1A24A

Solution nmr structure of reduced dsba from escherichia coli, family of 20 structures
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
189
structure length
189
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of reduced DsbA from Escherichia coli in solution.
pubmed doi rcsb
molecule keywords DSBA
molecule tags Oxidoreductase
source organism Escherichia coli
total genus 44
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 1998-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1a24A00
4V2MA 3ZREA 2GSTA 3UJ1A 4YQVA 5ECIB 2D2ZA 5J5NA 1IYIA 5EVOA 5GAND 2P5RA 1YF1A 4NHWA 2GSRA 2YJHA 1BG5A 1N8JA 1Z3EA 4BVYA 4GQFA 2H72A 4WEYA 2H1DA 2H6YA 1B9YC 1DE2A 2FNOA 1EOHA 3W8SA 3QAWA 2GT5A 5IMDA 3DKSA 2J9HA 4OMVA 2LNTA 1Q98A 1B4QA 4O7HA 3ZFLA 5ENUA 3F4SA 1CQHA 3ZIJA 2VO4A 1XFLA 2L5LA 4HQZA 5COHA 3ED3A 2IJYA 2GSQA 5KEJA 1JZRA 1Z5YE 1SYRA 12GSA 4JU5A 5HR0A 3HHVA 4KGIA 3VI5A 1X9SB 10GSA 1SYXA 1UA5A 2X8HA 4EO3A 4PURA 4KH7A 3KGKA 5KN3A 3RAZA 1YZXA 4AF2A 1XWGA 2HRFA 2FD3A 3CYNA 4HQSA 2LEGA 2V32A 3LFLA 2F8FA 3D0ZA 4BPYA 5G31A 4V2LA 3GL3A 3ZZXA 2O87A 3GH6A 1A0FA 4TW5A 1TI3A 3TDGA 4OCEA 2HZEB 5AN1A 3IK9A 4EVMA 2VL2C 3EC3A 2AUVA 3EINA 2O8VB 5IIZA 3A5WA 3WT2A 1KTEA 2VCXA 2VM1A 2GZZA 4XHMA 4WKWA 1EEJA 2VM2A 3GNJA 5A4WA 4DVCA 2KP2A 5HFIA 2FA4A 3BD2A 16GSA 1FHEA 3BJ5A 5IMVA 3TGZA 4HJMA 4FO5A 2VL2A 2FWFA 4IW9A 2B6MA 2PERA 2R2JA 1PSQA 2YWIA 4MF5A 2YZUA 3H8QA 3N5OA 1OKTA 2L5OA 1J0FA 2AB6A 1PD21 3HA9A 1GSQA 1QK8A 5INYA 2P0GA 2GQMA 2VCVA 1PL1A 1AAZA 1K3YA 1V40A 1XW5A 5D93A 5B6MA 4G10A 4KE3A 2FUG2 4MF7A 4I5QA 4KUNA 1KEBA 2PGTA 3M0FA 1RW1A 3U6VA 4KCEA 4F9ZA 5EL8A 4I2UA 5DBQA 1A2MA 1XOAA 4EF0A 3EE2A 4JRRA 2H75A 2KOKA 3DEXA 3UEMA 4MJAA 3O6TA 4HEA2 4HZ4A 4TR1A 2FWHA 2YN1A 3CSHA 2R5GA 2V6KA 1H75A 3H1NA 2XC2A 3GTUB 2KP1A 1FVKA 5DCHA 4HI7A 4HS1A 2VD0A 3LSZA 4ZL8A 1C72A 2B5EA 2CZ2A 4H86A 2NPBA 2FWEA 3M1GA 3FK8A 1OC9B 2MZCA 4NWYA 2H0HA 3GKNA 2IFQA 4MJEA 2OE3A 1AQXA 1TRSA 2ALBA 4L5OA 1OC3A 4PQIA 5CYYA 3C8EA 1XXUA 1R4WA 3DYRA 4TRXA 3WD6A 4L5LA 2L4QA 2JZSA 2H6ZA 5EY6A 2K9FA 3WGEA 1SL2B 3VPQA 4KX4A 1LJRA 5F0GA 2DSAA 1BQ7A 1W89A 1OKDA 4HDEA 2B7JA 4EDYA 3DMLA 1SK2A 2REMA 1Y25A 3I43A 5JWRB 6GSSA 2VLVA 1K3LA 2A2SA 5IMFA 2OKAA 3D21A 3SBCA 2V41A 1NW2A 1GSSA 4ISDA 1B8XA 4Q5NA 3TKSE 5HQPA 2OBKA 3HDCA 4NPBA 1TDIA 2N5BA 3J7Yb 3GURA 1M7TA 1ZCPA 4RUVA 4DEJA 3J7Yk 4J57E 2R4VA 2DIYA 4CDOA 4TXVA 1XW6A 3GKXA 1PX7A 2XPDA 1WJKA 1RK4A 2B3SA 4KDYA 3VURA 3KP8A 2PPTA 4GQCA 3UAPA 3PINA 1AW9A 5LD0A 3VPTA 3Q19A 1PQNA 1GH2A 2OE1A 3FZ9A 2C3NA 4XRDA 2VOCA 3IPZA 2YWMA 5D9WA 3IOSA 5JWQB 4I97A 3IXRA 2PUKC 3APOA 4F2IA 1ACVA 2IWTA 3ERGA 4GLTA 1KNGA 1PKWA 4TKYA 2YV9A 3F6FA 3GX8A 1YJ6A 5ID2A 2MMOA 3IHQA 4BA7A 4FYBA 5ELGA 3E0UA 4N0ZA 2FLSA 1SKWB 1Z7RA 1GSFA 3P8WA 2IIYA 4K6XA 2TIRA 1FAAA 2OE0A 3ZRDA 1M9AA 2LUSA 2A4VA 2LKUA 1W4VA 3E9JB 4ULXA 2O7KA 2HYXA 4L0UA 5G5EA 5EPFA 3ZITA 5DDLA 4F82A 4MJCA 3TJBA 4TR0A 1QMVA 4GF0A 5FWGA 3UMAA 4BVXA 2IMIA 2DJJA 1ZYQB 4WBJA 4ZB8A 1GSYA 1F3BA 4NXIA 6GSVA 1ON4A 5G2ZA 2E0QA 3UL3A 1SJ6A 3GKMA 4LLRA 2ES7A 5CRHA 1WE0A 2LQQA 2DBCA 3IDVA 3EYTA 1XCCA 2OJLA 1GNEA 5KN2A 1BAYA 4DSQA 3TKQA 5A5KA 6GSUA 1QGVA 2X8CA 1K0DA 1EZKA 1A2JA 3H93A 4O32A 2LJKA 3KEBA 2GTUA 1SJZA 1XIYA 1XWAA 2O85A 3O76A 4N30A 2GQKA 4WXTA 1K3OA 3D4TA 2PVOC 4GTUA 3VWWA 2P31A 3Q18A 1BEDA 4ECJA 4TR4A 1E6BA 4G19A 2MYGA 4DSRA 13GSA 5FHIA 3CBUA 4ZB6A 5AIVA 1GRXA 3WGDA 3GKKA 2C0GA 4EKZA 3A3TA 5ECQB 2CVDA 3H4KA 4MJBA 2H73A 3V1WA 5CO3A 2VCZA 2LRTA 2OA7A 2I4AA 3RPPA 2RIIA 3VWVA 2WS2A 4E8EA 5H5RA 5JCGA 1I9DA 5J41A 4HJ2A 1GSEA 5ECOB 4Q5FA 4NAXA 2VLUA 4NV2A 4PXOA 2WGRA 2M80A 4QQ7A 4O92A 2MMAA 1SL0B 3HVXA 3EWLA 2HLSA 2IMKA 1I5GA 4IP1A 2JACA 4HOJA 5LCZA 4KSMA 5ECHB 4D73B 1YEXA 5H5QA 1FB6A 4ZL9A 4K0NA 4F03A 1TRUA 4PQHA 1OE7A 2YJ7A 1AUCA 2TRXA 2DJ3A 4MP4A 5B7CA 1SD8A 2VIMA 2GZYA 3D4MA 3W6GA 2IMDA 3RHCA 4CHSA 1R5PA 1OVNA 3CRUA 1O8XA 2XBIA 3S9FA 3VK9A 3GRXA 2EIRA 2AV4A 3L9UA 1J08A 1ERTA 4MK3A 4L8EA 4XS4B 4ID0A 1GLPA 3FYGA 5DVBA 2GVPA 3EURA 2C8UA 2GZPA 3QFBC 1FG4A 2XHFA 1GLQA 1QQ2A 1URMA 3TKSC 3TRQA 6GSXA 3C1SA 1K0OA 2VD1A 2LRCA 2KUCA 3LG6A 1T8EB 4K0GA 2EIQA 2VCTA 3A2XA 2CZ3A 2JZRA 1TRVA 3F6DA 5G1KA 2J23A 2KHPA 1R26A 6GSWA 4I8BA 2L59A 3TKSA 1QXHA 2EC4A 3I9V2 5DQSA 2WZ9A 1FVJA 3KTBA 4MZCA 4XIHA 1TJDA 4FYCA 2C0FA 3HVSA 5JWOB 1OC9A 1FB0A 4LL4B 3HZ8A 3EMPA 3MNGA 4G2EA 2VUPA 4X1UA 3IA1A 2JU5A 3FR9A 1SENA 4EC0A 2VCQA 3CXGA 4Z7XA 5GAPD 3KMNA 5HR2A 4DSSB 2H6XA 3LORA 4RI7A 4X0XA 2G0FA 1Z6NA 2JZTA 1SKRB 3F4RA 2R37A 1WMJA 4FIWA 1VF3A 4KCAA 3BCIA 3VLNA 3NIVA 1U87A 1ERWA 3ZL5A 1B48A 2NDOA 1YY7A 1U6TA 2JADA 4IVFA 2O89A 2ZUPA 4Q5RA 4OFTA 3FW2A 3F3QA 2CQ9A 2YPMA 4IN0A 2B1LA 1GP1A 1FOVA 3ME7A 5G5FA 2RM6A 4EL1A 1TI1A 1VF1A 3LEFA 3UBLA 4YAVA 4RQXA 1QUWA 20GSA 3UBKA 2NBSA 1K0AA 1HD2A 5B8AA 3APQA 3KJYA 1S3DA 1TU7A 3WGXA 3UVTA 4ZILA 2K18A 2LRNA 2MBSA 1VRSD 1WP0A 3F9UA 1HYUA 2C80A 2WB9A 1PN9A 4XCSA 1K0NA 1A23A 1EEMA 1ML6A 1ZL9A 2H1GA 4K1FA 3ZVJA 2LQOA 3M9KA 1ABAA 1GSUA 5D9XA 4ECIA 2FGXA 3CMIA 1GTUA 3KH7A 4YQUA 5C04A 1TRWA 2L57A 1R5AA 2FCHA 3ZTLA 1ZZYA 2ON7A 1YEPA 3C71A 2G2QA 3FEUA 1NHYA 5JCWA 3WT1A 3Q74A 2C0DA 2ON5A 5J9BA 4IJIA 5AISA 2H1BA 2IN3A 3I69A 5A4VA 1YDKA 4KSOA 2YWOA 3KD0A 3F8UA 3M9JA 1O81A 2MBTA 4LMVA 4NV5A 3TJKA 1M2AA 2GGTA 3IAM2 1Z7PA 3TOTA 5DQYA 4IQAA 4OO5A 5ECPB 7GSSA 1U3AA 2OADA 4ZB9A 4E8HA 3NZNA 4L0WA 1AQWA 4WR4A 1T4ZA 3GA4A 1ST9A 2CX3A 4MLYA 2VCWA 17GSA 5ECSA 4Q5QA 3APSA 2JSZA 5CAXA 3RPNA 1DSBA 3MWHA 1O8WA 1NSWA 1A2LA 3A2VA 2H74A 5GSTA 2XPEA 3O3TA 5IMZA 2DLXA 3LQ7A 1SK1A 2YANA 2X99A 2OBIA 3ZFBA 4EE0A 1MD3A 3CTFA 4WBRD 1ZOFA 2CVKA 3CSJA 4EXJA 2JL4A 2IL3A 3CSIA 3L0HA 1DE1A 4G9HA 4YAPA 4TR3A 2LJAA 1UC7A 2PMTA 1OAZA 2GSSA 1B9XC 4AJ6A 2WFCA 2IMEA 3QDNA 1PGTA 1K0CA 4NMUA 1T00A 1SL1B 4AJ8A 3A2WA 2B1KA 1JFUA 2K8SA 2H70A 1M0UA 3LYPA 3WYWA 2H71A 5GSSA 3P90A 2A2RA 5IM9A 3F4TA 1SKSB 5IO2A 5DCGA 4ECCA 2N5AA 3EU3A 3MDKA 4KAEA 2H66A 3LGCA 2HT9A 2LNSA 2AHEA 5DAKB 4MZWA 3E3EA 3ZIVA 1F9MA 4PUAA 5IMAA 3G9BA 1ZYEA 4TR1B 2WDUA 5IO0A 5F06A 1K0MA 2YP6A 3GSSA 5HFKA 1HNAA 2HSHA 2HNLA 1TW9A 3HXSA 1GUKA 1T3BA 2HFDA 3QPMA 1XPVA 3LXTA 1ERUA 2H01A 3DRNA 3QAGA 4D73A 4YQMA 1RQMA 2C1YA 1CQGA 5KN1A 1MDIA 5CP1A 3D5JA 2YNXA 1VGLA 4GSNA 1VF4A 3OR5A 3P7XA 1HQOA 1XVQA 14GSA 2IFQB 1YQ1A 4GSTA 4IBPA 3C1RA 3M8NA 3ZYWA 1TK8B 18GSA 3L4NA 1A8LA 3M3MA 4ZBDA 2H0IA 1HNCA 1F2EA 4XS4A 4K2DA 1MTCA 2X8GA 2DJKA 5C00A 3ZMKA 5ECRB 2GDRA 1JLVA 1XBSA 3GIXA 4TOPA 1SD9A 2HE3A 4JE1A 3IC4A 2MMNA 4BWQA 3FR3A 2KLXA 1GL8A 3HYPA 4GSSA 3ZMLA 3UARA 3KMOA 1U3IA 1EOGA 1JLWA 1MD4A 1Q4JA 1B4PA 2C3QA 2L4CA 3FKFA 4V1Ap 4OD7A 3TKRA 4CW9A 3GMFA 2GLRA 3R2QA 3FZAA 3TJGA 3QFAC 3P2AA 3KM6A 5CNWA 1BYEA 4O5RA 3QR6A 4HU9A 1WWJA 4F0CA 1TOFA 2HZEA 1EWXA 4ZBBA 3EMXA 5D9VA 2L6CA 4MCUA 1XZOA 4K7IA 2B5XA 3L9SA 3HJOA 4GCIA 1GULA 3CTGA 2CX4A 3PH9A 2DIZA 4DSSA 2GQLA 2AJQB 4IQ1A 2DMMA 1EV4A 1S3CA 4P3YB 2HZFA 1PMTA 4AJ7A 1THXA 3TKPA 4WF4A 4JBBA 3F0IA 3IR4A 2M72A 1AQVA 1K0BA 1WPIA 1XW9A 4ZL7A 3LWAA 4F0BA 3DVWA 2XBQA 3JCML 3C73A 5ID2B 3UVHA 2R6KA 1A0RP 1FO5A 4N11A 3C7MA 5DALB 2K6VA 1G6YA 4ML1A 2Z9SA 1V9WA 3LXZA 4K8MA 5IQYA 5D73A 4ILFA 2HI7A 4RQRA 3ERFA 1X5EA 1JZDA 3PR8A 1TTZA 3KXOA 2ZCTA 1VF2A 5CRDA 5J4UA 4FH8A 2B5YA 3IE3A 3KIJA 1AIUA 1ERVA 1N2AA 3KTLA 1A24A 5J9CA 3L9VA 4K7NA 2GT6A 3MAKA 1KBNA 2BJXA 1X9WB 1X9MB 1MDJA 1GUMA 1G0TA 5F05A 1MEKA 1UVZA 3BBYA 3TOUA 2H30A 2HXKA 3IV4A 2X64A 2RUFA 4TN8A 3UIWA 3D6IA 4JR4A 1Z9HA 3GTUA 4MA9A 4PGTA 2HSYA 3RHBA 1EGRA 2YWNA 1ZMAA 1IYHA 2CVBA 4N0VA 3GL5A 2C0EA 4LMWA 3GV1A 1EV9A 5CREA 2PN8A 4ACSA 3ME8A 1WIKA 5D9TA 4IJ3A 1F6MC 1S3AA 2DJ2A 5B6NA 1H4OA 2PBJA 2WULA 2VLTA 1LU4A 2BTOT 2DJ0A 2PVQA 4HU7A 3BOAA 3LYKA 22GSA 4OFNA 2NVLA 3TJJA 1USBA 4MH2A 1NM3A 2QSIA 2H19A 3HZ4A 3PGTA 4X43A 4TXOB 5IPGA 2CV4A 3GYKA 2YZHA 5ECNB 5IPHA 1TK5B 2WCIA 3FRCA 3TRPA 5D8IA 4ML6A 1E2YA 2YV7A 1WOUA 1Z6MA 2VL9A 3UOMA 3KZQA 1XWCA 2QGVA 2FWGA 2IMFA 2K8VA 1O7UA 1U88A 5F07A 5ABRA 2V1MA 2BMXA 3QMXA 2CA8A 1GNWA 3QD9A 2V2GA 1G6WA 2GS3A 3HCZA 3GN3A 1X0RA 5FT3A 1TK0B 1A8YA 1R7HA 1JZOA 3VWUA 2N5FA 4OFMA 3GX0A 2L6DA 1T1VA 2RLIA 1O73A 4JR6A 2DC5A 3ERWA 2F51A 1AC1A 2LSTA 4BWSA 1GWCA 5HR3A 1M2DA 3HD5A 5HR1A 1OC8A 4ECBA 4WR5A 1EP7A 1XWBA 5A4UA 2H76A 3H79A 3HVVA 4PX1A 1YKAA 1THOA 3Q6OA 1XVWA 1XOBA 5DJMA 3G7YA 2FA8A 3ZVJD 4ZBAA 1V2AA 2R3XA 1O6JA 1OE8A 2CAQA 3BCKA 2ZNMA 4KW6A 1X5CA 3GUSA 4MABA 5DAKA 2P5QA 9GSSA 2IPAA 3G7JA 2HRNA 4K9ZA 4KB3A 4EUYA 3NOFA 4POKA 2H8LA 1SJIA 4MH3A 4N10A 5D96A 1TU8A 2F8AA 1NHOA 4MPGA 1XWKA 1LBKA 1EP8A 3KCMA 4K7OA 2LJRA 2RM5A 3FY7A 4XS6A 1ZGNA 5DJLA 2E2GA 2OACA 1BJXA 2AYTA 4TVEA 4V1Ag 3TUEA 4J2FA 3TRXA 4IP6A 4JEDA 2VL3A 3GFKA 3TJFA 1GUHA 5KN0A 4GRFA 1DBYA 1GTIA 4V2NA 1QFNA 2NTOA 4OWYA 2CT6A 3N9JA 3IK7A 2FHEA 4IELA 3VI7A 3VWXA 2I1UA 2LV3A 4IHUA 2LS5A 3SWLA 1PKZA 2EIOA 3L78A 3QOUA 4WF5A 5JCUA 1JZWA 1V98A 4ZXGA 5LNKe 3MSZA 4POLA 2E7PA 4GWRA 3CRTA 1V58A 1PRXA 3RDWA 4MDCA 2YCDA 4POMA 2E2MA 4XS1A 2H0GA 2MMZA 3FHKA 3F63A 1F3AA 3FZ5A 4MF6A 4WETA 5E4WA 4KDUA 1F37A 3DGQA 3DVXA 3IRAA 4XTSA 1GSDA 3G7IA 5HFGA 1T4YA 3GSTA 2I3YA 1M2BA 1SK0A 1X5DA 4HZ2A 3IBHA 2CAIA 2PU9C 5H5SA 2I81A 1M9BA 1FW1A 1GTBA 3K8NA 2F9SA 4OO4A 3KH9A 3I6AA 2DMLA 3ZLPA 4QL7A 2WJUA 4RI6A 3RBTA 4QL9A 1MDKA 4GXZA 8GSSA 1GTAA 3LJRA 1OYJA 3EVIA 4MZBA 4MPFA 1Y6EA 3DIEA 2AAWA 4PNGA 2VAFA 1WRYA 4JZQA 19GSA 3DXBA 3F3RA 5AIXA 4KDXA 4BL7A 5CRGA 5G1LA 4ZIJA 1YF0A 1AXDA 1G7EA 4PNFA 3U5RE 5E59A 1V57A 5DALA 2PWJA 5IMCA 6GSYA 4PUFC 3TCOA 3US3A 3AY8A 1EGOA 6GSTA 5J3RA 3GHAA 1YKCA 1JHBA 3IAS2 2FY6A 5IOXA 2C4JA 5F8BA 1T7PB 4KA0A 4HUAA 4IKHA 5GZZB 3ISOA 3QAVA 5L71A 2YOIA 3TB2A 5CRWA 4LL1B 1TKDB 1SU9A 3VFIA 4IS0A 3HJPA 2QKEA 5AGYA 4PQ1A 4AGSA 1J9BA 5ECMB 1PL2A 2C3TA 2TRCP 3KP9A 3DWVA 2WRTA 2LTKA 1UN2A 4KNDA 4POBA 5ECLB 3DD3A 2H1AA 4I6XA 1O85A 3QCPA 2V6OA 11GSA 1PA3A 4IGJA 1M99A 5ECKB 4J56E 2QC7A 1ILOA 3D22A 4I2TA 1BX9A 4XRAA 3HKRA 4FYUA 4MMMA 3GH9A 1G7OA 3FR6A 4EDZA 2RUEA 2I9HA 2F3MA 3HJMA 4TXOA 4OCFA 2M46A 1TXXA 1TP9A 1PX6A 3W8JA 4YH2A 5ELAA 5B8BA 3EU4A 1HNBA 2DJ1A 5G30A 4NHZA 5IOWA 3HY2A 1DUGA 2B7KA 2JSYA 3FZ4A 4LA1A
