1B4QA

Solution structure of human thioltransferase complex with glutathione
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
AQEFVNSKIQPGKVVVFIKPTCPYSRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDSIGGSSDLVSLQQSGELLTRLKQIGALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reactivity of the human thioltransferase (glutaredoxin) C7S, C25S, C78S, C82S mutant and NMR solution structure of its glutathionyl mixed disulfide intermediate reflect catalytic specificity.
pubmed doi rcsb
molecule keywords PROTEIN (HUMAN THIOLTRANSFERASE)
molecule tags Oxidoreductase
source organism Homo sapiens
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1b4qA00
3ED3A 5LCZA 4O32A 1K0MA 2IPAA 1X5EA 2VL2A 1PKWA 2R2JA 2H76A 4ECIA 5HR1A 3UBLA 1ML6A 1V58A 3FR9A 5J3RA 3FRCA 5ECSA 1YQ1A 4GSSA 1U6TA 3CTGA 1XOAA 3IOSA 3UJ1A 1GTAA 1EV4A 2P5RA 3D5JA 2OBIA 3IAM2 5B6NA 3IPZA 4FYCA 4XRDA 1K0OA 3TJJA 3P2AA 2WRTA 1XWGA 5COHA 5C04A 3DYRA 2MYGA 3C71A 4H86A 2GSTA 4FO5A 1B4QA 2H0HA 2V41A 2GZZA 1XWCA 3GL3A 6GSVA 3LYPA 1M9BA 1F3AA 2DLXA 3L4NA 5F06A 1G0TA 3VK9A 1S3AA 4I8BA 1K3LA 3M3MA 2YOIA 2MMAA 2XBIA 2B1KA 3QCPA 3W6GA 4WXTA 1K0DA 2C4JA 4TKYA 3WD6A 1FW1A 3A2XA 4YQMA 3VFIA 1TP9A 1GSYA 3CSJA 5ECRB 4ULXA 1XW5A 1TRWA 3DVXA 1E2YA 3GTUB 2REMA 3ZVJA 3GH6A 4O92A 3F3RA 1BQ7A 3RHBA 2R6KA 20GSA 3ZRDA 2L6DA 1TK0B 2OA7A 3ZL5A 5FT3A 4YQUA 1JZRA 2PWJA 1NM3A 3GTUA 4V2LA 4Q5QA 1M0UA 4HEA2 3ZVJD 2XHFA 5DAKB 4EF0A 4PUFC 2K18A 1EEMA 5AIXA 1UC7A 3D0ZA 4RQXA 1GULA 4GRFA 4AGSA 2FA8A 5KN1A 5ELGA 3O76A 1HNBA 3RHCA 5IMVA 3ZZXA 4WETA 2GDRA 2KLXA 4J2FA 7GSSA 2CVBA 4AJ6A 2C8UA 3QOUA 3F63A 5DJMA 2H0GA 2YV9A 2EIRA 2LEGA 2M72A 3D6IA 4Q5FA 2DBCA 2VAFA 2GZPA 1K3OA 3U5RE 2CX3A 3GFKA 4K0NA 1JFUA 2VLVA 3IRAA 3D4MA 3TKSC 2O87A 6GSTA 2EC4A 2VCXA 2JSYA 4IQ1A 1HNAA 4MDCA 5CYYA 1O7UA 2DJ0A 4WR4A 1TK8B 3ERGA 2LKUA 1F9MA 4ILFA 3D21A 3ZIVA 2CQ9A 1ZZYA 4POBA 3N9JA 4ID0A 5G2ZA 3W8JA 1XCCA 2HZFA 1F3BA 1TXXA 2E0QA 2IN3A 4MZWA 4DSRA 6GSYA 2FY6A 2FD3A 4KX4A 4RQRA 3KTLA 1G6WA 4YAVA 2VIMA 3EE2A 2E2GA 2DSAA 1NW2A 4D73B 4RI6A 2GT6A 2J9HA 1DUGA 4EC0A 1KTEA 2RUEA 5F8BA 3VLNA 5L71A 2H72A 4RUVA 1TTZA 1BG5A 4AJ8A 3CRTA 3P90A 1C72A 4D73A 2M80A 1MD3A 1Z5YE 1TOFA 1ZGNA 1XIYA 4V1Ag 2VLUA 2N5FA 1VF4A 3FZ9A 3KMOA 1YZXA 4LA1A 1GWCA 3F0IA 1A0FA 3KM6A 4IP6A 3BOAA 2H73A 2HNLA 2VM1A 3WGDA 3EU3A 1JHBA 3RPNA 3G9BA 4NPBA 1B8XA 1M2BA 2IMEA 3VI7A 1UA5A 3TKSE 1WWJA 1WOUA 1PKZA 3HVXA 3GMFA 4LLRA 2X8CA 4HZ4A 2P5QA 2AHEA 5DQSA 3TRXA 1V98A 1Z6MA 4GQCA 3IDVA 22GSA 4PNGA 2P31A 3BJ5A 5FWGA 2V6OA 4PNFA 4MMMA 4MZBA 1SYRA 5DDLA 2JZRA 4J56E 2MMZA 3F9UA 2C3NA 1AW9A 4GLTA 1HYUA 1XW6A 3APQA 1JLVA 2OE1A 2HYXA 2IWTA 2OADA 2XC2A 3L9UA 3E3EA 2LNSA 1KBNA 3NIVA 1GNEA 2GT5A 3GX0A 5A4WA 1OC8A 4YAPA 1YEPA 2LRTA 3GX8A 4HOJA 2L59A 3DRNA 3ZTLA 3TUEA 1T8EB 2A2RA 4ZB6A 1RQMA 2WULA 1OC9A 2R4VA 2MZCA 2RUFA 3KEBA 2TRCP 4OD7A 2I3YA 3GH9A 4KCEA 3BD2A 3NOFA 4I97A 3TJBA 5A4UA 6GSSA 5B6MA 4KGIA 3GIXA 1YF1A 2YV7A 4ZIJA 3FZ5A 2JADA 4E8HA 1GSQA 4WKWA 3G7JA 1TW9A 2PMTA 4MJAA 3PH9A 2YCDA 2V2GA 2IJYA 3VPQA 2V6KA 5DJLA 1OE8A 2FCHA 1SD9A 2CV4A 2CVKA 3GV1A 3UEMA 4E8EA 1M2DA 3GURA 5ENUA 4MA9A 4K7OA 4JBBA 3TGZA 2VL9A 4IKHA 3KH7A 3QPMA 2DJKA 2H8LA 3ISOA 4OWYA 1ZOFA 2WS2A 4NHWA 6GSWA 3ZYWA 2F8AA 1EOGA 1FB0A 1M2AA 4OFTA 4EO3A 4DSSB 3LGCA 1FG4A 3LSZA 1Q98A 5HR2A 3GSSA 3RAZA 4MF7A 5CRHA 5IQYA 2C3TA 2J23A 3P8WA 4HS1A 3LQ7A 3TB2A 4MF6A 1M9AA 2IMKA 1CQHA 3A2VA 1YKCA 2HXKA 1KEBA 1OKDA 1HNCA 4NV5A 3WGXA 5A4VA 3WT2A 5D8IA 4K8MA 1BAYA 5IIZA 4DEJA 3BBYA 1GSEA 2L4CA 3MDKA 1ERTA 2VOCA 2B7JA 5GSSA 3FR3A 1U87A 4GXZA 1SL0B 3N5OA 1BJXA 5LD0A 1GSUA 3O3TA 4F0BA 4KNDA 4CHSA 2VCQA 5E59A 5AN1A 1VF1A 5G1KA 1S3CA 1DSBA 5F05A 2R3XA 3H1NA 1PX7A 3EMXA 4HZ2A 5DALA 4N0ZA 2CT6A 1Z7PA 5LNKe 4IP1A 3QAVA 5B8BA 1FB6A 1RK4A 3FW2A 2H6XA 5ABRA 3KD0A 3EMPA 5ID2B 1I5GA 1QXHA 4XS1A 2LNTA 5IPHA 1OC3A 2N5BA 4JE1A 3GN3A 3DXBA 3C8EA 4EDZA 4EXJA 2QGVA 5ID2A 1AIUA 2EIOA 1AUCA 4HU9A 3M9JA 2MMNA 5D9WA 2PPTA 3DD3A 3KH9A 4MCUA 5CRDA 1PA3A 1TK5B 1F37A 1SJIA 1WP0A 2CX4A 1X9WB 2LJKA 