2LRNA

Solution structure of a thiol:disulfide interchange protein from bacteroides sp.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
152
Chain Sequence
MSLATGSVAPAITGIDLKGNSVSLNDFKGKYVLVDFWFAGCSWCRKETPYLLKTYNAFKDKGFTIYGVSTDRREEDWKKAIEEDKSYWNQVLLQKDDVKDVLESYCIVGFPHIILVDPEGKIVAKELRGDDLYNTVEKFVNGAKEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein
publication title Solution structure of a thiol:disulfide interchange protein from Bacteroides sp.
rcsb
source organism Bacteroides sp. 4_3_47faa
total genus 51
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lrnA00
1T8EB 4MZWA 2PVOC 5ECRB 2FUG2 1XIYA 4ZL8A 2LUSA 1KTEA 2PN8A 2B1KA 2YP6A 3F9UA 3GL5A 5ELGA 2YWMA 1X9SB 4WF5A 3RHBA 4GXZA 4OFNA 3ZTLA 4PNGA 2PERA 2LTKA 3N5OA 2H75A 2LRNA 4G10A 3QDNA 22GSA 2N5AA 4L0WA 4KSOA 3ERFA 2WS2A 1X5CA 4I6XA 2D2ZA 3MSZA 2EIRA 3IPZA 2I81A 4L0UA 2C0DA 3WD6A 1TU7A 2O87A 3APOA 3APSA 3C71A 1MDJA 2H1BA 4KX4A 3TJFA 1I5GA 3KTBA 5CREA 5AGYA 1SD9A 4OCEA 4ECJA 1OC9B 3TJBA 2HYXA 4GF0A 3ZMLA 5DALA 3UEMA 3CBUA 3HD5A 3GSSA 5DCHA 1TRWA 3UL3A 5CRDA 2YANA 3LSZA 5H5RA 1OVNA 4KW6A 1TI1A 1OAZA 1R5AA 1V58A 3R2QA 2FWGA 4KCAA 4POKA 1DSBA 2DIZA 2G0FA 1ZZYA 5KN1A 5CNWA 1K0DA 3KGKA 3NOFA 2L4QA 5IO2A 3KJYA 1HQOA 1OKTA 3C1SA 2OJLA 2I3YA 3F8UA 2IFQB 2GVPA 1MTCA 3EYTA 3RPPA 2LNTA 5FT3A 3L0HA 5DAKA 1AAZA 5IQYA 19GSA 1UN2A 4IKHA 1WWJA 4NAXA 1JZRA 4KA0A 2BJXA 3GMFA 3F4SA 2HZFA 2LRTA 2G2QA 4HJMA 3UIWA 2WB9A 4EVMA 5DJMA 3HCZA 4OCFA 2LJAA 1EGOA 1EWXA 3GA4A 4LL1B 2WDUA 3VWWA 2HI7A 2YNXA 2IIYA 2L59A 5ECKB 3WGEA 1AQXA 3IE3A 1ON4A 2K18A 4PX1A 2FNOA 2CZ2A 2GQLA 5L71A 1ERWA 1TRVA 3VK9A 2IMKA 4GWRA 3DVWA 4RUVA 1TRSA 3GUSA 3IAS2 1PGTA 2WULA 1R26A 3BD2A 3C1RA 3CRTA 2VL2A 1GUKA 3Q6OA 1TK0B 5FWGA 2B5EA 3TKSC 1QGVA 11GSA 2H6ZA 4HUAA 5B6MA 2IMFA 1T7PB 4XTSA 5CAXA 4K6XA 4MZBA 4IBPA 3VLNA 1E2YA 1TP9A 5HR1A 1JZWA 4WBRD 2PUKC 1SENA 4DEJA 1O73A 1G7EA 4JR6A 2VCVA 1TI3A 4ILFA 4MH3A 6GSVA 3ZRDA 1GLQA 2F51A 3P2AA 3KXOA 3UBKA 5ECSA 4DSSB 5ECQB 4ZB9A 4TR1A 1TKDB 2B5XA 3QAGA 2FWHA 3ZREA 1J9BA 3KCMA 4TXOA 2YWNA 3QPMA 2HXKA 1TK8B 4ML1A 2FY6A 4EDZA 2GSQA 4K1FA 3L9UA 5IIZA 1ZL9A 4KGIA 3G7JA 4K2DA 1QUWA 4JR4A 2PBJA 1M9AA 4JU5A 1FG4A 1M9BA 1HYUA 1K0CA 3F63A 2PVQA 3KZQA 5J4UA 1FVKA 4NWYA 1AXDA 1PX7A 1A8YA 5C04A 2VM1A 4F0CA 1NSWA 5IM9A 2YV7A 1NM3A 4JBBA 3L9SA 2R3XA 1V40A 2IMIA 5KN3A 4TKYA 2E7PA 2RUEA 3GURA 4BPYA 3KP8A 1ST9A 3LJRA 3BBYA 4J57E 4HOJA 2K8VA 3E0UA 3F3QA 1TJDA 2GLRA 3QCPA 2IMEA 4TXOB 2YWIA 2CV4A 4QL7A 2ZUPA 4GQFA 1YKCA 2PPTA 4GLTA 3TKSE 4ZBDA 4ZL7A 3EINA 1AQWA 5HR0A 2MBSA 3FZ5A 3ZMKA 1T1VA 5CRWA 4JZQA 1FO5A 1M0UA 3IV4A 5H5SA 5DBQA 4V2NA 4WBJA 1VF4A 2A2SA 2YV9A 1VF2A 3G7YA 5A4WA 2OBIA 4YAVA 5HFGA 2MYGA 4RQXA 3DYRA 1EGRA 2XPEA 5J3RA 2H66A 1PKZA 1I9DA 3GKXA 2C3TA 4LA1A 1ILOA 1PRXA 1YF0A 3FR9A 2GZZA 4ZILA 3GX8A 2VCWA 2H70A 5DJLA 2CZ3A 1A24A 3M9KA 5AIXA 1GSFA 2GQKA 5IMFA 3DRNA 2GZPA 3KH9A 2YWOA 1SL1B 2C80A 3M0FA 3F6DA 4JEDA 2H1DA 5GAPD 2MMZA 3AY8A 4MF5A 3SWLA 1SK1A 1SK0A 5CRGA 3P90A 1NHOA 2LJKA 2N5BA 4AJ8A 1CQGA 3I69A 3H79A 2TRCP 5D9WA 2B7KA 5JWQB 1SJ6A 1QXHA 4GTUA 4O5RA 2XBIA 6GSSA 4GRFA 3VI7A 5ECNB 3ZYWA 2VM2A 5ABRA 5G2ZA 5AIVA 1B48A 1G7OA 3F6FA 3U6VA 5KEJA 3H93A 1U3IA 3DD3A 2M80A 1B8XA 4WR5A 4POMA 5IMAA 3GSTA 3GTUA 3IR4A 13GSA 4AF2A 4MDCA 2CX3A 2EIOA 3IAM2 4DVCA 4L5OA 4L8EA 2DMMA 3ZIJA 4QL9A 2VAFA 5DQYA 4MF6A 2C4JA 2PMTA 5A4VA 1X5EA 3ME8A 4F0BA 3IDVA 4I2TA 3DVXA 4MA9A 4MJBA 5J41A 1XZOA 2AHEA 2H0GA 1EEJA 3ZFLA 3FW2A 4V2LA 3ERWA 5EY6A 5ENUA 2PU9C 2OADA 1Z9HA 4BWQA 2KLXA 2HFDA 2OA7A 2R2JA 4IN0A 2QSIA 1EOHA 3VURA 1OC9A 4MJEA 5E4WA 4AJ6A 4K7NA 5J9CA 4GCIA 1TW9A 1SL2B 1NHYA 2NTOA 3GTUB 2R6KA 2OE0A 1FB6A 4HEA2 2OACA 3WGDA 3FHKA 3ZLPA 1U87A 4FIWA 3D5JA 1XBSA 2HT9A 1FW1A 1FOVA 1YZXA 3HZ8A 3CRUA 1AUCA 1SKRB 2IFQA 3EURA 3LYPA 1GSSA 1M2AA 3TOTA 4XCSA 4TRXA 1XWBA 4MMMA 5IMDA 2YZHA 3LXZA 4PXOA 3DKSA 2HSYA 5B7CA 1OE7A 4YQMA 1XOBA 4N0ZA 2H0IA 4NXIA 2J23A 3KMOA 3VPQA 4KDUA 3QAWA 4XS4B 5AISA 10GSA 1M2DA 3TDGA 1WP0A 4NPBA 1A2JA 3V1WA 3GNJA 3O76A 4KUNA 4PNFA 1EEMA 1OKDA 5G30A 5D73A 2P0GA 1TOFA 1EZKA 1Z6MA 4YQUA 2DC5A 1GUHA 3PGTA 3QD9A 3IOSA 1RQMA 3GHAA 2MZCA 1FB0A 4POBA 4AJ7A 4YH2A 4EO3A 1R5PA 2V1MA 2GS3A 4MPFA 1O8XA 1BAYA 2LV3A 1GP1A 4ECCA 1OC3A 4IP6A 3KH7A 3IHQA 5HFIA 1BX9A 1SKSB 1XWAA 1V2AA 4PQ1A 2CAQA 1MDIA 20GSA 4FYBA 3FR3A 1F9MA 4I97A 3GRXA 3PINA 4MCUA 3FRCA 3CYNA 2KHPA 5GSSA 4EUYA 2LJRA 3IK7A 4L5LA 1GUMA 3ZITA 4OFMA 3EWLA 2VIMA 5B8AA 2X64A 2JSYA 2VCXA 4RI6A 1HD2A 4ZB8A 4CDOA 2F9SA 3IBHA 5FHIA 2RLIA 3DMLA 1WMJA 1FVJA 1W4VA 5JWRB 2Z9SA 1TDIA 1A8LA 2ZNMA 2ES7A 1QFNA 4DSSA 3KEBA 1PD21 3ISOA 1YEXA 2TIRA 4IGJA 1DE1A 1XWKA 4Q5RA 2CVDA 2GZYA 2L6CA 3E9JB 4O92A 1ABAA 3HVVA 2A2RA 3TB2A 5LNKe 5CYYA 3A5WA 3LQ7A 3CSIA 3QMXA 2V6KA 1T4ZA 1M2BA 2XPDA 1QK8A 5F8BA 2M46A 2VD1A 2CQ9A 4GSTA 1T4YA 4PGTA 1SD8A 14GSA 4QQ7A 2YJ7A 5ECLB 4I5QA 2C0GA 1YDKA 5G5EA 3BJ5A 2C0FA 2C8UA 4P3YB 1WJKA 4EF0A 3I9V2 3HHVA 4RI7A 2NPBA 4KB3A 3MDKA 2H73A 5F0GA 2VLTA 3LFLA 2A4VA 2GTUA 3UBLA 5DQSA 5ELAA 3L78A 2VLUA 1K3YA 3IXRA 1XFLA 2MBTA 2GGTA 1KEBA 2REMA 1R4WA 3F4TA 4IJ3A 2BMXA 4FYUA 4F9ZA 4O7HA 2TRXA 3SBCA 4MJCA 17GSA 2VL2C 3K8NA 3ZFBA 1YQ1A 4E8EA 3GN3A 1OC8A 2VO4A 4IVFA 9GSSA 1CQHA 2VD0A 2WFCA 5IMCA 2H74A 3EMXA 1V57A 1DUGA 3VWVA 1GTIA 3APQA 3C7MA 1PKWA 2L6DA 2P31A 1O85A 2I9HA 3MWHA 1H4OA 2JADA 2M72A 4O32A 3IK9A 1BEDA 4XRDA 1A0RP 4IQ1A 1GTAA 1USBA 4K8MA 3DWVA 1DBYA 3CSJA 2DJKA 1TK5B 3FZAA 3ME7A 2YPMA 2P5RA 5LCZA 2B3SA 5ECOB 3LG6A 3JCML 5HR2A 5INYA 2B7JA 3C73A 3DGQA 4TOPA 1Y6EA 4OO5A 2C3NA 4IELA 2GSSA 2V6OA 4K0NA 3F4RA 4BL7A 3P8WA 2VOCA 1F37A 4ZIJA 2RIIA 3WYWA 2WRTA 1VRSD 2FWFA 4JE1A 1WIKA 1JHBA 4HZ2A 2JZSA 2VUPA 4KH7A 4MJAA 4OD7A 3WT1A 4KE3A 3WGXA 2IN3A 3GIXA 3EE2A 2J9HA 2QKEA 3D0ZA 4AGSA 4PUAA 1U6TA 3FEUA 3S9FA 2GT5A 4G9HA 5F05A 1G6YA 1EV9A 1YEPA 4BWSA 3BCKA 4KCEA 5E59A 2R4VA 5ECPB 1UA5A 2FA8A 3N9JA 2GQMA 4KNDA 2VCTA 3PH9A 3ERGA 5D9XA 4YQVA 1OE8A 5G5FA 1EP8A 4WR4A 4E8HA 3BOAA 2DBCA 5CRHA 1PL2A 4OO4A 5C00A 1X0RA 5DDLA 2H8LA 3LORA 1K3OA 3PR8A 1UVZA 2FA4A 3EU3A 1RK4A 3TOUA 3GKKA 2JZRA 2DIYA 4EDYA 1ERUA 4Q5QA 1VF3A 5J9BA 1GSYA 3M1GA 2OE1A 2AB6A 5ECMB 1BG5A 2RM5A 3TRXA 2X8CA 4DSRA 2HSHA 2KUCA 3HZ4A 2HRFA 1O8WA 4PQHA 4WF4A 4POLA 4MPGA 5GAND 1GNWA 2L4CA 2H76A 2F8AA 1NW2A 3HXSA 1AW9A 3D6IA 2DMLA 4TVEA 2IJYA 1GRXA 8GSSA 3GH9A 4IS0A 1X9MB 1SK2A 4HDEA 1GTBA 2KP1A 1GSDA 5G31A 2H19A 4HZ4A 1E6BA 4WEYA 2X8HA 2NBSA 3I43A 3TUEA 5D93A 3GYKA 3FR6A 4HU9A 1LU4A 3EU4A 4Z7XA 3KIJA 4GSSA 4PUFC 3A2VA 3H1NA 4HJ2A 3CXGA 4IQAA 3LEFA 3KTLA 2X8GA 4K0GA 1A2MA 4D73B 2NVLA 4FH8A 5DCGA 2OE3A 2XC2A 3UARA 4X0XA 3TRPA 3M9JA 3OR5A 2B6MA 2VL3A 3FYGA 4KDYA 4XS4A 3FY7A 2DJ2A 1O7UA 3MAKA 1YJ6A 4MK3A 4N0VA 3KMNA 2V32A 4I8BA 1O81A 3CSHA 2XBQA 2EIQA 3FZ4A 5JCGA 2H1AA 1ERTA 3LXTA 4K7IA 4ULXA 1PMTA 2JU5A 6GSXA 1BYEA 4WKWA 3H4KA 4NMUA 3RPNA 2AJQB 1KNGA 2ZCTA 3F0IA 4OMVA 1ML6A 5IMVA 2VLVA 3DXBA 4HQSA 1ZMAA 3P7XA 3W6GA 1YY7A 1THXA 2CAIA 2DJ1A 3EC3A 2QGVA 3J7Yb 3CMIA 5IOXA 3IRAA 2FWEA 5B6NA 1G6WA 2HLSA 2R5GA 1TTZA 3TGZA 3RDWA 4TR4A 2EC4A 3HVSA 5HFKA 4MH2A 2MMAA 3FK8A 3QR6A 2JZTA 1GSQA 5IPHA 3HJPA 2MMOA 2MMNA 3TKRA 2H6XA 2LQQA 1SL0B 3UVHA 2YN1A 2H0HA 3C8EA 3M8NA 1JZOA 3FKFA 1M7TA 2E2MA 2YCDA 4EKZA 1IYIA 2PWJA 4TW5A 4MZCA 4V1Ap 2YJHA 2KOKA 2FGXA 5IOWA 5JCWA 2H30A 5CO3A 2WCIA 3MNGA 5ECIB 3DEXA 3D4MA 1K0MA 3RBTA 2BTOT 1K0AA 3RAZA 3HYPA 4EE0A 4HI7A 5GZZB 3ZL5A 2B1LA 3IC4A 1JZDA 5EL8A 1G0TA 5KN2A 2O7KA 1JLVA 3LWAA 1SU9A 3I6AA 2GDRA 2H6YA 3U5RE 1SJZA 1K0OA 3GKMA 2H01A 4XHMA 3TCOA 4CHSA 4LMWA 2LEGA 3A3TA 1K0NA 2JSZA 4GSNA 3GKNA 3E3EA 1GTUA 3GFKA 3HJOA 1KBNA 3TKSA 1XWGA 4F03A 4KSMA 5KN0A 3ZIVA 1H75A 2F8FA 4X43A 3UMAA 2O8VB 2XHFA 2QC7A 5DALB 1FAAA 5F06A 3L4NA 2LRCA 1WE0A 1MDKA 3Q19A 3ZVJA 1OYJA 4NV5A 5IMZA 1GWCA 3D4TA 2E0QA 3Q74A 4BVXA 1BQ7A 1ACVA 3QOUA 4BVYA 4EL1A 4JRRA 1AIUA 1TXXA 1GULA 3GL3A 2PGTA 1URMA 3LGCA 6GSWA 2AV4A 2DSAA 2DJ0A 2L5LA 3GV1A 2RM6A 5CP1A 1GSUA 2V2GA 2FD3A 4MABA 2L5OA 1TRUA 2CX4A 2C1YA 3W8SA 1ZCPA 5DVBA 4IW9A 5DAKB 1T00A 1SYXA 3IA1A 2LQOA 2I1UA 3O6TA 4HU7A 3A2XA 1TU8A 2CT6A 3H8QA 2N5FA 1DE2A 1PX6A 1AC1A 3D21A 1PQNA 3UVTA 1MD3A 4OFTA 4FYCA 4IP1A 3A2WA 3NZNA 1IYHA 5D8IA 3GX0A 4J2FA 4WXTA 2JL4A 2WZ9A 3UOMA 1UC7A 4ZL9A 1V98A 1ERVA 2RUFA 4TXVA 1B9XC 1F3BA 1HNAA 1HNCA 3TJJA 4J56E 4ZBBA 2DLXA 5A4UA 2AYTA 4PQIA 1Z7RA 2LNSA 2VCQA 4ML6A 2LSTA 2NDOA 1SKWB 4G19A 4I2UA 4K9ZA 4OWYA 1X9WB 1EV4A 1Q4JA 3W8JA 1JLWA 2HNLA 1GLPA 1XXUA 1S3AA 2DJ3A 5F07A 2C3QA 5B8BA 1Y25A 3J7Yk 1XOAA 4LLRA 2F3MA 3GH6A 3VWUA 2C0EA 4ISDA 6GSYA 3QFAC 4H86A 2IWTA 4G2EA 1WOUA 5J5NA 2O89A 4YAPA 4N10A 1K0BA 2E2GA 1F6MC 3KM6A 4PURA 1SJIA 2P5QA 2B5YA 2GSRA 5D9TA 4ECBA 1WRYA 2OKAA 1XVQA 3L9VA 1XPVA 4F82A 5GSTA 1PSQA 5AN1A 2H1GA 5IPGA 1ZOFA 1Z7PA 4ACSA 2H72A 3US3A 1F3AA 1J0FA 2HE3A 4TN8A 3G7IA 4XIHA 2X99A 1Z3EA 3CTFA 1SYRA 2FCHA 1K3LA 1B9YC 12GSA 4TR1B 3FZ9A 3TRQA 3WT2A 1LBKA 1XCCA 5G1KA 2YOIA 3HJMA 5IO0A 4EXJA 2ON7A 1QMVA 4MP4A 4N11A 2K8SA 2K9FA 2VL9A 2L57A 4ID0A 4X1UA 1RW1A 4XS1A 1GH2A 6GSTA 1XVWA 3ED3A 4ZBAA 4V1Ag 3M3MA 1HNBA 2GT6A 5ECHB 3EMPA 1XW6A 3KP9A 4XRAA 3LYKA 1ZYEA 5EPFA 2IL3A 4XS6A 2H71A 4HQZA 4N30A 3VPTA 2AUVA 5H5QA 5JWOB 1LJRA 2I4AA 4EC0A 1U88A 3UAPA 1VGLA 4WETA 5COHA 1A2LA 1U3AA 1XWCA 1EP7A 2R37A 4BA7A 3TKQA 5HR3A 1GSEA 2O85A 5EVOA 4ECIA 4GQCA 4LL4B 4KDXA 1A23A 4TR0A 4HS1A 5G1LA 4V2MA 2CVBA 2OBKA 4Q5NA 3Q18A 4NHWA 1FHEA 2JACA 3HVXA 5ID2A 3DIEA 1PN9A 3VWXA 1PL1A 3D22A 1J08A 4FO5A 1N2AA 1T3BA 3KD0A 4D73A 3BCIA 2YZUA 3EVIA 5JCUA 3HY2A 1AQVA 1YF1A 3HKRA 2KP2A 1Z5YE 3TJKA 4K7OA 1VF1A 3HDCA 18GSA 16GSA 3NIVA 2WJUA 1X5DA 1MEKA 1PA3A 3ZVJD 3F3RA 4CW9A 1B4PA 3HA9A 4MF7A 4ZXGA 4IHUA 2FHEA 3VI5A 1XW5A 7GSSA 1F2EA 6GSUA 1ZYQB 1YKAA 2VCZA 2HZEA 2DJJA 4Q5FA 3TJGA 1BJXA 2IPAA 4TR3A 3UJ1A 1M99A 5D9VA 5LD0A 3QFBC 1GL8A 2LKUA 1ZGNA 3RHCA 5ID2B 1THOA 1Z6NA 1JFUA 1Q98A 2GSTA 2K6VA 2AAWA 1WPIA 1N8JA 1C72A 2ON5A 2V41A 1B4QA 2CA8A 4MLYA 1MD4A 5A5KA 2LS5A 2IMDA 3CTGA 1S3CA 2HRNA 1O6JA 1S3DA 3TKPA 2ALBA 1V9WA 1XW9A 1QQ2A 3G9BA 4DSQA 2CVKA 1A0FA 3O3TA 2WGRA 4F2IA 1W89A 5HQPA 3QAVA 2FLSA 3VFIA 4ZB6A 4RQRA 4KAEA 1R7HA 4NV2A 1EOGA 4LMVA 3ZZXA 4NHZA 2HZEB 5D96A 4IJIA 1GNEA