chains in the Genus database with same CATH superfamily
4V2MA 3ZREA 2GSTA 3UJ1A 4YQVA 5ECIB 2D2ZA 5J5NA 1IYIA 5EVOA 5BRTA 5GAND 2P5RA 1YF1A 4NHWA 2GSRA 2YJHA 1BG5A 1N8JA 1Z3EA 4BVYA 4GQFA 2H72A 4WEYA 2H1DA 2H6YA 1B9YC 1DE2A 2FNOA 1EOHA 3W8SA 3QAWA 2GT5A 5IMDA 3DKSA 2J9HA 4OMVA 2LNTA 1Q98A 4BVXB 1B4QA 2QA1A 4O7HA 3ZFLA 5ENUA 3F4SA 1CQHA 3ZIJA 2VO4A 1XFLA 2L5LA 4HQZA 5COHA 3ED3A 2IJYA 2GSQA 5KEJA 1JZRA 1Z5YE 1SYRA 12GSA 4JU5A 5HR0A 3HHVA 4KGIA 3VI5A 1X9SB 10GSA 1SYXA 5KOWA 1UA5A 2X8HA 4EO3A 4PURA 4KH7A 3KGKA 5KN3A 3RAZA 1YZXA 4AF2A 1XWGA 2HRFA 2FD3A 3CYNA 4HQSA 2LEGA 2V32A 3LFLA 2F8FA 3D0ZA 4BPYA 5G31A 4V2LA 3GL3A 3ZZXA 2O87A 3GH6A 1A0FA 4TW5A 1TI3A 3TDGA 4OCEA 2HZEB 5AN1A 3IK9A 4EVMA 2VL2C 3EC3A 2AUVA 3EINA 2O8VB 5IIZA 3A5WA 3WT2A 1KTEA 2VCXA 2VM1A 2GZZA 4XHMA 4WKWA 1EEJA 2VM2A 3GNJA 5A4WA 4DVCA 2KP2A 5HFIA 2FA4A 3BD2A 16GSA 1FHEA 3BJ5A 5IMVA 2DKHA 3TGZA 4HJMA 4FO5A 2VL2A 2FWFA 4IW9A 2B6MA 2PERA 2R2JA 1PSQA 2YWIA 4MF5A 2YZUA 3H8QA 3N5OA 1OKTA 2L5OA 1J0FA 2AB6A 1PD21 3HA9A 1GSQA 1QK8A 5INYA 2P0GA 2GQMA 2VCVA 1PL1A 1AAZA 1K3YA 1V40A 1XW5A 5D93A 5B6MA 4G10A 4KE3A 2FUG2 4MF7A 4I5QA 4KUNA 1KEBA 2PGTA 3M0FA 1RW1A 4O5UA 3U6VA 4KCEA 4F9ZA 5EL8A 4I2UA 1A2MA 5DBQA 1XOAA 4EF0A 3EE2A 4JRRA 2H75A 2KOKA 3DEXA 3UEMA 4MJAA 3O6TA 4HEA2 4HZ4A 4TR1A 2FWHA 2YN1A 3CSHA 2R5GA 2V6KA 1H75A 3H1NA 4CY8A 2XC2A 3GTUB 2KP1A 1FOHA 1FVKA 5DCHA 4HI7A 4HS1A 2VD0A 3LSZA 4ZL8A 1C72A 2B5EA 2CZ2A 4H86A 2NPBA 2FWEA 3M1GA 3FK8A 1OC9B 2MZCA 4NWYA 2H0HA 3GKNA 2IFQA 4MJEA 2OE3A 1AQXA 1TRSA 2ALBA 4L5OA 1OC3A 4PQIA 5CYYA 3C8EA 1XXUA 1R4WA 3DYRA 4TRXA 3WD6A 4L5LA 2L4QA 2JZSA 2H6ZA 5EY6A 2K9FA 3WGEA 1SL2B 3VPQA 4KX4A 1LJRA 5F0GA 2DSAA 1BQ7A 1W89A 1OKDA 4HDEA 2B7JA 4EDYA 3DMLA 1SK2A 2REMA 1Y25A 3I43A 5JWRB 6GSSA 2VLVA 1K3LA 2A2SA 5IMFA 2OKAA 3D21A 3SBCA 2V41A 1NW2A 1GSSA 4ISDA 1B8XA 4Q5NA 3TKSE 5HQPA 2OBKA 3HDCA 4Z2UA 4NPBA 1TDIA 2N5BA 3J7Yb 3GURA 1M7TA 1ZCPA 4RUVA 4DEJA 3J7Yk 4J57E 2R4VA 2DIYA 4CDOA 4TXVA 1XW6A 3GKXA 1PX7A 2XPDA 1WJKA 1RK4A 2B3SA 4KDYA 3VURA 3KP8A 2PPTA 4GQCA 3UAPA 3PINA 1AW9A 5LD0A 3VPTA 3Q19A 1PQNA 1GH2A 2OE1A 3FZ9A 2C3NA 4XRDA 2VOCA 3IPZA 2YWMA 5D9WA 3IOSA 5JWQB 4I97A 3IXRA 2PUKC 3APOA 4F2IA 1ACVA 2IWTA 3ERGA 4GLTA 2QA2A 4YKGA 1KNGA 1PKWA 4TKYA 2YV9A 3F6FA 3GX8A 1YJ6A 5ID2A 2MMOA 3IHQA 4BA7A 4FYBA 5ELGA 4HSCX 3E0UA 4N0ZA 2FLSA 1SKWB 1Z7RA 1GSFA 3P8WA 2IIYA 4K6XA 2TIRA 1FAAA 2OE0A 3ZRDA 1M9AA 2LUSA 2A4VA 2LKUA 1W4VA 2UZ8A 3E9JB 4ULXA 2O7KA 2HYXA 4L0UA 5G5EA 5EPFA 3ZITA 5DDLA 4F82A 4MJCA 3TJBA 4TR0A 1QMVA 4GF0A 5FWGA 3UMAA 4BVXA 2IMIA 2DJJA 1ZYQB 4WBJA 4ZB8A 1GSYA 1F3BA 4NXIA 4Z2RA 6GSVA 1ON4A 5G2ZA 2E0QA 3UL3A 1SJ6A 3GKMA 4LLRA 2ES7A 5CRHA 1WE0A 2LQQA 2DBCA 3IDVA 3EYTA 1XCCA 2OJLA 1GNEA 5KN2A 1BAYA 4DSQA 3TKQA 3IC8A 5A5KA 6GSUA 1QGVA 2X8CA 2X49A 1K0DA 1EZKA 1A2JA 3H93A 4O32A 2LJKA 3KEBA 2GTUA 1SJZA 1XIYA 1XWAA 2O85A 3O76A 4N30A 2GQKA 4WXTA 1ZYNA 1K3OA 3D4TA 2PVOC 4GTUA 3VWWA 2P31A 3Q18A 1BEDA 4ECJA 4TR4A 1E6BA 4G19A 2MYGA 4DSRA 13GSA 5FHIA 3CBUA 4ZB6A 5AIVA 1GRXA 3WGDA 3GKKA 2C0GA 4EKZA 3A3TA 5ECQB 2CVDA 3H4KA 4MJBA 2H73A 3V1WA 5CO3A 2VCZA 2LRTA 2OA7A 2I4AA 3RPPA 2RIIA 3VWVA 2WS2A 4G0IA 4E8EA 5H5RA 5JCGA 1I9DA 5J41A 4HJ2A 1GSEA 5ECOB 4Q5FA 4NAXA 2VLUA 4NV2A 4PXOA 4K5SA 2WGRA 2M80A 4QQ7A 4O92A 2MMAA 1SL0B 3HVXA 3EWLA 2HLSA 3MYDA 2IMKA 1I5GA 4IP1A 2JACA 4HOJA 5LCZA 4KSMA 5ECHB 4D73B 1YEXA 5H5QA 1FB6A 4ZL9A 4K0NA 4F03A 1TRUA 4PQHA 1OE7A 2YJ7A 1AUCA 2TRXA 3FMWA 2DJ3A 4MP4A 5B7CA 1SD8A 2VIMA 2GZYA 3D4MA 3W6GA 2IMDA 3RHCA 4CHSA 1R5PA 1OVNA 3CQFA 3CRUA 1O8XA 2XBIA 3S9FA 3VK9A 3GRXA 2EIRA 2AV4A 3L9UA 1J08A 1ERTA 4MK3A 4L8EA 4XS4B 4ID0A 1GLPA 3FYGA 5DVBA 2GVPA 3EURA 2C8UA 2GZPA 3QFBC 1FG4A 2XHFA 1GLQA 1QQ2A 1URMA 3TKSC 3TRQA 6GSXA 3C1SA 1K0OA 2VD1A 2LRCA 2KUCA 3LG6A 1T8EB 4K0GA 2EIQA 2VCTA 3A2XA 2CZ3A 2JZRA 1TRVA 3F6DA 5G1KA 2J23A 2KHPA 1R26A 6GSWA 4I8BA 2L59A 3TKSA 1QXHA 2EC4A 3I9V2 5DQSA 2WZ9A 1FVJA 3KTBA 4MZCA 4XIHA 1TJDA 4FYCA 2C0FA 3HVSA 5JWOB 1OC9A 1FB0A 4LL4B 3HZ8A 3EMPA 3MNGA 4G2EA 2VUPA 4X1UA 3IA1A 2JU5A 3FR9A 1SENA 4EC0A 2VCQA 3CXGA 4Z7XA 1M3IA 5GAPD 3KMNA 5HR2A 4DSSB 2H6XA 4YKFA 3LORA 4RI7A 4X0XA 4EIPA 2G0FA 2A4HA 1Z6NA 2JZTA 1SKRB 3F4RA 2R37A 1WMJA 4FIWA 1VF3A 4KCAA 3BCIA 3VLNA 3NIVA 1U87A 1ERWA 3ZL5A 1B48A 2NDOA 1YY7A 1U6TA 2JADA 4IVFA 2O89A 2ZUPA 4Q5RA 4OFTA 3FW2A 3F3QA 3HVNA 2CQ9A 2YPMA 4IN0A 2B1LA 3LW9A 1GP1A 1FOVA 3ME7A 5G5FA 2RM6A 4EL1A 1TI1A 1VF1A 2R0PA 3LEFA 3UBLA 4YAVA 4RQXA 1QUWA 20GSA 3UBKA 2NBSA 4FQUA 1K0AA 1HD2A 5B8AA 3APQA 3KJYA 1S3DA 1TU7A 3WGXA 3UVTA 4ZILA 2K18A 2LRNA 2MBSA 1VRSD 1WP0A 3F9UA 1HYUA 2C80A 2WB9A 1PN9A 4XCSA 1K0NA 1A23A 1EEMA 1ML6A 1ZL9A 2H1GA 4K1FA 3ZVJA 2LQOA 3IHGA 3M9KA 1ABAA 1GSUA 5D9XA 4ECIA 2FGXA 3CMIA 1GTUA 3KH7A 4YQUA 5C04A 1TRWA 2L57A 1R5AA 2FCHA 3ZTLA 1ZZYA 2ON7A 1YEPA 3C71A 2G2QA 3FEUA 1NHYA 5JCWA 3WT1A 3Q74A 2C0DA 2ON5A 5J9BA 4IJIA 5AISA 2H1BA 2IN3A 3I69A 5A4VA 1YDKA 4KSOA 2YWOA 3KD0A 3F8UA 3M9JA 1O81A 2MBTA 4LMVA 4NV5A 3TJKA 1M2AA 2GGTA 3IAM2 1Z7PA 3TOTA 5DQYA 4IQAA 4OO5A 5ECPB 7GSSA 1U3AA 2OADA 4ZB9A 4E8HA 3NZNA 4L0WA 1AQWA 4WR4A 1T4ZA 3GA4A 1ST9A 2CX3A 4MLYA 2VCWA 17GSA 3MIXA 5ECSA 4CY6A 4Q5QA 3APSA 2JSZA 5CAXA 3RPNA 1DSBA 3MWHA 1O8WA 1NSWA 1A2LA 3A2VA 2H74A 5GSTA 2XPEA 3O3TA 5IMZA 2DLXA 3LQ7A 1SK1A 2YANA 2X99A 2OBIA 3ZFBA 4EE0A 1MD3A 3CTFA 4WBRD 1ZOFA 2CVKA 3CSJA 4EXJA 2JL4A 2IL3A 3CSIA 3L0HA 1DE1A 4G9HA 4YAPA 4TR3A 2LJAA 1UC7A 2PMTA 1OAZA 2GSSA 1B9XC 4AJ6A 2WFCA 2IMEA 3QDNA 1PGTA 1K0CA 4NMUA 1T00A 1SL1B 4AJ8A 3A2WA 2B1KA 1JFUA 2K8SA 2H70A 1M0UA 3LYPA 3WYWA 2H71A 5GSSA 3P90A 2A2RA 5IM9A 3F4TA 1SKSB 5IO2A 5DCGA 4ECCA 2N5AA 3EU3A 3MDKA 4KAEA 2H66A 3LGCA 2HT9A 2LNSA 2AHEA 5DAKB 4MZWA 3E3EA 3ZIVA 1F9MA 4PUAA 5IMAA 3G9BA 1ZYEA 4TR1B 2WDUA 5IO0A 5F06A 1K0MA 2YP6A 3GSSA 5HFKA 1HNAA 2HSHA 2HNLA 1TW9A 3HXSA 1GUKA 1T3BA 2HFDA 3QPMA 1XPVA 3LXTA 1ERUA 2H01A 3DRNA 3QAGA 4D73A 4YQMA 1RQMA 2C1YA 1CQGA 5KN1A 4X4JA 1MDIA 5CP1A 3D5JA 2YNXA 1VGLA 4GSNA 1VF4A 3OR5A 3P7XA 1HQOA 1XVQA 14GSA 2IFQB 1YQ1A 4GSTA 4IBPA 3C1RA 2A2PA 3M8NA 3ZYWA 1TK8B 18GSA 3L4NA 1A8LA 3M3MA 4ZBDA 5BMUA 2H0IA 1HNCA 1F2EA 4XS4A 4K2DA 1MTCA 2X8GA 2DJKA 5C00A 3ZMKA 5ECRB 2GDRA 1JLVA 1XBSA 2X4AA 5KOXA 3GIXA 4TOPA 1SD9A 2HE3A 4JE1A 3IC4A 2MMNA 4BWQA 3FR3A 2KLXA 1GL8A 3HYPA 4GSSA 3ZMLA 3UARA 3KMOA 1U3IA 1EOGA 1JLWA 1MD4A 1Q4JA 1B4PA 2C3QA 4USSA 2L4CA 3FKFA 4V1Ap 4OD7A 3TKRA 4CW9A 3GMFA 2GLRA 3R2QA 3FZAA 3TJGA 3QFAC 3P2AA 3KM6A 5CNWA 1BYEA 4O5RA 2R0CA 3QR6A 4HU9A 1WWJA 4F0CA 1TOFA 2HZEA 1EWXA 4ZBBA 1S3RA 3EMXA 5D9VA 2L6CA 4MCUA 1XZOA 4K7IA 2B5XA 3L9SA 3HJOA 4GCIA 1GULA 3CTGA 2CX4A 3PH9A 2DIZA 4DSSA 2GQLA 2AJQB 4IQ1A 2DMMA 1EV4A 1S3CA 4P3YB 2HZFA 1PMTA 4AJ7A 1THXA 3TKPA 4WF4A 4JBBA 3F0IA 3IR4A 2M72A 1AQVA 1K0BA 1WPIA 1XW9A 4ZL7A 3LWAA 4F0BA 3DVWA 2XBQA 4KF9A 3JCML 3C73A 5ID2B 4BL7B 3UVHA 2R6KA 1A0RP 1FO5A 4N11A 3C7MA 5DALB 2K6VA 1G6YA 4ML1A 2Z9SA 1V9WA 3LXZA 4K8MA 5IQYA 1ZYPA 5D73A 4ILFA 2HI7A 4RQRA 3ERFA 1X5EA 1JZDA 3PR8A 1TTZA 3KXOA 2ZCTA 1VF2A 5CRDA 5J4UA 4FH8A 2B5YA 3IE3A 3KIJA 1AIUA 1ERVA 1N2AA 3KTLA 1A24A 5J9CA 3L9VA 4K7NA 2GT6A 3MAKA 4A5PA 1KBNA 2BJXA 2R0GA 1X9WB 1X9MB 1MDJA 1GUMA 1G0TA 5F05A 1MEKA 1UVZA 3BBYA 3TOUA 2H30A 2HXKA 3IV4A 2X64A 2RUFA 4TN8A 3UIWA 3D6IA 4JR4A 1Z9HA 3GTUA 4MA9A 4PGTA 2HSYA 3RHBA 1EGRA 2YWNA 1ZMAA 1IYHA 2CVBA 4N0VA 3GL5A 2C0EA 4LMWA 3GV1A 1EV9A 5CREA 2PN8A 4ACSA 3ME8A 1WIKA 5D9TA 1PFOA 4IJ3A 1F6MC 1S3AA 2DJ2A 5B6NA 1H4OA 2PBJA 2WULA 2VLTA 1LU4A 2BTOT 2DJ0A 2PVQA 4HU7A 3BOAA 3LYKA 22GSA 4OFNA 2NVLA 3TJJA 1USBA 4MH2A 1NM3A 2QSIA 2H19A 3HZ4A 4MNNA 3PGTA 4X43A 4TXOB 5IPGA 2CV4A 3GYKA 2YZHA 5ECNB 5IPHA 1TK5B 2WCIA 3FRCA 3TRPA 5D8IA 4ML6A 1E2YA 2YV7A 4G0LA 1WOUA 1Z6MA 2VL9A 3UOMA 3KZQA 1XWCA 2QGVA 2FWGA 2IMFA 2K8VA 1O7UA 1U88A 1XG8A 5F07A 5ABRA 2V1MA 2BMXA 3QMXA 2CA8A 1GNWA 3QD9A 2V2GA 1G6WA 2GS3A 3HCZA 3GN3A 1X0RA 5FT3A 1TK0B 1A8YA 1R7HA 1JZOA 3VWUA 2N5FA 4OFMA 3GX0A 2L6DA 1T1VA 2RLIA 1O73A 4JR6A 2DC5A 3ERWA 2F51A 1AC1A 2LSTA 4BVYB 4BWSA 1GWCA 5HR3A 1M2DA 4G0KA 3HD5A 5HR1A 1OC8A 4ECBA 4WR5A 1EP7A 1XWBA 4O5QA 5A4UA 2H76A 3H79A 3HVVA 4PX1A 1YKAA 1THOA 3Q6OA 1XVWA 1XOBA 5DJMA 3G7YA 2FA8A 3ZVJD 4ZBAA 1V2AA 2R3XA 1O6JA 1OE8A 2CAQA 3BCKA 2ZNMA 4KW6A 1X5CA 3GUSA 4MABA 5DAKA 2P5QA 9GSSA 2IPAA 3G7JA 2HRNA 4K9ZA 4KB3A 4EUYA 3NOFA 3R3EA 4POKA 2H8LA 1SJIA 4MH3A 4N10A 3EPTA 5D96A 1TU8A 2F8AA 1NHOA 4MPGA 1XWKA 1LBKA 1EP8A 3KCMA 4K7OA 2LJRA 2RM5A 3FY7A 4XS6A 1ZGNA 5DJLA 4EIQA 2E2GA 2OACA 1BJXA 2AYTA 4TVEA 4V1Ag 3TUEA 4J2FA 3TRXA 4IP6A 4JEDA 2VL3A 3GFKA 3TJFA 1GUHA 5KN0A 