4Q5RA 3PR8A 4Q5NA 1URMA 2FWGA 4IGJA 2VM2A 3WGEA 3HXSA 3VWVA 4LL1B 5J5NA 1A2JA 2O7KA 2KOKA 3DWVA 4FIWA 1VGLA 1N2AA 2B5YA 2X8GA 4HQZA 4WEYA 3TJGA 3GKNA 5G5FA 2PUKC 4BWQA 4OCFA 2OBKA 3CBUA 4ZILA 4KDYA 3G7YA 4MJCA 1ZL9A 2F51A 1B9XC 5J41A 2VCTA 2JZTA 4HUAA 2JACA 2B6MA 1TI1A 1SENA 2QC7A 2G0FA 5ECMB 1FVJA 5J9BA 4OFNA 3KP9A 1AQXA 4AF2A 5DCHA 3UIWA 4QQ7A 1GTUA 2FUG2 2B5EA 4F82A 1TKDB 3HVSA 2C0GA 3TDGA 4OO5A 3QD9A 2GSSA 3ZMKA 3ZITA 4PXOA 1AAZA 4JZQA 3US3A 2H74A 1OVNA 1U3AA 2IL3A 4CW9A 1EP8A 1GP1A 4OFMA 1Q4JA 1MTCA 2JL4A 1R5AA 1DBYA 2WGRA 3I9V2 1SD8A 3HA9A 1X5DA 2LSTA 1K3YA 1PQNA 1O73A 3DVWA 3GA4A 4TW5A 1X5CA 5B8AA 3P7XA 4LMVA 1ON4A 1Z3EA 2YWMA 2K9FA 1RW1A 4JR4A 1XWBA 3GUSA 1IYHA 2B3SA 5IMZA 2RM5A 4OCEA 3LXTA 4ACSA 1FO5A 2K6VA 4FYBA 3UL3A 3CMIA 3APOA 1QK8A 3FY7A 3BCIA 3J7Yb 3NZNA 2WZ9A 5GAND 4IQAA 1A24A 4V2MA 3LYKA 3ZLPA 2F8FA 1S3DA 1X9MB 1WIKA 2LV3A 4ZBBA 2CZ2A 4HU7A 3IHQA 4X1UA 3TRPA 2KP1A 2HZEA 4EKZA 5JWRB 2LQQA 4MF5A 5HR0A 4F0CA 1F6MC 5CRGA 5CO3A 2VCWA 8GSSA 2VL2C 4JRRA 1EEJA 5CRWA 4N0VA 5G5EA 3HJMA 2AYTA 2PN8A 2H0IA 4K9ZA 2A4VA 1UVZA 3QAWA 1SYXA 5ECKB 1A23A 3F3QA 4L5LA 4I2TA 1WJKA 5FHIA 3FZ4A 2YWIA 3GKXA 5ELAA 2DJJA 3MWHA 4IELA 1MD4A 2B1LA 4F9ZA 4IW9A 3E0UA 4YQVA 2KUCA 2NTOA 3QMXA 2GZYA 3EVIA 3Q18A 5AGYA 3LEFA 2A2SA 4ZB8A 5KN3A 4N11A 2V1MA 4DSQA 1PMTA 4I6XA 1AXDA 4BA7A 2XPDA 2FWHA 4X0XA 3EINA 4HQSA 2H71A 2YWNA 2H6ZA 2TIRA 5HQPA 19GSA 4F2IA 4KDXA 3GYKA 1K0BA 5DCGA 2I81A 4TRXA 1WMJA 3KGKA 3UAPA 2RIIA 3KCMA 3IXRA 5D73A 3I6AA 4BPYA 4PURA 4WBJA 3H93A 2FGXA 2GQMA 3VPTA 4IS0A 2CA8A 3HDCA 2AB6A 2VD1A 1ZYEA 1QQ2A 4XIHA 4CDOA 1GLQA 3L78A 4PX1A 4MJEA 2HFDA 3I43A 3HHVA 4TXVA 1K0CA 5D93A 1YDKA 4HI7A 1OC9B 3F4TA 5HFIA 2H1GA 1CQGA 4ML6A 1EGOA 2PU9C 1O8WA 5GSTA 3FYGA 2ES7A 4YH2A 5J9CA 1R5PA 1T3BA 3G7IA 5ECOB 2H19A 3RDWA 4N30A 4L0WA 1ERWA 2KP2A 3ZFLA 2GS3A 1A2LA 1ZYQB 1G6YA 5GAPD 4KDUA 3FKFA 2P0GA 2PERA 2IMIA 1GRXA 3KZQA 2ON5A 2VD0A 5H5SA 1E6BA 3W8SA 2E2MA 2YJHA 4I5QA 1BX9A 1FVKA 1SJ6A 2IMFA 2PVQA 4XTSA 1T00A 5ECNB 3Q19A 2HLSA 3TJKA 3UMAA 4WF4A 1PSQA 2VL3A 5INYA 2WB9A 4ECCA 1WE0A 4TR0A 1XVWA 3SWLA 1UN2A 4TR1A 2HT9A 2L4QA 4XS4A 3FZAA 3KXOA 1QFNA 1XZOA 1A8YA 3FEUA 4N10A 4IBPA 3LFLA 1YJ6A 1TI3A 3GL5A 3MNGA 4NXIA 1EWXA 2AUVA 2JSZA 3H8QA 4V1Ap 1HD2A 3ERFA 2FNOA 4PUAA 5G31A 4KSOA 1G7OA 2I4AA 1K0AA 3IA1A 1X9SB 2I1UA 3ME7A 1HQOA 2AJQB 2H1AA 2YZUA 1XFLA 1XOBA 3QAGA 2HSHA 1QUWA 1W89A 5IMCA 4BVYA 4EDYA 4G9HA 5F07A 2BJXA 1JLWA 5CREA 2OACA 4V2NA 4KSMA 5DBQA 2BMXA 5E4WA 3HCZA 3VURA 1PN9A 1YEXA 2DMLA 2F3MA 5DALB 3GSTA 4ZBAA 5EL8A 3EURA 3PINA 4KUNA 3M8NA 4TVEA 1BYEA 4KCAA 14GSA 1ERUA 4NAXA 4DVCA 2X8HA 4MH3A 2YPMA 6GSXA 1Y25A 1EZKA 6GSUA 2CAQA 5IPGA 3KIJA 2ZCTA 4OO4A 3JCML 3TKSA 3GKMA 2FHEA 2X99A 3QR6A 4KAEA 3RBTA 5IMDA 2IFQB 4RI7A 4ISDA 2F9SA 2ON7A 2LJRA 4ZL8A 1BEDA 5CNWA 4KH7A 1USBA 1PX6A 3D4TA 1TRSA 2BTOT 4TXOB 5DQYA 3C1RA 5EPFA 1LBKA 1T7PB 5J4UA 4PGTA 2IFQA 3GKKA 1Z9HA 2K8SA 2WFCA 2GSRA 2WCIA 3S9FA 3ERWA 4G10A 3J7Yk 3TKQA 3M0FA 4TXOA 5AIVA 1GNWA 2YZHA 1LJRA 1J0FA 1M99A 1XWKA 5B7CA 1WPIA 1GH2A 2HRNA 3L9SA 3LG6A 1ZCPA 4GWRA 1VF2A 1PD21 3UBKA 5CP1A 1FAAA 3F4SA 3IR4A 5IMFA 3FR6A 4K7NA 2MBSA 3KMNA 3LORA 4HJMA 4NWYA 1MDIA 3TKRA 3IK9A 2MBTA 3OR5A 1GL8A 3RPPA 4XCSA 5KN0A 10GSA 3UVHA 4EVMA 4GSTA 1W4VA 1FHEA 16GSA 5KEJA 1MDKA 1ERVA 2DIZA 5IO2A 2R37A 3I69A 4JR6A 5A5KA 2GQKA 4GF0A 2VUPA 3HJOA 1EOHA 4L8EA 2YANA 1U3IA 1I9DA 4LL4B 3M1GA 4XHMA 3U6VA 5JCWA 3IK7A 1GSFA 2GLRA 1Z6NA 4MP4A 1A8LA 1FOVA 3SBCA 2LJAA 2QKEA 2YWOA 4G19A 1KNGA 1GLPA 4NHZA 1PRXA 1SKSB 3HVVA 1GUKA 1QMVA 2XPEA 1ACVA 4BVXA 4L0UA 4MZCA 3VWWA 4O7HA 1OKTA 3DKSA 1R4WA 1GUHA 1SU9A 5KN2A 1H75A 1M7TA 9GSSA 4ECBA 3ME8A 5D9VA 3Q74A 1XVQA 4AJ7A 5DAKA 1SKWB 3UOMA 5JWQB 2FLSA 2C0FA 11GSA 3TKPA 3VWUA 2VLTA 4WR5A 2YN1A 3TOUA 1ILOA 1J08A 1Y6EA 2EIQA 1IYIA 3Q6OA 3FHKA 1B9YC 5CAXA 3ZFBA 3IV4A 4K0GA 5ECLB 3K8NA 4K2DA 3GRXA 4GSNA 2HZEB 1ST9A 4OMVA 3GNJA 4ML1A 13GSA 2HE3A 3DEXA 5JCGA 4XRAA 4NV2A 3L0HA 4QL9A 2YP6A 2O85A 4L5OA 1SK1A 2HRFA 2JU5A 5H5QA 5C00A 4TOPA 3EC3A 4TN8A 5HFGA 3ZMLA 