chains in the Genus database with same CATH superfamily
1T8EB 4MZWA 2PVOC 5ECRB 2FUG2 1XIYA 4ZL8A 2LUSA 1KTEA 1M3JA 2PN8A 2B1KA 2YP6A 3F9UA 3GL5A 5ELGA 2YWMA 1X9SB 4WF5A 3RHBA 4GXZA 4OFNA 3ZTLA 4PNGA 3PPUA 2PERA 2LTKA 3N5OA 2H75A 2LRNA 4G10A 3QDNA 22GSA 2N5AA 4L0WA 4KSOA 3ERFA 2WS2A 1X5CA 4I6XA 2D2ZA 3MSZA 2EIRA 3IPZA 2I81A 4L0UA 2C0DA 3WD6A 1TU7A 2O87A 3APOA 3APSA 3C71A 1MDJA 2H1BA 4KX4A 3TJFA 1I5GA 3KTBA 5CREA 5AGYA 1SD9A 4OCEA 4ECJA 1OC9B 3TJBA 2HYXA 4GF0A 3ZMLA 5DALA 3UEMA 3CBUA 3HD5A 3GSSA 5DCHA 1TRWA 3UL3A 5CRDA 2YANA 3LSZA 5H5RA 1OVNA 4KW6A 1TI1A 5KOWA 1OAZA 1R5AA 1V58A 3R2QA 2FWGA 4KCAA 4POKA 2X4AA 1DSBA 2DIZA 2G0FA 1ZZYA 5KN1A 5CNWA 1K0DA 3KGKA 3NOFA 2L4QA 5IO2A 3KJYA 1HQOA 1OKTA 3C1SA 2OJLA 2I3YA 3F8UA 2IFQB 2GVPA 1MTCA 3EYTA 3RPPA 2LNTA 5FT3A 3L0HA 5DAKA 1AAZA 5IQYA 19GSA 1UN2A 2QA1A 4IKHA 1WWJA 4NAXA 1JZRA 4KA0A 2BJXA 3GMFA 3F4SA 2HZFA 2LRTA 2G2QA 4HJMA 3IC8A 3UIWA 2WB9A 4EVMA 5DJMA 3HCZA 4OCFA 2LJAA 1EGOA 1EWXA 3GA4A 4LL1B 2WDUA 3VWWA 2HI7A 2YNXA 2IIYA 2L59A 5ECKB 3WGEA 1AQXA 3IE3A 1ON4A 2K18A 4PX1A 2FNOA 2CZ2A 2GQLA 5L71A 1ERWA 1TRVA 3VK9A 2IMKA 4GWRA 3DVWA 4RUVA 1TRSA 3GUSA 3IAS2 1PGTA 2WULA 1R26A 3BD2A 3C1RA 3CRTA 2VL2A 2HSMA 1GUKA 3Q6OA 1TK0B 5FWGA 2B5EA 3TKSC 1QGVA 11GSA 2H6ZA 4HUAA 5B6MA 2IMFA 1T7PB 4XTSA 1M3IA 5CAXA 4K6XA 4MZBA 4IBPA 3VLNA 1E2YA 2A2PA 1TP9A 5HR1A 1JZWA 4WBRD 2PUKC 5BMUA 1SENA 4DEJA 1O73A 1G7EA 4JR6A 2VCVA 1TI3A 4ILFA 4MH3A 6GSVA 3ZRDA 1GLQA 2F51A 3P2AA 3KXOA 3UBKA 5ECSA 4DSSB 5ECQB 4ZB9A 4TR1A 1TKDB 2B5XA 3QAGA 2FWHA 3ZREA 1J9BA 3KCMA 4TXOA 2YWNA 3QPMA 2HXKA 1TK8B 4K5RA 4ML1A 2FY6A 4EDZA 2GSQA 4K1FA 3L9UA 5IIZA 1ZL9A 4KGIA 3G7JA 2HRKA 4K2DA 1QUWA 4JR4A 2PBJA 1M9AA 4JU5A 1FG4A 1M9BA 1HYUA 1K0CA 3F63A 2PVQA 3KZQA 5J4UA 1FVKA 4NWYA 1AXDA 1PX7A 1A8YA 5C04A 2VM1A 4F0CA 1NSWA 5IM9A 2YV7A 1NM3A 4JBBA 3L9SA 2R3XA 1V40A 2IMIA 5KN3A 4TKYA 2E7PA 2RUEA 3GURA 4BPYA 3KP8A 1ST9A 3LJRA 3BBYA 4J57E 4HOJA 2K8VA 3E0UA 3F3QA 1TJDA 2GLRA 3QCPA 1ZYPA 2IMEA 4TXOB 2YWIA 2CV4A 4QL7A 2ZUPA 4GQFA 1YKCA 2PPTA 4GLTA 3TKSE 4ZBDA 4ZL7A 3EINA 1AQWA 5HR0A 2MBSA 3FZ5A 3ZMKA 1T1VA 5CRWA 4JZQA 1FO5A 1M0UA 3IV4A 5H5SA 5DBQA 4V2NA 3EPTA 4WBJA 1VF4A 2A2SA 2YV9A 1VF2A 3G7YA 5A4WA 2OBIA 4YAVA 5HFGA 2MYGA 4RQXA 3DYRA 1EGRA 2XPEA 5J3RA 2H66A 1PKZA 1I9DA 3GKXA 2C3TA 4LA1A 1ILOA 1PRXA 1YF0A 3FR9A 2GZZA 4ZILA 3GX8A 2VCWA 2H70A 5BRTA 5DJLA 2CZ3A 1A24A 3M9KA 5AIXA 1GSFA 2GQKA 5IMFA 4BL7B 3DRNA 2GZPA 3KH9A 2YWOA 1SL1B 2C80A 3M0FA 3F6DA 4JEDA 2H1DA 5GAPD 2MMZA 3AY8A 4MF5A 3SWLA 4KF9A 1SK1A 1SK0A 5CRGA 3P90A 1NHOA 2LJKA 2N5BA 4AJ8A 1CQGA 3I69A 3H79A 2TRCP 5D9WA 2B7KA 5JWQB 1SJ6A 1QXHA 4GTUA 4O5RA 2XBIA 6GSSA 4GRFA 2DKHA 3VI7A 1PFOA 5ECNB 3ZYWA 2VM2A 5ABRA 5G2ZA 5AIVA 4O5QA 1B48A 1G7OA 3F6FA 3U6VA 5KEJA 3H93A 1U3IA 3DD3A 2M80A 1B8XA 4WR5A 4POMA 5IMAA 3GSTA 3GTUA 3IR4A 13GSA 4AF2A 4MDCA 2CX3A 2EIOA 3IAM2 4DVCA 4L5OA 4L8EA 2DMMA 3ZIJA 4QL9A 2VAFA 5DQYA 4MF6A 2C4JA 2PMTA 5A4VA 1X5EA 4K2XA 3ME8A 4F0BA 3IDVA 4I2TA 3DVXA 4MA9A 4MJBA 5J41A 1XZOA 2AHEA 2H0GA 1EEJA 4YKFA 3ZFLA 3FW2A 4V2LA 3ERWA 5EY6A 5ENUA 2PU9C 2OADA 1Z9HA 4BWQA 2KLXA 2HFDA 4O5UA 2OA7A 2R2JA 4IN0A 2QSIA 1EOHA 3VURA 1OC9A 4MJEA 5E4WA 4AJ6A 4K7NA 5J9CA 4GCIA 1TW9A 1SL2B 1NHYA 2NTOA 3GTUB 2R6KA 2OE0A 1FB6A 4HEA2 2OACA 3WGDA 3FHKA 4YKGA 3ZLPA 1U87A 4FIWA 3D5JA 3R3EA 1XBSA 2HT9A 1FW1A 1FOVA 1YZXA 3HZ8A 3CRUA 1AUCA 4Z2UA 1SKRB 2IFQA 3EURA 3LYPA 1GSSA 1M2AA 3TOTA 4XCSA 4TRXA 1XWBA 4MMMA 5IMDA 2YZHA 3LXZA 4PXOA 3DKSA 2HSYA 5B7CA 1OE7A 4YQMA 1XOBA 4N0ZA 2H0IA 4NXIA 2J23A 3KMOA 3VPQA 4KDUA 3QAWA 4XS4B 5AISA 10GSA 1M2DA 3TDGA 1WP0A 4NPBA 1A2JA 3V1WA 3GNJA 3O76A 4KUNA 4PNFA 1EEMA 1OKDA 5G30A 5D73A 2P0GA 1TOFA 1EZKA 1Z6MA 4YQUA 2DC5A 1GUHA 3PGTA 3QD9A 3IOSA 2DKIA 1RQMA 3GHAA 2MZCA 1FB0A 4POBA 4AJ7A 3FMWA 4YH2A 4EO3A 1R5PA 2V1MA 2GS3A 4MPFA 1O8XA 1BAYA 2LV3A 1GP1A 4ECCA 1OC3A 4IP6A 3KH7A 3IHQA 5HFIA 1BX9A 1SKSB 1XWAA 1V2AA 4PQ1A 2CAQA 1MDIA 20GSA 4FYBA 3FR3A 1F9MA 4I97A 3GRXA 3PINA 4MCUA 3FRCA 3CYNA 2KHPA 5GSSA 4EUYA 2LJRA 3IK7A 4L5LA 1GUMA 3ZITA 4OFMA 3EWLA 2VIMA 5B8AA 2X64A 2JSYA 2VCXA 4RI6A 1HD2A 4ZB8A 4CDOA 2F9SA 3IBHA 5FHIA 2RLIA 3DMLA 1WMJA 1FVJA 1W4VA 5JWRB 2Z9SA 1TDIA 1A8LA 2ZNMA 2ES7A 1QFNA 4DSSA 3KEBA 1PD21 3ISOA 4G0IA 1YEXA 2TIRA 4IGJA 1DE1A 1XWKA 4Q5RA 2CVDA 2GZYA 2L6CA 3E9JB 4O92A 1ABAA 3HVVA 2A2RA 3TB2A 5LNKe 5CYYA 3A5WA 3LQ7A 3CSIA 3QMXA 2V6KA 1T4ZA 1M2BA 2XPDA 1QK8A 5F8BA 2M46A 2VD1A 2CQ9A 4GSTA 1T4YA 4PGTA 1SD8A 14GSA 4QQ7A 2YJ7A 5ECLB 4I5QA 2C0GA 1YDKA 5G5EA 3BJ5A 2C0FA 2C8UA 4P3YB 1WJKA 4EF0A 3I9V2 3HHVA 4RI7A 4PTSA 2NPBA 4KB3A 3MDKA 2H73A 5F0GA 2VLTA 3LFLA 2A4VA 2GTUA 3UBLA 5DQSA 5ELAA 3L78A 2VLUA 1K3YA 3IXRA 1XFLA 4BVXB 2MBTA 2GGTA 1KEBA 2REMA 1R4WA 3F4TA 4IJ3A 2BMXA 4FYUA 4F9ZA 4BVYB 3LW9A 4O7HA 2TRXA 3SBCA 4MJCA 17GSA 2VL2C 3K8NA 3ZFBA 1YQ1A 4E8EA 3GN3A 1OC8A 2VO4A 4IVFA 9GSSA 1CQHA 2VD0A 2WFCA 5IMCA 2H74A 3EMXA 1V57A 1DUGA 3VWVA 1GTIA 3APQA 3C7MA 3IHGA 4MNNA 1PKWA 2L6DA 2P31A 1O85A 2I9HA 3MWHA 1H4OA 2JADA 2M72A 4O32A 3IK9A 1BEDA 4XRDA 1A0RP 4IQ1A 1GTAA 1USBA 4K8MA 3DWVA 1DBYA 3CSJA 2DJKA 1TK5B 3FZAA 3ME7A 2YPMA 2P5RA 5LCZA 2B3SA 5ECOB 3LG6A 3JCML 5HR2A 5INYA 2B7JA 3C73A 3DGQA 4TOPA 1Y6EA 4OO5A 2C3NA 4HSCX 4IELA 2GSSA 2V6OA 3A5IA 4K0NA 3F4RA 4BL7A 3P8WA 2VOCA 1F37A 3CQFA 4ZIJA 2RIIA 3WYWA 2WRTA 1VRSD 2FWFA 4JE1A 1WIKA 1JHBA 4HZ2A 2JZSA 2VUPA 4KH7A 4MJAA 4OD7A 3WT1A 2A4HA 4KE3A 3WGXA 2IN3A 3GIXA 3EE2A 2J9HA 2QKEA 3D0ZA 4AGSA 4PUAA 1U6TA 3FEUA 3S9FA 2GT5A 4G9HA 5F05A 1G6YA 4X4JA 1EV9A 1YEPA 4BWSA 3BCKA 2R0PA 4KCEA 5E59A 2R4VA 5ECPB 1UA5A 2FA8A 3N9JA 2GQMA 4KNDA 2VCTA 3PH9A 3ERGA 5D9XA 4YQVA 1OE8A 5G5FA 1EP8A 4WR4A 1S3RA 4E8HA 3BOAA 2DBCA 5CRHA 1PL2A 4OO4A 5C00A 1X0RA 5DDLA 2H8LA 3LORA 1K3OA 3PR8A 1UVZA 2FA4A 3EU3A 1RK4A 3TOUA 3GKKA 2JZRA 2DIYA 4EDYA 1ERUA 4Q5QA 1VF3A 5J9BA 1GSYA 3M1GA 2OE1A 2AB6A 5ECMB 1BG5A 2RM5A 3TRXA 2X8CA 4DSRA 4Z2RA 2HSHA 2KUCA 3HZ4A 2HRFA 1O8WA 4PQHA 4WF4A 4POLA 4MPGA 5GAND 1GNWA 2L4CA 2H76A 2F8AA 1NW2A 3HXSA 1AW9A 3D6IA 2DMLA 4TVEA 2IJYA 1GRXA 1ZYNA 3GH9A 4IS0A 8GSSA 1X9MB 1SK2A 4HDEA 1GTBA 2KP1A 1GSDA 5G31A 2H19A 4HZ4A 1E6BA 3MYDA 4WEYA 2X8HA 2NBSA 3I43A 3TUEA 5D93A 3GYKA 3FR6A 4HU9A 1LU4A 3EU4A 4Z7XA 3KIJA 4GSSA 4PUFC 3A2VA 3H1NA 4HJ2A 3CXGA 4IQAA 3LEFA 3KTLA 2X8GA 4K0GA 1A2MA 4D73B 2NVLA 4FH8A 5DCGA 2OE3A 2XC2A 3UARA 4X0XA 3TRPA 3M9JA 3OR5A 2B6MA 2VL3A 3FYGA 4KDYA 4XS4A 3FY7A 4EIPA 2DJ2A 1O7UA 3MAKA 1YJ6A 4MK3A 4N0VA 3KMNA 2V32A 4I8BA 1O81A 3CSHA 2XBQA 2EIQA 3FZ4A 5JCGA 2UZ8A 2H1AA 4G0KA 1ERTA 3LXTA 4K7IA 4ULXA 1PMTA 2JU5A 6GSXA 1BYEA 4WKWA 3H4KA 4NMUA 3RPNA 2AJQB 1KNGA 2ZCTA 3F0IA 4OMVA 1ML6A 5IMVA 2VLVA 3DXBA 4HQSA 1ZMAA 3P7XA 3W6GA 1YY7A 1THXA 2CAIA 2DJ1A 3EC3A 2QGVA 3J7Yb 3CMIA 5IOXA 3IRAA 2FWEA 5B6NA 1G6WA 2HLSA 2R5GA 1TTZA 3TGZA 3RDWA 4TR4A 2EC4A 3HVSA 5HFKA 4MH2A 2MMAA 3FK8A 3QR6A 2JZTA 1GSQA 5IPHA 3HJPA 2MMOA 2MMNA 3TKRA 2H6XA 2LQQA 1SL0B 3UVHA 2YN1A 2H0HA 3C8EA 3M8NA 1JZOA 3FKFA 1M7TA 2E2MA 2YCDA 4EKZA 1IYIA 2PWJA 4CY6A 4TW5A 4MZCA 4V1Ap 2YJHA 2KOKA 2FGXA 5IOWA 5JCWA 2H30A 5CO3A 2WCIA 3MNGA 5ECIB 3DEXA 3D4MA 1K0MA 3RBTA 2BTOT 1K0AA 3RAZA 3HYPA 4EE0A 4HI7A 5GZZB 3ZL5A 2B1LA 3IC4A 1JZDA 5EL8A 1G0TA 5KN2A 2O7KA 1JLVA 3LWAA 1SU9A 3I6AA 2GDRA 2H6YA 3U5RE 1SJZA 1K0OA 3GKMA 2H01A 4XHMA 3TCOA 4CHSA 4LMWA 2LEGA 3A3TA 1K0NA 2JSZA 4GSNA 3GKNA 3E3EA 1GTUA 3GFKA 3HJOA 1KBNA 3TKSA 1XWGA 4F03A 4KSMA 5KN0A 3ZIVA 1H75A 2F8FA 4X43A 3UMAA 2O8VB 2XHFA 2QC7A 5DALB 1FAAA 5F06A 4K5SA 3L4NA 2LRCA 1WE0A 1MDKA 3Q19A 3ZVJA 1OYJA 4NV5A 2QA2A 5IMZA 1GWCA 3D4TA 2E0QA 3Q74A 4BVXA 1BQ7A 1ACVA 3QOUA 4BVYA 4EL1A 4JRRA 1AIUA 1TXXA 1GULA 3GL3A 2PGTA 1URMA 3LGCA 6GSWA 4BIKA 2AV4A 2DSAA 2DJ0A 2L5LA 3GV1A 2RM6A 5CP1A 1GSUA 2V2GA 2FD3A 4MABA 2L5OA 1TRUA 2CX4A 2C1YA 3W8SA 1ZCPA 5DVBA 4IW9A 5DAKB 1T00A 1SYXA 3IA1A 2LQOA 2I1UA 3O6TA 4HU7A 3A2XA 1TU8A 2CT6A 3H8QA 2N5FA 1DE2A 1PX6A 1AC1A 3D21A 1PQNA 3UVTA 1MD3A 4OFTA 4FYCA 4IP1A 3A2WA 3NZNA 1IYHA 5D8IA 3GX0A 4J2FA 4WXTA 2JL4A 2WZ9A 3UOMA 1UC7A 4ZL9A 1V98A 1ERVA 2RUFA 4TXVA 1B9XC 1F3BA 1HNAA 1HNCA 3TJJA 4J56E 4ZBBA 2DLXA 5A4UA 2AYTA 4PQIA 1Z7RA 2LNSA 2VCQA 4ML6A 2LSTA 2NDOA 1SKWB 4G19A 4I2UA 4K9ZA 4OWYA 1X9WB 1EV4A 1Q4JA 3W8JA 1JLWA 2HNLA 1GLPA 1XXUA 1S3AA 2DJ3A 5F07A 2C3QA 5B8BA 4G0LA 1Y25A 3J7Yk 1XOAA 2HRAA 4LLRA 2F3MA 3GH6A 3VWUA 2C0EA 4ISDA 6GSYA 3QFAC 4H86A 2IWTA 4G2EA 1WOUA 5J5NA 2O89A 4YAPA 4N10A 1K0BA 2E2GA 1F6MC 3KM6A 4PURA 1SJIA 2P5QA 2R0CA 2B5YA 2GSRA 5D9TA 4ECBA 1WRYA 2OKAA 1XVQA 3MIXA 3L9VA 