4GRFA 1DBYA 1GTIA 4V2NA 1QFNA 2NTOA 4OWYA 2CT6A 3N9JA 3IK7A 2FHEA 4IELA 3VI7A 3VWXA 2I1UA 2LV3A 4IHUA 2LS5A 3SWLA 1PKZA 2EIOA 3L78A 3QOUA 4WF5A 4BIKA 5JCUA 1JZWA 1V98A 4ZXGA 5LNKe 3MSZA 4POLA 2E7PA 4GWRA 3CRTA 1V58A 1PRXA 3RDWA 4MDCA 2YCDA 4POMA 2E2MA 4XS1A 2H0GA 2MMZA 3FHKA 3F63A 1F3AA 3FZ5A 4MF6A 4WETA 5E4WA 4KDUA 1F37A 3DGQA 3DVXA 3IRAA 4XTSA 1GSDA 3G7IA 5HFGA 1T4YA 3GSTA 2I3YA 3PPUA 1M2BA 1SK0A 1X5DA 4HZ2A 3IBHA 2CAIA 2PU9C 5H5SA 2I81A 1M9BA 1FW1A 1GTBA 3K8NA 2F9SA 4OO4A 3KH9A 3I6AA 2DMLA 3ZLPA 4QL7A 2WJUA 2HSMA 4RI6A 3RBTA 4QL9A 1MDKA 4GXZA 1M3JA 8GSSA 1GTAA 3LJRA 1OYJA 3EVIA 4MZBA 4MPFA 1Y6EA 3DIEA 2AAWA 4PNGA 2VAFA 1WRYA 4JZQA 19GSA 3DXBA 3F3RA 5AIXA 4KDXA 4BL7A 5CRGA 5G1LA 4ZIJA 1YF0A 1AXDA 1G7EA 4PNFA 3U5RE 5E59A 1V57A 4ICYA 5DALA 2PWJA 5IMCA 6GSYA 4PUFC 3TCOA 3US3A 3AY8A 1EGOA 6GSTA 5J3RA 3GHAA 1YKCA 1JHBA 3IAS2 2FY6A 5IOXA 2C4JA 2HRKA 5F8BA 1T7PB 4KA0A 4HUAA 4IKHA 4K2XA 5GZZB 1PN0A 3ISOA 3QAVA 5L71A 2YOIA 3TB2A 5CRWA 4LL1B 1TKDB 1SU9A 3VFIA 4IS0A 3HJPA 2QKEA 5AGYA 4PQ1A 4AGSA 1J9BA 5ECMB 1PL2A 2C3TA 2TRCP 3KP9A 3DWVA 2DKIA 2WRTA 2LTKA 1UN2A 4KNDA 2HRAA 4POBA 5ECLB 3DD3A 2H1AA 4I6XA 1O85A 3QCPA 2V6OA 11GSA 1PA3A 4IGJA 4Z2TA 1M99A 5ECKB 4J56E 2QC7A 1ILOA 3D22A 4I2TA 1BX9A 4XRAA 3A5IA 3HKRA 4FYUA 4MMMA 3GH9A 1G7OA 3FR6A 4EDZA 2RUEA 2I9HA 2F3MA 3HJMA 4TXOA 4K5RA 4OCFA 2M46A 4PTSA 1TXXA 1TP9A 1PX6A 3W8JA 4YH2A 5ELAA 5B8BA 3EU4A 1HNBA 2DJ1A 5G30A 4NHZA 5IOWA 3HY2A 1DUGA 2B7KA 2JSYA 3FZ4A 4LA1A
chains in the Genus database with same CATH topology
4V2MA 3ZREA 2GSTA 3UJ1A 4YQVA 5ECIB 2D2ZA 5J5NA 1IYIA 5EVOA 5BRTA 5GAND 2P5RA 1YF1A 4NHWA 2GSRA 2YJHA 1BG5A 1N8JA 1Z3EA 4BVYA 4GQFA 2H72A 4WEYA 2H1DA 2H6YA 1B9YC 1DE2A 2FNOA 1EOHA 3W8SA 3QAWA 2GT5A 5IMDA 3DKSA 2J9HA 4OMVA 2LNTA 1Q98A 4BVXB 1B4QA 2QA1A 4O7HA 3ZFLA 5ENUA 3F4SA 1CQHA 3ZIJA 2VO4A 1XFLA 2L5LA 4HQZA 5COHA 3ED3A 2IJYA 2GSQA 5KEJA 1JZRA 1Z5YE 1SYRA 12GSA 4JU5A 5HR0A 3HHVA 4KGIA 3VI5A 1X9SB 10GSA 1SYXA 5KOWA 1UA5A 2X8HA 4EO3A 4PURA 4KH7A 3KGKA 5KN3A 3RAZA 1YZXA 4AF2A 1XWGA 2HRFA 2FD3A 3CYNA 4HQSA 2LEGA 2V32A 3LFLA 2F8FA 3D0ZA 4BPYA 5G31A 4V2LA 3GL3A 3ZZXA 2O87A 3GH6A 1A0FA 4TW5A 1TI3A 3TDGA 4OCEA 2HZEB 5AN1A 3IK9A 4EVMA 2VL2C 3EC3A 2AUVA 3EINA 2O8VB 5IIZA 3A5WA 3WT2A 1KTEA 2VCXA 2VM1A 2GZZA 4XHMA 4WKWA 1EEJA 2VM2A 3GNJA 5A4WA 4DVCA 2KP2A 5HFIA 2FA4A 3BD2A 16GSA 1FHEA 3BJ5A 5IMVA 2DKHA 3TGZA 4HJMA 4FO5A 2VL2A 2FWFA 4IW9A 2B6MA 2PERA 2R2JA 1PSQA 2YWIA 4MF5A 2YZUA 3H8QA 3N5OA 1OKTA 2L5OA 1J0FA 2AB6A 1PD21 3HA9A 1GSQA 1QK8A 5INYA 2P0GA 2GQMA 2VCVA 1PL1A 1AAZA 1K3YA 1V40A 1XW5A 5D93A 5B6MA 4G10A 4KE3A 2FUG2 4MF7A 4I5QA 4KUNA 1KEBA 2PGTA 3M0FA 1RW1A 4O5UA 3U6VA 4KCEA 4F9ZA 5EL8A 4I2UA 1A2MA 5DBQA 1XOAA 4EF0A 3EE2A 4JRRA 2H75A 2KOKA 3DEXA 3UEMA 4MJAA 3O6TA 4HEA2 4HZ4A 4TR1A 2FWHA 2YN1A 3CSHA 2R5GA 2V6KA 1H75A 3H1NA 4CY8A 2XC2A 3GTUB 2KP1A 1FOHA 1FVKA 5DCHA 4HI7A 4HS1A 2VD0A 3LSZA 4ZL8A 1C72A 2B5EA 2CZ2A 4H86A 2NPBA 2FWEA 3M1GA 3FK8A 1OC9B 2MZCA 4NWYA 2H0HA 3GKNA 2IFQA 4MJEA 2OE3A 1AQXA 1TRSA 2ALBA 4L5OA 1OC3A 4PQIA 5CYYA 3C8EA 1XXUA 1R4WA 3DYRA 4TRXA 3WD6A 4L5LA 2L4QA 2JZSA 2H6ZA 5EY6A 2K9FA 3WGEA 1SL2B 3VPQA 4KX4A 1LJRA 5F0GA 2DSAA 1BQ7A 1W89A 1OKDA 4HDEA 2B7JA 4EDYA 3DMLA 1SK2A 2REMA 1Y25A 3I43A 5JWRB 6GSSA 2VLVA 1K3LA 2A2SA 5IMFA 2OKAA 3D21A 3SBCA 2V41A 1NW2A 1GSSA 4ISDA 1B8XA 4Q5NA 3TKSE 5HQPA 2OBKA 3HDCA 4Z2UA 4NPBA 1TDIA 2N5BA 3J7Yb 3GURA 1M7TA 1ZCPA 4RUVA 4DEJA 3J7Yk 4J57E 2R4VA 2DIYA 4CDOA 4TXVA 1XW6A 3GKXA 1PX7A 2XPDA 1WJKA 1RK4A 2B3SA 4KDYA 3VURA 3KP8A 2PPTA 4GQCA 3UAPA 3PINA 1AW9A 5LD0A 3VPTA 3Q19A 1PQNA 1GH2A 2OE1A 3FZ9A 2C3NA 4XRDA 2VOCA 3IPZA 2YWMA 5D9WA 3IOSA 5JWQB 4I97A 3IXRA 2PUKC 3APOA 4F2IA 1ACVA 2IWTA 3ERGA 4GLTA 2QA2A 4YKGA 1KNGA 1PKWA 4TKYA 2YV9A 3F6FA 3GX8A 1YJ6A 5ID2A 2MMOA 3IHQA 4BA7A 4FYBA 5ELGA 3E0UA 4N0ZA 2FLSA 1SKWB 1Z7RA 1GSFA 3P8WA 2IIYA 4K6XA 2TIRA 1FAAA 2OE0A 3ZRDA 1M9AA 2LUSA 2A4VA 2LKUA 1W4VA 2UZ8A 3E9JB 4ULXA 2O7KA 2HYXA 4L0UA 5G5EA 5EPFA 3ZITA 5DDLA 4F82A 4MJCA 3TJBA 4TR0A 1QMVA 4GF0A 5FWGA 3UMAA 4BVXA 2IMIA 2DJJA 1ZYQB 4WBJA 4ZB8A 1GSYA 1F3BA 4NXIA 4Z2RA 6GSVA 1ON4A 5G2ZA 2E0QA 3UL3A 1SJ6A 3GKMA 4LLRA 2ES7A 5CRHA 1WE0A 2LQQA 2DBCA 3IDVA 3EYTA 1XCCA 2OJLA 1GNEA 5KN2A 1BAYA 4DSQA 3TKQA 3IC8A 5A5KA 6GSUA 1QGVA 2X8CA 2X49A 1K0DA 1EZKA 1A2JA 3H93A 4O32A 2LJKA 3KEBA 2GTUA 1SJZA 1XIYA 1XWAA 2O85A 3O76A 4N30A 2GQKA 4WXTA 1ZYNA 1K3OA 3D4TA 2PVOC 4GTUA 3VWWA 2P31A 3Q18A 1BEDA 4ECJA 4TR4A 1E6BA 4G19A 2MYGA 4DSRA 13GSA 5FHIA 3CBUA 4ZB6A 5AIVA 1GRXA 3WGDA 3GKKA 2C0GA 4EKZA 3A3TA 5ECQB 2CVDA 3H4KA 4MJBA 2H73A 3V1WA 5CO3A 2VCZA 2LRTA 2OA7A 2I4AA 3RPPA 2RIIA 3VWVA 2WS2A 4G0IA 4E8EA 5H5RA 5JCGA 1I9DA 5J41A 4HJ2A 1GSEA 5ECOB 4Q5FA 4NAXA 2VLUA 4NV2A 4PXOA 4K5SA 2WGRA 2M80A 4QQ7A 4O92A 2MMAA 1SL0B 3HVXA 3EWLA 2HLSA 3MYDA 2IMKA 1I5GA 4IP1A 2JACA 4HOJA 5LCZA 4KSMA 5ECHB 4D73B 1YEXA 5H5QA 1FB6A 4ZL9A 4K0NA 4F03A 1TRUA 4PQHA 1OE7A 2YJ7A 1AUCA 2TRXA 3FMWA 2DJ3A 4MP4A 5B7CA 1SD8A 2VIMA 2GZYA 3D4MA 3W6GA 2IMDA 3RHCA 4CHSA 1R5PA 1OVNA 3CRUA 1O8XA 2XBIA 3S9FA 3VK9A 3GRXA 2EIRA 2AV4A 3L9UA 1J08A 1ERTA 4MK3A 4L8EA 4XS4B 4ID0A 1GLPA 3FYGA 5DVBA 2GVPA 3EURA 2C8UA 2GZPA 3QFBC 1FG4A 2XHFA 1GLQA 1QQ2A 1URMA 3TKSC 3TRQA 6GSXA 3C1SA 1K0OA 2VD1A 2LRCA 2KUCA 3LG6A 1T8EB 4K0GA 2EIQA 2VCTA 3A2XA 2CZ3A 2JZRA 1TRVA 3F6DA 5G1KA 2J23A 2KHPA 1R26A 6GSWA 4I8BA 2L59A 3TKSA 1QXHA 2EC4A 3I9V2 5DQSA 2WZ9A 1FVJA 3KTBA 4MZCA 4XIHA 1TJDA 4FYCA 2C0FA 3HVSA 5JWOB 1OC9A 1FB0A 4LL4B 3HZ8A 3EMPA 3MNGA 4G2EA 2VUPA 4X1UA 3IA1A 2JU5A 3FR9A 1SENA 4EC0A 2VCQA 3CXGA 4Z7XA 5GAPD 3KMNA 5HR2A 4DSSB 2H6XA 4YKFA 3LORA 4RI7A 4X0XA 4EIPA 2G0FA 2A4HA 1Z6NA 2JZTA 1SKRB 3F4RA 2R37A 1WMJA 4FIWA 1VF3A 4KCAA 3BCIA 3VLNA 3NIVA 1U87A 1ERWA 3ZL5A 1B48A 2NDOA 1YY7A 1U6TA 2JADA 4IVFA 2O89A 2ZUPA 4Q5RA 4OFTA 3FW2A 3F3QA 2CQ9A 2YPMA 4IN0A 2B1LA 3LW9A 1GP1A 1FOVA 3ME7A 5G5FA 2RM6A 4EL1A 1TI1A 1VF1A 2R0PA 3LEFA 3UBLA 4YAVA 4RQXA 1QUWA 20GSA 3UBKA 2NBSA 4FQUA 1K0AA 1HD2A 5B8AA 3APQA 3KJYA 1S3DA 1TU7A 3WGXA 3UVTA 4ZILA 2K18A 2LRNA 2MBSA 1VRSD 1WP0A 3F9UA 1HYUA 2C80A 2WB9A 1PN9A 4XCSA 1K0NA 1A23A 1EEMA 1ML6A 1ZL9A 2H1GA 4K1FA 3ZVJA 2LQOA 3IHGA 3M9KA 1ABAA 1GSUA 5D9XA 4ECIA 2FGXA 3CMIA 1GTUA 3KH7A 4YQUA 5C04A 1TRWA 2L57A 1R5AA 2FCHA 3ZTLA 1ZZYA 2ON7A 1YEPA 3C71A 2G2QA 3FEUA 1NHYA 5JCWA 3WT1A 3Q74A 2C0DA 2ON5A 5J9BA 4IJIA 5AISA 2H1BA 2IN3A 3I69A 5A4VA 1YDKA 4KSOA 2YWOA 3KD0A 3F8UA 3M9JA 1O81A 2MBTA 4LMVA 4NV5A 3TJKA 1M2AA 2GGTA 3IAM2 1Z7PA 3TOTA 5DQYA 4IQAA 4OO5A 5ECPB 7GSSA 1U3AA 2OADA 4ZB9A 4E8HA 3NZNA 4L0WA 1AQWA 4WR4A 1T4ZA 3GA4A 1ST9A 2CX3A 4MLYA 2VCWA 17GSA 3MIXA 5ECSA 4CY6A 4Q5QA 3APSA 2JSZA 5CAXA 3RPNA 1DSBA 3MWHA 1O8WA 1NSWA 1A2LA 3A2VA 2H74A 5GSTA 2XPEA 3O3TA 5IMZA 2DLXA 3LQ7A 1SK1A 2YANA 2X99A 2OBIA 3ZFBA 4EE0A 1MD3A 3CTFA 4WBRD 1ZOFA 2CVKA 3CSJA 4EXJA 2JL4A 2IL3A 3CSIA 3L0HA 1DE1A 4G9HA 4YAPA 4TR3A 2LJAA 1UC7A 2PMTA 1OAZA 2GSSA 1B9XC 4AJ6A 2WFCA 2IMEA 3QDNA 1PGTA 1K0CA 4NMUA 1T00A 1SL1B 4AJ8A 3A2WA 2B1KA 1JFUA 2K8SA 2H70A 1M0UA 3LYPA 3WYWA 2H71A 5GSSA 3P90A 2A2RA 5IM9A 3F4TA 1SKSB 5IO2A 5DCGA 4ECCA 2N5AA 3EU3A 3MDKA 4KAEA 2H66A 3LGCA 2HT9A 2LNSA 2AHEA 5DAKB 4MZWA 3E3EA 3ZIVA 1F9MA 4PUAA 5IMAA 3G9BA 1ZYEA 4TR1B 2WDUA 5IO0A 5F06A 1K0MA 2YP6A 3GSSA 5HFKA 1HNAA 2HSHA 2HNLA 1TW9A 3HXSA 1GUKA 1T3BA 2HFDA 3QPMA 1XPVA 3LXTA 1ERUA 2H01A 3DRNA 3QAGA 4D73A 4YQMA 1RQMA 2C1YA 1CQGA 5KN1A 4X4JA 1MDIA 5CP1A 3D5JA 2YNXA 1VGLA 4GSNA 1VF4A 3OR5A 3P7XA 1HQOA 1XVQA 14GSA 2IFQB 1YQ1A 4GSTA 4IBPA 3C1RA 2A2PA 3M8NA 3ZYWA 1TK8B 18GSA 3L4NA 1A8LA 3M3MA 4ZBDA 5BMUA 2H0IA 1HNCA 1F2EA 4XS4A 4K2DA 1MTCA 2X8GA 2DJKA 5C00A 3ZMKA 5ECRB 2GDRA 1JLVA 1XBSA 2X4AA 5KOXA 3GIXA 4TOPA 1SD9A 2HE3A 4JE1A 3IC4A 2MMNA 4BWQA 3FR3A 2KLXA 1GL8A 3HYPA 4GSSA 3ZMLA 3UARA 3KMOA 1U3IA 1EOGA 1JLWA 1MD4A 1Q4JA 1B4PA 2C3QA 4USSA 2L4CA 3FKFA 4V1Ap 4OD7A 3TKRA 4CW9A 3GMFA 2GLRA 3R2QA 3FZAA 3TJGA 3QFAC 3P2AA 3KM6A 5CNWA 1BYEA 4O5RA 2R0CA 3QR6A 4HU9A 1WWJA 4F0CA 1TOFA 2HZEA 1EWXA 4ZBBA 3EMXA 5D9VA 2L6CA 4MCUA 1XZOA 4K7IA 2B5XA 3L9SA 3HJOA 4GCIA 1GULA 3CTGA 2CX4A 3PH9A 2DIZA 4DSSA 2GQLA 2AJQB 4IQ1A 2DMMA 1EV4A 1S3CA 4P3YB 2HZFA 1PMTA 4AJ7A 1THXA 3TKPA 4WF4A 4JBBA 3F0IA 3IR4A 2M72A 1AQVA 1K0BA 1WPIA 1XW9A 4ZL7A 3LWAA 4F0BA 3DVWA 2XBQA 4KF9A 3JCML 3C73A 5ID2B 4BL7B 3UVHA 2R6KA 1A0RP 1FO5A 4N11A 3C7MA 5DALB 2K6VA 1G6YA 4ML1A 2Z9SA 1V9WA 3LXZA 4K8MA 5IQYA 1ZYPA 5D73A 4ILFA 2HI7A 4RQRA 3ERFA 1X5EA 1JZDA 3PR8A 1TTZA 3KXOA 2ZCTA 1VF2A 5CRDA 5J4UA 4FH8A 2B5YA 3IE3A 3KIJA 1AIUA 1ERVA 1N2AA 3KTLA 1A24A 5J9CA 3L9VA 4K7NA 2GT6A 3MAKA 4A5PA 1KBNA 2BJXA 2R0GA 1X9WB 1X9MB 1MDJA 1GUMA 1G0TA 5F05A 1MEKA 1UVZA 3BBYA 3TOUA 2H30A 2HXKA 3IV4A 2X64A 2RUFA 4TN8A 3UIWA 3D6IA 4JR4A 1Z9HA 3GTUA 4MA9A 4PGTA 2HSYA 3RHBA 1EGRA 2YWNA 1ZMAA 1IYHA 2CVBA 4N0VA 3GL5A 2C0EA 4LMWA 3GV1A 1EV9A 5CREA 2PN8A 4ACSA 3ME8A 1WIKA 5D9TA 4IJ3A 1F6MC 1S3AA 2DJ2A 5B6NA 1H4OA 2PBJA 2WULA 2VLTA 1LU4A 2BTOT 2DJ0A 2PVQA 4HU7A 3BOAA 3LYKA 22GSA 4OFNA 2NVLA 3TJJA 1USBA 4MH2A 1NM3A 2QSIA 2H19A 3HZ4A 4MNNA 3PGTA 4X43A 4TXOB 5IPGA 2CV4A 3GYKA 2YZHA 5ECNB 5IPHA 1TK5B 2WCIA 3FRCA 3TRPA 5D8IA 4ML6A 1E2YA 2YV7A 4G0LA 1WOUA 1Z6MA 2VL9A 3UOMA 3KZQA 1XWCA 2QGVA 2FWGA 2IMFA 2K8VA 1O7UA 1U88A 5F07A 5ABRA 2V1MA 2BMXA 3QMXA 2CA8A 1GNWA 3QD9A 2V2GA 1G6WA 2GS3A 3HCZA 3GN3A 1X0RA 5FT3A 