1O81A 1U88A 1B48A 2NVLA 1TRVA 1XWAA 3QFBC 2WDUA 5IO0A 2D2ZA 3A2WA 2TRXA 3TJFA 4ECJA 1PL1A 4MJBA 2C1YA 2LRNA 3EYTA 3A3TA 3TOTA 4GCIA 3L9VA 2O89A 2LS5A 2LRCA 4PQIA 1PGTA 1XPVA 4WF5A 1R7HA 4FYUA 5ECHB 1F2EA 5D96A 1XBSA 2O8VB 2N5AA 2IIYA 1H4OA 4PQ1A 1VRSD 2H75A 2OKAA 2H1BA 2WJUA 2K8VA 4LMWA 4IN0A 1Z7RA 5D9XA 1TU7A 3TRQA 2HSYA 2L5LA 4PQHA 1NSWA 2KHPA 5DVBA 2NBSA 3F4RA 5EVOA 1OE7A 1MDJA 4TR4A 1TRUA 3LXZA 1SL2B 3F6DA 3HYPA 1O8XA 2OE0A 3KP8A 1X0RA 2YJ7A 1GSDA 2PVOC 2M46A 1AQWA 4ZB9A 2E7PA 3HD5A 3HKRA 5HR3A 1A0RP 1G7EA 4MABA 2ALBA 3A5WA 1B4PA 3QDNA 4MH2A 1T4ZA 1JZDA 2QSIA 1V9WA 1VF3A 4MLYA 1SKRB 2C0EA 4EL1A 2LQOA 2MMOA 17GSA 4IHUA 1LU4A 4KE3A 4POLA 1O85A 3C73A 3MAKA 3IAS2 4KA0A 4ZBDA 2FWFA 5AISA 3IBHA 2VCVA 2RM6A 2NPBA 3HJPA 2JZSA 2AV4A 4MK3A 4WBRD 3EWLA 5IOWA 3O6TA 4JU5A 4EUYA 1V40A 3H4KA 4IVFA 3KTBA 1SJZA 4FH8A 4Z7XA 2DJ2A 3C1SA 2GGTA 2H1DA 1T4YA 2Z9SA 2H30A 3CXGA 2G2QA 3HY2A 2C3QA 3E9JB 1JZWA 1T1VA 4F03A 4I2UA 1OYJA 1ABAA 2DJ3A 2B7KA 4J57E 2ZUPA 4ZL9A 1XXUA 3DIEA 2X64A 3PGTA 2IMDA 5ECIB 2CZ3A 2C0DA 2DC5A 1GTIA 4TR1B 3TCOA 4XS4B 2GSQA 1DE1A 2HI7A 3UVTA 2I9HA 3CRUA 4BL7A 3HZ8A 1EGRA 4K1FA 1GTBA 3UARA 2FWEA 1EP7A 2CAIA 3AY8A 4X43A 1SL1B 3IC4A 1K0NA 3IE3A 3VI5A 4ZL7A 2V32A 3H79A 1PL2A 2H6YA 1O6JA 4JEDA 1V57A 2OJLA 2GVPA 1QGVA 5ECQB 3FK8A 4O5RA 4GQFA 3LWAA 2GQLA 2OE3A 5G30A 5F0GA 2C80A 2XBQA 4MPGA 1R26A 3BCKA 5H5RA 2VO4A 3DMLA 2DJ1A 2DMMA 5JWOB 2R5GA 4IJIA 3M9KA 2L57A 4DSSA 1MEKA 1XW9A 2LUSA 2PGTA 5HFKA 3R2QA 5D9TA 12GSA 1SK0A 2CVDA 3GHAA 4HDEA 1JZOA 2L6CA 4G2EA 4TR3A 2LTKA 1YY7A 2GTUA 3KJYA 3CYNA 2H66A 1YF0A 1TU8A 3ZREA 3QFAC 4ZXGA 1NHOA 4EE0A 1EV9A 4XS6A 2FA4A 5IMAA 2H70A 5EY6A 18GSA 2NDOA 3CSHA 3CTFA 2VCZA 4QL7A 3WT1A 2DIYA 5GZZB 2YNXA 1GUMA 3LJRA 4IJ3A 3D22A 3CSIA 5IM9A 1GSSA 5IOXA 2PBJA 2H01A 1V2AA 1ZMAA 5JCUA 3F6FA 2L5OA 4POKA 1DE2A 1WRYA 3HZ4A 1OAZA 1TDIA 4K7IA 4P3YB 1YKAA 3ZIJA 1NHYA 2RLIA 3V1WA 5ECPB 1SK2A 1AC1A 3APSA 1N8JA 4GTUA 3WYWA 4K6XA 4MPFA 2B5XA 3MSZA 4NMUA 3C7MA 4KB3A 4POMA 2ZNMA 1THXA 1A2MA 2AAWA 4BWSA 3VWXA 3DGQA 1THOA 3EU4A 1TJDA 4HJ2A 1J9BA 5G1LA 3F8UA 4KW6A 1AQVA
chains in the Genus database with same CATH superfamily
4G0KA 3ED3A 5LCZA 4O32A 1K0MA 2IPAA 1X5EA 2VL2A 1PKWA 2R2JA 2H76A 4ECIA 5HR1A 3UBLA 1ML6A 1V58A 3FR9A 5J3RA 3FRCA 5ECSA 1YQ1A 4GSSA 1U6TA 3CTGA 1XOAA 3IOSA 3UJ1A 1GTAA 1EV4A 2P5RA 3D5JA 2OBIA 3IAM2 5B6NA 3IPZA 4FYCA 4XRDA 1K0OA 3TJJA 3P2AA 2WRTA 1XWGA 5COHA 5C04A 3DYRA 2MYGA 3C71A 4H86A 2GSTA 4FO5A 1B4QA 2H0HA 2V41A 2GZZA 1XWCA 3GL3A 6GSVA 3LYPA 1M9BA 1F3AA 2DLXA 3L4NA 5F06A 1G0TA 3VK9A 1S3AA 4I8BA 1K3LA 3M3MA 2YOIA 1M3IA 2MMAA 2XBIA 2B1KA 3QCPA 4YKFA 3W6GA 4WXTA 1K0DA 2C4JA 4TKYA 3WD6A 1FW1A 3A2XA 4YQMA 3VFIA 1TP9A 2DKIA 1GSYA 3CSJA 5ECRB 4ULXA 1XW5A 1TRWA 3DVXA 1E2YA 3GTUB 2REMA 3ZVJA 3GH6A 4O92A 3F3RA 1BQ7A 3RHBA 2R6KA 20GSA 3ZRDA 2L6DA 1TK0B 2OA7A 3ZL5A 5FT3A 4YQUA 1JZRA 2PWJA 1NM3A 3GTUA 4V2LA 4Q5QA 1M0UA 3LW9A 4HEA2 3ZVJD 2XHFA 5DAKB 4EF0A 4PUFC 2K18A 1EEMA 5AIXA 1UC7A 3D0ZA 4RQXA 1GULA 4GRFA 4AGSA 2FA8A 5KN1A 5ELGA 3O76A 1HNBA 3RHCA 5IMVA 3ZZXA 4WETA 2GDRA 2KLXA 4J2FA 7GSSA 2CVBA 4AJ6A 2C8UA 3QOUA 3F63A 5DJMA 2H0GA 2YV9A 2EIRA 2LEGA 2M72A 3D6IA 4Q5FA 2DBCA 2VAFA 2GZPA 1K3OA 2DKHA 3U5RE 4YKGA 2CX3A 3GFKA 4K0NA 1JFUA 2VLVA 3IRAA 3D4MA 3TKSC 2O87A 6GSTA 2EC4A 2VCXA 2JSYA 4HSCX 4IQ1A 1HNAA 4MDCA 5CYYA 1O7UA 2DJ0A 3HVNA 1S3RA 4WR4A 1TK8B 3ERGA 2LKUA 1F9MA 4ILFA 3D21A 3ZIVA 2CQ9A 1ZZYA 4POBA 3N9JA 4ID0A 5G2ZA 3W8JA 1XCCA 2HZFA 1F3BA 1TXXA 2E0QA 2IN3A 4MZWA 4DSRA 6GSYA 2FY6A 2FD3A 4KX4A 4RQRA 3KTLA 1G6WA 4YAVA 2VIMA 3EE2A 2E2GA 2DSAA 1NW2A 4D73B 4RI6A 2GT6A 2J9HA 1DUGA 4EC0A 1KTEA 2RUEA 5F8BA 3VLNA 5L71A 2H72A 4RUVA 1TTZA 1BG5A 4AJ8A 3CRTA 3P90A 1C72A 4D73A 2M80A 1MD3A 1Z5YE 1TOFA 1ZGNA 1XIYA 5BRTA 4V1Ag 2VLUA 2N5FA 1VF4A 3FZ9A 3KMOA 1YZXA 4LA1A 1GWCA 3F0IA 1A0FA 3KM6A 1PN0A 4IP6A 3BOAA 2H73A 2HNLA 2VM1A 3WGDA 3EU3A 1JHBA 3RPNA 3G9BA 4NPBA 1B8XA 1M2BA 2IMEA 3VI7A 1UA5A 3TKSE 1WWJA 1WOUA 1PKZA 3HVXA 3GMFA 4LLRA 2X8CA 4HZ4A 2P5QA 2AHEA 5DQSA 3TRXA 1V98A 1Z6MA 