1XPVA 4F82A 5GSTA 1PSQA 5AN1A 2H1GA 5IPGA 1ZOFA 1Z7PA 4ACSA 2H72A 3US3A 1F3AA 1J0FA 2HE3A 4TN8A 3G7IA 4XIHA 2X99A 1Z3EA 3CTFA 1SYRA 2FCHA 1K3LA 1B9YC 4CY8A 12GSA 4TR1B 3FZ9A 3TRQA 3WT2A 1LBKA 1XCCA 5G1KA 2YOIA 3HJMA 5IO0A 4EXJA 2ON7A 1QMVA 4MP4A 4N11A 2K8SA 2K9FA 2VL9A 2L57A 4ID0A 4X1UA 1RW1A 4XS1A 1GH2A 6GSTA 1XVWA 3ED3A 4ZBAA 4V1Ag 3M3MA 1HNBA 2GT6A 5ECHB 3EMPA 1XW6A 3KP9A 4XRAA 3LYKA 4FQUA 1ZYEA 5EPFA 2IL3A 4XS6A 2H71A 4HQZA 4ICYA 4N30A 2AUVA 5H5QA 3VPTA 5JWOB 1LJRA 2I4AA 4EC0A 1U88A 3UAPA 1VGLA 4WETA 5COHA 1A2LA 1U3AA 1XWCA 1EP7A 2R37A 4BA7A 3TKQA 5HR3A 1GSEA 2O85A 5EVOA 4ECIA 4GQCA 4LL4B 4KDXA 1A23A 4TR0A 4HS1A 5G1LA 4V2MA 2CVBA 2OBKA 1PN0A 4Q5NA 3Q18A 4NHWA 1FHEA 2JACA 3HVXA 5ID2A 3DIEA 1PN9A 3VWXA 1PL1A 3D22A 1J08A 2R0GA 4FO5A 1N2AA 4USSA 1T3BA 3KD0A 4D73A 3BCIA 2YZUA 3EVIA 5JCUA 3HY2A 1AQVA 1YF1A 3HKRA 2KP2A 1Z5YE 3HVNA 3TJKA 4K7OA 1VF1A 3HDCA 18GSA 16GSA 3NIVA 2WJUA 1X5DA 1MEKA 1PA3A 3ZVJD 3F3RA 4CW9A 1B4PA 3HA9A 4MF7A 4ZXGA 4IHUA 2FHEA 3VI5A 1XW5A 7GSSA 1F2EA 6GSUA 1ZYQB 1YKAA 2VCZA 2HZEA 2DJJA 4Q5FA 3TJGA 1BJXA 2IPAA 4TR3A 2X49A 3UJ1A 4A5PA 1M99A 5D9VA 5LD0A 3QFBC 1GL8A 2LKUA 1ZGNA 3RHCA 5ID2B 1THOA 1Z6NA 1JFUA 4Z2TA 1Q98A 2GSTA 2K6VA 4EIQA 2AAWA 1WPIA 1N8JA 1C72A 1XG8A 2ON5A 2V41A 1B4QA 1FOHA 2CA8A 4MLYA 1MD4A 5A5KA 2LS5A 2IMDA 3CTGA 1S3CA 2HRNA 1O6JA 1S3DA 3TKPA 2ALBA 1V9WA 1XW9A 1QQ2A 3G9BA 4DSQA 2CVKA 1A0FA 3O3TA 2WGRA 4F2IA 1W89A 5HQPA 3QAVA 2FLSA 3VFIA 4ZB6A 4RQRA 4KAEA 1R7HA 4NV2A 1EOGA 4LMVA 3ZZXA 4NHZA 2HZEB 5D96A 5KOXA 4IJIA 1GNEA
chains in the Genus database with same CATH topology
1T8EB 4MZWA 2PVOC 5ECRB 2FUG2 1XIYA 4ZL8A 2LUSA 1KTEA 2PN8A 2B1KA 2YP6A 3F9UA 3GL5A 5ELGA 2YWMA 1X9SB 4WF5A 3RHBA 4GXZA 4OFNA 3ZTLA 4PNGA 3PPUA 2PERA 2LTKA 3N5OA 2H75A 2LRNA 4G10A 3QDNA 22GSA 2N5AA 4L0WA 4KSOA 3ERFA 2WS2A 1X5CA 4I6XA 2D2ZA 3MSZA 2EIRA 3IPZA 2I81A 4L0UA 2C0DA 3WD6A 1TU7A 2O87A 3APOA 3APSA 3C71A 1MDJA 2H1BA 4KX4A 3TJFA 1I5GA 3KTBA 5CREA 5AGYA 1SD9A 4OCEA 4ECJA 1OC9B 3TJBA 2HYXA 4GF0A 3ZMLA 5DALA 3UEMA 3CBUA 3HD5A 3GSSA 5DCHA 1TRWA 3UL3A 5CRDA 2YANA 3LSZA 5H5RA 1OVNA 4KW6A 1TI1A 5KOWA 1OAZA 1R5AA 1V58A 3R2QA 2FWGA 4KCAA 4POKA 2X4AA 1DSBA 2DIZA 2G0FA 1ZZYA 5KN1A 5CNWA 1K0DA 3KGKA 3NOFA 2L4QA 5IO2A 3KJYA 1HQOA 1OKTA 3C1SA 2OJLA 2I3YA 3F8UA 2IFQB 2GVPA 1MTCA 3EYTA 3RPPA 2LNTA 5FT3A 3L0HA 5DAKA 1AAZA 5IQYA 19GSA 1UN2A 2QA1A 4IKHA 1WWJA 4NAXA 1JZRA 4KA0A 2BJXA 3GMFA 3F4SA 2HZFA 2LRTA 2G2QA 4HJMA 3IC8A 3UIWA 2WB9A 4EVMA 5DJMA 3HCZA 4OCFA 2LJAA 1EGOA 1EWXA 3GA4A 4LL1B 2WDUA 3VWWA 2HI7A 2YNXA 2IIYA 2L59A 5ECKB 3WGEA 1AQXA 3IE3A 1ON4A 2K18A 4PX1A 2FNOA 2CZ2A 2GQLA 5L71A 1ERWA 1TRVA 3VK9A 2IMKA 4GWRA 3DVWA 4RUVA 1TRSA 3GUSA 3IAS2 1PGTA 2WULA 1R26A 3BD2A 3C1RA 3CRTA 2VL2A 2HSMA 1GUKA 3Q6OA 1TK0B 5FWGA 2B5EA 3TKSC 1QGVA 11GSA 2H6ZA 4HUAA 5B6MA 2IMFA 1T7PB 4XTSA 5CAXA 4K6XA 4MZBA 4IBPA 3VLNA 1E2YA 2A2PA 1TP9A 5HR1A 1JZWA 4WBRD 2PUKC 5BMUA 1SENA 4DEJA 1O73A 1G7EA 4JR6A 2VCVA 1TI3A 4ILFA 4MH3A 6GSVA 3ZRDA 1GLQA 2F51A 3P2AA 3KXOA 3UBKA 5ECSA 4DSSB 5ECQB 4ZB9A 4TR1A 1TKDB 2B5XA 3QAGA 2FWHA 3ZREA 1J9BA 3KCMA 4TXOA 2YWNA 3QPMA 2HXKA 1TK8B 4K5RA 4ML1A 2FY6A 4EDZA 2GSQA 4K1FA 3L9UA 5IIZA 1ZL9A 4KGIA 3G7JA 2HRKA 4K2DA 1QUWA 4JR4A 2PBJA 1M9AA 4JU5A 1FG4A 1M9BA 1HYUA 1K0CA 3F63A 2PVQA 3KZQA 5J4UA 1FVKA 4NWYA 1AXDA 1PX7A 1A8YA 5C04A 2VM1A 4F0CA 1NSWA 5IM9A 2YV7A 1NM3A 4JBBA 3L9SA 2R3XA 1V40A 2IMIA 5KN3A 4TKYA 2E7PA 2RUEA 3GURA 4BPYA 3KP8A 1ST9A 3LJRA 3BBYA 4J57E 4HOJA 2K8VA 3E0UA 3F3QA 1TJDA 2GLRA 3QCPA 1ZYPA 2IMEA 4TXOB 2YWIA 2CV4A 4QL7A 2ZUPA 4GQFA 1YKCA 2PPTA 4GLTA 3TKSE 4ZBDA 4ZL7A 3EINA 1AQWA 5HR0A 2MBSA 3FZ5A 3ZMKA 1T1VA 5CRWA 4JZQA 1FO5A 1M0UA 3IV4A 5H5SA 5DBQA 4V2NA 3EPTA 4WBJA 1VF4A 2A2SA 2YV9A 1VF2A 3G7YA 5A4WA 2OBIA 4YAVA 5HFGA 2MYGA 4RQXA 3DYRA 1EGRA 2XPEA 5J3RA 2H66A 1PKZA 1I9DA 3GKXA 2C3TA 4LA1A 1ILOA 1PRXA 1YF0A 3FR9A 2GZZA 4ZILA 3GX8A 2VCWA 2H70A 5BRTA 5DJLA 2CZ3A 1A24A 3M9KA 5AIXA 1GSFA 2GQKA 5IMFA 4BL7B 3DRNA 2GZPA 3KH9A 2YWOA 1SL1B 2C80A 3M0FA 3F6DA 4JEDA 2H1DA 5GAPD 2MMZA 3AY8A 4MF5A 3SWLA 4KF9A 1SK1A 1SK0A 5CRGA 3P90A 1NHOA 2LJKA 2N5BA 4AJ8A 1CQGA 3I69A 3H79A 2TRCP 5D9WA 2B7KA 5JWQB 1SJ6A 1QXHA 4GTUA 4O5RA 2XBIA 6GSSA 4GRFA 2DKHA 3VI7A 5ECNB 3ZYWA 2VM2A 5ABRA 5G2ZA 5AIVA 4O5QA 1B48A 1G7OA 3F6FA 3U6VA 5KEJA 3H93A 1U3IA 3DD3A 2M80A 1B8XA 4WR5A 4POMA 5IMAA 3GSTA 3GTUA 3IR4A 13GSA 4AF2A 4MDCA 2CX3A 2EIOA 3IAM2 4DVCA 4L5OA 4L8EA 2DMMA 3ZIJA 4QL9A 2VAFA 5DQYA 4MF6A 2C4JA 2PMTA 5A4VA 1X5EA 4K2XA 3ME8A 4F0BA 3IDVA 4I2TA 3DVXA 4MA9A 4MJBA 5J41A 1XZOA 2AHEA 2H0GA 1EEJA 4YKFA 3ZFLA 3FW2A 4V2LA 3ERWA 5EY6A 5ENUA 2PU9C 2OADA 1Z9HA 4BWQA 2KLXA 2HFDA 4O5UA 2OA7A 2R2JA 4IN0A 2QSIA 1EOHA 3VURA 1OC9A 4MJEA 5E4WA 4AJ6A 4K7NA 5J9CA 4GCIA 1TW9A 1SL2B 1NHYA 2NTOA 3GTUB 2R6KA 2OE0A 1FB6A 4HEA2 2OACA 3WGDA 3FHKA 4YKGA 3ZLPA 1U87A 4FIWA 3D5JA 3R3EA 1XBSA 2HT9A 1FW1A 1FOVA 1YZXA 3HZ8A 3CRUA 1AUCA 4Z2UA 1SKRB 2IFQA 3EURA 3LYPA 1GSSA 1M2AA 3TOTA 4XCSA 4TRXA 1XWBA 4MMMA 5IMDA 2YZHA 3LXZA 4PXOA 3DKSA 2HSYA 5B7CA 1OE7A 4YQMA 1XOBA 4N0ZA 2H0IA 4NXIA 2J23A 3KMOA 3VPQA 4KDUA 3QAWA 4XS4B 5AISA 10GSA 1M2DA 3TDGA 1WP0A 4NPBA 1A2JA 3V1WA 3GNJA 3O76A 4KUNA 4PNFA 1EEMA 1OKDA 5G30A 5D73A 2P0GA 1TOFA 1EZKA 1Z6MA 4YQUA 2DC5A 1GUHA 3PGTA 3QD9A 3IOSA 2DKIA 1RQMA 3GHAA 2MZCA 1FB0A 4POBA 4AJ7A 3FMWA 4YH2A 4EO3A 1R5PA 2V1MA 2GS3A 4MPFA 1O8XA 1BAYA 2LV3A 1GP1A 4ECCA 1OC3A 4IP6A 3KH7A 3IHQA 5HFIA 1BX9A 1SKSB 1XWAA 1V2AA 4PQ1A 2CAQA 1MDIA 20GSA 4FYBA 3FR3A 1F9MA 4I97A 3GRXA 3PINA 4MCUA 3FRCA 3CYNA 2KHPA 5GSSA 4EUYA 2LJRA 3IK7A 4L5LA 1GUMA 3ZITA 4OFMA 3EWLA 2VIMA 5B8AA 2X64A 2JSYA 2VCXA 4RI6A 1HD2A 4ZB8A 4CDOA 2F9SA 3IBHA 5FHIA 2RLIA 3DMLA 1WMJA 1FVJA 1W4VA 5JWRB 2Z9SA 1TDIA 1A8LA 2ZNMA 2ES7A 1QFNA 4DSSA 3KEBA 1PD21 3ISOA 4G0IA 1YEXA 2TIRA 4IGJA 1DE1A 1XWKA 4Q5RA 2CVDA 2GZYA 2L6CA 3E9JB 4O92A 1ABAA 3HVVA 2A2RA 3TB2A 5LNKe 5CYYA 3A5WA 3LQ7A 3CSIA 3QMXA 2V6KA 1T4ZA 1M2BA 2XPDA 1QK8A 5F8BA 2M46A 2VD1A 2CQ9A 4GSTA 1T4YA 4PGTA 1SD8A 14GSA 4QQ7A 2YJ7A 5ECLB 4I5QA 2C0GA 1YDKA 5G5EA 3BJ5A 2C0FA 2C8UA 4P3YB 1WJKA 4EF0A 3I9V2 3HHVA 4RI7A 4PTSA 2NPBA 4KB3A 3MDKA 2H73A 5F0GA 2VLTA 3LFLA 2A4VA 2GTUA 3UBLA 5DQSA 5ELAA 3L78A 2VLUA 1K3YA 3IXRA 1XFLA 4BVXB 2MBTA 2GGTA 1KEBA 2REMA 1R4WA 3F4TA 4IJ3A 2BMXA 4FYUA 4F9ZA 4BVYB 3LW9A 4O7HA 2TRXA 3SBCA 4MJCA 17GSA 2VL2C 3K8NA 3ZFBA 1YQ1A 4E8EA 3GN3A 1OC8A 2VO4A 4IVFA 9GSSA 1CQHA 2VD0A 2WFCA 5IMCA 2H74A 3EMXA 1V57A 1DUGA 3VWVA 1GTIA 3APQA 3C7MA 3IHGA 4MNNA 1PKWA 2L6DA 2P31A 1O85A 2I9HA 3MWHA 1H4OA 2JADA 2M72A 4O32A 3IK9A 1BEDA 4XRDA 1A0RP 4IQ1A 1GTAA 1USBA 4K8MA 3DWVA 1DBYA 3CSJA 2DJKA 1TK5B 3FZAA 3ME7A 2YPMA 2P5RA 5LCZA 2B3SA 5ECOB 3LG6A 3JCML 5HR2A 5INYA 2B7JA 3C73A 3DGQA 4TOPA 1Y6EA 4OO5A 2C3NA 4IELA 2GSSA 2V6OA 3A5IA 4K0NA 3F4RA 4BL7A 3P8WA 2VOCA 1F37A 4ZIJA 2RIIA 3WYWA 2WRTA 1VRSD 2FWFA 4JE1A 1WIKA 1JHBA 4HZ2A 2JZSA 2VUPA 4KH7A 4MJAA 4OD7A 3WT1A 2A4HA 4KE3A 3WGXA 2IN3A 3GIXA 3EE2A 2J9HA 2QKEA 3D0ZA 4AGSA 4PUAA 1U6TA 3FEUA 3S9FA 2GT5A 4G9HA 5F05A 1G6YA 4X4JA 1EV9A 1YEPA 4BWSA 3BCKA 2R0PA 4KCEA 5E59A 2R4VA 5ECPB 1UA5A 2FA8A 3N9JA 2GQMA 4KNDA 2VCTA 3PH9A 3ERGA 5D9XA 4YQVA 1OE8A 5G5FA 1EP8A 4WR4A 4E8HA 3BOAA 2DBCA 5CRHA 1PL2A 4OO4A 5C00A 1X0RA 5DDLA 2H8LA 3LORA 1K3OA 3PR8A 1UVZA 2FA4A 3EU3A 1RK4A 3TOUA 3GKKA 2JZRA 2DIYA 4EDYA 1ERUA 4Q5QA 1VF3A 5J9BA 1GSYA 3M1GA 2OE1A 2AB6A 5ECMB 1BG5A 2RM5A 3TRXA 2X8CA 4DSRA 4Z2RA 2HSHA 2KUCA 3HZ4A 2HRFA 1O8WA 4PQHA 4WF4A 4POLA 4MPGA 5GAND 1GNWA 2L4CA 2H76A 2F8AA 1NW2A 3HXSA 1AW9A 3D6IA 2DMLA 4TVEA 2IJYA 1GRXA 1ZYNA 3GH9A 4IS0A 8GSSA 1X9MB 1SK2A 4HDEA 1GTBA 2KP1A 1GSDA 5G31A 2H19A 4HZ4A 1E6BA 3MYDA 4WEYA 2X8HA 2NBSA 3I43A 3TUEA 5D93A 3GYKA 3FR6A 4HU9A 1LU4A 3EU4A 4Z7XA 3KIJA 4GSSA 4PUFC 3A2VA 3H1NA 4HJ2A 3CXGA 4IQAA 3LEFA 3KTLA 2X8GA 4K0GA 1A2MA 4D73B 2NVLA 4FH8A 5DCGA 2OE3A 2XC2A 3UARA 4X0XA 3TRPA 3M9JA 3OR5A 2B6MA 2VL3A 3FYGA 4KDYA 4XS4A 3FY7A 4EIPA 2DJ2A 1O7UA 3MAKA 1YJ6A 4MK3A 4N0VA 3KMNA 2V32A 4I8BA 1O81A 3CSHA 2XBQA 2EIQA 3FZ4A 5JCGA 2UZ8A 2H1AA 4G0KA 1ERTA 3LXTA 4K7IA 4ULXA 1PMTA 2JU5A 6GSXA 1BYEA 4WKWA 3H4KA 4NMUA 3RPNA 2AJQB 1KNGA 2ZCTA 3F0IA 4OMVA 1ML6A 5IMVA 2VLVA 3DXBA 4HQSA 1ZMAA 3P7XA 3W6GA 1YY7A 1THXA 2CAIA 2DJ1A 3EC3A 2QGVA 3J7Yb 3CMIA 5IOXA 3IRAA 2FWEA 5B6NA 1G6WA 2HLSA 2R5GA 1TTZA 3TGZA 3RDWA 4TR4A 2EC4A 3HVSA 5HFKA 4MH2A 2MMAA 3FK8A 3QR6A 2JZTA 1GSQA 5IPHA 3HJPA 2MMOA 2MMNA 3TKRA 2H6XA 2LQQA 1SL0B 3UVHA 2YN1A 2H0HA 3C8EA 3M8NA 1JZOA 3FKFA 1M7TA 2E2MA 2YCDA 4EKZA 1IYIA 2PWJA 4CY6A 4TW5A 4MZCA 4V1Ap 2YJHA 2KOKA 2FGXA 5IOWA 5JCWA 2H30A 5CO3A 2WCIA 3MNGA 5ECIB 3DEXA 3D4MA 1K0MA 3RBTA 2BTOT 1K0AA 3RAZA 3HYPA 4EE0A 4HI7A 5GZZB 3ZL5A 2B1LA 3IC4A 1JZDA 5EL8A 1G0TA 5KN2A 2O7KA 1JLVA 3LWAA 1SU9A 3I6AA 2GDRA 2H6YA 3U5RE 1SJZA 1K0OA 3GKMA 2H01A 4XHMA 3TCOA 4CHSA 4LMWA 2LEGA 3A3TA 1K0NA 2JSZA 4GSNA 3GKNA 3E3EA 1GTUA 3GFKA 3HJOA 1KBNA 3TKSA 1XWGA 4F03A 4KSMA 5KN0A 3ZIVA 1H75A 2F8FA 4X43A 3UMAA 2O8VB 2XHFA 2QC7A 5DALB 1FAAA 5F06A 4K5SA 3L4NA 2LRCA 1WE0A 1MDKA 3Q19A 3ZVJA 1OYJA 4NV5A 2QA2A 5IMZA 1GWCA 3D4TA 2E0QA 3Q74A 4BVXA 1BQ7A 1ACVA 3QOUA 4BVYA 4EL1A 4JRRA 1AIUA 1TXXA 1GULA 3GL3A 2PGTA 1URMA 3LGCA 6GSWA 2AV4A 2DSAA 2DJ0A 2L5LA 3GV1A 2RM6A 5CP1A 1GSUA 2V2GA 2FD3A 4MABA 2L5OA 1TRUA 2CX4A 2C1YA 3W8SA 1ZCPA 5DVBA 4IW9A 5DAKB 1T00A 1SYXA 3IA1A 2LQOA 2I1UA 