1TK0B 1A8YA 1R7HA 1JZOA 3VWUA 2N5FA 4OFMA 3GX0A 2L6DA 1T1VA 2RLIA 1O73A 4JR6A 2DC5A 3ERWA 2F51A 1AC1A 2LSTA 4BVYB 4BWSA 1GWCA 5HR3A 1M2DA 4G0KA 3HD5A 5HR1A 1OC8A 4ECBA 4WR5A 1EP7A 1XWBA 4O5QA 5A4UA 2H76A 3H79A 3HVVA 4PX1A 1YKAA 1THOA 3Q6OA 1XVWA 1XOBA 5DJMA 3G7YA 2FA8A 3ZVJD 4ZBAA 1V2AA 2R3XA 1O6JA 1OE8A 2CAQA 3BCKA 2ZNMA 4KW6A 1X5CA 3GUSA 4MABA 5DAKA 2P5QA 9GSSA 2IPAA 3G7JA 2HRNA 4K9ZA 4KB3A 4EUYA 3NOFA 3R3EA 4POKA 2H8LA 1SJIA 4MH3A 4N10A 3EPTA 5D96A 1TU8A 2F8AA 1NHOA 4MPGA 1XWKA 1LBKA 1EP8A 3KCMA 4K7OA 2LJRA 2RM5A 3FY7A 4XS6A 1ZGNA 5DJLA 4EIQA 2E2GA 2OACA 1BJXA 2AYTA 4TVEA 4V1Ag 3TUEA 4J2FA 3TRXA 4IP6A 4JEDA 2VL3A 3GFKA 3TJFA 1GUHA 5KN0A 4GRFA 1DBYA 1GTIA 4V2NA 1QFNA 2NTOA 4OWYA 2CT6A 3N9JA 3IK7A 2FHEA 4IELA 3VI7A 3VWXA 2I1UA 2LV3A 4IHUA 2LS5A 3SWLA 1PKZA 2EIOA 3L78A 3QOUA 4WF5A 5JCUA 1JZWA 1V98A 4ZXGA 5LNKe 3MSZA 4POLA 2E7PA 4GWRA 3CRTA 1V58A 1PRXA 3RDWA 4MDCA 2YCDA 4POMA 2E2MA 4XS1A 2H0GA 2MMZA 3FHKA 3F63A 1F3AA 3FZ5A 4MF6A 4WETA 5E4WA 4KDUA 1F37A 3DGQA 3DVXA 3IRAA 4XTSA 1GSDA 3G7IA 5HFGA 1T4YA 3GSTA 2I3YA 3PPUA 1M2BA 1SK0A 1X5DA 4HZ2A 3IBHA 2CAIA 2PU9C 5H5SA 2I81A 1M9BA 1FW1A 1GTBA 3K8NA 2F9SA 4OO4A 3KH9A 3I6AA 2DMLA 3ZLPA 4QL7A 2WJUA 2HSMA 4RI6A 3RBTA 4QL9A 1MDKA 4GXZA 8GSSA 1GTAA 3LJRA 1OYJA 3EVIA 4MZBA 4MPFA 1Y6EA 3DIEA 2AAWA 4PNGA 2VAFA 1WRYA 4JZQA 19GSA 3DXBA 3F3RA 5AIXA 4KDXA 4BL7A 5CRGA 5G1LA 4ZIJA 1YF0A 1AXDA 1G7EA 4PNFA 3U5RE 5E59A 1V57A 4ICYA 5DALA 2PWJA 5IMCA 6GSYA 4PUFC 3TCOA 3US3A 3AY8A 1EGOA 6GSTA 5J3RA 3GHAA 1YKCA 1JHBA 3IAS2 2FY6A 5IOXA 2C4JA 2HRKA 5F8BA 1T7PB 4KA0A 4HUAA 4IKHA 4K2XA 5GZZB 1PN0A 3ISOA 3QAVA 5L71A 2YOIA 3TB2A 5CRWA 4LL1B 1TKDB 1SU9A 3VFIA 4IS0A 3HJPA 2QKEA 5AGYA 4PQ1A 4AGSA 1J9BA 5ECMB 1PL2A 2C3TA 2TRCP 3KP9A 3DWVA 2DKIA 2WRTA 2LTKA 1UN2A 4KNDA 2HRAA 4POBA 5ECLB 3DD3A 2H1AA 4I6XA 1O85A 3QCPA 2V6OA 11GSA 1PA3A 4IGJA 4Z2TA 1M99A 5ECKB 4J56E 2QC7A 1ILOA 3D22A 4I2TA 1BX9A 4XRAA 3A5IA 3HKRA 4FYUA 4MMMA 3GH9A 1G7OA 3FR6A 4EDZA 2RUEA 2I9HA 2F3MA 3HJMA 4TXOA 4K5RA 4OCFA 2M46A 4PTSA 1TXXA 1TP9A 1PX6A 3W8JA 4YH2A 5ELAA 5B8BA 3EU4A 1HNBA 2DJ1A 5G30A 4NHZA 5IOWA 3HY2A 1DUGA 2B7KA 2JSYA 3FZ4A 4LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2M A;  3ZRE A;  2GST A;  3UJ1 A;  4YQV A;  5ECI B;  2D2Z A;  5J5N A;  1IYI A;  5EVO A;  5GAN D;  2P5R A;  1YF1 A;  4NHW A;  2GSR A;  2YJH A;  1BG5 A;  1N8J A;  1Z3E A;  4BVY A;  4GQF A;  2H72 A;  4WEY A;  2H1D A;  2H6Y A;  1B9Y C;  1DE2 A;  2FNO A;  1EOH A;  3W8S A;  3QAW A;  2GT5 A;  5IMD A;  3DKS A;  2J9H A;  4OMV A;  2LNT A;  1Q98 A;  1B4Q A;  4O7H A;  3ZFL A;  5ENU A;  3F4S A;  1CQH A;  3ZIJ A;  2VO4 A;  1XFL A;  2L5L A;  4HQZ A;  5COH A;  3ED3 A;  2IJY A;  2GSQ A;  5KEJ A;  1JZR A;  1Z5Y E;  1SYR A;  12GS A;  4JU5 A;  5HR0 A;  3HHV A;  4KGI A;  3VI5 A;  1X9S B;  10GS A;  1SYX A;  1UA5 A;  2X8H A;  4EO3 A;  4PUR A;  4KH7 A;  3KGK A;  5KN3 A;  3RAZ A;  1YZX A;  4AF2 A;  1XWG A;  2HRF A;  2FD3 A;  3CYN A;  4HQS A;  2LEG A;  2V32 A;  3LFL A;  2F8F A;  3D0Z A;  4BPY A;  5G31 A;  4V2L A;  3GL3 A;  3ZZX A;  2O87 A;  3GH6 A;  1A0F A;  4TW5 A;  1TI3 A;  3TDG A;  4OCE A;  2HZE B;  5AN1 A;  3IK9 A;  4EVM A;  2VL2 C;  3EC3 A;  2AUV A;  3EIN A;  2O8V B;  5IIZ A;  3A5W A;  3WT2 A;  1KTE A;  2VCX A;  2VM1 A;  2GZZ A;  4XHM A;  4WKW A;  1EEJ A;  2VM2 A;  3GNJ A;  5A4W A;  4DVC A;  2KP2 A;  5HFI A;  2FA4 A;  3BD2 A;  16GS A;  1FHE A;  3BJ5 A;  5IMV A;  3TGZ A;  4HJM A;  4FO5 A;  2VL2 A;  2FWF A;  4IW9 A;  2B6M A;  2PER A;  2R2J A;  1PSQ A;  2YWI A;  4MF5 A;  2YZU A;  3H8Q A;  3N5O A;  1OKT A;  2L5O A;  1J0F A;  2AB6 A;  1PD2 1;  3HA9 A;  1GSQ A;  1QK8 A;  5INY A;  2P0G A;  2GQM A;  2VCV A;  1PL1 A;  1AAZ A;  1K3Y A;  1V40 A;  1XW5 A;  5D93 A;  5B6M A;  4G10 A;  4KE3 A;  2FUG 2;  4MF7 A;  4I5Q A;  4KUN A;  1KEB A;  2PGT A;  3M0F A;  1RW1 A;  3U6V A;  4KCE A;  4F9Z A;  5EL8 A;  4I2U A;  5DBQ A;  1A2M A;  1XOA A;  4EF0 A;  3EE2 A;  4JRR A;  2H75 A;  2KOK A;  3DEX A;  3UEM A;  4MJA A;  3O6T A;  4HEA 2;  4HZ4 A;  4TR1 A;  2FWH A;  2YN1 A;  3CSH A;  2R5G A;  2V6K A;  1H75 A;  3H1N A;  2XC2 A;  3GTU B;  2KP1 A;  1FVK A;  5DCH A;  4HI7 A;  4HS1 A;  2VD0 A;  3LSZ A;  4ZL8 A;  1C72 A;  2B5E A;  2CZ2 A;  4H86 A;  2NPB A;  2FWE A;  3M1G A;  3FK8 A;  1OC9 B;  2MZC A;  4NWY A;  2H0H A;  3GKN A;  2IFQ A;  4MJE A;  2OE3 A;  1AQX A;  1TRS A;  2ALB A;  4L5O A;  1OC3 A;  4PQI A;  5CYY A;  3C8E A;  1XXU A;  1R4W A;  3DYR A;  4TRX A;  3WD6 A;  4L5L A;  2L4Q A;  2JZS A;  2H6Z A;  5EY6 A;  2K9F A;  3WGE A;  1SL2 B;  3VPQ A;  4KX4 A;  1LJR A;  5F0G A;  2DSA A;  1BQ7 A;  1W89 A;  1OKD A;  4HDE A;  2B7J A;  4EDY A;  3DML A;  1SK2 A;  2REM A;  1Y25 A;  3I43 A;  5JWR B;  6GSS A;  2VLV A;  1K3L A;  2A2S A;  5IMF A;  2OKA A;  3D21 A;  3SBC A;  2V41 A;  1NW2 A;  1GSS A;  4ISD A;  1B8X A;  4Q5N A;  3TKS E;  5HQP A;  2OBK A;  3HDC A;  4NPB A;  1TDI A;  2N5B A;  3J7Y b;  3GUR A;  1M7T A;  1ZCP A;  4RUV A;  4DEJ A;  3J7Y k;  4J57 E;  2R4V A;  2DIY A;  4CDO A;  4TXV A;  1XW6 A;  3GKX A;  1PX7 A;  2XPD A;  1WJK A;  1RK4 A;  2B3S A;  4KDY A;  3VUR A;  3KP8 A;  2PPT A;  4GQC A;  3UAP A;  3PIN A;  1AW9 A;  5LD0 A;  3VPT A;  3Q19 A;  1PQN A;  1GH2 A;  2OE1 A;  3FZ9 A;  2C3N A;  4XRD A;  2VOC A;  3IPZ A;  2YWM A;  5D9W A;  3IOS A;  5JWQ B;  4I97 A;  3IXR A;  2PUK C;  3APO A;  4F2I A;  1ACV A;  2IWT A;  3ERG A;  4GLT A;  1KNG A;  1PKW A;  4TKY A;  2YV9 A;  3F6F A;  3GX8 A;  1YJ6 A;  5ID2 A;  2MMO A;  3IHQ A;  4BA7 A;  4FYB A;  5ELG A;  3E0U A;  4N0Z A;  2FLS A;  1SKW B;  1Z7R A;  1GSF A;  3P8W A;  2IIY A;  4K6X A;  2TIR A;  1FAA A;  2OE0 A;  3ZRD A;  1M9A A;  2LUS A;  2A4V A;  2LKU A;  1W4V A;  3E9J B;  4ULX A;  2O7K A;  2HYX A;  4L0U A;  5G5E A;  5EPF A;  3ZIT A;  5DDL A;  4F82 A;  4MJC A;  3TJB A;  4TR0 A;  1QMV A;  4GF0 A;  5FWG A;  3UMA A;  4BVX A;  2IMI A;  2DJJ A;  1ZYQ B;  4WBJ A;  4ZB8 A;  1GSY A;  1F3B A;  4NXI A;  6GSV A;  1ON4 A;  5G2Z A;  2E0Q A;  3UL3 A;  1SJ6 A;  3GKM A;  4LLR A;  2ES7 A;  5CRH A;  1WE0 A;  2LQQ A;  2DBC A;  3IDV A;  3EYT A;  1XCC A;  2OJL A;  1GNE A;  5KN2 A;  1BAY A;  4DSQ A;  3TKQ A;  5A5K A;  6GSU A;  1QGV A;  2X8C A;  1K0D A;  1EZK A;  1A2J A;  3H93 A;  4O32 A;  2LJK A;  3KEB A;  2GTU A;  1SJZ A;  1XIY A;  1XWA A;  2O85 A;  3O76 A;  4N30 A;  2GQK A;  4WXT A;  1K3O A;  3D4T A;  2PVO C;  4GTU A;  3VWW A;  2P31 A;  3Q18 A;  1BED A;  4ECJ A;  4TR4 A;  1E6B A;  4G19 A;  2MYG A;  4DSR A;  13GS A;  5FHI A;  3CBU A;  4ZB6 A;  5AIV A;  1GRX A;  3WGD A;  3GKK A;  2C0G A;  4EKZ A;  3A3T A;  5ECQ B;  2CVD A;  3H4K A;  4MJB A;  2H73 A;  3V1W A;  5CO3 A;  2VCZ A;  2LRT A;  2OA7 A;  2I4A A;  3RPP A;  2RII A;  3VWV A;  2WS2 A;  4E8E A;  5H5R A;  5JCG A;  1I9D A;  5J41 A;  4HJ2 A;  1GSE A;  5ECO B;  4Q5F A;  4NAX A;  2VLU A;  4NV2 A;  4PXO A;  2WGR A;  2M80 A;  4QQ7 A;  4O92 A;  2MMA A;  1SL0 B;  3HVX A;  3EWL A;  2HLS A;  2IMK A;  1I5G A;  4IP1 A;  2JAC A;  4HOJ A;  5LCZ A;  4KSM A;  5ECH B;  4D73 B;  1YEX A;  5H5Q A;  1FB6 A;  4ZL9 A;  4K0N A;  4F03 A;  1TRU A;  4PQH A;  1OE7 A;  2YJ7 A;  1AUC A;  2TRX A;  2DJ3 A;  4MP4 A;  5B7C A;  1SD8 A;  2VIM A;  2GZY A;  3D4M A;  3W6G A;  2IMD A;  3RHC A;  4CHS A;  1R5P A;  1OVN A;  3CRU A;  1O8X A;  2XBI A;  3S9F A;  3VK9 A;  3GRX A;  2EIR A;  2AV4 A;  3L9U A;  1J08 A;  1ERT A;  4MK3 A;  4L8E A;  4XS4 B;  4ID0 A;  1GLP A;  3FYG A;  5DVB A;  2GVP A;  3EUR A;  2C8U A;  2GZP A;  3QFB C;  1FG4 A;  2XHF A;  1GLQ A;  1QQ2 A;  1URM A;  3TKS C;  3TRQ A;  6GSX A;  3C1S A;  1K0O A;  2VD1 A;  2LRC A;  2KUC A;  3LG6 A;  1T8E B;  4K0G A;  2EIQ A;  2VCT A;  3A2X A;  2CZ3 A;  2JZR A;  1TRV A;  3F6D A;  5G1K A;  2J23 A;  2KHP A;  1R26 A;  6GSW A;  4I8B A;  2L59 A;  3TKS A;  1QXH A;  2EC4 A;  3I9V 2;  5DQS A;  2WZ9 A;  1FVJ A;  3KTB A;  4MZC A;  4XIH A;  1TJD A;  4FYC A;  2C0F A;  3HVS A;  5JWO B;  1OC9 A;  1FB0 A;  4LL4 B;  3HZ8 A;  3EMP A;  3MNG A;  4G2E A;  2VUP A;  4X1U A;  3IA1 A;  2JU5 A;  3FR9 A;  1SEN A;  4EC0 A;  2VCQ A;  3CXG A;  4Z7X A;  5GAP D;  3KMN A;  5HR2 A;  4DSS B;  2H6X A;  3LOR A;  4RI7 A;  4X0X A;  2G0F A;  1Z6N A;  2JZT A;  1SKR B;  3F4R A;  2R37 A;  1WMJ A;  4FIW A;  1VF3 A;  4KCA A;  3BCI A;  3VLN A;  3NIV A;  1U87 A;  1ERW A;  3ZL5 A;  1B48 A;  2NDO A;  1YY7 A;  1U6T A;  2JAD A;  4IVF A;  2O89 A;  2ZUP A;  4Q5R A;  4OFT A;  3FW2 A;  3F3Q A;  2CQ9 A;  2YPM A;  4IN0 A;  2B1L A;  1GP1 A;  1FOV A;  3ME7 A;  5G5F A;  2RM6 A;  4EL1 A;  1TI1 A;  1VF1 A;  3LEF A;  3UBL A;  4YAV A;  4RQX A;  1QUW A;  20GS A;  3UBK A;  2NBS A;  1K0A A;  1HD2 A;  5B8A A;  3APQ A;  3KJY A;  1S3D A;  1TU7 A;  3WGX A;  3UVT A;  4ZIL A;  2K18 A;  2LRN A;  2MBS A;  1VRS D;  1WP0 A;  3F9U A;  1HYU A;  2C80 A;  2WB9 A;  1PN9 A;  4XCS A;  1K0N A;  1A23 A;  1EEM A;  1ML6 A;  1ZL9 A;  2H1G A;  4K1F A;  3ZVJ A;  2LQO A;  3M9K A;  1ABA A;  1GSU A;  5D9X A;  4ECI A;  2FGX A;  3CMI A;  1GTU A;  3KH7 A;  4YQU A;  5C04 A;  1TRW A;  2L57 A;  1R5A A;  2FCH A;  3ZTL A;  1ZZY A;  2ON7 A;  1YEP A;  3C71 A;  2G2Q A;  3FEU A;  1NHY A;  5JCW A;  3WT1 A;  3Q74 A;  2C0D A;  2ON5 A;  5J9B A;  4IJI A;  5AIS A;  2H1B A;  2IN3 A;  3I69 A;  5A4V A;  1YDK A;  4KSO A;  2YWO A;  3KD0 A;  3F8U A;  3M9J A;  1O81 A;  2MBT A;  4LMV A;  4NV5 A;  3TJK