4GQCA 3IDVA 22GSA 4PNGA 2P31A 3BJ5A 5FWGA 2V6OA 4PNFA 4MMMA 4MZBA 1SYRA 5DDLA 2JZRA 4J56E 2MMZA 3F9UA 2C3NA 1AW9A 4GLTA 1HYUA 4K5RA 2UZ8A 1XW6A 3APQA 1JLVA 2OE1A 2HYXA 2IWTA 2OADA 2XC2A 3L9UA 3E3EA 2LNSA 2X4AA 1KBNA 3NIVA 1GNEA 2GT5A 3GX0A 5A4WA 1OC8A 4YAPA 1YEPA 2LRTA 3GX8A 4HOJA 2L59A 3DRNA 3ZTLA 3TUEA 1T8EB 2A2RA 4ZB6A 1RQMA 2WULA 1OC9A 2R4VA 2MZCA 2RUFA 3KEBA 2TRCP 4OD7A 2I3YA 3GH9A 4KCEA 3BD2A 3NOFA 4I97A 3TJBA 5A4UA 6GSSA 5B6MA 4KGIA 3GIXA 1YF1A 2YV7A 4ZIJA 3FZ5A 2JADA 4E8HA 1GSQA 4WKWA 3G7JA 1TW9A 2PMTA 4MJAA 3PH9A 2YCDA 2V2GA 2IJYA 4USSA 3VPQA 2V6KA 5DJLA 1OE8A 2FCHA 1SD9A 2CV4A 2CVKA 3GV1A 3UEMA 4E8EA 1M2DA 3GURA 5ENUA 4MA9A 4K7OA 4JBBA 3TGZA 2VL9A 4IKHA 3KH7A 3QPMA 2DJKA 2H8LA 3ISOA 4OWYA 1ZOFA 2WS2A 4NHWA 6GSWA 3ZYWA 4PTSA 2F8AA 1EOGA 1FB0A 1M2AA 4OFTA 4EO3A 4DSSB 3LGCA 1FG4A 3LSZA 1Q98A 5HR2A 3GSSA 3RAZA 4MF7A 5CRHA 5IQYA 2C3TA 2J23A 3P8WA 4HS1A 3LQ7A 3TB2A 4MF6A 1M9AA 2IMKA 1CQHA 3A2VA 1YKCA 2HXKA 1KEBA 4G0IA 1OKDA 1HNCA 4NV5A 3WGXA 5A4VA 3WT2A 5D8IA 4K8MA 1BAYA 1ZYNA 5IIZA 4DEJA 3BBYA 1GSEA 2L4CA 3MDKA 1ERTA 2VOCA 2B7JA 5GSSA 3FR3A 1U87A 4GXZA 1SL0B 3N5OA 1BJXA 5LD0A 1GSUA 3O3TA 4F0BA 4KNDA 4CHSA 2VCQA 5E59A 5AN1A 1VF1A 1XG8A 5G1KA 1S3CA 1DSBA 5F05A 2R3XA 3H1NA 1PX7A 3EMXA 4HZ2A 2A4HA 5DALA 4N0ZA 2CT6A 1Z7PA 5LNKe 4IP1A 3QAVA 5B8BA 1FB6A 1RK4A 3FW2A 2H6XA 5ABRA 3KD0A 3EMPA 5ID2B 1I5GA 1QXHA 4XS1A 2LNTA 5IPHA 1OC3A 2N5BA 4JE1A 3GN3A 3DXBA 3C8EA 4EDZA 4EXJA 2QGVA 5ID2A 1AIUA 2EIOA 1AUCA 4HU9A 3M9JA 2MMNA 4ICYA 5D9WA 2PPTA 3DD3A 3KH9A 4MCUA 5CRDA 1PA3A 1TK5B 1F37A 1SJIA 1WP0A 2CX4A 1X9WB 2LJKA 4Q5RA 3PR8A 4Q5NA 1URMA 2FWGA 4IGJA 4A5PA 2VM2A 3WGEA 3HXSA 3VWVA 4LL1B 5J5NA 1A2JA 2O7KA 2KOKA 3DWVA 4FIWA 1VGLA 1N2AA 2B5YA 2X8GA 4HQZA 4WEYA 3TJGA 3GKNA 5G5FA 2PUKC 4BWQA 4OCFA 2OBKA 3CBUA 4ZILA 4KDYA 3G7YA 4MJCA 1ZL9A 2F51A 1B9XC 5J41A 2VCTA 2JZTA 4HUAA 2JACA 2B6MA 1TI1A 1SENA 2QC7A 2G0FA 5ECMB 1FVJA 5J9BA 4OFNA 3KP9A 1AQXA 4AF2A 5DCHA 3UIWA 4QQ7A 1GTUA 2FUG2 2B5EA 4F82A 1TKDB 3HVSA 2C0GA 3TDGA 4OO5A 3QD9A 2X49A 2GSSA 3ZMKA 3ZITA 4PXOA 1AAZA 4JZQA 3US3A 2H74A 1OVNA 1U3AA 2IL3A 4CW9A 1EP8A 1GP1A 4OFMA 1Q4JA 1MTCA 2JL4A 1R5AA 1DBYA 2WGRA 3I9V2 1SD8A 3HA9A 1X5DA 2LSTA 1K3YA 1PQNA 1O73A 3DVWA 3GA4A 4TW5A 1X5CA 5B8AA 3P7XA 4LMVA 1ON4A 5BMUA 1Z3EA 2YWMA 2K9FA 1RW1A 4JR4A 1XWBA 3GUSA 1IYHA 2B3SA 5IMZA 2RM5A 3IC8A 4OCEA 3LXTA 2HRAA 4ACSA 1FO5A 2K6VA 4FYBA 3UL3A 3EPTA 3CMIA 3APOA 1QK8A 3FY7A 3BCIA 3J7Yb 3NZNA 2WZ9A 5GAND 4IQAA 1A24A 4V2MA 3LYKA 3ZLPA 2F8FA 1S3DA 1X9MB 1WIKA 2LV3A 4ZBBA 3PPUA 2CZ2A 4HU7A 3IHQA 4X1UA 3TRPA 2KP1A 2HZEA 4EKZA 5JWRB 2LQQA 4MF5A 5HR0A 4F0CA 1F6MC 5CRGA 5CO3A 2VCWA 8GSSA 2VL2C 4JRRA 1EEJA 5CRWA 4N0VA 5G5EA 3HJMA 2AYTA 2PN8A 2H0IA 4K9ZA 2A4VA 1UVZA 3QAWA 1SYXA 5ECKB 1A23A 3F3QA 4L5LA 4I2TA 1WJKA 5FHIA 3FZ4A 2YWIA 3GKXA 5ELAA 2DJJA 3MWHA 4IELA 1MD4A 1ZYPA 2B1LA 4F9ZA 4IW9A 4X4JA 3E0UA 4YQVA 2KUCA 2NTOA 3QMXA 2GZYA 3EVIA 3Q18A 5AGYA 3LEFA 2A2SA 4ZB8A 5KN3A 4N11A 2V1MA 4DSQA 5KOXA 1PMTA 4I6XA 1AXDA 4BA7A 4Z2TA 2XPDA 2FWHA 4X0XA 3EINA 4HQSA 2H71A 2YWNA 2H6ZA 2TIRA 5HQPA 19GSA 3A5IA 4F2IA 4KDXA 3GYKA 1K0BA 5DCGA 2I81A 4TRXA 1WMJA 3KGKA 3UAPA 2RIIA 3KCMA 3IXRA 5D73A 3I6AA 4BPYA 4PURA 4WBJA 3H93A 2FGXA 2GQMA 3VPTA 4IS0A 2CA8A 3HDCA 2AB6A 2VD1A 1ZYEA 1QQ2A 4XIHA 4CDOA 1GLQA 3L78A 4PX1A 4MJEA 2HFDA 3I43A 3HHVA 4TXVA 1K0CA 5D93A 1YDKA 4HI7A 1OC9B 3F4TA 5HFIA 2H1GA 1CQGA 4ML6A 1EGOA 2PU9C 1O8WA 5GSTA 3FYGA 2ES7A 4YH2A 5J9CA 3CQFA 1R5PA 1T3BA 3G7IA 5ECOB 2H19A 3RDWA 4N30A 1FOHA 4L0WA 1ERWA 4K5SA 2KP2A 3ZFLA 2GS3A 1A2LA 1ZYQB 1G6YA 5GAPD 4KDUA 3FKFA 2P0GA 2PERA 2IMIA 4MNNA 1GRXA 3KZQA 2ON5A 2VD0A 5H5SA 1E6BA 3W8SA 2E2MA 2YJHA 4I5QA 1BX9A 1FVKA 1SJ6A 2IMFA 2PVQA 4XTSA 4CY8A 1T00A 5ECNB 3Q19A 2HLSA 3TJKA 3UMAA 4WF4A 1PSQA 2VL3A 5INYA 2WB9A 4ECCA 1WE0A 4TR0A 1XVWA 3SWLA 1UN2A 4TR1A 2HT9A 2L4QA 4XS4A 3FZAA 3KXOA 1QFNA 1XZOA 1A8YA 3FEUA 4N10A 4IBPA 3LFLA 1YJ6A 1TI3A 3GL5A 3MNGA 4NXIA 1EWXA 2AUVA 2JSZA 3H8QA 4V1Ap 1HD2A 3ERFA 2FNOA 4PUAA 5G31A 4KSOA 4BVYB 1G7OA 2I4AA 1K0AA 3IA1A 