3O6TA 4HU7A 3A2XA 1TU8A 2CT6A 3H8QA 2N5FA 1DE2A 1PX6A 1AC1A 3D21A 1PQNA 3UVTA 1MD3A 4OFTA 4FYCA 4IP1A 3A2WA 3NZNA 1IYHA 5D8IA 3GX0A 4J2FA 4WXTA 2JL4A 2WZ9A 3UOMA 1UC7A 4ZL9A 1V98A 1ERVA 2RUFA 4TXVA 1B9XC 1F3BA 1HNAA 1HNCA 3TJJA 4J56E 4ZBBA 2DLXA 5A4UA 2AYTA 4PQIA 1Z7RA 2LNSA 2VCQA 4ML6A 2LSTA 2NDOA 1SKWB 4G19A 4I2UA 4K9ZA 4OWYA 1X9WB 1EV4A 1Q4JA 3W8JA 1JLWA 2HNLA 1GLPA 1XXUA 1S3AA 2DJ3A 5F07A 2C3QA 5B8BA 4G0LA 1Y25A 3J7Yk 1XOAA 2HRAA 4LLRA 2F3MA 3GH6A 3VWUA 2C0EA 4ISDA 6GSYA 3QFAC 4H86A 2IWTA 4G2EA 1WOUA 5J5NA 2O89A 4YAPA 4N10A 1K0BA 2E2GA 1F6MC 3KM6A 4PURA 1SJIA 2P5QA 2R0CA 2B5YA 2GSRA 5D9TA 4ECBA 1WRYA 2OKAA 1XVQA 3MIXA 3L9VA 1XPVA 4F82A 5GSTA 1PSQA 5AN1A 2H1GA 5IPGA 1ZOFA 1Z7PA 4ACSA 2H72A 3US3A 1F3AA 1J0FA 2HE3A 4TN8A 3G7IA 4XIHA 2X99A 1Z3EA 3CTFA 1SYRA 2FCHA 1K3LA 1B9YC 4CY8A 12GSA 4TR1B 3FZ9A 3TRQA 3WT2A 1LBKA 1XCCA 5G1KA 2YOIA 3HJMA 5IO0A 4EXJA 2ON7A 1QMVA 4MP4A 4N11A 2K8SA 2K9FA 2VL9A 2L57A 4ID0A 4X1UA 1RW1A 4XS1A 1GH2A 6GSTA 1XVWA 3ED3A 4ZBAA 4V1Ag 3M3MA 1HNBA 2GT6A 5ECHB 3EMPA 1XW6A 3KP9A 4XRAA 3LYKA 4FQUA 1ZYEA 5EPFA 2IL3A 4XS6A 2H71A 4HQZA 4ICYA 4N30A 2AUVA 5H5QA 3VPTA 5JWOB 1LJRA 2I4AA 4EC0A 1U88A 3UAPA 1VGLA 4WETA 5COHA 1A2LA 1U3AA 1XWCA 1EP7A 2R37A 4BA7A 3TKQA 5HR3A 1GSEA 2O85A 5EVOA 4ECIA 4GQCA 4LL4B 4KDXA 1A23A 4TR0A 4HS1A 5G1LA 4V2MA 2CVBA 2OBKA 1PN0A 4Q5NA 3Q18A 4NHWA 1FHEA 2JACA 3HVXA 5ID2A 3DIEA 1PN9A 3VWXA 1PL1A 3D22A 1J08A 2R0GA 4FO5A 1N2AA 4USSA 1T3BA 3KD0A 4D73A 3BCIA 2YZUA 3EVIA 5JCUA 3HY2A 1AQVA 1YF1A 3HKRA 2KP2A 1Z5YE 3TJKA 4K7OA 1VF1A 3HDCA 18GSA 16GSA 3NIVA 2WJUA 1X5DA 1MEKA 1PA3A 3ZVJD 3F3RA 4CW9A 1B4PA 3HA9A 4MF7A 4ZXGA 4IHUA 2FHEA 3VI5A 1XW5A 7GSSA 1F2EA 6GSUA 1ZYQB 1YKAA 2VCZA 2HZEA 2DJJA 4Q5FA 3TJGA 1BJXA 2IPAA 4TR3A 2X49A 3UJ1A 4A5PA 1M99A 5D9VA 5LD0A 3QFBC 1GL8A 2LKUA 1ZGNA 3RHCA 5ID2B 1THOA 1Z6NA 1JFUA 4Z2TA 1Q98A 2GSTA 2K6VA 4EIQA 2AAWA 1WPIA 1N8JA 1C72A 2ON5A 2V41A 1B4QA 1FOHA 2CA8A 4MLYA 1MD4A 5A5KA 2LS5A 2IMDA 3CTGA 1S3CA 2HRNA 1O6JA 1S3DA 3TKPA 2ALBA 1V9WA 1XW9A 1QQ2A 3G9BA 4DSQA 2CVKA 1A0FA 3O3TA 2WGRA 4F2IA 1W89A 5HQPA 3QAVA 2FLSA 3VFIA 4ZB6A 4RQRA 4KAEA 1R7HA 4NV2A 1EOGA 4LMVA 3ZZXA 4NHZA 2HZEB 5D96A 5KOXA 4IJIA 1GNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8E B;  4MZW A;  2PVO C;  5ECR B;  2FUG 2;  1XIY A;  4ZL8 A;  2LUS A;  1KTE A;  2PN8 A;  2B1K A;  2YP6 A;  3F9U A;  3GL5 A;  5ELG A;  2YWM A;  1X9S B;  4WF5 A;  3RHB A;  4GXZ A;  4OFN A;  3ZTL A;  4PNG A;  2PER A;  2LTK A;  3N5O A;  2H75 A;  2LRN A;  4G10 A;  3QDN A;  22GS A;  2N5A A;  4L0W A;  4KSO A;  3ERF A;  2WS2 A;  1X5C A;  4I6X A;  2D2Z A;  3MSZ A;  2EIR A;  3IPZ A;  2I81 A;  4L0U A;  2C0D A;  3WD6 A;  1TU7 A;  2O87 A;  3APO A;  3APS A;  3C71 A;  1MDJ A;  2H1B A;  4KX4 A;  3TJF A;  1I5G A;  3KTB A;  5CRE A;  5AGY A;  1SD9 A;  4OCE A;  4ECJ A;  1OC9 B;  3TJB A;  2HYX A;  4GF0 A;  3ZML A;  5DAL A;  3UEM A;  3CBU A;  3HD5 A;  3GSS A;  5DCH A;  1TRW A;  3UL3 A;  5CRD A;  2YAN A;  3LSZ A;  5H5R A;  1OVN A;  4KW6 A;  1TI1 A;  1OAZ A;  1R5A A;  1V58 A;  3R2Q A;  2FWG A;  4KCA A;  4POK A;  1DSB A;  2DIZ A;  2G0F A;  1ZZY A;  5KN1 A;  5CNW A;  1K0D A;  3KGK A;  3NOF A;  2L4Q A;  5IO2 A;  3KJY A;  1HQO A;  1OKT A;  3C1S A;  2OJL A;  2I3Y A;  3F8U A;  2IFQ B;  2GVP A;  1MTC A;  3EYT A;  3RPP A;  2LNT A;  5FT3 A;  3L0H A;  5DAK A;  1AAZ A;  5IQY A;  19GS A;  1UN2 A;  4IKH A;  1WWJ A;  4NAX A;  1JZR A;  4KA0 A;  2BJX A;  3GMF A;  3F4S A;  2HZF A;  2LRT A;  2G2Q A;  4HJM A;  3UIW A;  2WB9 A;  4EVM A;  5DJM A;  3HCZ A;  4OCF A;  2LJA A;  1EGO A;  1EWX A;  3GA4 A;  4LL1 B;  2WDU A;  3VWW A;  2HI7 A;  2YNX A;  2IIY A;  2L59 A;  5ECK B;  3WGE A;  1AQX A;  3IE3 A;  1ON4 A;  2K18 A;  4PX1 A;  2FNO A;  2CZ2 A;  2GQL A;  5L71 A;  1ERW A;  1TRV A;  3VK9 A;  2IMK A;  4GWR A;  3DVW A;  4RUV A;  1TRS A;  3GUS A;  3IAS 2;  1PGT A;  2WUL A;  1R26 A;  3BD2 A;  3C1R A;  3CRT A;  2VL2 A;  1GUK A;  3Q6O A;  1TK0 B;  5FWG A;  2B5E A;  3TKS C;  1QGV A;  11GS A;  2H6Z A;  4HUA A;  5B6M A;  2IMF A;  1T7P B;  4XTS A;  5CAX A;  4K6X A;  4MZB A;  4IBP A;  3VLN A;  1E2Y A;  1TP9 A;  5HR1 A;  1JZW A;  4WBR D;  2PUK C;  1SEN A;  4DEJ A;  1O73 A;  1G7E A;  4JR6 A;  2VCV A;  1TI3 A;  4ILF A;  4MH3 A;  6GSV A;  3ZRD A;  1GLQ A;  2F51 A;  3P2A A;  3KXO A;  3UBK A;  5ECS A;  4DSS B;  5ECQ B;  4ZB9 A;  4TR1 A;  1TKD B;  2B5X A;  3QAG A;  2FWH A;  3ZRE A;  1J9B A;  3KCM A;  4TXO A;  2YWN A;  3QPM A;  2HXK A;  1TK8 B;  4ML1 A;  2FY6 A;  4EDZ A;  2GSQ A;  4K1F A;  3L9U A;  5IIZ A;  1ZL9 A;  4KGI A;  3G7J A;  4K2D A;  1QUW A;  4JR4 A;  2PBJ A;  1M9A A;  4JU5 A;  1FG4 A;  1M9B A;  1HYU A;  1K0C A;  3F63 A;  2PVQ A;  3KZQ A;  5J4U A;  1FVK A;  4NWY A;  1AXD A;  1PX7 A;  1A8Y A;  5C04 A;  2VM1 A;  4F0C A;  1NSW A;  5IM9 A;  2YV7 A;  1NM3 A;  4JBB A;  3L9S A;  2R3X A;  1V40 A;  2IMI A;  5KN3 A;  4TKY A;  2E7P A;  2RUE A;  3GUR A;  4BPY A;  3KP8 A;  1ST9 A;  3LJR A;  3BBY A;  4J57 E;  4HOJ A;  2K8V A;  3E0U A;  3F3Q A;  1TJD A;  2GLR A;  3QCP A;  2IME A;  4TXO B;  2YWI A;  2CV4 A;  4QL7 A;  2ZUP A;  4GQF A;  1YKC A;  2PPT A;  4GLT A;  3TKS E;  4ZBD A;  4ZL7 A;  3EIN A;  1AQW A;  5HR0 A;  2MBS A;  3FZ5 A;  3ZMK A;  1T1V A;  5CRW A;  4JZQ A;  1FO5 A;  1M0U A;  3IV4 A;  5H5S A;  5DBQ A;  4V2N A;  4WBJ A;  1VF4 A;  2A2S A;  2YV9 A;  1VF2 A;  3G7Y A;  5A4W A;  2OBI A;  4YAV A;  5HFG A;  2MYG A;  4RQX A;  3DYR A;  1EGR A;  2XPE A;  5J3R A;  2H66 A;  1PKZ A;  1I9D A;  3GKX A;  2C3T A;  4LA1 A;  1ILO A;  1PRX A;  1YF0 A;  3FR9 A;  2GZZ A;  4ZIL A;  3GX8 A;  2VCW A;  2H70 A;  5DJL A;  2CZ3 A;  1A24 A;  3M9K A;  5AIX A;  1GSF A;  2GQK A;  5IMF A;  3DRN A;  2GZP A;  3KH9 A;  2YWO A;  1SL1 B;  2C80 A;  3M0F A;  3F6D A;  4JED A;  2H1D A;  5GAP D;  2MMZ A;  3AY8 A;  4MF5 A;  3SWL A;  1SK1 A;  1SK0 A;  5CRG A;  3P90 A;  1NHO A;  2LJK A;  2N5B A;  4AJ8 A;  1CQG A;  3I69 A;  3H79 A;  2TRC P;  5D9W A;  2B7K A;  5JWQ B;  1SJ6 A;  1QXH A;  4GTU A;  4O5R A;  2XBI A;  6GSS A;  4GRF A;  3VI7 A;  5ECN B;  3ZYW A;  2VM2 A;  5ABR A;  5G2Z A;  5AIV A;  1B48 A;  1G7O A;  3F6F A;  3U6V A;  5KEJ A;  3H93 A;  1U3I A;  3DD3 A;  2M80 A;  1B8X A;  4WR5 A;  4POM A;  5IMA A;  3GST A;  3GTU A;  3IR4 A;  13GS A;  4AF2 A;  4MDC A;  2CX3 A;  2EIO A;  3IAM 2;  4DVC A;  4L5O A;  4L8E A;  2DMM A;  3ZIJ A;  4QL9 A;  2VAF A;  5DQY A;  4MF6 A;  2C4J A;  2PMT A;  5A4V A;  1X5E A;  3ME8 A;  4F0B A;  3IDV A;  4I2T A;  3DVX A;  4MA9 A;  4MJB A;  5J41 A;  1XZO A;  2AHE A;  2H0G A;  1EEJ A;  3ZFL A;  3FW2 A;  4V2L A;  3ERW A;  5EY6 A;  5ENU A;  2PU9 C;  2OAD A;  1Z9H A;  4BWQ A;  2KLX A;  2HFD A;  2OA7 A;  2R2J A;  4IN0 A;  2QSI A;  1EOH A;  3VUR A;  1OC9 A;  4MJE A;  5E4W A;  4AJ6 A;  4K7N A;  5J9C A;  4GCI A;  1TW9 A;  1SL2 B;  1NHY A;  2NTO A;  3GTU B;  2R6K A;  2OE0 A;  1FB6 A;  4HEA 2;  2OAC A;  3WGD A;  3FHK A;  3ZLP A;  1U87 A;  4FIW A;  3D5J A;  1XBS A;  2HT9 A;  1FW1 A;  1FOV A;  1YZX A;  3HZ8 A;  3CRU A;  1AUC A;  1SKR B;  2IFQ A;  3EUR A;  3LYP A;  1GSS A;  1M2A A;  3TOT A;  4XCS A;  4TRX A;  1XWB A;  4MMM A;  5IMD A;  2YZH A;  3LXZ A;  4PXO A;  3DKS A;  2HSY A;  5B7C A;  1OE7 A;  4YQM A;  1XOB A;  4N0Z A;  2H0I A;  4NXI A;  2J23 A;  3KMO A;  3VPQ A;  4KDU A;  3QAW A;  4XS4 B;  5AIS A;  10GS A;  1M2D A;  3TDG A;  1WP0 A;  4NPB A;  1A2J A;  3V1W A;  3GNJ A;  3O76 A;  4KUN A;  4PNF A;  1EEM A;  1OKD A;  5G30 A;  5D73 A;  2P0G A;  1TOF A;  1EZK A;  1Z6M A;  4YQU A;  2DC5 A;  1GUH A;  3PGT A;  3QD9 A;  3IOS A;  1RQM A;  3GHA A;  2MZC A;  1FB0 A;  4POB A;  4AJ7 A;  4YH2 A;  4EO3 A;  1R5P A;  2V1M A;  2GS3 A;  4MPF A;  1O8X A;  1BAY A;  2LV3 A;  1GP1 A;  4ECC A;  1OC3 A;  4IP6 A;  3KH7 A;  3IHQ A;  5HFI A;  1BX9 A;  1SKS B;  1XWA A;  1V2A A;  4PQ1 A;  2CAQ A;  1MDI A;  20GS A;  4FYB A;  3FR3 A;  1F9M A;  4I97 A;  3GRX A;  3PIN A;  4MCU A;  3FRC A;  3CYN A;  2KHP A;  5GSS A;  4EUY A;  2LJR A;  3IK7 A;  4L5L A;  1GUM A;  3ZIT A;  4OFM A;  3EWL A;  2VIM A;  5B8A A;  2X64 A;  2JSY A;  2VCX A;  4RI6 A;  1HD2 A;  4ZB8 A;  4CDO A;  2F9S A;  3IBH A;  5FHI A;  2RLI A;  3DML A;  1WMJ A;  1FVJ A;  1W4V A;  5JWR B;  2Z9S A;  1TDI A;  1A8L A;  2ZNM A;  2ES7 A;  1QFN A;  4DSS A;  3KEB A;  1PD2 1;  3ISO A;  1YEX A;  2TIR A;  4IGJ A;  1DE1 A;  1XWK A;  4Q5R A;  2CVD A;  2GZY A;  2L6C A;  3E9J B;  4O92 A;  1ABA A;  3HVV A;  2A2R A;  3TB2 A;  5LNK e;  5CYY A;  3A5W A;  3LQ7 A;  3CSI A;  3QMX A;  2V6K A;  1T4Z A;  1M2B A;  2XPD A;  1QK8 A;  5F8B A;  2M46 A;  2VD1 A;  2CQ9 A;  4GST A;  1T4Y A;  4PGT A;  1SD8 A;  14GS A;  4QQ7 A;  2YJ7 A;  5ECL B;  4I5Q A;  2C0G A;  1YDK A;  5G5E A;  3BJ5 A;  2C0F A;  2C8U A;  4P3Y B;  1WJK A;  4EF0 A;  3I9V 2;  3HHV A;  4RI7 A;  2NPB A;  4KB3 A;  3MDK A;  2H73 A;  5F0G A;  2VLT A;  3LFL A;  2A4V A;  2GTU A;  3UBL A;  5DQS A;  5ELA A;  3L78 A;  2VLU A;  1K3Y A;  3IXR A;  1XFL A;  2MBT A;  2GGT A;  1KEB A;  2REM A;  1R4W A;  3F4T A;  4IJ3 A;  2BMX A;  4FYU A;  4F9Z A;  4O7H A;  2TRX A;  3SBC A;  4MJC A;  17GS A;  2VL2 C;  3K8N A;  3ZFB A;  1YQ1 A;  4E8E A;  3GN3 A;  1OC8 A;  2VO4 A;  4IVF A;  9GSS A;  1CQH A;  2VD0 A;  2WFC A;  5IMC A;  2H74 A;  3EMX A;  1V57 A;  1DUG A;  3VWV A;  1GTI A;  3APQ A;  3C7M A;  1PKW A;  2L6D A;  2P31 A;  1O85 A;  2I9H