A;  1M2A A;  2GGT A;  3IAM 2;  1Z7P A;  3TOT A;  5DQY A;  4IQA A;  4OO5 A;  5ECP B;  7GSS A;  1U3A A;  2OAD A;  4ZB9 A;  4E8H A;  3NZN A;  4L0W A;  1AQW A;  4WR4 A;  1T4Z A;  3GA4 A;  1ST9 A;  2CX3 A;  4MLY A;  2VCW A;  17GS A;  5ECS A;  4Q5Q A;  3APS A;  2JSZ A;  5CAX A;  3RPN A;  1DSB A;  3MWH A;  1O8W A;  1NSW A;  1A2L A;  3A2V A;  2H74 A;  5GST A;  2XPE A;  3O3T A;  5IMZ A;  2DLX A;  3LQ7 A;  1SK1 A;  2YAN A;  2X99 A;  2OBI A;  3ZFB A;  4EE0 A;  1MD3 A;  3CTF A;  4WBR D;  1ZOF A;  2CVK A;  3CSJ A;  4EXJ A;  2JL4 A;  2IL3 A;  3CSI A;  3L0H A;  1DE1 A;  4G9H A;  4YAP A;  4TR3 A;  2LJA A;  1UC7 A;  2PMT A;  1OAZ A;  2GSS A;  1B9X C;  4AJ6 A;  2WFC A;  2IME A;  3QDN A;  1PGT A;  1K0C A;  4NMU A;  1T00 A;  1SL1 B;  4AJ8 A;  3A2W A;  2B1K A;  1JFU A;  2K8S A;  2H70 A;  1M0U A;  3LYP A;  3WYW A;  2H71 A;  5GSS A;  3P90 A;  2A2R A;  5IM9 A;  3F4T A;  1SKS B;  5IO2 A;  5DCG A;  4ECC A;  2N5A A;  3EU3 A;  3MDK A;  4KAE A;  2H66 A;  3LGC A;  2HT9 A;  2LNS A;  2AHE A;  5DAK B;  4MZW A;  3E3E A;  3ZIV A;  1F9M A;  4PUA A;  5IMA A;  3G9B A;  1ZYE A;  4TR1 B;  2WDU A;  5IO0 A;  5F06 A;  1K0M A;  2YP6 A;  3GSS A;  5HFK A;  1HNA A;  2HSH A;  2HNL A;  1TW9 A;  3HXS A;  1GUK A;  1T3B A;  2HFD A;  3QPM A;  1XPV A;  3LXT A;  1ERU A;  2H01 A;  3DRN A;  3QAG A;  4D73 A;  4YQM A;  1RQM A;  2C1Y A;  1CQG A;  5KN1 A;  1MDI A;  5CP1 A;  3D5J A;  2YNX A;  1VGL A;  4GSN A;  1VF4 A;  3OR5 A;  3P7X A;  1HQO A;  1XVQ A;  14GS A;  2IFQ B;  1YQ1 A;  4GST A;  4IBP A;  3C1R A;  3M8N A;  3ZYW A;  1TK8 B;  18GS A;  3L4N A;  1A8L A;  3M3M A;  4ZBD A;  2H0I A;  1HNC A;  1F2E A;  4XS4 A;  4K2D A;  1MTC A;  2X8G A;  2DJK A;  5C00 A;  3ZMK A;  5ECR B;  2GDR A;  1JLV A;  1XBS A;  3GIX A;  4TOP A;  1SD9 A;  2HE3 A;  4JE1 A;  3IC4 A;  2MMN A;  4BWQ A;  3FR3 A;  2KLX A;  1GL8 A;  3HYP A;  4GSS A;  3ZML A;  3UAR A;  3KMO A;  1U3I A;  1EOG A;  1JLW A;  1MD4 A;  1Q4J A;  1B4P A;  2C3Q A;  2L4C A;  3FKF A;  4V1A p;  4OD7 A;  3TKR A;  4CW9 A;  3GMF A;  2GLR A;  3R2Q A;  3FZA A;  3TJG A;  3QFA C;  3P2A A;  3KM6 A;  5CNW A;  1BYE A;  4O5R A;  3QR6 A;  4HU9 A;  1WWJ A;  4F0C A;  1TOF A;  2HZE A;  1EWX A;  4ZBB A;  3EMX A;  5D9V A;  2L6C A;  4MCU A;  1XZO A;  4K7I A;  2B5X A;  3L9S A;  3HJO A;  4GCI A;  1GUL A;  3CTG A;  2CX4 A;  3PH9 A;  2DIZ A;  4DSS A;  2GQL A;  2AJQ B;  4IQ1 A;  2DMM A;  1EV4 A;  1S3C A;  4P3Y B;  2HZF A;  1PMT A;  4AJ7 A;  1THX A;  3TKP A;  4WF4 A;  4JBB A;  3F0I A;  3IR4 A;  2M72 A;  1AQV A;  1K0B A;  1WPI A;  1XW9 A;  4ZL7 A;  3LWA A;  4F0B A;  3DVW A;  2XBQ A;  3JCM L;  3C73 A;  5ID2 B;  3UVH A;  2R6K A;  1A0R P;  1FO5 A;  4N11 A;  3C7M A;  5DAL B;  2K6V A;  1G6Y A;  4ML1 A;  2Z9S A;  1V9W A;  3LXZ A;  4K8M A;  5IQY A;  5D73 A;  4ILF A;  2HI7 A;  4RQR A;  3ERF A;  1X5E A;  1JZD A;  3PR8 A;  1TTZ A;  3KXO A;  2ZCT A;  1VF2 A;  5CRD A;  5J4U A;  4FH8 A;  2B5Y A;  3IE3 A;  3KIJ A;  1AIU A;  1ERV A;  1N2A A;  3KTL A;  1A24 A;  5J9C A;  3L9V A;  4K7N A;  2GT6 A;  3MAK A;  1KBN A;  2BJX A;  1X9W B;  1X9M B;  1MDJ A;  1GUM A;  1G0T A;  5F05 A;  1MEK A;  1UVZ A;  3BBY A;  3TOU A;  2H30 A;  2HXK A;  3IV4 A;  2X64 A;  2RUF A;  4TN8 A;  3UIW A;  3D6I A;  4JR4 A;  1Z9H A;  3GTU A;  4MA9 A;  4PGT A;  2HSY A;  3RHB A;  1EGR A;  2YWN A;  1ZMA A;  1IYH A;  2CVB A;  4N0V A;  3GL5 A;  2C0E A;  4LMW A;  3GV1 A;  1EV9 A;  5CRE A;  2PN8 A;  4ACS A;  3ME8 A;  1WIK A;  5D9T A;  4IJ3 A;  1F6M C;  1S3A A;  2DJ2 A;  5B6N A;  1H4O A;  2PBJ A;  2WUL A;  2VLT A;  1LU4 A;  2BTO T;  2DJ0 A;  2PVQ A;  4HU7 A;  3BOA A;  3LYK A;  22GS A;  4OFN A;  2NVL A;  3TJJ A;  1USB A;  4MH2 A;  1NM3 A;  2QSI A;  2H19 A;  3HZ4 A;  3PGT A;  4X43 A;  4TXO B;  5IPG A;  2CV4 A;  3GYK A;  2YZH A;  5ECN B;  5IPH A;  1TK5 B;  2WCI A;  3FRC A;  3TRP A;  5D8I A;  4ML6 A;  1E2Y A;  2YV7 A;  1WOU A;  1Z6M A;  2VL9 A;  3UOM A;  3KZQ A;  1XWC A;  2QGV A;  2FWG A;  2IMF A;  2K8V A;  1O7U A;  1U88 A;  5F07 A;  5ABR A;  2V1M A;  2BMX A;  3QMX A;  2CA8 A;  1GNW A;  3QD9 A;  2V2G A;  1G6W A;  2GS3 A;  3HCZ A;  3GN3 A;  1X0R A;  5FT3 A;  1TK0 B;  1A8Y A;  1R7H A;  1JZO A;  3VWU A;  2N5F A;  4OFM A;  3GX0 A;  2L6D A;  1T1V A;  2RLI A;  1O73 A;  4JR6 A;  2DC5 A;  3ERW A;  2F51 A;  1AC1 A;  2LST A;  4BWS A;  1GWC A;  5HR3 A;  1M2D A;  3HD5 A;  5HR1 A;  1OC8 A;  4ECB A;  4WR5 A;  1EP7 A;  1XWB A;  5A4U A;  2H76 A;  3H79 A;  3HVV A;  4PX1 A;  1YKA A;  1THO A;  3Q6O A;  1XVW A;  1XOB A;  5DJM A;  3G7Y A;  2FA8 A;  3ZVJ D;  4ZBA A;  1V2A A;  2R3X A;  1O6J A;  1OE8 A;  2CAQ A;  3BCK A;  2ZNM A;  4KW6 A;  1X5C A;  3GUS A;  4MAB A;  5DAK A;  2P5Q A;  9GSS A;  2IPA A;  3G7J A;  2HRN A;  4K9Z A;  4KB3 A;  4EUY A;  3NOF A;  4POK A;  2H8L A;  1SJI A;  4MH3 A;  4N10 A;  5D96 A;  1TU8 A;  2F8A A;  1NHO A;  4MPG A;  1XWK A;  1LBK A;  1EP8 A;  3KCM A;  4K7O A;  2LJR A;  2RM5 A;  3FY7 A;  4XS6 A;  1ZGN A;  5DJL A;  2E2G A;  2OAC A;  1BJX A;  2AYT A;  4TVE A;  4V1A g;  3TUE A;  4J2F A;  3TRX A;  4IP6 A;  4JED A;  2VL3 A;  3GFK A;  3TJF A;  1GUH A;  5KN0 A;  4GRF A;  1DBY A;  1GTI A;  4V2N A;  1QFN A;  2NTO A;  4OWY A;  2CT6 A;  3N9J A;  3IK7 A;  2FHE A;  4IEL A;  3VI7 A;  3VWX A;  2I1U A;  2LV3 A;  4IHU A;  2LS5 A;  3SWL A;  1PKZ A;  2EIO A;  3L78 A;  3QOU A;  4WF5 A;  5JCU A;  1JZW A;  1V98 A;  4ZXG A;  5LNK e;  3MSZ A;  4POL A;  2E7P A;  4GWR A;  3CRT A;  1V58 A;  1PRX A;  3RDW A;  4MDC A;  2YCD A;  4POM A;  2E2M A;  4XS1 A;  2H0G A;  2MMZ A;  3FHK A;  3F63 A;  1F3A A;  3FZ5 A;  4MF6 A;  4WET A;  5E4W A;  4KDU A;  1F37 A;  3DGQ A;  3DVX A;  3IRA A;  4XTS A;  1GSD A;  3G7I A;  5HFG A;  1T4Y A;  3GST A;  2I3Y A;  1M2B A;  1SK0 A;  1X5D A;  4HZ2 A;  3IBH A;  2CAI A;  2PU9 C;  5H5S A;  2I81 A;  1M9B A;  1FW1 A;  1GTB A;  3K8N A;  2F9S A;  4OO4 A;  3KH9 A;  3I6A A;  2DML A;  3ZLP A;  4QL7 A;  2WJU A;  4RI6 A;  3RBT A;  4QL9 A;  1MDK A;  4GXZ A;  8GSS A;  1GTA A;  3LJR A;  1OYJ A;  3EVI A;  4MZB A;  4MPF A;  1Y6E A;  3DIE A;  2AAW A;  4PNG A;  2VAF A;  1WRY A;  4JZQ A;  19GS A;  3DXB A;  3F3R A;  5AIX A;  4KDX A;  4BL7 A;  5CRG A;  5G1L A;  4ZIJ A;  1YF0 A;  1AXD A;  1G7E A;  4PNF A;  3U5R E;  5E59 A;  1V57 A;  5DAL A;  2PWJ A;  5IMC A;  6GSY A;  4PUF C;  3TCO A;  3US3 A;  3AY8 A;  1EGO A;  6GST A;  5J3R A;  3GHA A;  1YKC A;  1JHB A;  3IAS 2;  2FY6 A;  5IOX A;  2C4J A;  5F8B A;  1T7P B;  4KA0 A;  4HUA A;  4IKH A;  5GZZ B;  3ISO A;  3QAV A;  5L71 A;  2YOI A;  3TB2 A;  5CRW A;  4LL1 B;  1TKD B;  1SU9 A;  3VFI A;  4IS0 A;  3HJP A;  2QKE A;  5AGY A;  4PQ1 A;  4AGS A;  1J9B A;  5ECM B;  1PL2 A;  2C3T A;  2TRC P;  3KP9 A;  3DWV A;  2WRT A;  2LTK A;  1UN2 A;  4KND A;  4POB A;  5ECL B;  3DD3 A;  2H1A A;  4I6X A;  1O85 A;  3QCP A;  2V6O A;  11GS A;  1PA3 A;  4IGJ A;  1M99 A;  5ECK B;  4J56 E;  2QC7 A;  1ILO A;  3D22 A;  4I2T A;  1BX9 A;  4XRA A;  3HKR A;  4FYU A;  4MMM A;  3GH9 A;  1G7O A;  3FR6 A;  4EDZ A;  2RUE A;  2I9H A;  2F3M A;  3HJM A;  4TXO A;  4OCF A;  2M46 A;  1TXX A;  1TP9 A;  1PX6 A;  3W8J A;  4YH2 A;  5ELA A;  5B8B A;  3EU4 A;  1HNB A;  2DJ1 A;  5G30 A;  4NHZ A;  5IOW A;  3HY2 A;  1DUG A;  2B7K A;  2JSY A;  3FZ4 A;  4LA1 A; 
#chains in the Genus database with same CATH topology
 4V2M A;  3ZRE A;  2GST A;  3UJ1 A;  4YQV A;  5ECI B;  2D2Z A;  5J5N A;  1IYI A;  5EVO A;  5BRT A;  5GAN D;  2P5R A;  1YF1 A;  4NHW A;  2GSR A;  2YJH A;  1BG5 A;  1N8J A;  1Z3E A;  4BVY A;  4GQF A;  2H72 A;  4WEY A;  2H1D A;  2H6Y A;  1B9Y C;  1DE2 A;  2FNO A;  1EOH A;  3W8S A;  3QAW A;  2GT5 A;  5IMD A;  3DKS A;  2J9H A;  4OMV A;  2LNT A;  1Q98 A;  4BVX B;  1B4Q A;  2QA1 A;  4O7H A;  3ZFL A;  5ENU A;  3F4S A;  1CQH A;  3ZIJ A;  2VO4 A;  1XFL A;  2L5L A;  4HQZ A;  5COH A;  3ED3 A;  2IJY A;  2GSQ A;  5KEJ A;  1JZR A;  1Z5Y E;  1SYR A;  12GS A;  4JU5 A;  5HR0 A;  3HHV A;  4KGI A;  3VI5 A;  1X9S B;  10GS A;  1SYX A;  5KOW A;  1UA5 A;  2X8H A;  4EO3 A;  4PUR A;  4KH7 A;  3KGK A;  5KN3 A;  3RAZ A;  1YZX A;  4AF2 A;  1XWG A;  2HRF A;  2FD3 A;  3CYN A;  4HQS A;  2LEG A;  2V32 A;  3LFL A;  2F8F A;  3D0Z A;  4BPY A;  5G31 A;  4V2L A;  3GL3 A;  3ZZX A;  2O87 A;  3GH6 A;  1A0F A;  4TW5 A;  1TI3 A;  3TDG A;  4OCE A;  2HZE B;  5AN1 A;  3IK9 A;  4EVM A;  2VL2 C;  3EC3 A;  2AUV A;  3EIN A;  2O8V B;  5IIZ A;  3A5W A;  3WT2 A;  1KTE A;  2VCX A;  2VM1 A;  2GZZ A;  4XHM A;  4WKW A;  1EEJ A;  2VM2 A;  3GNJ A;  5A4W A;  4DVC A;  2KP2 A;  5HFI A;  2FA4 A;  3BD2 A;  16GS A;  1FHE A;  3BJ5 A;  5IMV A;  2DKH A;  3TGZ A;  4HJM A;  4FO5 A;  2VL2 A;  2FWF A;  4IW9 A;  2B6M A;  2PER A;  2R2J A;  1PSQ A;  2YWI A;  4MF5 A;  2YZU A;  3H8Q A;  3N5O A;  1OKT A;  2L5O A;  1J0F A;  2AB6 A;  1PD2 1;  3HA9 A;  1GSQ A;  1QK8 A;  5INY A;  2P0G A;  2GQM A;  2VCV A;  1PL1 A;  1AAZ A;  1K3Y A;  1V40 A;  1XW5 A;  5D93 A;  5B6M A;  4G10 A;  4KE3 A;  2FUG 2;  4MF7 A;  4I5Q A;  4KUN A;  1KEB A;  2PGT A;  3M0F A;  1RW1 A;  4O5U A;  3U6V A;  4KCE A;  4F9Z A;  5EL8 A;  4I2U A;  1A2M A;  5DBQ A;  1XOA A;  4EF0 A;  3EE2 A;  4JRR A;  2H75 A;  2KOK A;  3DEX A;  3UEM A;  4MJA A;  3O6T A;  4HEA 2;  4HZ4 A;  4TR1 A;  2FWH A;  2YN1 A;  3CSH A;  2R5G A;  2V6K A;  1H75 A;  3H1N A;  4CY8 A;  2XC2 A;  3GTU B;  2KP1 A;  1FOH A;  1FVK A;  5DCH A;  4HI7 A;  4HS1 