1X9SB 2I1UA 3ME7A 1HQOA 2AJQB 2H1AA 2YZUA 1XFLA 1XOBA 3QAGA 2HSHA 1QUWA 1W89A 5IMCA 4BVYA 4EDYA 4G9HA 5F07A 2BJXA 1JLWA 5CREA 2OACA 4V2NA 4KSMA 5DBQA 1PFOA 2BMXA 5E4WA 3HCZA 3VURA 1PN9A 1YEXA 2DMLA 2F3MA 5DALB 4O5QA 3GSTA 4ZBAA 5EL8A 3EURA 3PINA 4KUNA 3M8NA 4TVEA 1BYEA 4KCAA 14GSA 1ERUA 4NAXA 4DVCA 3IHGA 2X8HA 4MH3A 2YPMA 6GSXA 1Y25A 1EZKA 6GSUA 2CAQA 5IPGA 3KIJA 2ZCTA 4OO4A 3JCML 3TKSA 3GKMA 2FHEA 2X99A 3QR6A 4KAEA 3RBTA 5IMDA 2IFQB 4RI7A 4ISDA 2F9SA 2ON7A 2LJRA 4ZL8A 1BEDA 5CNWA 4KH7A 1USBA 1PX6A 3D4TA 4KF9A 1TRSA 2BTOT 4TXOB 5DQYA 3C1RA 5EPFA 1LBKA 1T7PB 5J4UA 4PGTA 2IFQA 3GKKA 1Z9HA 2K8SA 2WFCA 2GSRA 2WCIA 3S9FA 3ERWA 4G10A 3J7Yk 3TKQA 3M0FA 4TXOA 5AIVA 1GNWA 2YZHA 1LJRA 1J0FA 1M99A 1XWKA 5B7CA 1WPIA 1GH2A 2HRNA 3L9SA 3LG6A 1ZCPA 4GWRA 1VF2A 1PD21 3UBKA 5CP1A 1FAAA 3F4SA 3IR4A 5IMFA 3FR6A 4K7NA 3MIXA 2MBSA 3KMNA 3LORA 4HJMA 4NWYA 1MDIA 3TKRA 3IK9A 2MBTA 3OR5A 4O5UA 1GL8A 3RPPA 4XCSA 5KN0A 10GSA 3UVHA 4EVMA 4GSTA 1W4VA 1FHEA 16GSA 5KEJA 1MDKA 1ERVA 2DIZA 5IO2A 2R37A 3I69A 4JR6A 5A5KA 2GQKA 4GF0A 2VUPA 3HJOA 1EOHA 4L8EA 2YANA 1U3IA 1I9DA 4LL4B 3M1GA 4XHMA 3U6VA 5JCWA 3IK7A 1GSFA 2GLRA 1Z6NA 4MP4A 1A8LA 1FOVA 4G0LA 3SBCA 2LJAA 2QKEA 4EIPA 2YWOA 4BVXB 4G19A 1KNGA 1GLPA 4EIQA 4NHZA 1PRXA 1SKSB 3HVVA 1GUKA 1QMVA 2XPEA 1ACVA 4BVXA 4Z2UA 4L0UA 4MZCA 3VWWA 4O7HA 1OKTA 3DKSA 1R4WA 1GUHA 4BIKA 1SU9A 5KN2A 1H75A 1M7TA 9GSSA 4ECBA 3ME8A 5D9VA 3Q74A 1XVQA 4AJ7A 5DAKA 1SKWB 3UOMA 5JWQB 2FLSA 3R3EA 2C0FA 11GSA 3TKPA 3VWUA 2VLTA 4WR5A 2YN1A 3TOUA 1ILOA 1J08A 1Y6EA 2EIQA 1IYIA 4FQUA 3Q6OA 3FHKA 1B9YC 5CAXA 3ZFBA 2QA2A 3IV4A 4K0GA 5ECLB 3K8NA 4K2DA 3GRXA 4GSNA 2HZEB 2R0CA 1ST9A 4OMVA 3GNJA 4ML1A 13GSA 2R0PA 2HE3A 3DEXA 5JCGA 4XRAA 4NV2A 3L0HA 4QL9A 2YP6A 2O85A 4L5OA 1SK1A 2HRFA 2JU5A 5H5QA 5C00A 4TOPA 3EC3A 4TN8A 5HFGA 3ZMLA 1O81A 1U88A 1B48A 2NVLA 1TRVA 1XWAA 3QFBC 2WDUA 5IO0A 2D2ZA 3A2WA 2TRXA 3TJFA 4ECJA 1PL1A 4MJBA 2C1YA 2LRNA 3EYTA 3A3TA 3TOTA 4GCIA 3L9VA 3MYDA 2O89A 2LS5A 2LRCA 4PQIA 1PGTA 1XPVA 4WF5A 1R7HA 4FYUA 5ECHB 1F2EA 5D96A 1XBSA 2O8VB 2N5AA 2IIYA 1H4OA 4PQ1A 1VRSD 2H75A 2OKAA 2H1BA 2WJUA 2K8VA 4LMWA 4IN0A 4Z2RA 1Z7RA 5D9XA 1TU7A 3TRQA 2HSYA 2L5LA 4PQHA 1NSWA 2KHPA 5DVBA 2NBSA 3F4RA 5EVOA 1OE7A 1MDJA 4TR4A 2R0GA 1TRUA 3LXZA 1SL2B 3F6DA 3HYPA 1O8XA 2OE0A 5KOWA 3KP8A 1X0RA 2YJ7A 1GSDA 2PVOC 2M46A 1AQWA 4ZB9A 2E7PA 3HD5A 3HKRA 5HR3A 1A0RP 1G7EA 4MABA 2ALBA 3A5WA 1B4PA 3QDNA 4MH2A 1T4ZA 1JZDA 2HSMA 2QSIA 1V9WA 1VF3A 4MLYA 1SKRB 2C0EA 4EL1A 2LQOA 2MMOA 17GSA 4IHUA 1LU4A 4KE3A 4POLA 1O85A 3C73A 3MAKA 3IAS2 4KA0A 4ZBDA 2FWFA 5AISA 3IBHA 2VCVA 2RM6A 2NPBA 3HJPA 2JZSA 2AV4A 4MK3A 4WBRD 3EWLA 5IOWA 3O6TA 4JU5A 4EUYA 1V40A 3H4KA 4IVFA 3KTBA 1SJZA 4FH8A 4Z7XA 2DJ2A 3C1SA 2GGTA 2H1DA 1T4YA 2Z9SA 2H30A 3CXGA 2G2QA 3HY2A 2C3QA 3E9JB 1JZWA 1T1VA 4F03A 4I2UA 1OYJA 1ABAA 2DJ3A 2B7KA 4J57E 2ZUPA 4ZL9A 1XXUA 3DIEA 2X64A 3PGTA 4BL7B 2IMDA 5ECIB 2CZ3A 2C0DA 2DC5A 1GTIA 4TR1B 3TCOA 4XS4B 2GSQA 1DE1A 2HI7A 3UVTA 2I9HA 3CRUA 4BL7A 3HZ8A 1EGRA 4K1FA 1GTBA 3UARA 2FWEA 1EP7A 2CAIA 3AY8A 4X43A 1SL1B 3IC4A 1K0NA 3IE3A 3VI5A 2QA1A 4ZL7A 2V32A 3H79A 2A2PA 1PL2A 2H6YA 1O6JA 4JEDA 1V57A 4CY6A 2OJLA 2GVPA 1QGVA 3FK8A 4O5RA 5ECQB 4GQFA 2HRKA 3LWAA 2GQLA 2OE3A 3FMWA 5G30A 5F0GA 2C80A 2XBQA 4MPGA 1R26A 3BCKA 5H5RA 2VO4A 3DMLA 2DJ1A 2DMMA 5JWOB 2R5GA 4IJIA 3M9KA 2L57A 4DSSA 1MEKA 1XW9A 2LUSA 2PGTA 5HFKA 3R2QA 5D9TA 12GSA 1SK0A 2CVDA 3GHAA 4HDEA 1JZOA 2L6CA 4G2EA 4TR3A 2LTKA 1YY7A 2GTUA 3KJYA 3CYNA 2H66A 1YF0A 1TU8A 1M3JA 3ZREA 3QFAC 4ZXGA 1NHOA 4EE0A 1EV9A 4XS6A 2FA4A 5IMAA 2H70A 5EY6A 18GSA 2NDOA 3CSHA 3CTFA 2VCZA 4QL7A 3WT1A 2DIYA 5GZZB 2YNXA 1GUMA 3LJRA 4IJ3A 3D22A 3CSIA 5IM9A 1GSSA 5IOXA 2PBJA 2H01A 1V2AA 1ZMAA 5JCUA 3F6FA 2L5OA 4POKA 1DE2A 1WRYA 3HZ4A 1OAZA 1TDIA 4K7IA 4P3YB 1YKAA 3ZIJA 1NHYA 2RLIA 3V1WA 5ECPB 1SK2A 1AC1A 3APSA 1N8JA 4GTUA 3WYWA 4K6XA 4MPFA 2B5XA 3MSZA 4NMUA 3C7MA 4KB3A 4POMA 2ZNMA 1THXA 1A2MA 2AAWA 4BWSA 3VWXA 3DGQA 4K2XA 1THOA 3EU4A 1TJDA 4HJ2A 1J9BA 5G1LA 3F8UA 4KW6A 1AQVA
