LNK e;  1NSW A;  3WGX A;  4YH2 A;  1KEB A;  2KHP A;  1Q4J A;  1O6J A;  2L6C A;  2C3Q A;  2GZZ A;  1VF4 A;  4EVM A;  4K7N A;  4AF2 A;  2VIM A;  4O32 A;  3Q74 A;  2IPA A;  4KUN A;  3VWU A;  3ZZX A;  3MWH A;  4IN0 A;  4ZB9 A;  1TK8 B;  3J7Y k;  4ZBB A;  3FHK A;  1GLQ A;  3QDN A;  4IGJ A;  5H5S A;  2OAC A;  2EIR A;  4ECB A;  2BMX A;  1OC9 A;  1M2D A;  2DMM A;  1XVW A;  1TRV A;  4TVE A;  3G7I A;  4IEL A;  3UJ1 A;  6GSX A;  3D22 A;  4MP4 A;  3EC3 A;  3UEM A;  1XFL A;  5DAK B;  3KH7 A;  4F0B A;  5COH A;  4F2I A;  2YOI A;  1AAZ A;  3LYK A;  3IHG A;  2WZ9 A;  4XS4 A;  3F8U A;  3TOT A;  1ZYE A;  3M0F A;  1SKR B;  5IIZ A;  2V6O A;  5IMV A;  4XS6 A;  4IQA A;  2ZCT A;  3JCM L;  2E2M A;  2JL4 A;  2LRN A;  20GS A;  3TJJ A;  2QGV A;  3GH6 A;  4F0C A;  4HJ2 A;  1LBK A;  2HRF A;  1GH2 A;  4FYB A;  3MAK A;  1X9W B;  3V1W A;  2DKH A;  4OMV A;  1X9S B;  7GSS A;  2CV4 A;  2BTO T;  4EDZ A;  2FLS A;  5J41 A;  2JZT A;  1SK0 A;  5LCZ A;  22GS A;  4F82 A;  3M9J A;  3UOM A;  2IWT A;  4HDE A;  2WFC A;  4ECJ A;  2QKE A;  1KTE A;  4PQI A;  5IOW A;  3ZVJ D;  2X8H A;  4FIW A;  1OKD A;  3A5W A;  13GS A;  4HI7 A;  1SK1 A;  1YKC A;  2MMZ A;  5C00 A;  2DJK A;  1ML6 A;  3H93 A;  1ZYP A;  1USB A;  4MZW A;  2L5L A;  1OYJ A;  2PVQ A;  4IS0 A;  2RM5 A;  5DBQ A;  2ZUP A;  4MDC A;  10GS A;  2RM6 A;  3F6D A;  4F03 A;  4OO4 A;  5G2Z A;  5EVO A;  1GUH A;  3QFA C;  2H66 A;  3EU3 A;  4JR6 A;  1JLV A;  4ULX A;  1ERW A;  4HQZ A;  4IJI A;  4ECC A;  2MZC A;  4TRX A;  2G0F A;  4ZB8 A;  3DVW A;  4AJ6 A;  1V40 A;  2H8L A;  1JZW A;  2K8S A;  2AJQ B;  4BWS A;  1XVQ A;  4MMM A;  1X5E A;  3QFB C;  3EWL A;  3KP8 A;  2B1L A;  2HZF A;  2IMI A;  3P2A A;  4N10 A;  3IK7 A;  2VCV A;  3RAZ A;  2E0Q A;  16GS A;  1ON4 A;  2RUE A;  4MZB A;  2B7K A;  3KTL A;  4GQC A;  2GQM A;  1TW9 A;  2VLV A;  4GRF A;  4GCI A;  1HNA A;  2V32 A;  1WRY A;  2MBT A;  1A2J A;  2PBJ A;  4AJ8 A;  2GT5 A;  3VK9 A;  4KGI A;  2OE1 A;  4NV2 A;  1XW9 A;  4KE3 A;  2CQ9 A;  2A4V A;  3C8E A;  1SJZ A;  5KOW A;  1M99 A;  2NTO A;  2HRN A;  5JCG A;  4IP1 A;  4MZC A;  4PNF A;  5D9V A;  2L57 A;  2VAF A;  3BCK A;  2GGT A;  3BCI A;  3GA4 A;  1MD3 A;  3LSZ A;  1PQN A;  1GL8 A;  1PX7 A;  2MMN A;  3F63 A;  2OE0 A;  5DQY A;  