A;  2VD0 A;  3LSZ A;  4ZL8 A;  1C72 A;  2B5E A;  2CZ2 A;  4H86 A;  2NPB A;  2FWE A;  3M1G A;  3FK8 A;  1OC9 B;  2MZC A;  4NWY A;  2H0H A;  3GKN A;  2IFQ A;  4MJE A;  2OE3 A;  1AQX A;  1TRS A;  2ALB A;  4L5O A;  1OC3 A;  4PQI A;  5CYY A;  3C8E A;  1XXU A;  1R4W A;  3DYR A;  4TRX A;  3WD6 A;  4L5L A;  2L4Q A;  2JZS A;  2H6Z A;  5EY6 A;  2K9F A;  3WGE A;  1SL2 B;  3VPQ A;  4KX4 A;  1LJR A;  5F0G A;  2DSA A;  1BQ7 A;  1W89 A;  1OKD A;  4HDE A;  2B7J A;  4EDY A;  3DML A;  1SK2 A;  2REM A;  1Y25 A;  3I43 A;  5JWR B;  6GSS A;  2VLV A;  1K3L A;  2A2S A;  5IMF A;  2OKA A;  3D21 A;  3SBC A;  2V41 A;  1NW2 A;  1GSS A;  4ISD A;  1B8X A;  4Q5N A;  3TKS E;  5HQP A;  2OBK A;  3HDC A;  4Z2U A;  4NPB A;  1TDI A;  2N5B A;  3J7Y b;  3GUR A;  1M7T A;  1ZCP A;  4RUV A;  4DEJ A;  3J7Y k;  4J57 E;  2R4V A;  2DIY A;  4CDO A;  4TXV A;  1XW6 A;  3GKX A;  1PX7 A;  2XPD A;  1WJK A;  1RK4 A;  2B3S A;  4KDY A;  3VUR A;  3KP8 A;  2PPT A;  4GQC A;  3UAP A;  3PIN A;  1AW9 A;  5LD0 A;  3VPT A;  3Q19 A;  1PQN A;  1GH2 A;  2OE1 A;  3FZ9 A;  2C3N A;  4XRD A;  2VOC A;  3IPZ A;  2YWM A;  5D9W A;  3IOS A;  5JWQ B;  4I97 A;  3IXR A;  2PUK C;  3APO A;  4F2I A;  1ACV A;  2IWT A;  3ERG A;  4GLT A;  2QA2 A;  4YKG A;  1KNG A;  1PKW A;  4TKY A;  2YV9 A;  3F6F A;  3GX8 A;  1YJ6 A;  5ID2 A;  2MMO A;  3IHQ A;  4BA7 A;  4FYB A;  5ELG A;  4HSC X;  3E0U A;  4N0Z A;  2FLS A;  1SKW B;  1Z7R A;  1GSF A;  3P8W A;  2IIY A;  4K6X A;  2TIR A;  1FAA A;  2OE0 A;  3ZRD A;  1M9A A;  2LUS A;  2A4V A;  2LKU A;  1W4V A;  2UZ8 A;  3E9J B;  4ULX A;  2O7K A;  2HYX A;  4L0U A;  5G5E A;  5EPF A;  3ZIT A;  5DDL A;  4F82 A;  4MJC A;  3TJB A;  4TR0 A;  1QMV A;  4GF0 A;  5FWG A;  3UMA A;  4BVX A;  2IMI A;  2DJJ A;  1ZYQ B;  4WBJ A;  4ZB8 A;  1GSY A;  1F3B A;  4NXI A;  4Z2R A;  6GSV A;  1ON4 A;  5G2Z A;  2E0Q A;  3UL3 A;  1SJ6 A;  3GKM A;  4LLR A;  2ES7 A;  5CRH A;  1WE0 A;  2LQQ A;  2DBC A;  3IDV A;  3EYT A;  1XCC A;  2OJL A;  1GNE A;  5KN2 A;  1BAY A;  4DSQ A;  3TKQ A;  3IC8 A;  5A5K A;  6GSU A;  1QGV A;  2X8C A;  2X49 A;  1K0D A;  1EZK A;  1A2J A;  3H93 A;  4O32 A;  2LJK A;  3KEB A;  2GTU A;  1SJZ A;  1XIY A;  1XWA A;  2O85 A;  3O76 A;  4N30 A;  2GQK A;  4WXT A;  1ZYN A;  1K3O A;  3D4T A;  2PVO C;  4GTU A;  3VWW A;  2P31 A;  3Q18 A;  1BED A;  4ECJ A;  4TR4 A;  1E6B A;  4G19 A;  2MYG A;  4DSR A;  13GS A;  5FHI A;  3CBU A;  4ZB6 A;  5AIV A;  1GRX A;  3WGD A;  3GKK A;  2C0G A;  4EKZ A;  3A3T A;  5ECQ B;  2CVD A;  3H4K A;  4MJB A;  2H73 A;  3V1W A;  5CO3 A;  2VCZ A;  2LRT A;  2OA7 A;  2I4A A;  3RPP A;  2RII A;  3VWV A;  2WS2 A;  4G0I A;  4E8E A;  5H5R A;  5JCG A;  1I9D A;  5J41 A;  4HJ2 A;  1GSE A;  5ECO B;  4Q5F A;  4NAX A;  2VLU A;  4NV2 A;  4PXO A;  4K5S A;  2WGR A;  2M80 A;  4QQ7 A;  4O92 A;  2MMA A;  1SL0 B;  3HVX A;  3EWL A;  2HLS A;  3MYD A;  2IMK A;  1I5G A;  4IP1 A;  2JAC A;  4HOJ A;  5LCZ A;  4KSM A;  5ECH B;  4D73 B;  1YEX A;  5H5Q A;  1FB6 A;  4ZL9 A;  4K0N A;  4F03 A;  1TRU A;  4PQH A;  1OE7 A;  2YJ7 A;  1AUC A;  2TRX A;  3FMW A;  2DJ3 A;  4MP4 A;  5B7C A;  1SD8 A;  2VIM A;  2GZY A;  3D4M A;  3W6G A;  2IMD A;  3RHC A;  4CHS A;  1R5P A;  1OVN A;  3CQF A;  3CRU A;  1O8X A;  2XBI A;  3S9F A;  3VK9 A;  3GRX A;  2EIR A;  2AV4 A;  3L9U A;  1J08 A;  1ERT A;  4MK3 A;  4L8E A;  4XS4 B;  4ID0 A;  1GLP A;  3FYG A;  5DVB A;  2GVP A;  3EUR A;  2C8U A;  2GZP A;  3QFB C;  1FG4 A;  2XHF A;  1GLQ A;  1QQ2 A;  1URM A;  3TKS C;  3TRQ A;  6GSX A;  3C1S A;  1K0O A;  2VD1 A;  2LRC A;  2KUC A;  3LG6 A;  1T8E B;  4K0G A;  2EIQ A;  2VCT A;  3A2X A;  2CZ3 A;  2JZR A;  1TRV A;  3F6D A;  5G1K A;  2J23 A;  2KHP A;  1R26 A;  6GSW A;  4I8B A;  2L59 A;  3TKS A;  1QXH A;  2EC4 A;  3I9V 2;  5DQS A;  2WZ9 A;  1FVJ A;  3KTB A;  4MZC A;  4XIH A;  1TJD A;  4FYC A;  2C0F A;  3HVS A;  5JWO B;  1OC9 A;  1FB0 A;  4LL4 B;  3HZ8 A;  3EMP A;  3MNG A;  4G2E A;  2VUP A;  4X1U A;  3IA1 A;  2JU5 A;  3FR9 A;  1SEN A;  4EC0 A;  2VCQ A;  3CXG A;  4Z7X A;  1M3I A;  5GAP D;  3KMN A;  5HR2 A;  4DSS B;  2H6X A;  4YKF A;  3LOR A;  4RI7 A;  4X0X A;  4EIP A;  2G0F A;  2A4H A;  1Z6N A;  2JZT A;  1SKR B;  3F4R A;  2R37 A;  1WMJ A;  4FIW A;  1VF3 A;  4KCA A;  3BCI A;  3VLN A;  3NIV A;  1U87 A;  1ERW A;  3ZL5 A;  1B48 A;  2NDO A;  1YY7 A;  1U6T A;  2JAD A;  4IVF A;  2O89 A;  2ZUP A;  4Q5R A;  4OFT A;  3FW2 A;  3F3Q A;  3HVN A;  2CQ9 A;  2YPM A;  4IN0 A;  2B1L A;  3LW9 A;  1GP1 A;  1FOV A;  3ME7 A;  5G5F A;  2RM6 A;  4EL1 A;  1TI1 A;  1VF1 A;  2R0P A;  3LEF A;  3UBL A;  4YAV A;  4RQX A;  1QUW A;  20GS A;  3UBK A;  2NBS A;  4FQU A;  1K0A A;  1HD2 A;  5B8A A;  3APQ A;  3KJY A;  1S3D A;  1TU7 A;  3WGX A;  3UVT A;  4ZIL A;  2K18 A;  2LRN A;  2MBS A;  1VRS D;  1WP0 A;  3F9U A;  1HYU A;  2C80 A;  2WB9 A;  1PN9 A;  4XCS A;  1K0N A;  1A23 A;  1EEM A;  1ML6 A;  1ZL9 A;  2H1G A;  4K1F A;  3ZVJ A;  2LQO A;  3IHG A;  3M9K A;  1ABA A;  1GSU A;  5D9X A;  4ECI A;  2FGX A;  3CMI A;  1GTU A;  3KH7 A;  4YQU A;  5C04 A;  1TRW A;  2L57 A;  1R5A A;  2FCH A;  3ZTL A;  1ZZY A;  2ON7 A;  1YEP A;  3C71 A;  2G2Q A;  3FEU A;  1NHY A;  5JCW A;  3WT1 A;  3Q74 A;  2C0D A;  2ON5 A;  5J9B A;  4IJI A;  5AIS A;  2H1B A;  2IN3 A;  3I69 A;  5A4V A;  1YDK A;  4KSO A;  2YWO A;  3KD0 A;  3F8U A;  3M9J A;  1O81 A;  2MBT A;  4LMV A;  4NV5 A;  3TJK A;  1M2A A;  2GGT A;  3IAM 2;  1Z7P A;  3TOT A;  5DQY A;  4IQA A;  4OO5 A;  5ECP B;  7GSS A;  1U3A A;  2OAD A;  4ZB9 A;  4E8H A;  3NZN A;  4L0W A;  1AQW A;  4WR4 A;  1T4Z A;  3GA4 A;  1ST9 A;  2CX3 A;  4MLY A;  2VCW A;  17GS A;  3MIX A;  5ECS A;  4CY6 A;  4Q5Q A;  3APS A;  2JSZ A;  5CAX A;  3RPN A;  1DSB A;  3MWH A;  1O8W A;  1NSW A;  1A2L A;  3A2V A;  2H74 A;  5GST A;  2XPE A;  3O3T A;  5IMZ A;  2DLX A;  3LQ7 A;  1SK1 A;  2YAN A;  2X99 A;  2OBI A;  3ZFB A;  4EE0 A;  1MD3 A;  3CTF A;  4WBR D;  1ZOF A;  2CVK A;  3CSJ A;  4EXJ A;  2JL4 A;  2IL3 A;  3CSI A;  3L0H A;  1DE1 A;  4G9H A;  4YAP A;  4TR3 A;  2LJA A;  1UC7 A;  2PMT A;  1OAZ A;  2GSS A;  1B9X C;  4AJ6 A;  2WFC A;  2IME A;  3QDN A;  1PGT A;  1K0C A;  4NMU A;  1T00 A;  1SL1 B;  4AJ8 A;  3A2W A;  2B1K A;  1JFU A;  2K8S A;  2H70 A;  1M0U A;  3LYP A;  3WYW A;  2H71 A;  5GSS A;  3P90 A;  2A2R A;  5IM9 A;  3F4T A;  1SKS B;  5IO2 A;  5DCG A;  4ECC A;  2N5A A;  3EU3 A;  3MDK A;  4KAE A;  2H66 A;  3LGC A;  2HT9 A;  2LNS A;  2AHE A;  5DAK B;  4MZW A;  3E3E A;  3ZIV A;  1F9M A;  4PUA A;  5IMA A;  3G9B A;  1ZYE A;  4TR1 B;  2WDU A;  5IO0 A;  5F06 A;  1K0M A;  2YP6 A;  3GSS A;  5HFK A;  1HNA A;  2HSH A;  2HNL A;  1TW9 A;  3HXS A;  1GUK A;  1T3B A;  2HFD A;  3QPM A;  1XPV A;  3LXT A;  1ERU A;  2H01 A;  3DRN A;  3QAG A;  4D73 A;  4YQM A;  1RQM A;  2C1Y A;  1CQG A;  5KN1 A;  4X4J A;  1MDI A;  5CP1 A;  3D5J A;  2YNX A;  1VGL A;  4GSN A;  1VF4 A;  3OR5 A;  3P7X A;  1HQO A;  1XVQ A;  14GS A;  2IFQ B;  1YQ1 A;  4GST A;  4IBP A;  3C1R A;  2A2P A;  3M8N A;  3ZYW A;  1TK8 B;  18GS A;  3L4N A;  1A8L A;  3M3M A;  4ZBD A;  5BMU A;  2H0I A;  1HNC A;  1F2E A;  4XS4 A;  4K2D A;  1MTC A;  2X8G A;  2DJK A;  5C00 A;  3ZMK A;  5ECR B;  2GDR A;  1JLV A;  1XBS A;  2X4A A;  5KOX A;  3GIX A;  4TOP A;  1SD9 A;  2HE3 A;  4JE1 A;  3IC4 A;  2MMN A;  4BWQ A;  3FR3 A;  2KLX A;  1GL8 A;  3HYP A;  4GSS A;  3ZML A;  3UAR A;  3KMO A;  1U3I A;  1EOG A;  1JLW A;  1MD4 A;  1Q4J A;  1B4P A;  2C3Q A;  4USS A;  2L4C A;  3FKF A;  4V1A p;  4OD7 A;  3TKR A;  4CW9 A;  3GMF A;  2GLR A;  3R2Q A;  3FZA A;  3TJG A;  3QFA C;  3P2A A;  3KM6 A;  5CNW A;  1BYE A;  4O5R A;  2R0C A;  3QR6 A;  4HU9 A;  1WWJ A;  4F0C A;  1TOF A;  2HZE A;  1EWX A;  4ZBB A;  1S3R A;  3EMX A;  5D9V A;  2L6C A;  4MCU A;  1XZO A;  4K7I A;  2B5X A;  3L9S A;  3HJO A;  4GCI A;  1GUL A;  3CTG A;  2CX4 A;  3PH9 A;  2DIZ A;  4DSS A;  2GQL A;  2AJQ B;  4IQ1 A;  2DMM A;  1EV4 A;  1S3C A;  4P3Y B;  2HZF A;  1PMT A;  4AJ7 A;  1THX A;  3TKP A;  4WF4 A;  4JBB A;  3F0I A;  3IR4 A;  2M72 A;  1AQV A;  1K0B A;  1WPI A;  1XW9 A;  4ZL7 A;  3LWA A;  4F0B A;  3DVW A;  2XBQ A;  4KF9 A;  3JCM L;  3C73 A;  5ID2 B;  4BL7 B;  3UVH A;  2R6K A;  1A0R P;  1FO5 A;  4N11 A;  3C7M A;  5DAL B;  2K6V A;  1G6Y A;  4ML1 A;  2Z9S A;  1V9W A;  3LXZ A;  4K8M A;  5IQY A;  1ZYP A;  5D73 A;  4ILF A;  2HI7 A;  4RQR A;  3ERF A;  1X5E A;  1JZD A;  3PR8 A;  1TTZ A;  3KXO A;  2ZCT A;  1VF2 A;  5CRD A;  5J4U A;  4FH8 A;  2B5Y A;  3IE3 A;  3KIJ A;  1AIU A;  1ERV A;  1N2A A;  3KTL A;  1A24 A;  5J9C A;  3L9V A;  4K7N A;  2GT6 A;  3MAK A;  4A5P A;  1KBN A;  2BJX A;  2R0G A;  1X9W B;  1X9M B;  1MDJ A;  1GUM A;  1G0T A;  5F05 A;  1MEK A;  1UVZ A;  3BBY A;  3TOU A;  2H30 A;  2HXK A;  3IV4 A;  2X64 A;  2RUF A;  4TN8 A;  3UIW A;  3D6I A;  4JR4 A;  1Z9H A;  3GTU A;  4MA9 A;  4PGT A;  2HSY A;  3RHB A;  1EGR A;  2YWN A;  1ZMA A;  1IYH A;  2CVB A;  4N0V A;  3GL5 A;  2C0E A;  4LMW A;  3GV1 A;  1EV9 A;  5CRE A;  2PN8 A;  4ACS A;  3ME8 A;  1WIK A;  5D9T A;  1PFO A;  4IJ3 A;  1F6M C;  1S3A A;  2DJ2 A;  5B6N A;  1H4O A;  2PBJ A;  2WUL A;  2VLT A;  1LU4 A;  2BTO T;  2DJ0 A;  2PVQ A;  4HU7 A;  3BOA A;  3LYK A;  22GS A;  4OFN A;  2NVL A;  3TJJ A;  1USB A;  4MH2 A;  1NM3 A;  2QSI A;  2H19 A;  3HZ4 A;  4MNN A;  3PGT A;  4X43 A;  4TXO B;  5IPG A;  2CV4 A;  3GYK A;  2YZH A;  5ECN B;  5IPH A;  