chains in the Genus database with same CATH topology
4G0KA 3ED3A 5LCZA 4O32A 1K0MA 2IPAA 1X5EA 2VL2A 1PKWA 2R2JA 2H76A 4ECIA 5HR1A 3UBLA 1ML6A 1V58A 3FR9A 5J3RA 3FRCA 5ECSA 1YQ1A 4GSSA 1U6TA 3CTGA 1XOAA 3IOSA 3UJ1A 1GTAA 1EV4A 2P5RA 3D5JA 2OBIA 3IAM2 5B6NA 3IPZA 4FYCA 4XRDA 1K0OA 3TJJA 3P2AA 2WRTA 1XWGA 5COHA 5C04A 3DYRA 2MYGA 3C71A 4H86A 2GSTA 4FO5A 1B4QA 2H0HA 2V41A 2GZZA 1XWCA 3GL3A 6GSVA 3LYPA 1M9BA 1F3AA 2DLXA 3L4NA 5F06A 1G0TA 3VK9A 1S3AA 4I8BA 1K3LA 3M3MA 2YOIA 2MMAA 2XBIA 2B1KA 3QCPA 4YKFA 3W6GA 4WXTA 1K0DA 2C4JA 4TKYA 3WD6A 1FW1A 3A2XA 4YQMA 3VFIA 1TP9A 2DKIA 1GSYA 3CSJA 5ECRB 4ULXA 1XW5A 1TRWA 3DVXA 1E2YA 3GTUB 2REMA 3ZVJA 3GH6A 4O92A 3F3RA 1BQ7A 3RHBA 2R6KA 20GSA 3ZRDA 2L6DA 1TK0B 2OA7A 3ZL5A 5FT3A 4YQUA 1JZRA 2PWJA 1NM3A 3GTUA 4V2LA 4Q5QA 1M0UA 3LW9A 4HEA2 3ZVJD 2XHFA 5DAKB 4EF0A 4PUFC 2K18A 1EEMA 5AIXA 1UC7A 3D0ZA 4RQXA 1GULA 4GRFA 4AGSA 2FA8A 5KN1A 5ELGA 3O76A 1HNBA 3RHCA 5IMVA 3ZZXA 4WETA 2GDRA 2KLXA 4J2FA 7GSSA 2CVBA 4AJ6A 2C8UA 3QOUA 3F63A 5DJMA 2H0GA 2YV9A 2EIRA 2LEGA 2M72A 3D6IA 4Q5FA 2DBCA 2VAFA 2GZPA 1K3OA 2DKHA 3U5RE 4YKGA 2CX3A 3GFKA 4K0NA 1JFUA 2VLVA 3IRAA 3D4MA 3TKSC 2O87A 6GSTA 2EC4A 2VCXA 2JSYA 4IQ1A 1HNAA 4MDCA 5CYYA 1O7UA 2DJ0A 4WR4A 1TK8B 3ERGA 2LKUA 1F9MA 4ILFA 3D21A 3ZIVA 2CQ9A 1ZZYA 4POBA 3N9JA 4ID0A 5G2ZA 3W8JA 1XCCA 2HZFA 1F3BA 1TXXA 2E0QA 2IN3A 4MZWA 4DSRA 6GSYA 2FY6A 2FD3A 4KX4A 4RQRA 3KTLA 1G6WA 4YAVA 2VIMA 3EE2A 2E2GA 2DSAA 1NW2A 4D73B 4RI6A 2GT6A 2J9HA 1DUGA 4EC0A 1KTEA 2RUEA 5F8BA 3VLNA 5L71A 2H72A 4RUVA 1TTZA 1BG5A 4AJ8A 3CRTA 3P90A 1C72A 4D73A 2M80A 1MD3A 1Z5YE 1TOFA 1ZGNA 1XIYA 5BRTA 4V1Ag 2VLUA 2N5FA 1VF4A 3FZ9A 3KMOA 1YZXA 4LA1A 1GWCA 3F0IA 1A0FA 3KM6A 1PN0A 4IP6A 3BOAA 2H73A 2HNLA 2VM1A 3WGDA 3EU3A 1JHBA 3RPNA 3G9BA 4NPBA 1B8XA 1M2BA 2IMEA 3VI7A 1UA5A 3TKSE 1WWJA 1WOUA 1PKZA 3HVXA 3GMFA 4LLRA 2X8CA 4HZ4A 2P5QA 2AHEA 5DQSA 3TRXA 1V98A 1Z6MA 4GQCA 3IDVA 22GSA 4PNGA 2P31A 3BJ5A 5FWGA 2V6OA 4PNFA 4MMMA 4MZBA 1SYRA 5DDLA 2JZRA 4J56E 2MMZA 3F9UA 2C3NA 1AW9A 4GLTA 1HYUA 4K5RA 2UZ8A 1XW6A 3APQA 1JLVA 2OE1A 2HYXA 2IWTA 2OADA 2XC2A 3L9UA 3E3EA 2LNSA 2X4AA 1KBNA 3NIVA 1GNEA 2GT5A 3GX0A 5A4WA 1OC8A 4YAPA 1YEPA 2LRTA 3GX8A 4HOJA 2L59A 3DRNA 3ZTLA 3TUEA 1T8EB 2A2RA 4ZB6A 1RQMA 2WULA 1OC9A 2R4VA 2MZCA 2RUFA 3KEBA 2TRCP 4OD7A 2I3YA 3GH9A 4KCEA 3BD2A 3NOFA 4I97A 3TJBA 5A4UA 6GSSA 5B6MA 4KGIA 3GIXA 1YF1A 2YV7A 4ZIJA 3FZ5A 2JADA 4E8HA 1GSQA 4WKWA 3G7JA 1TW9A 2PMTA 4MJAA 3PH9A 2YCDA 2V2GA 2IJYA 4USSA 3VPQA 2V6KA 5DJLA 1OE8A 2FCHA 1SD9A 2CV4A 2CVKA 3GV1A 3UEMA 4E8EA 1M2DA 3GURA 5ENUA 4MA9A 4K7OA 4JBBA 3TGZA 2VL9A 4IKHA 3KH7A 3QPMA 2DJKA 2H8LA 3ISOA 4OWYA 1ZOFA 2WS2A 4NHWA 6GSWA 3ZYWA 4PTSA 2F8AA 1EOGA 1FB0A 1M2AA 4OFTA 4EO3A 4DSSB 3LGCA 1FG4A 3LSZA 1Q98A 5HR2A 3GSSA 3RAZA 4MF7A 5CRHA 5IQYA 2C3TA 2J23A 3P8WA 4HS1A 3LQ7A 3TB2A 4MF6A 1M9AA 2IMKA 1CQHA 3A2VA 1YKCA 2HXKA 1KEBA 4G0IA 1OKDA 1HNCA 4NV5A 3WGXA 5A4VA 3WT2A 5D8IA 4K8MA 1BAYA 1ZYNA 5IIZA 4DEJA 3BBYA 1GSEA 2L4CA 3MDKA 1ERTA 2VOCA 2B7JA 5GSSA 3FR3A 1U87A 4GXZA 1SL0B 3N5OA 1BJXA 5LD0A 1GSUA 3O3TA 4F0BA 4KNDA 4CHSA 2VCQA 5E59A 5AN1A 1VF1A 5G1KA 1S3CA 1DSBA 5F05A 2R3XA 3H1NA 1PX7A 3EMXA 4HZ2A 2A4HA 5DALA 4N0ZA 2CT6A 1Z7PA 5LNKe 4IP1A 3QAVA 5B8BA 1FB6A 1RK4A 3FW2A 2H6XA 5ABRA 3KD0A 3EMPA 5ID2B 1I5GA 1QXHA 4XS1A 2LNTA 5IPHA 1OC3A 2N5BA 4JE1A 3GN3A 3DXBA 3C8EA 4EDZA 4EXJA 2QGVA 5ID2A 1AIUA 2EIOA 1AUCA 4HU9A 3M9JA 2MMNA 4ICYA 5D9WA 2PPTA 3DD3A 3KH9A 4MCUA 5CRDA 1PA3A 1TK5B 1F37A 1SJIA 1WP0A 2CX4A 1X9WB 2LJKA 4Q5RA 3PR8A 4Q5NA 1URMA 2FWGA 4IGJA 4A5PA 2VM2A 3WGEA 3HXSA 3VWVA 4LL1B 5J5NA 1A2JA 2O7KA 2KOKA 3DWVA 4FIWA 1VGLA 1N2AA 2B5YA 2X8GA 4HQZA 4WEYA 3TJGA 3GKNA 5G5FA 2PUKC 4BWQA 4OCFA 2OBKA 3CBUA 4ZILA 4KDYA 3G7YA 4MJCA 1ZL9A 2F51A 1B9XC 5J41A 2VCTA 2JZTA 4HUAA 2JACA 2B6MA 1TI1A 1SENA 2QC7A 2G0FA 5ECMB 1FVJA 5J9BA 4OFNA 3KP9A 1AQXA 4AF2A 5DCHA 3UIWA 4QQ7A 1GTUA 2FUG2 2B5EA 4F82A 1TKDB 3HVSA 2C0GA 3TDGA 4OO5A 3QD9A 2X49A 2GSSA 3ZMKA 3ZITA 4PXOA 1AAZA 4JZQA 3US3A 2H74A 1OVNA 1U3AA 2IL3A 4CW9A 1EP8A 1GP1A 4OFMA 1Q4JA 1MTCA 2JL4A 1R5AA 