2KLX A;  2KOK A;  2VM2 A;  2H01 A;  1O8W A;  4RUV A;  1Y6E A;  2REM A;  5HR0 A;  1G0T A;  3FEU A;  3UBL A;  3MNG A;  2YWO A;  5A4V A;  5J9C A;  2H1D A;  1OVN A;  1VGL A;  2I4A A;  4OO5 A;  5AN1 A;  2B1K A;  2TIR A;  3LG6 A;  5ECO B;  2P0G A;  3HHV A;  4PXO A;  4V2N A;  3U6V A;  4TXO A;  1WMJ A;  2K6V A;  3EMX A;  1GUL A;  5F05 A;  5IMA A;  1U6T A;  1G7E A;  4BVY A;  1PGT A;  1VF1 A;  5A5K A;  3AY8 A;  3ME7 A;  3QAW A;  4BPY A;  2TRX A;  4RI7 A;  1TK0 B;  3PIN A;  1J08 A;  1JFU A;  2L4Q A;  3GSS A;  2VLU A;  3EYT A;  5FWG A;  3NZN A;  1YZX A;  1GSY A;  3EU4 A;  2CZ3 A;  5JCW A;  4Z2R A;  4NAX A;  3RDW A;  3N5O A;  5ECI B;  1O81 A;  2F3M A;  3R3E A;  5DJL A;  3RPP A;  4DSS B;  1LU4 A;  4K7I A;  2PER A;  4ISD A;  2P31 A;  2AUV A;  5HR2 A;  2FGX A;  4XS4 B;  5D73 A;  1QK8 A;  3RBT A;  19GS A;  2YNX A;  4I97 A;  4JE1 A;  3L9U A;  5CRG A;  4RQR A;  4KX4 A;  1YDK A;  4MF5 A;  2HZE B;  1JZR A;  1ZZY A;  5ECS A;  2RII A;  2IN3 A;  2XHF A;  4OFN A;  3LYP A;  2AB6 A;  3OR5 A;  2A2S A;  2HE3 A;  1TRW A;  4FH8 A;  4X0X A;  2VO4 A;  1K0D A;  2DKI A;  3LJR A;  1BG5 A;  4D73 A;  1GTU A;  3IBH A;  2DBC A;  3UVT A;  3C1S A;  1XWA A;  3GL5 A;  4PTS A;  1MTC A;  4XIH A;  3A3T A;  1A0R P;  1NHY A;  2GSS A;  3CSJ A;  1AW9 A;  1EEJ A;  4AGS A;  4EF0 A;  3SBC A;  5AIS A;  1EV9 A;  4N0Z A;  2C1Y A;  4IVF A;  5ECN B;  2E2G A;  3DD3 A;  3IOS A;  4Q5F A;  3KIJ A;  4CY6 A;  1FAA A;  3EE2 A;  4ZL8 A;  5G5F A;  3ED3 A;  2FWG A;  4PX1 A;  4JED A;  2CX4 A;  3H4K A;  1PMT A;  4K9Z A;  4PNG A;  1T00 A;  2FUG 2;  1OAZ A;  4K1F A;  3GN3 A;  3DML A;  5CRD A;  1M9A A;  4QQ7 A;  4POK A;  3TKR A;  1EV4 A;  2LRT A;  2R0P A;  4FQU A;  2ON7 A;  4Q5R A;  1AC1 A;  2H71 A;  2DJ2 A;  3CRT A;  1R4W A;  5F06 A;  3RHC A;  1T7P B;  2TRC P;  1DE2 A;  1B4P A;  3UMA A;  1KBN A;  2R5G A;  1SJI A;  1NHO A;  1TJD A;  4NHZ A;  2ON5 A;  3UBK A;  2LQO A;  4ZIJ A;  5KEJ A;  3Q19 A;  4FYU A;  1XWK A;  2O8V B;  2YJH A;  1F2E A;  3D4T A;  1T8E B;  4N30 A;  3H1N A;  3KEB A;  3LWA A;  3M9K A;  1K3O A;  3GFK A;  2YZU A;  3LW9 A;  4KDY A;  5D9X A;  3GHA A;  1R7H A;  1E6B A;  2FWF A;  2JAD A;  4XTS A;  5CYY A;  4EUY A;  2DJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...