A;  3MWH A;  1H4O A;  2JAD A;  2M72 A;  4O32 A;  3IK9 A;  1BED A;  4XRD A;  1A0R P;  4IQ1 A;  1GTA A;  1USB A;  4K8M A;  3DWV A;  1DBY A;  3CSJ A;  2DJK A;  1TK5 B;  3FZA A;  3ME7 A;  2YPM A;  2P5R A;  5LCZ A;  2B3S A;  5ECO B;  3LG6 A;  3JCM L;  5HR2 A;  5INY A;  2B7J A;  3C73 A;  3DGQ A;  4TOP A;  1Y6E A;  4OO5 A;  2C3N A;  4IEL A;  2GSS A;  2V6O A;  4K0N A;  3F4R A;  4BL7 A;  3P8W A;  2VOC A;  1F37 A;  4ZIJ A;  2RII A;  3WYW A;  2WRT A;  1VRS D;  2FWF A;  4JE1 A;  1WIK A;  1JHB A;  4HZ2 A;  2JZS A;  2VUP A;  4KH7 A;  4MJA A;  4OD7 A;  3WT1 A;  4KE3 A;  3WGX A;  2IN3 A;  3GIX A;  3EE2 A;  2J9H A;  2QKE A;  3D0Z A;  4AGS A;  4PUA A;  1U6T A;  3FEU A;  3S9F A;  2GT5 A;  4G9H A;  5F05 A;  1G6Y A;  1EV9 A;  1YEP A;  4BWS A;  3BCK A;  4KCE A;  5E59 A;  2R4V A;  5ECP B;  1UA5 A;  2FA8 A;  3N9J A;  2GQM A;  4KND A;  2VCT A;  3PH9 A;  3ERG A;  5D9X A;  4YQV A;  1OE8 A;  5G5F A;  1EP8 A;  4WR4 A;  4E8H A;  3BOA A;  2DBC A;  5CRH A;  1PL2 A;  4OO4 A;  5C00 A;  1X0R A;  5DDL A;  2H8L A;  3LOR A;  1K3O A;  3PR8 A;  1UVZ A;  2FA4 A;  3EU3 A;  1RK4 A;  3TOU A;  3GKK A;  2JZR A;  2DIY A;  4EDY A;  1ERU A;  4Q5Q A;  1VF3 A;  5J9B A;  1GSY A;  3M1G A;  2OE1 A;  2AB6 A;  5ECM B;  1BG5 A;  2RM5 A;  3TRX A;  2X8C A;  4DSR A;  2HSH A;  2KUC A;  3HZ4 A;  2HRF A;  1O8W A;  4PQH A;  4WF4 A;  4POL A;  4MPG A;  5GAN D;  1GNW A;  2L4C A;  2H76 A;  2F8A A;  1NW2 A;  3HXS A;  1AW9 A;  3D6I A;  2DML A;  4TVE A;  2IJY A;  1GRX A;  8GSS A;  3GH9 A;  4IS0 A;  1X9M B;  1SK2 A;  4HDE A;  1GTB A;  2KP1 A;  1GSD A;  5G31 A;  2H19 A;  4HZ4 A;  1E6B A;  4WEY A;  2X8H A;  2NBS A;  3I43 A;  3TUE A;  5D93 A;  3GYK A;  3FR6 A;  4HU9 A;  1LU4 A;  3EU4 A;  4Z7X A;  3KIJ A;  4GSS A;  4PUF C;  3A2V A;  3H1N A;  4HJ2 A;  3CXG A;  4IQA A;  3LEF A;  3KTL A;  2X8G A;  4K0G A;  1A2M A;  4D73 B;  2NVL A;  4FH8 A;  5DCG A;  2OE3 A;  2XC2 A;  3UAR A;  4X0X A;  3TRP A;  3M9J A;  3OR5 A;  2B6M A;  2VL3 A;  3FYG A;  4KDY A;  4XS4 A;  3FY7 A;  2DJ2 A;  1O7U A;  3MAK A;  1YJ6 A;  4MK3 A;  4N0V A;  3KMN A;  2V32 A;  4I8B A;  1O81 A;  3CSH A;  2XBQ A;  2EIQ A;  3FZ4 A;  5JCG A;  2H1A A;  1ERT A;  3LXT A;  4K7I A;  4ULX A;  1PMT A;  2JU5 A;  6GSX A;  1BYE A;  4WKW A;  3H4K A;  4NMU A;  3RPN A;  2AJQ B;  1KNG A;  2ZCT A;  3F0I A;  4OMV A;  1ML6 A;  5IMV A;  2VLV A;  3DXB A;  4HQS A;  1ZMA A;  3P7X A;  3W6G A;  1YY7 A;  1THX A;  2CAI A;  2DJ1 A;  3EC3 A;  2QGV A;  3J7Y b;  3CMI A;  5IOX A;  3IRA A;  2FWE A;  5B6N A;  1G6W A;  2HLS A;  2R5G A;  1TTZ A;  3TGZ A;  3RDW A;  4TR4 A;  2EC4 A;  3HVS A;  5HFK A;  4MH2 A;  2MMA A;  3FK8 A;  3QR6 A;  2JZT A;  1GSQ A;  5IPH A;  3HJP A;  2MMO A;  2MMN A;  3TKR A;  2H6X A;  2LQQ A;  1SL0 B;  3UVH A;  2YN1 A;  2H0H A;  3C8E A;  3M8N A;  1JZO A;  3FKF A;  1M7T A;  2E2M A;  2YCD A;  4EKZ A;  1IYI A;  2PWJ A;  4TW5 A;  4MZC A;  4V1A p;  2YJH A;  2KOK A;  2FGX A;  5IOW A;  5JCW A;  2H30 A;  5CO3 A;  2WCI A;  3MNG A;  5ECI B;  3DEX A;  3D4M A;  1K0M A;  3RBT A;  2BTO T;  1K0A A;  3RAZ A;  3HYP A;  4EE0 A;  4HI7 A;  5GZZ B;  3ZL5 A;  2B1L A;  3IC4 A;  1JZD A;  5EL8 A;  1G0T A;  5KN2 A;  2O7K A;  1JLV A;  3LWA A;  1SU9 A;  3I6A A;  2GDR A;  2H6Y A;  3U5R E;  1SJZ A;  1K0O A;  3GKM A;  2H01 A;  4XHM A;  3TCO A;  4CHS A;  4LMW A;  2LEG A;  3A3T A;  1K0N A;  2JSZ A;  4GSN A;  3GKN A;  3E3E A;  1GTU A;  3GFK A;  3HJO A;  1KBN A;  3TKS A;  1XWG A;  4F03 A;  4KSM A;  5KN0 A;  3ZIV A;  1H75 A;  2F8F A;  4X43 A;  3UMA A;  2O8V B;  2XHF A;  2QC7 A;  5DAL B;  1FAA A;  5F06 A;  3L4N A;  2LRC A;  1WE0 A;  1MDK A;  3Q19 A;  3ZVJ A;  1OYJ A;  4NV5 A;  5IMZ A;  1GWC A;  3D4T A;  2E0Q A;  3Q74 A;  4BVX A;  1BQ7 A;  1ACV A;  3QOU A;  4BVY A;  4EL1 A;  4JRR A;  1AIU A;  1TXX A;  1GUL A;  3GL3 A;  2PGT A;  1URM A;  3LGC A;  6GSW A;  2AV4 A;  2DSA A;  2DJ0 A;  2L5L A;  3GV1 A;  2RM6 A;  5CP1 A;  1GSU A;  2V2G A;  2FD3 A;  4MAB A;  2L5O A;  1TRU A;  2CX4 A;  2C1Y A;  3W8S A;  1ZCP A;  5DVB A;  4IW9 A;  5DAK B;  1T00 A;  1SYX A;  3IA1 A;  2LQO A;  2I1U A;  3O6T A;  4HU7 A;  3A2X A;  1TU8 A;  2CT6 A;  3H8Q A;  2N5F A;  1DE2 A;  1PX6 A;  1AC1 A;  3D21 A;  1PQN A;  3UVT A;  1MD3 A;  4OFT A;  4FYC A;  4IP1 A;  3A2W A;  3NZN A;  1IYH A;  5D8I A;  3GX0 A;  4J2F A;  4WXT A;  2JL4 A;  2WZ9 A;  3UOM A;  1UC7 A;  4ZL9 A;  1V98 A;  1ERV A;  2RUF A;  4TXV A;  1B9X C;  1F3B A;  1HNA A;  1HNC A;  3TJJ A;  4J56 E;  4ZBB A;  2DLX A;  5A4U A;  2AYT A;  4PQI A;  1Z7R A;  2LNS A;  2VCQ A;  4ML6 A;  2LST A;  2NDO A;  1SKW B;  4G19 A;  4I2U A;  4K9Z A;  4OWY A;  1X9W B;  1EV4 A;  1Q4J A;  3W8J A;  1JLW A;  2HNL A;  1GLP A;  1XXU A;  1S3A A;  2DJ3 A;  5F07 A;  2C3Q A;  5B8B A;  1Y25 A;  3J7Y k;  1XOA A;  4LLR A;  2F3M A;  3GH6 A;  3VWU A;  2C0E A;  4ISD A;  6GSY A;  3QFA C;  4H86 A;  2IWT A;  4G2E A;  1WOU A;  5J5N A;  2O89 A;  4YAP A;  4N10 A;  1K0B A;  2E2G A;  1F6M C;  3KM6 A;  4PUR A;  1SJI A;  2P5Q A;  2B5Y A;  2GSR A;  5D9T A;  4ECB A;  1WRY A;  2OKA A;  1XVQ A;  3L9V A;  1XPV A;  4F82 A;  5GST A;  1PSQ A;  5AN1 A;  2H1G A;  5IPG A;  1ZOF A;  1Z7P A;  4ACS A;  2H72 A;  3US3 A;  1F3A A;  1J0F A;  2HE3 A;  4TN8 A;  3G7I A;  4XIH A;  2X99 A;  1Z3E A;  3CTF A;  1SYR A;  2FCH A;  1K3L A;  1B9Y C;  12GS A;  4TR1 B;  3FZ9 A;  3TRQ A;  3WT2 A;  1LBK A;  1XCC A;  5G1K A;  2YOI A;  3HJM A;  5IO0 A;  4EXJ A;  2ON7 A;  1QMV A;  4MP4 A;  4N11 A;  2K8S A;  2K9F A;  2VL9 A;  2L57 A;  4ID0 A;  4X1U A;  1RW1 A;  4XS1 A;  1GH2 A;  6GST A;  1XVW A;  3ED3 A;  4ZBA A;  4V1A g;  3M3M A;  1HNB A;  2GT6 A;  5ECH B;  3EMP A;  1XW6 A;  3KP9 A;  4XRA A;  3LYK A;  1ZYE A;  5EPF A;  2IL3 A;  4XS6 A;  2H71 A;  4HQZ A;  4N30 A;  3VPT A;  2AUV A;  5H5Q A;  5JWO B;  1LJR A;  2I4A A;  4EC0 A;  1U88 A;  3UAP A;  1VGL A;  4WET A;  5COH A;  1A2L A;  1U3A A;  1XWC A;  1EP7 A;  2R37 A;  4BA7 A;  3TKQ A;  5HR3 A;  1GSE A;  2O85 A;  5EVO A;  4ECI A;  4GQC A;  4LL4 B;  4KDX A;  1A23 A;  4TR0 A;  4HS1 A;  5G1L A;  4V2M A;  2CVB A;  2OBK A;  4Q5N A;  3Q18 A;  4NHW A;  1FHE A;  2JAC A;  3HVX A;  5ID2 A;  3DIE A;  1PN9 A;  3VWX A;  1PL1 A;  3D22 A;  1J08 A;  4FO5 A;  1N2A A;  1T3B A;  3KD0 A;  4D73 A;  3BCI A;  2YZU A;  3EVI A;  5JCU A;  3HY2 A;  1AQV A;  1YF1 A;  3HKR A;  2KP2 A;  1Z5Y E;  3TJK A;  4K7O A;  1VF1 A;  3HDC A;  18GS A;  16GS A;  3NIV A;  2WJU A;  1X5D A;  1MEK A;  1PA3 A;  3ZVJ D;  3F3R A;  4CW9 A;  1B4P A;  3HA9 A;  4MF7 A;  4ZXG A;  4IHU A;  2FHE A;  3VI5 A;  1XW5 A;  7GSS A;  1F2E A;  6GSU A;  1ZYQ B;  1YKA A;  2VCZ A;  2HZE A;  2DJJ A;  4Q5F A;  3TJG A;  1BJX A;  2IPA A;  4TR3 A;  3UJ1 A;  1M99 A;  5D9V A;  5LD0 A;  3QFB C;  1GL8 A;  2LKU A;  1ZGN A;  3RHC A;  5ID2 B;  1THO A;  1Z6N A;  1JFU A;  1Q98 A;  2GST A;  2K6V A;  2AAW A;  1WPI A;  1N8J A;  1C72 A;  2ON5 A;  2V41 A;  1B4Q A;  2CA8 A;  4MLY A;  1MD4 A;  5A5K A;  2LS5 A;  2IMD A;  3CTG A;  1S3C A;  2HRN A;  1O6J A;  1S3D A;  3TKP A;  2ALB A;  1V9W A;  1XW9 A;  1QQ2 A;  3G9B A;  4DSQ A;  2CVK A;  1A0F A;  3O3T A;  2WGR A;  4F2I A;  1W89 A;  5HQP A;  3QAV A;  2FLS A;  3VFI A;  4ZB6 A;  4RQR A;  4KAE A;  1R7H A;  4NV2 A;  1EOG A;  4LMV A;  3ZZX A;  4NHZ A;  2HZE B;  5D96 A;  4IJI A;  1GNE A; 
#chains in the Genus database with same CATH topology
 1T8E B;  4MZW A;  2PVO C;  5ECR B;  2FUG 2;  1XIY A;  4ZL8 A;  2LUS A;  1KTE A;  1M3J A;  2PN8 A;  2B1K A;  2YP6 A;  3F9U A;  3GL5 A;  5ELG A;  2YWM A;  1X9S B;  4WF5 A;  3RHB A;  4GXZ A;  4OFN A;  3ZTL A;  4PNG A;  3PPU A;  2PER A;  2LTK A;  3N5O A;  2H75 A;  2LRN A;  4G10 A;  3QDN A;  22GS A;  2N5A A;  4L0W A;  4KSO A;  3ERF A;  2WS2 A;  1X5C A;  4I6X A;  2D2Z A;  3MSZ A;  2EIR A;  3IPZ A;  2I81 A;  4L0U A;  2C0D A;  3WD6 A;  1TU7 A;  2O87 A;  3APO A;  3APS A;  3C71 A;  1MDJ A;  2H1B A;  4KX4 A;  3TJF A;  1I5G A;  3KTB A;  5CRE A;  5AGY A;  1SD9 A;  4OCE A;  4ECJ A;  1OC9 B;  3TJB A;  2HYX A;  4GF0 A;  3ZML A;  5DAL A;  3UEM A;  3CBU A;  3HD5 A;  3GSS A;  5DCH A;  1TRW A;  3UL3 A;  5CRD A;  2YAN A;  3LSZ A;  5H5R A;  1OVN A;  4KW6 A;  1TI1 A;  5KOW A;  1OAZ A;  1R5A A;  1V58 A;  3R2Q A;  2FWG A;  4KCA A;  4POK A;  2X4A A;  1DSB A;  2DIZ A;  2G0F A;  1ZZY A;  5KN1 A;  5CNW A;  1K0D A;  3KGK A;  3NOF A;  2L4Q A;  5IO2 A;  3KJY A;  1HQO A;  1OKT A;  3C1S A;  2OJL A;  2I3Y A;  3F8U A;  2IFQ B;  2GVP A;  1MTC A;  3EYT A;  3RPP A;  2LNT A;  5FT3 A;  3L0H A;  5DAK A;  1AAZ A;  5IQY A;  19GS A;  1UN2 A;  2QA1 A;  4IKH A;  1WWJ A;  4NAX A;  1JZR A;  4KA0 A;  2BJX A;  3GMF A;  3F4S A;  2HZF A;  2LRT A;  2G2Q A;  4HJM A;  3IC8 A;  3UIW A;  2WB9 A;  4EVM A;  5DJM A;  3HCZ A;  4OCF A;  2LJA A;  1EGO A;  1EWX A;  3GA4 A;  4LL1 B;  2WDU A;  3VWW A;  2HI7 A;  2YNX A;  2IIY A;  2L59 A;  5ECK B;  3WGE A;  1AQX A;  3IE3 A;  1ON4 A;  2K18 A;  4PX1 A;  2FNO A;  2CZ2 A;  2GQL A;  5L71 A;  1ERW A;  1TRV A;  3VK9 A;  2IMK A;  4GWR A;  3DVW A;  4RUV A;  1TRS A;  3GUS A;  3IAS 2;  1PGT A;  2WUL A;  1R26 A;  3BD2 A;  3C1R A;  3CRT A;  2VL2 A;  2HSM A;  1GUK A;  3Q6O A;  1TK0 B;  5FWG A;  2B5E A;  3TKS C;  1QGV A;  11GS A;  2H6Z A;  4HUA A;  5B6M A;  2IMF A;  1T7P B;  4XTS A;  1M3I A;  5CAX A;  4K6X A;  4MZB A;  4IBP A;  3VLN A;  1E2Y A;  2A2P A;  1TP9 A;  5HR1 A;  1JZW A;  4WBR D;  2PUK C;  5BMU A;  