1DBYA 2WGRA 3I9V2 1SD8A 3HA9A 1X5DA 2LSTA 1K3YA 1PQNA 1O73A 3DVWA 3GA4A 4TW5A 1X5CA 5B8AA 3P7XA 4LMVA 1ON4A 5BMUA 1Z3EA 2YWMA 2K9FA 1RW1A 4JR4A 1XWBA 3GUSA 1IYHA 2B3SA 5IMZA 2RM5A 3IC8A 4OCEA 3LXTA 2HRAA 4ACSA 1FO5A 2K6VA 4FYBA 3UL3A 3EPTA 3CMIA 3APOA 1QK8A 3FY7A 3BCIA 3J7Yb 3NZNA 2WZ9A 5GAND 4IQAA 1A24A 4V2MA 3LYKA 3ZLPA 2F8FA 1S3DA 1X9MB 1WIKA 2LV3A 4ZBBA 3PPUA 2CZ2A 4HU7A 3IHQA 4X1UA 3TRPA 2KP1A 2HZEA 4EKZA 5JWRB 2LQQA 4MF5A 5HR0A 4F0CA 1F6MC 5CRGA 5CO3A 2VCWA 8GSSA 2VL2C 4JRRA 1EEJA 5CRWA 4N0VA 5G5EA 3HJMA 2AYTA 2PN8A 2H0IA 4K9ZA 2A4VA 1UVZA 3QAWA 1SYXA 5ECKB 1A23A 3F3QA 4L5LA 4I2TA 1WJKA 5FHIA 3FZ4A 2YWIA 3GKXA 5ELAA 2DJJA 3MWHA 4IELA 1MD4A 1ZYPA 2B1LA 4F9ZA 4IW9A 4X4JA 3E0UA 4YQVA 2KUCA 2NTOA 3QMXA 2GZYA 3EVIA 3Q18A 5AGYA 3LEFA 2A2SA 4ZB8A 5KN3A 4N11A 2V1MA 4DSQA 5KOXA 1PMTA 4I6XA 1AXDA 4BA7A 4Z2TA 2XPDA 2FWHA 4X0XA 3EINA 4HQSA 2H71A 2YWNA 2H6ZA 2TIRA 5HQPA 19GSA 3A5IA 4F2IA 4KDXA 3GYKA 1K0BA 5DCGA 2I81A 4TRXA 1WMJA 3KGKA 3UAPA 2RIIA 3KCMA 3IXRA 5D73A 3I6AA 4BPYA 4PURA 4WBJA 3H93A 2FGXA 2GQMA 3VPTA 4IS0A 2CA8A 3HDCA 2AB6A 2VD1A 1ZYEA 1QQ2A 4XIHA 4CDOA 1GLQA 3L78A 4PX1A 4MJEA 2HFDA 3I43A 3HHVA 4TXVA 1K0CA 5D93A 1YDKA 4HI7A 1OC9B 3F4TA 5HFIA 2H1GA 1CQGA 4ML6A 1EGOA 2PU9C 1O8WA 5GSTA 3FYGA 2ES7A 4YH2A 5J9CA 1R5PA 1T3BA 3G7IA 5ECOB 2H19A 3RDWA 4N30A 1FOHA 4L0WA 1ERWA 4K5SA 2KP2A 3ZFLA 2GS3A 1A2LA 1ZYQB 1G6YA 5GAPD 4KDUA 3FKFA 2P0GA 2PERA 2IMIA 4MNNA 1GRXA 3KZQA 2ON5A 2VD0A 5H5SA 1E6BA 3W8SA 2E2MA 2YJHA 4I5QA 1BX9A 1FVKA 1SJ6A 2IMFA 2PVQA 4XTSA 4CY8A 1T00A 5ECNB 3Q19A 2HLSA 3TJKA 3UMAA 4WF4A 1PSQA 2VL3A 5INYA 2WB9A 4ECCA 1WE0A 4TR0A 1XVWA 3SWLA 1UN2A 4TR1A 2HT9A 2L4QA 4XS4A 3FZAA 3KXOA 1QFNA 1XZOA 1A8YA 3FEUA 4N10A 4IBPA 3LFLA 1YJ6A 1TI3A 3GL5A 3MNGA 4NXIA 1EWXA 2AUVA 2JSZA 3H8QA 4V1Ap 1HD2A 3ERFA 2FNOA 4PUAA 5G31A 4KSOA 4BVYB 1G7OA 2I4AA 1K0AA 3IA1A 1X9SB 2I1UA 3ME7A 1HQOA 2AJQB 2H1AA 2YZUA 1XFLA 1XOBA 3QAGA 2HSHA 1QUWA 1W89A 5IMCA 4BVYA 4EDYA 4G9HA 5F07A 2BJXA 1JLWA 5CREA 2OACA 4V2NA 4KSMA 5DBQA 2BMXA 5E4WA 3HCZA 3VURA 1PN9A 1YEXA 2DMLA 2F3MA 5DALB 4O5QA 3GSTA 4ZBAA 5EL8A 3EURA 3PINA 4KUNA 3M8NA 4TVEA 1BYEA 4KCAA 14GSA 1ERUA 4NAXA 4DVCA 3IHGA 2X8HA 4MH3A 2YPMA 6GSXA 1Y25A 1EZKA 6GSUA 2CAQA 5IPGA 3KIJA 2ZCTA 4OO4A 3JCML 3TKSA 3GKMA 2FHEA 2X99A 3QR6A 4KAEA 3RBTA 5IMDA 2IFQB 4RI7A 4ISDA 2F9SA 2ON7A 2LJRA 4ZL8A 1BEDA 5CNWA 4KH7A 1USBA 1PX6A 3D4TA 4KF9A 1TRSA 2BTOT 4TXOB 5DQYA 3C1RA 5EPFA 1LBKA 1T7PB 5J4UA 4PGTA 2IFQA 3GKKA 1Z9HA 2K8SA 2WFCA 2GSRA 2WCIA 3S9FA 3ERWA 4G10A 3J7Yk 3TKQA 3M0FA 4TXOA 5AIVA 1GNWA 2YZHA 1LJRA 1J0FA 1M99A 1XWKA 5B7CA 1WPIA 1GH2A 2HRNA 3L9SA 3LG6A 1ZCPA 4GWRA 1VF2A 1PD21 3UBKA 5CP1A 1FAAA 3F4SA 3IR4A 5IMFA 3FR6A 4K7NA 3MIXA 2MBSA 3KMNA 3LORA 4HJMA 4NWYA 1MDIA 3TKRA 3IK9A 2MBTA 3OR5A 4O5UA 1GL8A 3RPPA 4XCSA 5KN0A 10GSA 3UVHA 4EVMA 4GSTA 1W4VA 1FHEA 16GSA 5KEJA 1MDKA 1ERVA 2DIZA 5IO2A 2R37A 3I69A 4JR6A 5A5KA 2GQKA 4GF0A 2VUPA 3HJOA 1EOHA 4L8EA 2YANA 1U3IA 1I9DA 4LL4B 3M1GA 4XHMA 3U6VA 5JCWA 3IK7A 1GSFA 2GLRA 1Z6NA 4MP4A 1A8LA 1FOVA 4G0LA 3SBCA 2LJAA 2QKEA 4EIPA 2YWOA 4BVXB 4G19A 1KNGA 1GLPA 4EIQA 4NHZA 1PRXA 1SKSB 3HVVA 1GUKA 1QMVA 2XPEA 1ACVA 4BVXA 4Z2UA 4L0UA 4MZCA 3VWWA 4O7HA 1OKTA 3DKSA 1R4WA 1GUHA 1SU9A 5KN2A 1H75A 1M7TA 9GSSA 4ECBA 3ME8A 5D9VA 3Q74A 1XVQA 4AJ7A 5DAKA 1SKWB 3UOMA 5JWQB 2FLSA 3R3EA 2C0FA 11GSA 3TKPA 3VWUA 2VLTA 4WR5A 2YN1A 3TOUA 1ILOA 1J08A 1Y6EA 2EIQA 1IYIA 4FQUA 3Q6OA 3FHKA 1B9YC 5CAXA 3ZFBA 2QA2A 3IV4A 4K0GA 5ECLB 3K8NA 4K2DA 3GRXA 4GSNA 2HZEB 2R0CA 1ST9A 4OMVA 3GNJA 4ML1A 13GSA 2R0PA 2HE3A 3DEXA 5JCGA 4XRAA 4NV2A 3L0HA 4QL9A 2YP6A 2O85A 4L5OA 1SK1A 2HRFA 2JU5A 5H5QA 5C00A 4TOPA 3EC3A 4TN8A 5HFGA 3ZMLA 1O81A 1U88A 1B48A 2NVLA 1TRVA 1XWAA 3QFBC 2WDUA 5IO0A 2D2ZA 3A2WA 2TRXA 3TJFA 4ECJA 1PL1A 4MJBA 2C1YA 2LRNA 3EYTA 3A3TA 3TOTA 4GCIA 3L9VA 3MYDA 2O89A 2LS5A 2LRCA 4PQIA 1PGTA 1XPVA 4WF5A 1R7HA 4FYUA 5ECHB 1F2EA 5D96A 1XBSA 2O8VB 2N5AA 2IIYA 1H4OA 4PQ1A 1VRSD 2H75A 2OKAA 2H1BA 2WJUA 2K8VA 4LMWA 4IN0A 4Z2RA 1Z7RA 5D9XA 1TU7A 3TRQA 2HSYA 2L5LA 4PQHA 