1TK5 B;  2WCI A;  3FRC A;  3TRP A;  5D8I A;  4ML6 A;  1E2Y A;  2YV7 A;  4G0L A;  1WOU A;  1Z6M A;  2VL9 A;  3UOM A;  3KZQ A;  1XWC A;  2QGV A;  2FWG A;  2IMF A;  2K8V A;  1O7U A;  1U88 A;  1XG8 A;  5F07 A;  5ABR A;  2V1M A;  2BMX A;  3QMX A;  2CA8 A;  1GNW A;  3QD9 A;  2V2G A;  1G6W A;  2GS3 A;  3HCZ A;  3GN3 A;  1X0R A;  5FT3 A;  1TK0 B;  1A8Y A;  1R7H A;  1JZO A;  3VWU A;  2N5F A;  4OFM A;  3GX0 A;  2L6D A;  1T1V A;  2RLI A;  1O73 A;  4JR6 A;  2DC5 A;  3ERW A;  2F51 A;  1AC1 A;  2LST A;  4BVY B;  4BWS A;  1GWC A;  5HR3 A;  1M2D A;  4G0K A;  3HD5 A;  5HR1 A;  1OC8 A;  4ECB A;  4WR5 A;  1EP7 A;  1XWB A;  4O5Q A;  5A4U A;  2H76 A;  3H79 A;  3HVV A;  4PX1 A;  1YKA A;  1THO A;  3Q6O A;  1XVW A;  1XOB A;  5DJM A;  3G7Y A;  2FA8 A;  3ZVJ D;  4ZBA A;  1V2A A;  2R3X A;  1O6J A;  1OE8 A;  2CAQ A;  3BCK A;  2ZNM A;  4KW6 A;  1X5C A;  3GUS A;  4MAB A;  5DAK A;  2P5Q A;  9GSS A;  2IPA A;  3G7J A;  2HRN A;  4K9Z A;  4KB3 A;  4EUY A;  3NOF A;  3R3E A;  4POK A;  2H8L A;  1SJI A;  4MH3 A;  4N10 A;  3EPT A;  5D96 A;  1TU8 A;  2F8A A;  1NHO A;  4MPG A;  1XWK A;  1LBK A;  1EP8 A;  3KCM A;  4K7O A;  2LJR A;  2RM5 A;  3FY7 A;  4XS6 A;  1ZGN A;  5DJL A;  4EIQ A;  2E2G A;  2OAC A;  1BJX A;  2AYT A;  4TVE A;  4V1A g;  3TUE A;  4J2F A;  3TRX A;  4IP6 A;  4JED A;  2VL3 A;  3GFK A;  3TJF A;  1GUH A;  5KN0 A;  4GRF A;  1DBY A;  1GTI A;  4V2N A;  1QFN A;  2NTO A;  4OWY A;  2CT6 A;  3N9J A;  3IK7 A;  2FHE A;  4IEL A;  3VI7 A;  3VWX A;  2I1U A;  2LV3 A;  4IHU A;  2LS5 A;  3SWL A;  1PKZ A;  2EIO A;  3L78 A;  3QOU A;  4WF5 A;  4BIK A;  5JCU A;  1JZW A;  1V98 A;  4ZXG A;  5LNK e;  3MSZ A;  4POL A;  2E7P A;  4GWR A;  3CRT A;  1V58 A;  1PRX A;  3RDW A;  4MDC A;  2YCD A;  4POM A;  2E2M A;  4XS1 A;  2H0G A;  2MMZ A;  3FHK A;  3F63 A;  1F3A A;  3FZ5 A;  4MF6 A;  4WET A;  5E4W A;  4KDU A;  1F37 A;  3DGQ A;  3DVX A;  3IRA A;  4XTS A;  1GSD A;  3G7I A;  5HFG A;  1T4Y A;  3GST A;  2I3Y A;  3PPU A;  1M2B A;  1SK0 A;  1X5D A;  4HZ2 A;  3IBH A;  2CAI A;  2PU9 C;  5H5S A;  2I81 A;  1M9B A;  1FW1 A;  1GTB A;  3K8N A;  2F9S A;  4OO4 A;  3KH9 A;  3I6A A;  2DML A;  3ZLP A;  4QL7 A;  2WJU A;  2HSM A;  4RI6 A;  3RBT A;  4QL9 A;  1MDK A;  4GXZ A;  1M3J A;  8GSS A;  1GTA A;  3LJR A;  1OYJ A;  3EVI A;  4MZB A;  4MPF A;  1Y6E A;  3DIE A;  2AAW A;  4PNG A;  2VAF A;  1WRY A;  4JZQ A;  19GS A;  3DXB A;  3F3R A;  5AIX A;  4KDX A;  4BL7 A;  5CRG A;  5G1L A;  4ZIJ A;  1YF0 A;  1AXD A;  1G7E A;  4PNF A;  3U5R E;  5E59 A;  1V57 A;  4ICY A;  5DAL A;  2PWJ A;  5IMC A;  6GSY A;  4PUF C;  3TCO A;  3US3 A;  3AY8 A;  1EGO A;  6GST A;  5J3R A;  3GHA A;  1YKC A;  1JHB A;  3IAS 2;  2FY6 A;  5IOX A;  2C4J A;  2HRK A;  5F8B A;  1T7P B;  4KA0 A;  4HUA A;  4IKH A;  4K2X A;  5GZZ B;  1PN0 A;  3ISO A;  3QAV A;  5L71 A;  2YOI A;  3TB2 A;  5CRW A;  4LL1 B;  1TKD B;  1SU9 A;  3VFI A;  4IS0 A;  3HJP A;  2QKE A;  5AGY A;  4PQ1 A;  4AGS A;  1J9B A;  5ECM B;  1PL2 A;  2C3T A;  2TRC P;  3KP9 A;  3DWV A;  2DKI A;  2WRT A;  2LTK A;  1UN2 A;  4KND A;  2HRA A;  4POB A;  5ECL B;  3DD3 A;  2H1A A;  4I6X A;  1O85 A;  3QCP A;  2V6O A;  11GS A;  1PA3 A;  4IGJ A;  4Z2T A;  1M99 A;  5ECK B;  4J56 E;  2QC7 A;  1ILO A;  3D22 A;  4I2T A;  1BX9 A;  4XRA A;  3A5I A;  3HKR A;  4FYU A;  4MMM A;  3GH9 A;  1G7O A;  3FR6 A;  4EDZ A;  2RUE A;  2I9H A;  2F3M A;  3HJM A;  4TXO A;  4K5R A;  4OCF A;  2M46 A;  4PTS A;  1TXX A;  1TP9 A;  1PX6 A;  3W8J A;  4YH2 A;  5ELA A;  5B8B A;  3EU4 A;  1HNB A;  2DJ1 A;  5G30 A;  4NHZ A;  5IOW A;  3HY2 A;  1DUG A;  2B7K A;  2JSY A;  3FZ4 A;  4LA1 A; 
#chains in the Genus database with same CATH homology
 4V2M A;  3ZRE A;  2GST A;  3UJ1 A;  4YQV A;  5ECI B;  2D2Z A;  5J5N A;  1IYI A;  5EVO A;  5BRT A;  5GAN D;  2P5R A;  1YF1 A;  4NHW A;  2GSR A;  2YJH A;  1BG5 A;  1N8J A;  1Z3E A;  4BVY A;  4GQF A;  2H72 A;  4WEY A;  2H1D A;  2H6Y A;  1B9Y C;  1DE2 A;  2FNO A;  1EOH A;  3W8S A;  3QAW A;  2GT5 A;  5IMD A;  3DKS A;  2J9H A;  4OMV A;  2LNT A;  1Q98 A;  4BVX B;  1B4Q A;  2QA1 A;  4O7H A;  3ZFL A;  5ENU A;  3F4S A;  1CQH A;  3ZIJ A;  2VO4 A;  1XFL A;  2L5L A;  4HQZ A;  5COH A;  3ED3 A;  2IJY A;  2GSQ A;  5KEJ A;  1JZR A;  1Z5Y E;  1SYR A;  12GS A;  4JU5 A;  5HR0 A;  3HHV A;  4KGI A;  3VI5 A;  1X9S B;  10GS A;  1SYX A;  5KOW A;  1UA5 A;  2X8H A;  4EO3 A;  4PUR A;  4KH7 A;  3KGK A;  5KN3 A;  3RAZ A;  1YZX A;  4AF2 A;  1XWG A;  2HRF A;  2FD3 A;  3CYN A;  4HQS A;  2LEG A;  2V32 A;  3LFL A;  2F8F A;  3D0Z A;  4BPY A;  5G31 A;  4V2L A;  3GL3 A;  3ZZX A;  2O87 A;  3GH6 A;  1A0F A;  4TW5 A;  1TI3 A;  3TDG A;  4OCE A;  2HZE B;  5AN1 A;  3IK9 A;  4EVM A;  2VL2 C;  3EC3 A;  2AUV A;  3EIN A;  2O8V B;  5IIZ A;  3A5W A;  3WT2 A;  1KTE A;  2VCX A;  2VM1 A;  2GZZ A;  4XHM A;  4WKW A;  1EEJ A;  2VM2 A;  3GNJ A;  5A4W A;  4DVC A;  2KP2 A;  5HFI A;  2FA4 A;  3BD2 A;  16GS A;  1FHE A;  3BJ5 A;  5IMV A;  2DKH A;  3TGZ A;  4HJM A;  4FO5 A;  2VL2 A;  2FWF A;  4IW9 A;  2B6M A;  2PER A;  2R2J A;  1PSQ A;  2YWI A;  4MF5 A;  2YZU A;  3H8Q A;  3N5O A;  1OKT A;  2L5O A;  1J0F A;  2AB6 A;  1PD2 1;  3HA9 A;  1GSQ A;  1QK8 A;  5INY A;  2P0G A;  2GQM A;  2VCV A;  1PL1 A;  1AAZ A;  1K3Y A;  1V40 A;  1XW5 A;  5D93 A;  5B6M A;  4G10 A;  4KE3 A;  2FUG 2;  4MF7 A;  4I5Q A;  4KUN A;  1KEB A;  2PGT A;  3M0F A;  1RW1 A;  4O5U A;  3U6V A;  4KCE A;  4F9Z A;  5EL8 A;  4I2U A;  1A2M A;  5DBQ A;  1XOA A;  4EF0 A;  3EE2 A;  4JRR A;  2H75 A;  2KOK A;  3DEX A;  3UEM A;  4MJA A;  3O6T A;  4HEA 2;  4HZ4 A;  4TR1 A;  2FWH A;  2YN1 A;  3CSH A;  2R5G A;  2V6K A;  1H75 A;  3H1N A;  4CY8 A;  2XC2 A;  3GTU B;  2KP1 A;  1FOH A;  1FVK A;  5DCH A;  4HI7 A;  4HS1 A;  2VD0 A;  3LSZ A;  4ZL8 A;  1C72 A;  2B5E A;  2CZ2 A;  4H86 A;  2NPB A;  2FWE A;  3M1G A;  3FK8 A;  1OC9 B;  2MZC A;  4NWY A;  2H0H A;  3GKN A;  2IFQ A;  4MJE A;  2OE3 A;  1AQX A;  1TRS A;  2ALB A;  4L5O A;  1OC3 A;  4PQI A;  5CYY A;  3C8E A;  1XXU A;  1R4W A;  3DYR A;  4TRX A;  3WD6 A;  4L5L A;  2L4Q A;  2JZS A;  2H6Z A;  5EY6 A;  2K9F A;  3WGE A;  1SL2 B;  3VPQ A;  4KX4 A;  1LJR A;  5F0G A;  2DSA A;  1BQ7 A;  1W89 A;  1OKD A;  4HDE A;  2B7J A;  4EDY A;  3DML A;  1SK2 A;  2REM A;  1Y25 A;  3I43 A;  5JWR B;  6GSS A;  2VLV A;  1K3L A;  2A2S A;  5IMF A;  2OKA A;  3D21 A;  3SBC A;  2V41 A;  1NW2 A;  1GSS A;  4ISD A;  1B8X A;  4Q5N A;  3TKS E;  5HQP A;  2OBK A;  3HDC A;  4Z2U A;  4NPB A;  1TDI A;  2N5B A;  3J7Y b;  3GUR A;  1M7T A;  1ZCP A;  4RUV A;  4DEJ A;  3J7Y k;  4J57 E;  2R4V A;  2DIY A;  4CDO A;  4TXV A;  1XW6 A;  3GKX A;  1PX7 A;  2XPD A;  1WJK A;  1RK4 A;  2B3S A;  4KDY A;  3VUR A;  3KP8 A;  2PPT A;  4GQC A;  3UAP A;  3PIN A;  1AW9 A;  5LD0 A;  3VPT A;  3Q19 A;  1PQN A;  1GH2 A;  2OE1 A;  3FZ9 A;  2C3N A;  4XRD A;  2VOC A;  3IPZ A;  2YWM A;  5D9W A;  3IOS A;  5JWQ B;  4I97 A;  3IXR A;  2PUK C;  3APO A;  4F2I A;  1ACV A;  2IWT A;  3ERG A;  4GLT A;  2QA2 A;  4YKG A;  1KNG A;  1PKW A;  4TKY A;  2YV9 A;  3F6F A;  3GX8 A;  1YJ6 A;  5ID2 A;  2MMO A;  3IHQ A;  4BA7 A;  4FYB A;  5ELG A;  3E0U A;  4N0Z A;  2FLS A;  1SKW B;  1Z7R A;  1GSF A;  3P8W A;  2IIY A;  4K6X A;  2TIR A;  1FAA A;  2OE0 A;  3ZRD A;  1M9A A;  2LUS A;  2A4V A;  2LKU A;  1W4V A;  2UZ8 A;  3E9J B;  4ULX A;  2O7K A;  2HYX A;  4L0U A;  5G5E A;  5EPF A;  3ZIT A;  5DDL A;  4F82 A;  4MJC A;  3TJB A;  4TR0 A;  1QMV A;  4GF0 A;  5FWG A;  3UMA A;  4BVX A;  2IMI A;  2DJJ A;  1ZYQ B;  4WBJ A;  4ZB8 A;  1GSY A;  1F3B A;  4NXI A;  4Z2R A;  6GSV A;  1ON4 A;  5G2Z A;  2E0Q A;  3UL3 A;  1SJ6 A;  3GKM A;  4LLR A;  2ES7 A;  5CRH A;  1WE0 A;  2LQQ A;  2DBC A;  3IDV A;  3EYT A;  1XCC A;  2OJL A;  1GNE A;  5KN2 A;  1BAY A;  4DSQ A;  3TKQ A;  3IC8 A;  5A5K A;  6GSU A;  1QGV A;  2X8C A;  2X49 A;  1K0D A;  1EZK A;  1A2J A;  3H93 A;  4O32 A;  2LJK A;  3KEB A;  2GTU A;  1SJZ A;  1XIY A;  1XWA A;  2O85 A;  3O76 A;  4N30 A;  2GQK A;  4WXT A;  1ZYN A;  1K3O A;  3D4T A;  2PVO C;  4GTU A;  3VWW A;  2P31 A;  3Q18 A;  1BED A;  4ECJ A;  4TR4 A;  1E6B A;  4G19 A;  2MYG A;  4DSR A;  13GS A;  5FHI A;  3CBU A;  4ZB6 A;  5AIV A;  1GRX A;  3WGD A;  3GKK A;  2C0G A;  4EKZ A;  3A3T A;  5ECQ B;  2CVD A;  3H4K A;  4MJB A;  2H73 A;  3V1W A;  5CO3 A;  2VCZ A;  2LRT A;  2OA7 A;  2I4A A;  3RPP A;  2RII A;  3VWV A;  2WS2 A;  4G0I A;  4E8E A;  5H5R A;  5JCG A;  1I9D A;  5J41 A;  4HJ2 A;  1GSE A;  5ECO B;  4Q5F A;  4NAX A;  2VLU A;  4NV2 A;  4PXO A;  4K5S A;  2WGR A;  2M80 A;  4QQ7 A;  4O92 A;  2MMA A;  1SL0 B;  3HVX A;  3EWL A;  2HLS A;  3MYD A;  2IMK A;  1I5G A;  4IP1 A;  2JAC A;  4HOJ A;  5LCZ A;  4KSM A;  5ECH B;  4D73 B;  1YEX A;  5H5Q A;  1FB6 A;  4ZL9 A;  4K0N A;  4F03 A;  1TRU A;  4PQH A;  1OE7 A;  2YJ7 A;  1AUC A;  2TRX A;  3FMW A;  2DJ3 A;  4MP4 A;  5B7C A;  1SD8 A;  2VIM A;  2GZY A;  3D4M A;  3W6G A;  2IMD A;  3RHC A;  4CHS A;  1R5P A;  1OVN A;  3CRU A;  1O8X A;  2XBI A;  3S9F A;  3VK9 A;  3GRX A;  2EIR A;  2AV4 A;  3L9U A;  1J08 A;  1ERT A;  4MK3 A;  4L8E A;  4XS4 B;  4ID0 A;  1GLP A;  3FYG A;  5DVB A;  2GVP A;  3EUR A;  2C8U A;  2GZP A;  3QFB C;  1FG4 A;  2XHF A;  1GLQ A;  1QQ2 A;  1URM A;  3TKS C;  3TRQ A;  6GSX A;  3C1S A;  1K0O A;  2VD1 A;  2LRC A;  2KUC A;  3LG6 A;  1T8E B;  4K0G A;  2EIQ A;  2VCT A;  3A2X A;  