1SEN A;  4DEJ A;  1O73 A;  1G7E A;  4JR6 A;  2VCV A;  1TI3 A;  4ILF A;  4MH3 A;  6GSV A;  3ZRD A;  1GLQ A;  2F51 A;  3P2A A;  3KXO A;  3UBK A;  5ECS A;  4DSS B;  5ECQ B;  4ZB9 A;  4TR1 A;  1TKD B;  2B5X A;  3QAG A;  2FWH A;  3ZRE A;  1J9B A;  3KCM A;  4TXO A;  2YWN A;  3QPM A;  2HXK A;  1TK8 B;  4K5R A;  4ML1 A;  2FY6 A;  4EDZ A;  2GSQ A;  4K1F A;  3L9U A;  5IIZ A;  1ZL9 A;  4KGI A;  3G7J A;  2HRK A;  4K2D A;  1QUW A;  4JR4 A;  2PBJ A;  1M9A A;  4JU5 A;  1FG4 A;  1M9B A;  1HYU A;  1K0C A;  3F63 A;  2PVQ A;  3KZQ A;  5J4U A;  1FVK A;  4NWY A;  1AXD A;  1PX7 A;  1A8Y A;  5C04 A;  2VM1 A;  4F0C A;  1NSW A;  5IM9 A;  2YV7 A;  1NM3 A;  4JBB A;  3L9S A;  2R3X A;  1V40 A;  2IMI A;  5KN3 A;  4TKY A;  2E7P A;  2RUE A;  3GUR A;  4BPY A;  3KP8 A;  1ST9 A;  3LJR A;  3BBY A;  4J57 E;  4HOJ A;  2K8V A;  3E0U A;  3F3Q A;  1TJD A;  2GLR A;  3QCP A;  1ZYP A;  2IME A;  4TXO B;  2YWI A;  2CV4 A;  4QL7 A;  2ZUP A;  4GQF A;  1YKC A;  2PPT A;  4GLT A;  3TKS E;  4ZBD A;  4ZL7 A;  3EIN A;  1AQW A;  5HR0 A;  2MBS A;  3FZ5 A;  3ZMK A;  1T1V A;  5CRW A;  4JZQ A;  1FO5 A;  1M0U A;  3IV4 A;  5H5S A;  5DBQ A;  4V2N A;  3EPT A;  4WBJ A;  1VF4 A;  2A2S A;  2YV9 A;  1VF2 A;  3G7Y A;  5A4W A;  2OBI A;  4YAV A;  5HFG A;  2MYG A;  4RQX A;  3DYR A;  1EGR A;  2XPE A;  5J3R A;  2H66 A;  1PKZ A;  1I9D A;  3GKX A;  2C3T A;  4LA1 A;  1ILO A;  1PRX A;  1YF0 A;  3FR9 A;  2GZZ A;  4ZIL A;  3GX8 A;  2VCW A;  2H70 A;  5BRT A;  5DJL A;  2CZ3 A;  1A24 A;  3M9K A;  5AIX A;  1GSF A;  2GQK A;  5IMF A;  4BL7 B;  3DRN A;  2GZP A;  3KH9 A;  2YWO A;  1SL1 B;  2C80 A;  3M0F A;  3F6D A;  4JED A;  2H1D A;  5GAP D;  2MMZ A;  3AY8 A;  4MF5 A;  3SWL A;  4KF9 A;  1SK1 A;  1SK0 A;  5CRG A;  3P90 A;  1NHO A;  2LJK A;  2N5B A;  4AJ8 A;  1CQG A;  3I69 A;  3H79 A;  2TRC P;  5D9W A;  2B7K A;  5JWQ B;  1SJ6 A;  1QXH A;  4GTU A;  4O5R A;  2XBI A;  6GSS A;  4GRF A;  2DKH A;  3VI7 A;  1PFO A;  5ECN B;  3ZYW A;  2VM2 A;  5ABR A;  5G2Z A;  5AIV A;  4O5Q A;  1B48 A;  1G7O A;  3F6F A;  3U6V A;  5KEJ A;  3H93 A;  1U3I A;  3DD3 A;  2M80 A;  1B8X A;  4WR5 A;  4POM A;  5IMA A;  3GST A;  3GTU A;  3IR4 A;  13GS A;  4AF2 A;  4MDC A;  2CX3 A;  2EIO A;  3IAM 2;  4DVC A;  4L5O A;  4L8E A;  2DMM A;  3ZIJ A;  4QL9 A;  2VAF A;  5DQY A;  4MF6 A;  2C4J A;  2PMT A;  5A4V A;  1X5E A;  4K2X A;  3ME8 A;  4F0B A;  3IDV A;  4I2T A;  3DVX A;  4MA9 A;  4MJB A;  5J41 A;  1XZO A;  2AHE A;  2H0G A;  1EEJ A;  4YKF A;  3ZFL A;  3FW2 A;  4V2L A;  3ERW A;  5EY6 A;  5ENU A;  2PU9 C;  2OAD A;  1Z9H A;  4BWQ A;  2KLX A;  2HFD A;  4O5U A;  2OA7 A;  2R2J A;  4IN0 A;  2QSI A;  1EOH A;  3VUR A;  1OC9 A;  4MJE A;  5E4W A;  4AJ6 A;  4K7N A;  5J9C A;  4GCI A;  1TW9 A;  1SL2 B;  1NHY A;  2NTO A;  3GTU B;  2R6K A;  2OE0 A;  1FB6 A;  4HEA 2;  2OAC A;  3WGD A;  3FHK A;  4YKG A;  3ZLP A;  1U87 A;  4FIW A;  3D5J A;  3R3E A;  1XBS A;  2HT9 A;  1FW1 A;  1FOV A;  1YZX A;  3HZ8 A;  3CRU A;  1AUC A;  4Z2U A;  1SKR B;  2IFQ A;  3EUR A;  3LYP A;  1GSS A;  1M2A A;  3TOT A;  4XCS A;  4TRX A;  1XWB A;  4MMM A;  5IMD A;  2YZH A;  3LXZ A;  4PXO A;  3DKS A;  2HSY A;  5B7C A;  1OE7 A;  4YQM A;  1XOB A;  4N0Z A;  2H0I A;  4NXI A;  2J23 A;  3KMO A;  3VPQ A;  4KDU A;  3QAW A;  4XS4 B;  5AIS A;  10GS A;  1M2D A;  3TDG A;  1WP0 A;  4NPB A;  1A2J A;  3V1W A;  3GNJ A;  3O76 A;  4KUN A;  4PNF A;  1EEM A;  1OKD A;  5G30 A;  5D73 A;  2P0G A;  1TOF A;  1EZK A;  1Z6M A;  4YQU A;  2DC5 A;  1GUH A;  3PGT A;  3QD9 A;  3IOS A;  2DKI A;  1RQM A;  3GHA A;  2MZC A;  1FB0 A;  4POB A;  4AJ7 A;  3FMW A;  4YH2 A;  4EO3 A;  1R5P A;  2V1M A;  2GS3 A;  4MPF A;  1O8X A;  1BAY A;  2LV3 A;  1GP1 A;  4ECC A;  1OC3 A;  4IP6 A;  3KH7 A;  3IHQ A;  5HFI A;  1BX9 A;  1SKS B;  1XWA A;  1V2A A;  4PQ1 A;  2CAQ A;  1MDI A;  20GS A;  4FYB A;  3FR3 A;  1F9M A;  4I97 A;  3GRX A;  3PIN A;  4MCU A;  3FRC A;  3CYN A;  2KHP A;  5GSS A;  4EUY A;  2LJR A;  3IK7 A;  4L5L A;  1GUM A;  3ZIT A;  4OFM A;  3EWL A;  2VIM A;  5B8A A;  2X64 A;  2JSY A;  2VCX A;  4RI6 A;  1HD2 A;  4ZB8 A;  4CDO A;  2F9S A;  3IBH A;  5FHI A;  2RLI A;  3DML A;  1WMJ A;  1FVJ A;  1W4V A;  5JWR B;  2Z9S A;  1TDI A;  1A8L A;  2ZNM A;  2ES7 A;  1QFN A;  4DSS A;  3KEB A;  1PD2 1;  3ISO A;  4G0I A;  1YEX A;  2TIR A;  4IGJ A;  1DE1 A;  1XWK A;  4Q5R A;  2CVD A;  2GZY A;  2L6C A;  3E9J B;  4O92 A;  1ABA A;  3HVV A;  2A2R A;  3TB2 A;  5LNK e;  5CYY A;  3A5W A;  3LQ7 A;  3CSI A;  3QMX A;  2V6K A;  1T4Z A;  1M2B A;  2XPD A;  1QK8 A;  5F8B A;  2M46 A;  2VD1 A;  2CQ9 A;  4GST A;  1T4Y A;  4PGT A;  1SD8 A;  14GS A;  4QQ7 A;  2YJ7 A;  5ECL B;  4I5Q A;  2C0G A;  1YDK A;  5G5E A;  3BJ5 A;  2C0F A;  2C8U A;  4P3Y B;  1WJK A;  4EF0 A;  3I9V 2;  3HHV A;  4RI7 A;  4PTS A;  2NPB A;  4KB3 A;  3MDK A;  2H73 A;  5F0G A;  2VLT A;  3LFL A;  2A4V A;  2GTU A;  3UBL A;  5DQS A;  5ELA A;  3L78 A;  2VLU A;  1K3Y A;  3IXR A;  1XFL A;  4BVX B;  2MBT A;  2GGT A;  1KEB A;  2REM A;  1R4W A;  3F4T A;  4IJ3 A;  2BMX A;  4FYU A;  4F9Z A;  4BVY B;  3LW9 A;  4O7H A;  2TRX A;  3SBC A;  4MJC A;  17GS A;  2VL2 C;  3K8N A;  3ZFB A;  1YQ1 A;  4E8E A;  3GN3 A;  1OC8 A;  2VO4 A;  4IVF A;  9GSS A;  1CQH A;  2VD0 A;  2WFC A;  5IMC A;  2H74 A;  3EMX A;  1V57 A;  1DUG A;  3VWV A;  1GTI A;  3APQ A;  3C7M A;  3IHG A;  4MNN A;  1PKW A;  2L6D A;  2P31 A;  1O85 A;  2I9H A;  3MWH A;  1H4O A;  2JAD A;  2M72 A;  4O32 A;  3IK9 A;  1BED A;  4XRD A;  1A0R P;  4IQ1 A;  1GTA A;  1USB A;  4K8M A;  3DWV A;  1DBY A;  3CSJ A;  2DJK A;  1TK5 B;  3FZA A;  3ME7 A;  2YPM A;  2P5R A;  5LCZ A;  2B3S A;  5ECO B;  3LG6 A;  3JCM L;  5HR2 A;  5INY A;  2B7J A;  3C73 A;  3DGQ A;  4TOP A;  1Y6E A;  4OO5 A;  2C3N A;  4HSC X;  4IEL A;  2GSS A;  2V6O A;  3A5I A;  4K0N A;  3F4R A;  4BL7 A;  3P8W A;  2VOC A;  1F37 A;  3CQF A;  4ZIJ A;  2RII A;  3WYW A;  2WRT A;  1VRS D;  2FWF A;  4JE1 A;  1WIK A;  1JHB A;  4HZ2 A;  2JZS A;  2VUP A;  4KH7 A;  4MJA A;  4OD7 A;  3WT1 A;  2A4H A;  4KE3 A;  3WGX A;  2IN3 A;  3GIX A;  3EE2 A;  2J9H A;  2QKE A;  3D0Z A;  4AGS A;  4PUA A;  1U6T A;  3FEU A;  3S9F A;  2GT5 A;  4G9H A;  5F05 A;  1G6Y A;  4X4J A;  1EV9 A;  1YEP A;  4BWS A;  3BCK A;  2R0P A;  4KCE A;  5E59 A;  2R4V A;  5ECP B;  1UA5 A;  2FA8 A;  3N9J A;  2GQM A;  4KND A;  2VCT A;  3PH9 A;  3ERG A;  5D9X A;  4YQV A;  1OE8 A;  5G5F A;  1EP8 A;  4WR4 A;  1S3R A;  4E8H A;  3BOA A;  2DBC A;  5CRH A;  1PL2 A;  4OO4 A;  5C00 A;  1X0R A;  5DDL A;  2H8L A;  3LOR A;  1K3O A;  3PR8 A;  1UVZ A;  2FA4 A;  3EU3 A;  1RK4 A;  3TOU A;  3GKK A;  2JZR A;  2DIY A;  4EDY A;  1ERU A;  4Q5Q A;  1VF3 A;  5J9B A;  1GSY A;  3M1G A;  2OE1 A;  2AB6 A;  5ECM B;  1BG5 A;  2RM5 A;  3TRX A;  2X8C A;  4DSR A;  4Z2R A;  2HSH A;  2KUC A;  3HZ4 A;  2HRF A;  1O8W A;  4PQH A;  4WF4 A;  4POL A;  4MPG A;  5GAN D;  1GNW A;  2L4C A;  2H76 A;  2F8A A;  1NW2 A;  3HXS A;  1AW9 A;  3D6I A;  2DML A;  4TVE A;  2IJY A;  1GRX A;  1ZYN A;  3GH9 A;  4IS0 A;  8GSS A;  1X9M B;  1SK2 A;  4HDE A;  1GTB A;  2KP1 A;  1GSD A;  5G31 A;  2H19 A;  4HZ4 A;  1E6B A;  3MYD A;  4WEY A;  2X8H A;  2NBS A;  3I43 A;  3TUE A;  5D93 A;  3GYK A;  3FR6 A;  4HU9 A;  1LU4 A;  3EU4 A;  4Z7X A;  3KIJ A;  4GSS A;  4PUF C;  3A2V A;  3H1N A;  4HJ2 A;  3CXG A;  4IQA A;  3LEF A;  3KTL A;  2X8G A;  4K0G A;  1A2M A;  4D73 B;  2NVL A;  4FH8 A;  5DCG A;  2OE3 A;  2XC2 A;  3UAR A;  4X0X A;  3TRP A;  3M9J A;  3OR5 A;  2B6M A;  2VL3 A;  3FYG A;  4KDY A;  4XS4 A;  3FY7 A;  4EIP A;  2DJ2 A;  1O7U A;  3MAK A;  1YJ6 A;  4MK3 A;  4N0V A;  3KMN A;  2V32 A;  4I8B A;  1O81 A;  3CSH A;  2XBQ A;  2EIQ A;  3FZ4 A;  5JCG A;  2UZ8 A;  2H1A A;  4G0K A;  1ERT A;  3LXT A;  4K7I A;  4ULX A;  1PMT A;  2JU5 A;  6GSX A;  1BYE A;  4WKW A;  3H4K A;  4NMU A;  3RPN A;  2AJQ B;  1KNG A;  2ZCT A;  3F0I A;  4OMV A;  1ML6 A;  5IMV A;  2VLV A;  3DXB A;  4HQS A;  1ZMA A;  3P7X A;  3W6G A;  1YY7 A;  1THX A;  2CAI A;  2DJ1 A;  3EC3 A;  2QGV A;  3J7Y b;  3CMI A;  5IOX A;  3IRA A;  2FWE A;  5B6N A;  1G6W A;  2HLS A;  2R5G A;  1TTZ A;  3TGZ A;  3RDW A;  4TR4 A;  2EC4 A;  3HVS A;  5HFK A;  4MH2 A;  2MMA A;  3FK8 A;  3QR6 A;  2JZT A;  1GSQ A;  5IPH A;  3HJP A;  2MMO A;  2MMN A;  3TKR A;  2H6X A;  2LQQ A;  1SL0 B;  3UVH A;  2YN1 A;  2H0H A;  3C8E A;  3M8N A;  1JZO A;  3FKF A;  1M7T A;  2E2M A;  2YCD A;  4EKZ A;  1IYI A;  2PWJ A;  4CY6 A;  4TW5 A;  4MZC A;  4V1A p;  2YJH A;  2KOK A;  2FGX A;  5IOW A;  5JCW A;  2H30 A;  5CO3 A;  2WCI A;  3MNG A;  5ECI B;  3DEX A;  3D4M A;  1K0M A;  3RBT A;  2BTO T;  1K0A A;  3RAZ A;  3HYP A;  4EE0 A;  4HI7 A;  5GZZ B;  3ZL5 A;  2B1L A;  3IC4 A;  1JZD A;  5EL8 A;  1G0T A;  5KN2 A;  2O7K A;  1JLV A;  3LWA A;  1SU9 A;  3I6A A;  2GDR A;  2H6Y A;  3U5R E;  1SJZ A;  1K0O A;  3GKM A;  2H01 A;  4XHM A;  3TCO A;  4CHS A;  4LMW A;  2LEG A;  3A3T A;  1K0N A;  2JSZ A;  4GSN A;  3GKN A;  3E3E A;  1GTU A;  3GFK A;  3HJO A;  1KBN A;  3TKS A;  1XWG A;  4F03 A;  4KSM A;  5KN0 A;  3ZIV A;  1H75 A;  2F8F A;  4X43 A;  3UMA A;  2O8V B;  2XHF A;  2QC7 A;  5DAL B;  1FAA A;  5F06 A;  4K5S A;  3L4N A;  2LRC A;  1WE0 A;  1MDK A;  3Q19 A;  3ZVJ A;  1OYJ A;  4NV5 A;  2QA2 A;  5IMZ A;  1GWC A;  3D4T A;  2E0Q A;  3Q74 A;  4BVX A;  1BQ7 A;  1ACV A;  3QOU A;  4BVY A;  4EL1 A;  4JRR A;  1AIU A;  1TXX A;  1GUL A;  3GL3 A;  2PGT A;  1URM A;  3LGC A;  6GSW A;  4BIK A;  2AV4 A;  2DSA A;  2DJ0 A;  2L5L A;  3GV1 A;  2RM6 A;  5CP1 A;  1GSU A;  2V2G A;  2FD3 A;  4MAB A;  2L5O A;  1TRU A;  2CX4 A;  2C1Y A;  3W8S A;  1ZCP A;  5DVB A;  4IW9 A;  5DAK B;  1T00 A;  1SYX A;  3IA1 A;  2LQO A;  2I1U A;  3O6T A;  4HU7 A;  3A2X A;  1TU8 A;  2CT6 A;  3H8Q A;  2N5F A;  1DE2 A;  1PX6 A;  1AC1 A;  3D21 A;  1PQN A;  3UVT A;  1MD3 A;  4OFT A;  4FYC A;  4IP1 A;  3A2W A;  3NZN A;  1IYH A;  5D8I A;  3GX0 A;  4J2F A;  4WXT A;  2JL4 A;  2WZ9 A;  3UOM A;  1UC7 A;  4ZL9 A;  1V98 A;  1ERV A;  2RUF A;  4TXV A;  1B9X C;  1F3B A;  1HNA A;  1HNC A;  3TJJ A;  4J56 E;  4ZBB A;  2DLX A;  5A4U A;  2AYT A;  4PQI A;  1Z7R A;  2LNS A;  2VCQ A;  4ML6 A;  2LST A;  2NDO A;  1SKW B;  4G19 A;  4I2U A;  4K9Z A;  4OWY A;  1X9W B;  1EV4 A;  1Q4J A;  3W8J A;  1JLW A;  2HNL A;  1GLP A;  1XXU A;  1S3A A;  2DJ3 A;  5F07 A;  2C3Q A;  5B8B A;  4G0L A;  1Y25 A;  3J7Y k;  1XOA A;  2HRA A;  4LLR A;  2F3M A;  3GH6 A;  3VWU A;  2C0E A;  4ISD A;  6GSY A;  3QFA C;  4H86 A;  2IWT A;  4G2E A;  1WOU A;  5J5N A;  2O89 A;  4YAP A;  4N10 A;  1K0B A;  2E2G A;  1F6M C;  3KM6 A;  4PUR A;  1SJI A;  2P5Q A;  2R0C A;  2B5Y A;  2GSR A;  5D9T A;  4ECB A;  1WRY A;  2OKA A;  1XVQ A;  3MIX A;  3L9V A;  1XPV A;  4F82 A;  5GST A;  1PSQ A;  5AN1 A;  2H1G A;  5IPG A;  1ZOF A;  1Z7P A;  4ACS A;  2H72 A;  3US3 A;  1F3A A;  1J0F A;  2HE3 A;  4TN8 A;  3G7I A;  4XIH A;  2X99 A;  1Z3E A;  3CTF A;  1SYR A;  2FCH A;  1K3L A;  1B9Y C;  4CY8 A;  12GS A;  4TR1 B;  3FZ9 A;  3TRQ A;  3WT2 A;  1LBK A;  1XCC A;  5G1K A;  2YOI A;  3HJM A;  5IO0 A;  4EXJ A;  2ON7 A;  1QMV A;  4MP4 A;  4N11 A;  2K8S A;  2K9F A;  2VL9 A;  2L57 A;  4ID0 A;  4X1U A;  1RW1 A;  4XS1 A;  1GH2 A;  6GST A;  1XVW A;  3ED3 A;  4ZBA A;  4V1A g;  3M3M A;  1HNB A;  2GT6 A;  5ECH B;  3EMP A;  1XW6 A;  3KP9 A;  4XRA A;  3LYK A;  4FQU A;  1ZYE A;  5EPF A;  2IL3 A;  4XS6 A;  2H71 A;  4HQZ A;  4ICY A;  4N30 A;  2AUV A;  5H5Q A;  3VPT A;  5JWO B;  1LJR A;  2I4A A;  4EC0 A;  1U88 A;  3UAP A;  1VGL A;  4WET A;  5COH A;  1A2L A;  1U3A A;  1XWC A;  1EP7 A;  2R37 A;  4BA7 A;  3TKQ A;  5HR3 A;  1GSE A;  2O85 A;  5EVO A;  4ECI A;  4GQC A;  4LL4 B;  4KDX A;  1A23 A;  4TR0 A;  4HS1 A;  5G1L A;  4V2M A;  2CVB A;  2OBK A;  1PN0 A;  4Q5N A;  3Q18 A;  4NHW A;  1FHE A;  2JAC A;  3HVX A;  5ID2 A;  3DIE A;  1PN9 A;  3VWX A;  1PL1 A;  3D22 A;  1J08 A;  2R0G A;  4FO5 A;  1N2A A;  4USS A;  1T3B A;  3KD0 A;  4D73 A;  3BCI A;  2YZU A;  3EVI A;  5JCU A;  3HY2 A;  1AQV A;  1YF1 A;  3HKR A;  2KP2 A;  1Z5Y E;  3HVN A;  3TJK A;  4K7O A;  1VF1 A;  3HDC A;  18GS A;  16GS A;  3NIV A;  2WJU A;  1X5D A;  1MEK A;  1PA3 A;  3ZVJ D;  3F3R A;  4CW9 A;  1B4P A;  3HA9 A;  4MF7 A;  4ZXG A;  4IHU A;  2FHE A;  3VI5 A;  1XW5 A;  7GSS A;  1F2E A;  6GSU A;  1ZYQ B;  1YKA A;  2VCZ A;  2HZE A;  2DJJ A;  4Q5F A;  3TJG A;  1BJX A;  2IPA A;  4TR3 A;  2X49 A;  3UJ1 A;  4A5P A;  1M99 A;  5D9V A;  5LD0 A;  3QFB C;  1GL8 A;  2LKU A;  1ZGN A;  3RHC A;  5ID2 B;  1THO A;  1Z6N A;  1JFU A;  4Z2T A;  1Q98 A;  2GST A;  2K6V A;  4EIQ A;  2AAW A;  1WPI A;  1N8J A;  1C72 A;  1XG8 A;  2ON5 A;  2V41 A;  1B4Q A;  1FOH A;  2CA8 A;  4MLY A;  1MD4 A;  5A5K A;  2LS5 A;  2IMD A;  3CTG A;  1S3C A;  2HRN A;  1O6J A;  1S3D A;  3TKP A;  2ALB A;  1V9W A;  1XW9 A;  1QQ2 A;  3G9B A;  4DSQ A;  2CVK A;  1A0F A;  3O3T A;  2WGR A;  4F2I A;  1W89 A;  5HQP A;  3QAV A;  2FLS A;  3VFI A;  4ZB6 A;  4RQR A;  4KAE A;  1R7H A;  4NV2 A;  1EOG A;  4LMV A;  3ZZX A;  4NHZ A;  2HZE B;  5D96 A;  5KOX A;  4IJI A;  1GNE A; 
#chains in the Genus database with same CATH homology
 1T8E B;  4MZW A;  2PVO C;  5ECR B;  2FUG 2;  1XIY A;  4ZL8 A;  2LUS A;  1KTE A;  2PN8 A;  2B1K A;  2YP6 A;  3F9U A;  3GL5 A;  5ELG A;  2YWM A;  1X9S B;  4WF5 A;  3RHB A;  4GXZ A;  4OFN A;  3ZTL A;  4PNG A;  3PPU A;  2PER A;  2LTK A;  3N5O A;  2H75 A;  2LRN A;  4G10 A;  3QDN A;  22GS A;  2N5A A;  4L0W A;  4KSO A;  3ERF A;  2WS2 A;  1X5C A;  4I6X A;  2D2Z A;  3MSZ A;  2EIR A;  3IPZ A;  2I81 A;  4L0U A;  2C0D A;  3WD6 A;  1TU7 A;  2O87 A;  3APO A;  3APS A;  3C71 A;  1MDJ A;  2H1B A;  4KX4 A;  3TJF A;  1I5G A;  3KTB A;  5CRE A;  5AGY A;  1SD9 A;  4OCE A;  4ECJ A;  1OC9 B;  3TJB A;  2HYX A;  4GF0 A;  3ZML A;  5DAL A;  3UEM A;  3CBU A;  3HD5 A;  3GSS A;  5DCH A;  1TRW A;  3UL3 A;  5CRD A;  2YAN A;  3LSZ A;  5H5R A;  1OVN A;  4KW6 A;  1TI1 A;  5KOW A;  1OAZ A;  1R5A A;  1V58 A;  3R2Q A;  2FWG A;  4KCA A;  4POK A;  2X4A A;  1DSB A;  2DIZ A;  2G0F A;  1ZZY A;  5KN1 A;  5CNW A;  1K0D A;  3KGK A;  3NOF A;  2L4Q A;  5IO2 A;  3KJY A;  1HQO A;  1OKT A;  3C1S A;  2OJL A;  2I3Y A;  3F8U A;  2IFQ B;  2GVP A;  1MTC A;  3EYT A;  3RPP A;  2LNT A;  5FT3 A;  3L0H A;  5DAK A;  1AAZ A;  5IQY A;  19GS A;  1UN2 A;  2QA1 A;  4IKH A;  1WWJ A;  4NAX A;  1JZR A;  4KA0 A;  2BJX A;  3GMF A;  3F4S A;  2HZF A;  2LRT A;  2G2Q A;  4HJM A;  3IC8 A;  3UIW A;  2WB9 A;  4EVM A;  5DJM A;  3HCZ A;  4OCF A;  2LJA A;  1EGO A;  1EWX A;  3GA4 A;  4LL1 B;  2WDU A;  3VWW A;  2HI7 A;  2YNX A;  2IIY A;  2L59 A;  5ECK B;  3WGE A;  1AQX A;  3IE3 A;  1ON4 A;  2K18 A;  4PX1 A;  2FNO A;  2CZ2 A;  2GQL A;  5L71 A;  1ERW A;  1TRV A;  3VK9 A;  2IMK A;  4GWR A;  3DVW A;  4RUV A;  1TRS A;  3GUS A;  3IAS 2;  1PGT A;  2WUL A;  1R26 A;  3BD2 A;  3C1R A;  3CRT A;  2VL2 A;  2HSM A;  1GUK A;  3Q6O A;  1TK0 B;  5FWG A;  2B5E A;  3TKS C;  1QGV A;  11GS A;  2H6Z A;  4HUA A;  5B6M A;  2IMF A;  1T7P B;  4XTS A;  5CAX A;  4K6X A;  4MZB A;  4IBP A;  3VLN A;  1E2Y A;  2A2P A;  1TP9 A;  5HR1 A;  1JZW A;  4WBR D;  2PUK C;  5BMU A;  1SEN A;  4DEJ A;  1O73 A;  1G7E A;  4JR6 A;  2VCV A;  1TI3 A;  4ILF A;  4MH3 A;  6GSV A;  3ZRD A;  1GLQ A;  2F51 A;  3P2A A;  3KXO A;  3UBK A;  5ECS A;  4DSS B;  5ECQ B;  4ZB9 A;  4TR1 A;  1TKD B;  2B5X A;  3QAG A;  2FWH A;  3ZRE A;  1J9B A;  3KCM A;  4TXO A;  2YWN A;  3QPM A;  2HXK A;  1TK8 B;  4K5R A;  4ML1 A;  2FY6 A;  4EDZ A;  2GSQ A;  4K1F A;  3L9U A;  5IIZ A;  1ZL9 A;  4KGI A;  3G7J A;  2HRK A;  4K2D A;  1QUW A;  4JR4 A;  2PBJ A;  1M9A A;  4JU5 A;  1FG4 A;  1M9B A;  1HYU A;  1K0C A;  3F63 A;  2PVQ A;  3KZQ A;  5J4U A;  1FVK A;  4NWY A;  1AXD A;  1PX7 A;  1A8Y A;  5C04 A;  2VM1 A;  4F0C A;  1NSW A;  5IM9 A;  2YV7 A;  1NM3 A;  4JBB A;  3L9S A;  2R3X A;  1V40 A;  2IMI A;  5KN3 A;  4TKY A;  2E7P A;  2RUE A;  3GUR A;  4BPY A;  3KP8 A;  1ST9 A;  3LJR A;  3BBY A;  4J57 E;  4HOJ A;  2K8V A;  3E0U A;  3F3Q A;  1TJD A;  2GLR A;  3QCP A;  1ZYP A;  2IME A;  4TXO B;  2YWI A;  2CV4 A;  4QL7 A;  2ZUP A;  4GQF A;  1YKC A;  2PPT A;  4GLT A;  3TKS E;  4ZBD A;  4ZL7 A;  3EIN A;  1AQW A;  5HR0 A;  2MBS A;  3FZ5 A;  3ZMK A;  1T1V A;  5CRW A;  4JZQ A;  1FO5 A;  1M0U A;  3IV4 A;  5H5S A;  5DBQ A;  4V2N A;  3EPT A;  4WBJ A;  1VF4 A;  2A2S A;  2YV9 A;  1VF2 A;  3G7Y A;  5A4W A;  2OBI A;  4YAV A;  5HFG A;  2MYG A;  4RQX A;  3DYR A;  1EGR A;  2XPE A;  5J3R A;  2H66 A;  1PKZ A;  1I9D A;  3GKX A;  2C3T A;  4LA1 A;  1ILO A;  1PRX A;  1YF0 A;  3FR9 A;  2GZZ A;  4ZIL A;  3GX8 A;  2VCW A;  2H70 A;  5BRT A;  5DJL A;  2CZ3 A;  1A24 A;  3M9K A;  5AIX A;  1GSF A;  2GQK A;  5IMF A;  4BL7 B;  3DRN A;  2GZP A;  3KH9 A;  2YWO A;  1SL1 B;  2C80 A;  3M0F A;  3F6D A;  4JED A;  2H1D A;  5GAP D;  2MMZ A;  3AY8 A;  4MF5 A;  3SWL A;  4KF9 A;  1SK1 A;  1SK0 A;  5CRG A;  3P90 A;  1NHO A;  2LJK A;  2N5B A;  4AJ8 A;  1CQG A;  3I69 A;  3H79 A;  2TRC P;  5D9W A;  2B7K A;  5JWQ B;  1SJ6 A;  1QXH A;  4GTU A;  4O5R A;  2XBI A;  6GSS A;  4GRF A;  2DKH A;  3VI7 A;  5ECN B;  3ZYW A;  2VM2 A;  5ABR A;  5G2Z A;  5AIV A;  4O5Q A;  1B48 A;  1G7O A;  3F6F A;  3U6V A;  5KEJ A;  3H93 A;  1U3I A;  3DD3 A;  2M80 A;  1B8X A;  4WR5 A;  4POM A;  5IMA A;  3GST A;  3GTU A;  3IR4 A;  13GS A;  4AF2 A;  4MDC A;  2CX3 A;  2EIO A;  3IAM 2;  4DVC A;  4L5O A;  4L8E A;  2DMM A;  3ZIJ A;  4QL9 A;  2VAF A;  5DQY A;  4MF6 A;  2C4J A;  2PMT A;  5A4V A;  1X5E A;  4K2X A;  3ME8 A;  4F0B A;  3IDV A;  4I2T A;  3DVX A;  4MA9 A;  4MJB A;  5J41 A;  1XZO A;  2AHE A;  2H0G A;  1EEJ A;  4YKF A;  3ZFL A;  3FW2 A;  4V2L A;  3ERW A;  5EY6 A;  5ENU A;  2PU9 C;  2OAD A;  1Z9H A;  4BWQ A;  2KLX A;  2HFD A;  4O5U A;  2OA7 A;  2R2J A;  4IN0 A;  2QSI A;  1EOH A;  3VUR A;  1OC9 A;  4MJE A;  5E4W A;  4AJ6 A;  4K7N A;  5J9C A;  4GCI A;  1TW9 A;  1SL2 B;  1NHY A;  2NTO A;  3GTU B;  2R6K A;  2OE0 A;  1FB6 A;  4HEA 2;  2OAC A;  3WGD A;  3FHK A;  4YKG A;  3ZLP A;  1U87 A;  4FIW A;  3D5J A;  3R3E A;  1XBS A;  2HT9 A;  1FW1 A;  1FOV A;  1YZX A;  3HZ8 A;  3CRU A;  1AUC A;  4Z2U A;  1SKR B;  2IFQ A;  3EUR A;  3LYP A;  1GSS A;  1M2A A;  3TOT A;  4XCS A;  4TRX A;  1XWB A;  4MMM A;  5IMD A;  2YZH A;  3LXZ A;  4PXO A;  3DKS A;  2HSY A;  5B7C A;  1OE7 A;  4YQM A;  1XOB A;  4N0Z A;  2H0I A;  4NXI A;  2J23 A;  3KMO A;  3VPQ A;  4KDU A;  3QAW A;  4XS4 B;  5AIS A;  10GS A;  1M2D A;  3TDG A;  1WP0 A;  4NPB A;  1A2J A;  3V1W A;  3GNJ A;  3O76 A;  4KUN A;  4PNF A;  1EEM A;  1OKD A;  5G30 A;  5D73 A;  2P0G A;  1TOF A;  1EZK A;  1Z6M A;  4YQU A;  2DC5 A;  1GUH A;  3PGT A;  3QD9 A;  3IOS A;  2DKI A;  1RQM A;  3GHA A;  2MZC A;  1FB0 A;  4POB A;  4AJ7 A;  3FMW A;  4YH2 A;  4EO3 A;  1R5P A;  2V1M A;  