2CZ3 A;  2JZR A;  1TRV A;  3F6D A;  5G1K A;  2J23 A;  2KHP A;  1R26 A;  6GSW A;  4I8B A;  2L59 A;  3TKS A;  1QXH A;  2EC4 A;  3I9V 2;  5DQS A;  2WZ9 A;  1FVJ A;  3KTB A;  4MZC A;  4XIH A;  1TJD A;  4FYC A;  2C0F A;  3HVS A;  5JWO B;  1OC9 A;  1FB0 A;  4LL4 B;  3HZ8 A;  3EMP A;  3MNG A;  4G2E A;  2VUP A;  4X1U A;  3IA1 A;  2JU5 A;  3FR9 A;  1SEN A;  4EC0 A;  2VCQ A;  3CXG A;  4Z7X A;  5GAP D;  3KMN A;  5HR2 A;  4DSS B;  2H6X A;  4YKF A;  3LOR A;  4RI7 A;  4X0X A;  4EIP A;  2G0F A;  2A4H A;  1Z6N A;  2JZT A;  1SKR B;  3F4R A;  2R37 A;  1WMJ A;  4FIW A;  1VF3 A;  4KCA A;  3BCI A;  3VLN A;  3NIV A;  1U87 A;  1ERW A;  3ZL5 A;  1B48 A;  2NDO A;  1YY7 A;  1U6T A;  2JAD A;  4IVF A;  2O89 A;  2ZUP A;  4Q5R A;  4OFT A;  3FW2 A;  3F3Q A;  2CQ9 A;  2YPM A;  4IN0 A;  2B1L A;  3LW9 A;  1GP1 A;  1FOV A;  3ME7 A;  5G5F A;  2RM6 A;  4EL1 A;  1TI1 A;  1VF1 A;  2R0P A;  3LEF A;  3UBL A;  4YAV A;  4RQX A;  1QUW A;  20GS A;  3UBK A;  2NBS A;  4FQU A;  1K0A A;  1HD2 A;  5B8A A;  3APQ A;  3KJY A;  1S3D A;  1TU7 A;  3WGX A;  3UVT A;  4ZIL A;  2K18 A;  2LRN A;  2MBS A;  1VRS D;  1WP0 A;  3F9U A;  1HYU A;  2C80 A;  2WB9 A;  1PN9 A;  4XCS A;  1K0N A;  1A23 A;  1EEM A;  1ML6 A;  1ZL9 A;  2H1G A;  4K1F A;  3ZVJ A;  2LQO A;  3IHG A;  3M9K A;  1ABA A;  1GSU A;  5D9X A;  4ECI A;  2FGX A;  3CMI A;  1GTU A;  3KH7 A;  4YQU A;  5C04 A;  1TRW A;  2L57 A;  1R5A A;  2FCH A;  3ZTL A;  1ZZY A;  2ON7 A;  1YEP A;  3C71 A;  2G2Q A;  3FEU A;  1NHY A;  5JCW A;  3WT1 A;  3Q74 A;  2C0D A;  2ON5 A;  5J9B A;  4IJI A;  5AIS A;  2H1B A;  2IN3 A;  3I69 A;  5A4V A;  1YDK A;  4KSO A;  2YWO A;  3KD0 A;  3F8U A;  3M9J A;  1O81 A;  2MBT A;  4LMV A;  4NV5 A;  3TJK A;  1M2A A;  2GGT A;  3IAM 2;  1Z7P A;  3TOT A;  5DQY A;  4IQA A;  4OO5 A;  5ECP B;  7GSS A;  1U3A A;  2OAD A;  4ZB9 A;  4E8H A;  3NZN A;  4L0W A;  1AQW A;  4WR4 A;  1T4Z A;  3GA4 A;  1ST9 A;  2CX3 A;  4MLY A;  2VCW A;  17GS A;  3MIX A;  5ECS A;  4CY6 A;  4Q5Q A;  3APS A;  2JSZ A;  5CAX A;  3RPN A;  1DSB A;  3MWH A;  1O8W A;  1NSW A;  1A2L A;  3A2V A;  2H74 A;  5GST A;  2XPE A;  3O3T A;  5IMZ A;  2DLX A;  3LQ7 A;  1SK1 A;  2YAN A;  2X99 A;  2OBI A;  3ZFB A;  4EE0 A;  1MD3 A;  3CTF A;  4WBR D;  1ZOF A;  2CVK A;  3CSJ A;  4EXJ A;  2JL4 A;  2IL3 A;  3CSI A;  3L0H A;  1DE1 A;  4G9H A;  4YAP A;  4TR3 A;  2LJA A;  1UC7 A;  2PMT A;  1OAZ A;  2GSS A;  1B9X C;  4AJ6 A;  2WFC A;  2IME A;  3QDN A;  1PGT A;  1K0C A;  4NMU A;  1T00 A;  1SL1 B;  4AJ8 A;  3A2W A;  2B1K A;  1JFU A;  2K8S A;  2H70 A;  1M0U A;  3LYP A;  3WYW A;  2H71 A;  5GSS A;  3P90 A;  2A2R A;  5IM9 A;  3F4T A;  1SKS B;  5IO2 A;  5DCG A;  4ECC A;  2N5A A;  3EU3 A;  3MDK A;  4KAE A;  2H66 A;  3LGC A;  2HT9 A;  2LNS A;  2AHE A;  5DAK B;  4MZW A;  3E3E A;  3ZIV A;  1F9M A;  4PUA A;  5IMA A;  3G9B A;  1ZYE A;  4TR1 B;  2WDU A;  5IO0 A;  5F06 A;  1K0M A;  2YP6 A;  3GSS A;  5HFK A;  1HNA A;  2HSH A;  2HNL A;  1TW9 A;  3HXS A;  1GUK A;  1T3B A;  2HFD A;  3QPM A;  1XPV A;  3LXT A;  1ERU A;  2H01 A;  3DRN A;  3QAG A;  4D73 A;  4YQM A;  1RQM A;  2C1Y A;  1CQG A;  5KN1 A;  4X4J A;  1MDI A;  5CP1 A;  3D5J A;  2YNX A;  1VGL A;  4GSN A;  1VF4 A;  3OR5 A;  3P7X A;  1HQO A;  1XVQ A;  14GS A;  2IFQ B;  1YQ1 A;  4GST A;  4IBP A;  3C1R A;  2A2P A;  3M8N A;  3ZYW A;  1TK8 B;  18GS A;  3L4N A;  1A8L A;  3M3M A;  4ZBD A;  5BMU A;  2H0I A;  1HNC A;  1F2E A;  4XS4 A;  4K2D A;  1MTC A;  2X8G A;  2DJK A;  5C00 A;  3ZMK A;  5ECR B;  2GDR A;  1JLV A;  1XBS A;  2X4A A;  5KOX A;  3GIX A;  4TOP A;  1SD9 A;  2HE3 A;  4JE1 A;  3IC4 A;  2MMN A;  4BWQ A;  3FR3 A;  2KLX A;  1GL8 A;  3HYP A;  4GSS A;  3ZML A;  3UAR A;  3KMO A;  1U3I A;  1EOG A;  1JLW A;  1MD4 A;  1Q4J A;  1B4P A;  2C3Q A;  4USS A;  2L4C A;  3FKF A;  4V1A p;  4OD7 A;  3TKR A;  4CW9 A;  3GMF A;  2GLR A;  3R2Q A;  3FZA A;  3TJG A;  3QFA C;  3P2A A;  3KM6 A;  5CNW A;  1BYE A;  4O5R A;  2R0C A;  3QR6 A;  4HU9 A;  1WWJ A;  4F0C A;  1TOF A;  2HZE A;  1EWX A;  4ZBB A;  3EMX A;  5D9V A;  2L6C A;  4MCU A;  1XZO A;  4K7I A;  2B5X A;  3L9S A;  3HJO A;  4GCI A;  1GUL A;  3CTG A;  2CX4 A;  3PH9 A;  2DIZ A;  4DSS A;  2GQL A;  2AJQ B;  4IQ1 A;  2DMM A;  1EV4 A;  1S3C A;  4P3Y B;  2HZF A;  1PMT A;  4AJ7 A;  1THX A;  3TKP A;  4WF4 A;  4JBB A;  3F0I A;  3IR4 A;  2M72 A;  1AQV A;  1K0B A;  1WPI A;  1XW9 A;  4ZL7 A;  3LWA A;  4F0B A;  3DVW A;  2XBQ A;  4KF9 A;  3JCM L;  3C73 A;  5ID2 B;  4BL7 B;  3UVH A;  2R6K A;  1A0R P;  1FO5 A;  4N11 A;  3C7M A;  5DAL B;  2K6V A;  1G6Y A;  4ML1 A;  2Z9S A;  1V9W A;  3LXZ A;  4K8M A;  5IQY A;  1ZYP A;  5D73 A;  4ILF A;  2HI7 A;  4RQR A;  3ERF A;  1X5E A;  1JZD A;  3PR8 A;  1TTZ A;  3KXO A;  2ZCT A;  1VF2 A;  5CRD A;  5J4U A;  4FH8 A;  2B5Y A;  3IE3 A;  3KIJ A;  1AIU A;  1ERV A;  1N2A A;  3KTL A;  1A24 A;  5J9C A;  3L9V A;  4K7N A;  2GT6 A;  3MAK A;  4A5P A;  1KBN A;  2BJX A;  2R0G A;  1X9W B;  1X9M B;  1MDJ A;  1GUM A;  1G0T A;  5F05 A;  1MEK A;  1UVZ A;  3BBY A;  3TOU A;  2H30 A;  2HXK A;  3IV4 A;  2X64 A;  2RUF A;  4TN8 A;  3UIW A;  3D6I A;  4JR4 A;  1Z9H A;  3GTU A;  4MA9 A;  4PGT A;  2HSY A;  3RHB A;  1EGR A;  2YWN A;  1ZMA A;  1IYH A;  2CVB A;  4N0V A;  3GL5 A;  2C0E A;  4LMW A;  3GV1 A;  1EV9 A;  5CRE A;  2PN8 A;  4ACS A;  3ME8 A;  1WIK A;  5D9T A;  4IJ3 A;  1F6M C;  1S3A A;  2DJ2 A;  5B6N A;  1H4O A;  2PBJ A;  2WUL A;  2VLT A;  1LU4 A;  2BTO T;  2DJ0 A;  2PVQ A;  4HU7 A;  3BOA A;  3LYK A;  22GS A;  4OFN A;  2NVL A;  3TJJ A;  1USB A;  4MH2 A;  1NM3 A;  2QSI A;  2H19 A;  3HZ4 A;  4MNN A;  3PGT A;  4X43 A;  4TXO B;  5IPG A;  2CV4 A;  3GYK A;  2YZH A;  5ECN B;  5IPH A;  1TK5 B;  2WCI A;  3FRC A;  3TRP A;  5D8I A;  4ML6 A;  1E2Y A;  2YV7 A;  4G0L A;  1WOU A;  1Z6M A;  2VL9 A;  3UOM A;  3KZQ A;  1XWC A;  2QGV A;  2FWG A;  2IMF A;  2K8V A;  1O7U A;  1U88 A;  5F07 A;  5ABR A;  2V1M A;  2BMX A;  3QMX A;  2CA8 A;  1GNW A;  3QD9 A;  2V2G A;  1G6W A;  2GS3 A;  3HCZ A;  3GN3 A;  1X0R A;  5FT3 A;  1TK0 B;  1A8Y A;  1R7H A;  1JZO A;  3VWU A;  2N5F A;  4OFM A;  3GX0 A;  2L6D A;  1T1V A;  2RLI A;  1O73 A;  4JR6 A;  2DC5 A;  3ERW A;  2F51 A;  1AC1 A;  2LST A;  4BVY B;  4BWS A;  1GWC A;  5HR3 A;  1M2D A;  4G0K A;  3HD5 A;  5HR1 A;  1OC8 A;  4ECB A;  4WR5 A;  1EP7 A;  1XWB A;  4O5Q A;  5A4U A;  2H76 A;  3H79 A;  3HVV A;  4PX1 A;  1YKA A;  1THO A;  3Q6O A;  1XVW A;  1XOB A;  5DJM A;  3G7Y A;  2FA8 A;  3ZVJ D;  4ZBA A;  1V2A A;  2R3X A;  1O6J A;  1OE8 A;  2CAQ A;  3BCK A;  2ZNM A;  4KW6 A;  1X5C A;  3GUS A;  4MAB A;  5DAK A;  2P5Q A;  9GSS A;  2IPA A;  3G7J A;  2HRN A;  4K9Z A;  4KB3 A;  4EUY A;  3NOF A;  3R3E A;  4POK A;  2H8L A;  1SJI A;  4MH3 A;  4N10 A;  3EPT A;  5D96 A;  1TU8 A;  2F8A A;  1NHO A;  4MPG A;  1XWK A;  1LBK A;  1EP8 A;  3KCM A;  4K7O A;  2LJR A;  2RM5 A;  3FY7 A;  4XS6 A;  1ZGN A;  5DJL A;  4EIQ A;  2E2G A;  2OAC A;  1BJX A;  2AYT A;  4TVE A;  4V1A g;  3TUE A;  4J2F A;  3TRX A;  4IP6 A;  4JED A;  2VL3 A;  3GFK A;  3TJF A;  1GUH A;  5KN0 A;  4GRF A;  1DBY A;  1GTI A;  4V2N A;  1QFN A;  2NTO A;  4OWY A;  2CT6 A;  3N9J A;  3IK7 A;  2FHE A;  4IEL A;  3VI7 A;  3VWX A;  2I1U A;  2LV3 A;  4IHU A;  2LS5 A;  3SWL A;  1PKZ A;  2EIO A;  3L78 A;  3QOU A;  4WF5 A;  5JCU A;  1JZW A;  1V98 A;  4ZXG A;  5LNK e;  3MSZ A;  4POL A;  2E7P A;  4GWR A;  3CRT A;  1V58 A;  1PRX A;  3RDW A;  4MDC A;  2YCD A;  4POM A;  2E2M A;  4XS1 A;  2H0G A;  2MMZ A;  3FHK A;  3F63 A;  1F3A A;  3FZ5 A;  4MF6 A;  4WET A;  5E4W A;  4KDU A;  1F37 A;  3DGQ A;  3DVX A;  3IRA A;  4XTS A;  1GSD A;  3G7I A;  5HFG A;  1T4Y A;  3GST A;  2I3Y A;  3PPU A;  1M2B A;  1SK0 A;  1X5D A;  4HZ2 A;  3IBH A;  2CAI A;  2PU9 C;  5H5S A;  2I81 A;  1M9B A;  1FW1 A;  1GTB A;  3K8N A;  2F9S A;  4OO4 A;  3KH9 A;  3I6A A;  2DML A;  3ZLP A;  4QL7 A;  2WJU A;  2HSM A;  4RI6 A;  3RBT A;  4QL9 A;  1MDK A;  4GXZ A;  8GSS A;  1GTA A;  3LJR A;  1OYJ A;  3EVI A;  4MZB A;  4MPF A;  1Y6E A;  3DIE A;  2AAW A;  4PNG A;  2VAF A;  1WRY A;  4JZQ A;  19GS A;  3DXB A;  3F3R A;  5AIX A;  4KDX A;  4BL7 A;  5CRG A;  5G1L A;  4ZIJ A;  1YF0 A;  1AXD A;  1G7E A;  4PNF A;  3U5R E;  5E59 A;  1V57 A;  4ICY A;  5DAL A;  2PWJ A;  5IMC A;  6GSY A;  4PUF C;  3TCO A;  3US3 A;  3AY8 A;  1EGO A;  6GST A;  5J3R A;  3GHA A;  1YKC A;  1JHB A;  3IAS 2;  2FY6 A;  5IOX A;  2C4J A;  2HRK A;  5F8B A;  1T7P B;  4KA0 A;  4HUA A;  4IKH A;  4K2X A;  5GZZ B;  1PN0 A;  3ISO A;  3QAV A;  5L71 A;  2YOI A;  3TB2 A;  5CRW A;  4LL1 B;  1TKD B;  1SU9 A;  3VFI A;  4IS0 A;  3HJP A;  2QKE A;  5AGY A;  4PQ1 A;  4AGS A;  1J9B A;  5ECM B;  1PL2 A;  2C3T A;  2TRC P;  3KP9 A;  3DWV A;  2DKI A;  2WRT A;  2LTK A;  1UN2 A;  4KND A;  2HRA A;  4POB A;  5ECL B;  3DD3 A;  2H1A A;  4I6X A;  1O85 A;  3QCP A;  2V6O A;  11GS A;  1PA3 A;  4IGJ A;  4Z2T A;  1M99 A;  5ECK B;  4J56 E;  2QC7 A;  1ILO A;  3D22 A;  4I2T A;  1BX9 A;  4XRA A;  3A5I A;  3HKR A;  4FYU A;  4MMM A;  3GH9 A;  1G7O A;  3FR6 A;  4EDZ A;  2RUE A;  2I9H A;  2F3M A;  3HJM A;  4TXO A;  4K5R A;  4OCF A;  2M46 A;  4PTS A;  1TXX A;  1TP9 A;  1PX6 A;  3W8J A;  4YH2 A;  5ELA A;  5B8B A;  3EU4 A;  1HNB A;  2DJ1 A;  5G30 A;  4NHZ A;  5IOW A;  3HY2 A;  1DUG A;  2B7K A;  2JSY A;  3FZ4 A;  4LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...