2GS3 A;  4MPF A;  1O8X A;  1BAY A;  2LV3 A;  1GP1 A;  4ECC A;  1OC3 A;  4IP6 A;  3KH7 A;  3IHQ A;  5HFI A;  1BX9 A;  1SKS B;  1XWA A;  1V2A A;  4PQ1 A;  2CAQ A;  1MDI A;  20GS A;  4FYB A;  3FR3 A;  1F9M A;  4I97 A;  3GRX A;  3PIN A;  4MCU A;  3FRC A;  3CYN A;  2KHP A;  5GSS A;  4EUY A;  2LJR A;  3IK7 A;  4L5L A;  1GUM A;  3ZIT A;  4OFM A;  3EWL A;  2VIM A;  5B8A A;  2X64 A;  2JSY A;  2VCX A;  4RI6 A;  1HD2 A;  4ZB8 A;  4CDO A;  2F9S A;  3IBH A;  5FHI A;  2RLI A;  3DML A;  1WMJ A;  1FVJ A;  1W4V A;  5JWR B;  2Z9S A;  1TDI A;  1A8L A;  2ZNM A;  2ES7 A;  1QFN A;  4DSS A;  3KEB A;  1PD2 1;  3ISO A;  4G0I A;  1YEX A;  2TIR A;  4IGJ A;  1DE1 A;  1XWK A;  4Q5R A;  2CVD A;  2GZY A;  2L6C A;  3E9J B;  4O92 A;  1ABA A;  3HVV A;  2A2R A;  3TB2 A;  5LNK e;  5CYY A;  3A5W A;  3LQ7 A;  3CSI A;  3QMX A;  2V6K A;  1T4Z A;  1M2B A;  2XPD A;  1QK8 A;  5F8B A;  2M46 A;  2VD1 A;  2CQ9 A;  4GST A;  1T4Y A;  4PGT A;  1SD8 A;  14GS A;  4QQ7 A;  2YJ7 A;  5ECL B;  4I5Q A;  2C0G A;  1YDK A;  5G5E A;  3BJ5 A;  2C0F A;  2C8U A;  4P3Y B;  1WJK A;  4EF0 A;  3I9V 2;  3HHV A;  4RI7 A;  4PTS A;  2NPB A;  4KB3 A;  3MDK A;  2H73 A;  5F0G A;  2VLT A;  3LFL A;  2A4V A;  2GTU A;  3UBL A;  5DQS A;  5ELA A;  3L78 A;  2VLU A;  1K3Y A;  3IXR A;  1XFL A;  4BVX B;  2MBT A;  2GGT A;  1KEB A;  2REM A;  1R4W A;  3F4T A;  4IJ3 A;  2BMX A;  4FYU A;  4F9Z A;  4BVY B;  3LW9 A;  4O7H A;  2TRX A;  3SBC A;  4MJC A;  17GS A;  2VL2 C;  3K8N A;  3ZFB A;  1YQ1 A;  4E8E A;  3GN3 A;  1OC8 A;  2VO4 A;  4IVF A;  9GSS A;  1CQH A;  2VD0 A;  2WFC A;  5IMC A;  2H74 A;  3EMX A;  1V57 A;  1DUG A;  3VWV A;  1GTI A;  3APQ A;  3C7M A;  3IHG A;  4MNN A;  1PKW A;  2L6D A;  2P31 A;  1O85 A;  2I9H A;  3MWH A;  1H4O A;  2JAD A;  2M72 A;  4O32 A;  3IK9 A;  1BED A;  4XRD A;  1A0R P;  4IQ1 A;  1GTA A;  1USB A;  4K8M A;  3DWV A;  1DBY A;  3CSJ A;  2DJK A;  1TK5 B;  3FZA A;  3ME7 A;  2YPM A;  2P5R A;  5LCZ A;  2B3S A;  5ECO B;  3LG6 A;  3JCM L;  5HR2 A;  5INY A;  2B7J A;  3C73 A;  3DGQ A;  4TOP A;  1Y6E A;  4OO5 A;  2C3N A;  4IEL A;  2GSS A;  2V6O A;  3A5I A;  4K0N A;  3F4R A;  4BL7 A;  3P8W A;  2VOC A;  1F37 A;  4ZIJ A;  2RII A;  3WYW A;  2WRT A;  1VRS D;  2FWF A;  4JE1 A;  1WIK A;  1JHB A;  4HZ2 A;  2JZS A;  2VUP A;  4KH7 A;  4MJA A;  4OD7 A;  3WT1 A;  2A4H A;  4KE3 A;  3WGX A;  2IN3 A;  3GIX A;  3EE2 A;  2J9H A;  2QKE A;  3D0Z A;  4AGS A;  4PUA A;  1U6T A;  3FEU A;  3S9F A;  2GT5 A;  4G9H A;  5F05 A;  1G6Y A;  4X4J A;  1EV9 A;  1YEP A;  4BWS A;  3BCK A;  2R0P A;  4KCE A;  5E59 A;  2R4V A;  5ECP B;  1UA5 A;  2FA8 A;  3N9J A;  2GQM A;  4KND A;  2VCT A;  3PH9 A;  3ERG A;  5D9X A;  4YQV A;  1OE8 A;  5G5F A;  1EP8 A;  4WR4 A;  4E8H A;  3BOA A;  2DBC A;  5CRH A;  1PL2 A;  4OO4 A;  5C00 A;  1X0R A;  5DDL A;  2H8L A;  3LOR A;  1K3O A;  3PR8 A;  1UVZ A;  2FA4 A;  3EU3 A;  1RK4 A;  3TOU A;  3GKK A;  2JZR A;  2DIY A;  4EDY A;  1ERU A;  4Q5Q A;  1VF3 A;  5J9B A;  1GSY A;  3M1G A;  2OE1 A;  2AB6 A;  5ECM B;  1BG5 A;  2RM5 A;  3TRX A;  2X8C A;  4DSR A;  4Z2R A;  2HSH A;  2KUC A;  3HZ4 A;  2HRF A;  1O8W A;  4PQH A;  4WF4 A;  4POL A;  4MPG A;  5GAN D;  1GNW A;  2L4C A;  2H76 A;  2F8A A;  1NW2 A;  3HXS A;  1AW9 A;  3D6I A;  2DML A;  4TVE A;  2IJY A;  1GRX A;  1ZYN A;  3GH9 A;  4IS0 A;  8GSS A;  1X9M B;  1SK2 A;  4HDE A;  1GTB A;  2KP1 A;  1GSD A;  5G31 A;  2H19 A;  4HZ4 A;  1E6B A;  3MYD A;  4WEY A;  2X8H A;  2NBS A;  3I43 A;  3TUE A;  5D93 A;  3GYK A;  3FR6 A;  4HU9 A;  1LU4 A;  3EU4 A;  4Z7X A;  3KIJ A;  4GSS A;  4PUF C;  3A2V A;  3H1N A;  4HJ2 A;  3CXG A;  4IQA A;  3LEF A;  3KTL A;  2X8G A;  4K0G A;  1A2M A;  4D73 B;  2NVL A;  4FH8 A;  5DCG A;  2OE3 A;  2XC2 A;  3UAR A;  4X0X A;  3TRP A;  3M9J A;  3OR5 A;  2B6M A;  2VL3 A;  3FYG A;  4KDY A;  4XS4 A;  3FY7 A;  4EIP A;  2DJ2 A;  1O7U A;  3MAK A;  1YJ6 A;  4MK3 A;  4N0V A;  3KMN A;  2V32 A;  4I8B A;  1O81 A;  3CSH A;  2XBQ A;  2EIQ A;  3FZ4 A;  5JCG A;  2UZ8 A;  2H1A A;  4G0K A;  1ERT A;  3LXT A;  4K7I A;  4ULX A;  1PMT A;  2JU5 A;  6GSX A;  1BYE A;  4WKW A;  3H4K A;  4NMU A;  3RPN A;  2AJQ B;  1KNG A;  2ZCT A;  3F0I A;  4OMV A;  1ML6 A;  5IMV A;  2VLV A;  3DXB A;  4HQS A;  1ZMA A;  3P7X A;  3W6G A;  1YY7 A;  1THX A;  2CAI A;  2DJ1 A;  3EC3 A;  2QGV A;  3J7Y b;  3CMI A;  5IOX A;  3IRA A;  2FWE A;  5B6N A;  1G6W A;  2HLS A;  2R5G A;  1TTZ A;  3TGZ A;  3RDW A;  4TR4 A;  2EC4 A;  3HVS A;  5HFK A;  4MH2 A;  2MMA A;  3FK8 A;  3QR6 A;  2JZT A;  1GSQ A;  5IPH A;  3HJP A;  2MMO A;  2MMN A;  3TKR A;  2H6X A;  2LQQ A;  1SL0 B;  3UVH A;  2YN1 A;  2H0H A;  3C8E A;  3M8N A;  1JZO A;  3FKF A;  1M7T A;  2E2M A;  2YCD A;  4EKZ A;  1IYI A;  2PWJ A;  4CY6 A;  4TW5 A;  4MZC A;  4V1A p;  2YJH A;  2KOK A;  2FGX A;  5IOW A;  5JCW A;  2H30 A;  5CO3 A;  2WCI A;  3MNG A;  5ECI B;  3DEX A;  3D4M A;  1K0M A;  3RBT A;  2BTO T;  1K0A A;  3RAZ A;  3HYP A;  4EE0 A;  4HI7 A;  5GZZ B;  3ZL5 A;  2B1L A;  3IC4 A;  1JZD A;  5EL8 A;  1G0T A;  5KN2 A;  2O7K A;  1JLV A;  3LWA A;  1SU9 A;  3I6A A;  2GDR A;  2H6Y A;  3U5R E;  1SJZ A;  1K0O A;  3GKM A;  2H01 A;  4XHM A;  3TCO A;  4CHS A;  4LMW A;  2LEG A;  3A3T A;  1K0N A;  2JSZ A;  4GSN A;  3GKN A;  3E3E A;  1GTU A;  3GFK A;  3HJO A;  1KBN A;  3TKS A;  1XWG A;  4F03 A;  4KSM A;  5KN0 A;  3ZIV A;  1H75 A;  2F8F A;  4X43 A;  3UMA A;  2O8V B;  2XHF A;  2QC7 A;  5DAL B;  1FAA A;  5F06 A;  4K5S A;  3L4N A;  2LRC A;  1WE0 A;  1MDK A;  3Q19 A;  3ZVJ A;  1OYJ A;  4NV5 A;  2QA2 A;  5IMZ A;  1GWC A;  3D4T A;  2E0Q A;  3Q74 A;  4BVX A;  1BQ7 A;  1ACV A;  3QOU A;  4BVY A;  4EL1 A;  4JRR A;  1AIU A;  1TXX A;  1GUL A;  3GL3 A;  2PGT A;  1URM A;  3LGC A;  6GSW A;  2AV4 A;  2DSA A;  2DJ0 A;  2L5L A;  3GV1 A;  2RM6 A;  5CP1 A;  1GSU A;  2V2G A;  2FD3 A;  4MAB A;  2L5O A;  1TRU A;  2CX4 A;  2C1Y A;  3W8S A;  1ZCP A;  5DVB A;  4IW9 A;  5DAK B;  1T00 A;  1SYX A;  3IA1 A;  2LQO A;  2I1U A;  3O6T A;  4HU7 A;  3A2X A;  1TU8 A;  2CT6 A;  3H8Q A;  2N5F A;  1DE2 A;  1PX6 A;  1AC1 A;  3D21 A;  1PQN A;  3UVT A;  1MD3 A;  4OFT A;  4FYC A;  4IP1 A;  3A2W A;  3NZN A;  1IYH A;  5D8I A;  3GX0 A;  4J2F A;  4WXT A;  2JL4 A;  2WZ9 A;  3UOM A;  1UC7 A;  4ZL9 A;  1V98 A;  1ERV A;  2RUF A;  4TXV A;  1B9X C;  1F3B A;  1HNA A;  1HNC A;  3TJJ A;  4J56 E;  4ZBB A;  2DLX A;  5A4U A;  2AYT A;  4PQI A;  1Z7R A;  2LNS A;  2VCQ A;  4ML6 A;  2LST A;  2NDO A;  1SKW B;  4G19 A;  4I2U A;  4K9Z A;  4OWY A;  1X9W B;  1EV4 A;  1Q4J A;  3W8J A;  1JLW A;  2HNL A;  1GLP A;  1XXU A;  1S3A A;  2DJ3 A;  5F07 A;  2C3Q A;  5B8B A;  4G0L A;  1Y25 A;  3J7Y k;  1XOA A;  2HRA A;  4LLR A;  2F3M A;  3GH6 A;  3VWU A;  2C0E A;  4ISD A;  6GSY A;  3QFA C;  4H86 A;  2IWT A;  4G2E A;  1WOU A;  5J5N A;  2O89 A;  4YAP A;  4N10 A;  1K0B A;  2E2G A;  1F6M C;  3KM6 A;  4PUR A;  1SJI A;  2P5Q A;  2R0C A;  2B5Y A;  2GSR A;  5D9T A;  4ECB A;  1WRY A;  2OKA A;  1XVQ A;  3MIX A;  3L9V A;  1XPV A;  4F82 A;  5GST A;  1PSQ A;  5AN1 A;  2H1G A;  5IPG A;  1ZOF A;  1Z7P A;  4ACS A;  2H72 A;  3US3 A;  1F3A A;  1J0F A;  2HE3 A;  4TN8 A;  3G7I A;  4XIH A;  2X99 A;  1Z3E A;  3CTF A;  1SYR A;  2FCH A;  1K3L A;  1B9Y C;  4CY8 A;  12GS A;  4TR1 B;  3FZ9 A;  3TRQ A;  3WT2 A;  1LBK A;  1XCC A;  5G1K A;  2YOI A;  3HJM A;  5IO0 A;  4EXJ A;  2ON7 A;  1QMV A;  4MP4 A;  4N11 A;  2K8S A;  2K9F A;  2VL9 A;  2L57 A;  4ID0 A;  4X1U A;  1RW1 A;  4XS1 A;  1GH2 A;  6GST A;  1XVW A;  3ED3 A;  4ZBA A;  4V1A g;  3M3M A;  1HNB A;  2GT6 A;  5ECH B;  3EMP A;  1XW6 A;  3KP9 A;  4XRA A;  3LYK A;  4FQU A;  1ZYE A;  5EPF A;  2IL3 A;  4XS6 A;  2H71 A;  4HQZ A;  4ICY A;  4N30 A;  2AUV A;  5H5Q A;  3VPT A;  5JWO B;  1LJR A;  2I4A A;  4EC0 A;  1U88 A;  3UAP A;  1VGL A;  4WET A;  5COH A;  1A2L A;  1U3A A;  1XWC A;  1EP7 A;  2R37 A;  4BA7 A;  3TKQ A;  5HR3 A;  1GSE A;  2O85 A;  5EVO A;  4ECI A;  4GQC A;  4LL4 B;  4KDX A;  1A23 A;  4TR0 A;  4HS1 A;  5G1L A;  4V2M A;  2CVB A;  2OBK A;  1PN0 A;  4Q5N A;  3Q18 A;  4NHW A;  1FHE A;  2JAC A;  3HVX A;  5ID2 A;  3DIE A;  1PN9 A;  3VWX A;  1PL1 A;  3D22 A;  1J08 A;  2R0G A;  4FO5 A;  1N2A A;  4USS A;  1T3B A;  3KD0 A;  4D73 A;  3BCI A;  2YZU A;  3EVI A;  5JCU A;  3HY2 A;  1AQV A;  1YF1 A;  3HKR A;  2KP2 A;  1Z5Y E;  3TJK A;  4K7O A;  1VF1 A;  3HDC A;  18GS A;  16GS A;  3NIV A;  2WJU A;  1X5D A;  1MEK A;  1PA3 A;  3ZVJ D;  3F3R A;  4CW9 A;  1B4P A;  3HA9 A;  4MF7 A;  4ZXG A;  4IHU A;  2FHE A;  3VI5 A;  1XW5 A;  7GSS A;  1F2E A;  6GSU A;  1ZYQ B;  1YKA A;  2VCZ A;  2HZE A;  2DJJ A;  4Q5F A;  3TJG A;  1BJX A;  2IPA A;  4TR3 A;  2X49 A;  3UJ1 A;  4A5P A;  1M99 A;  5D9V A;  5LD0 A;  3QFB C;  1GL8 A;  2LKU A;  1ZGN A;  3RHC A;  5ID2 B;  1THO A;  1Z6N A;  1JFU A;  4Z2T A;  1Q98 A;  2GST A;  2K6V A;  4EIQ A;  2AAW A;  1WPI A;  1N8J A;  1C72 A;  2ON5 A;  2V41 A;  1B4Q A;  1FOH A;  2CA8 A;  4MLY A;  1MD4 A;  5A5K A;  2LS5 A;  2IMD A;  3CTG A;  1S3C A;  2HRN A;  1O6J A;  1S3D A;  3TKP A;  2ALB A;  1V9W A;  1XW9 A;  1QQ2 A;  3G9B A;  4DSQ A;  2CVK A;  1A0F A;  3O3T A;  2WGR A;  4F2I A;  1W89 A;  5HQP A;  3QAV A;  2FLS A;  3VFI A;  4ZB6 A;  4RQR A;  4KAE A;  1R7H A;  4NV2 A;  1EOG A;  4LMV A;  3ZZX A;  4NHZ A;  2HZE B;  5D96 A;  5KOX A;  4IJI A;  1GNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...