1NSWA 2KHPA 5DVBA 2NBSA 3F4RA 5EVOA 1OE7A 1MDJA 4TR4A 2R0GA 1TRUA 3LXZA 1SL2B 3F6DA 3HYPA 1O8XA 2OE0A 5KOWA 3KP8A 1X0RA 2YJ7A 1GSDA 2PVOC 2M46A 1AQWA 4ZB9A 2E7PA 3HD5A 3HKRA 5HR3A 1A0RP 1G7EA 4MABA 2ALBA 3A5WA 1B4PA 3QDNA 4MH2A 1T4ZA 1JZDA 2HSMA 2QSIA 1V9WA 1VF3A 4MLYA 1SKRB 2C0EA 4EL1A 2LQOA 2MMOA 17GSA 4IHUA 1LU4A 4KE3A 4POLA 1O85A 3C73A 3MAKA 3IAS2 4KA0A 4ZBDA 2FWFA 5AISA 3IBHA 2VCVA 2RM6A 2NPBA 3HJPA 2JZSA 2AV4A 4MK3A 4WBRD 3EWLA 5IOWA 3O6TA 4JU5A 4EUYA 1V40A 3H4KA 4IVFA 3KTBA 1SJZA 4FH8A 4Z7XA 2DJ2A 3C1SA 2GGTA 2H1DA 1T4YA 2Z9SA 2H30A 3CXGA 2G2QA 3HY2A 2C3QA 3E9JB 1JZWA 1T1VA 4F03A 4I2UA 1OYJA 1ABAA 2DJ3A 2B7KA 4J57E 2ZUPA 4ZL9A 1XXUA 3DIEA 2X64A 3PGTA 4BL7B 2IMDA 5ECIB 2CZ3A 2C0DA 2DC5A 1GTIA 4TR1B 3TCOA 4XS4B 2GSQA 1DE1A 2HI7A 3UVTA 2I9HA 3CRUA 4BL7A 3HZ8A 1EGRA 4K1FA 1GTBA 3UARA 2FWEA 1EP7A 2CAIA 3AY8A 4X43A 1SL1B 3IC4A 1K0NA 3IE3A 3VI5A 2QA1A 4ZL7A 2V32A 3H79A 2A2PA 1PL2A 2H6YA 1O6JA 4JEDA 1V57A 4CY6A 2OJLA 2GVPA 1QGVA 3FK8A 4O5RA 5ECQB 4GQFA 2HRKA 3LWAA 2GQLA 2OE3A 3FMWA 5G30A 5F0GA 2C80A 2XBQA 4MPGA 1R26A 3BCKA 5H5RA 2VO4A 3DMLA 2DJ1A 2DMMA 5JWOB 2R5GA 4IJIA 3M9KA 2L57A 4DSSA 1MEKA 1XW9A 2LUSA 2PGTA 5HFKA 3R2QA 5D9TA 12GSA 1SK0A 2CVDA 3GHAA 4HDEA 1JZOA 2L6CA 4G2EA 4TR3A 2LTKA 1YY7A 2GTUA 3KJYA 3CYNA 2H66A 1YF0A 1TU8A 3ZREA 3QFAC 4ZXGA 1NHOA 4EE0A 1EV9A 4XS6A 2FA4A 5IMAA 2H70A 5EY6A 18GSA 2NDOA 3CSHA 3CTFA 2VCZA 4QL7A 3WT1A 2DIYA 5GZZB 2YNXA 1GUMA 3LJRA 4IJ3A 3D22A 3CSIA 5IM9A 1GSSA 5IOXA 2PBJA 2H01A 1V2AA 1ZMAA 5JCUA 3F6FA 2L5OA 4POKA 1DE2A 1WRYA 3HZ4A 1OAZA 1TDIA 4K7IA 4P3YB 1YKAA 3ZIJA 1NHYA 2RLIA 3V1WA 5ECPB 1SK2A 1AC1A 3APSA 1N8JA 4GTUA 3WYWA 4K6XA 4MPFA 2B5XA 3MSZA 4NMUA 3C7MA 4KB3A 4POMA 2ZNMA 1THXA 1A2MA 2AAWA 4BWSA 3VWXA 3DGQA 4K2XA 1THOA 3EU4A 1TJDA 4HJ2A 1J9BA 5G1LA 3F8UA 4KW6A 1AQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ED3 A;  5LCZ A;  4O32 A;  1K0M A;  2IPA A;  1X5E A;  2VL2 A;  1PKW A;  2R2J A;  2H76 A;  4ECI A;  5HR1 A;  3UBL A;  1ML6 A;  1V58 A;  3FR9 A;  5J3R A;  3FRC A;  5ECS A;  1YQ1 A;  4GSS A;  1U6T A;  3CTG A;  1XOA A;  3IOS A;  3UJ1 A;  1GTA A;  1EV4 A;  2P5R A;  3D5J A;  2OBI A;  3IAM 2;  5B6N A;  3IPZ A;  4FYC A;  4XRD A;  1K0O A;  3TJJ A;  3P2A A;  2WRT A;  1XWG A;  5COH A;  5C04 A;  3DYR A;  2MYG A;  3C71 A;  4H86 A;  2GST A;  4FO5 A;  1B4Q A;  2H0H A;  2V41 A;  2GZZ A;  1XWC A;  3GL3 A;  6GSV A;  3LYP A;  1M9B A;  1F3A A;  2DLX A;  3L4N A;  5F06 A;  1G0T A;  3VK9 A;  1S3A A;  4I8B A;  1K3L A;  3M3M A;  2YOI A;  2MMA A;  2XBI A;  2B1K A;  3QCP A;  3W6G A;  4WXT A;  1K0D A;  2C4J A;  4TKY A;  3WD6 A;  1FW1 A;  3A2X A;  4YQM A;  3VFI A;  1TP9 A;  1GSY A;  3CSJ A;  5ECR B;  4ULX A;  1XW5 A;  1TRW A;  3DVX A;  1E2Y A;  3GTU B;  2REM A;  3ZVJ A;  3GH6 A;  4O92 A;  3F3R A;  1BQ7 A;  3RHB A;  2R6K A;  20GS A;  3ZRD A;  2L6D A;  1TK0 B;  2OA7 A;  3ZL5 A;  5FT3 A;  4YQU A;  1JZR A;  2PWJ A;  1NM3 A;  3GTU A;  4V2L A;  4Q5Q A;  1M0U A;  4HEA 2;  3ZVJ D;  2XHF A;  5DAK B;  4EF0 A;  4PUF C;  2K18 A;  1EEM A;  5AIX A;  1UC7 A;  3D0Z A;  4RQX A;  1GUL A;  4GRF A;  4AGS A;  2FA8 A;  5KN1 A;  5ELG A;  3O76 A;  1HNB A;  3RHC A;  5IMV A;  3ZZX A;  4WET A;  2GDR A;  2KLX A;  4J2F A;  7GSS A;  2CVB A;  4AJ6 A;  2C8U A;  3QOU A;  3F63 A;  5DJM A;  2H0G A;  2YV9 A;  2EIR A;  2LEG A;  2M72 A;  3D6I A;  4Q5F A;  2DBC A;  2VAF A;  2GZP A;  1K3O A;  3U5R E;  2CX3 A;  3GFK A;  4K0N A;  1JFU A;  2VLV A;  3IRA A;  3D4M A;  3TKS C;  2O87 A;  6GST A;  2EC4 A;  2VCX A;  2JSY A;  4IQ1 A;  1HNA A;  4MDC A;  5CYY A;  1O7U A;  2DJ0 A;  4WR4 A;  1TK8 B;  3ERG A;  2LKU A;  1F9M A;  4ILF A;  3D21 A;  3ZIV A;  2CQ9 A;  1ZZY A;  4POB A;  3N9J A;  4ID0 A;  5G2Z A;  3W8J A;  1XCC A;  2HZF A;  1F3B A;  1TXX A;  2E0Q A;  2IN3 A;  4MZW A;  4DSR A;  6GSY A;  2FY6 A;  2FD3 A;  4KX4 A;  4RQR A;  3KTL A;  1G6W A;  4YAV A;  2VIM A;  3EE2 A;  2E2G A;  2DSA A;  1NW2 A;  4D73 B;  4RI6 A;  2GT6 A;  2J9H A;  1DUG A;  4EC0 A;  1KTE A;  2RUE A;  5F8B A;  3VLN A;  5L71 A;  2H72 A;  4RUV A;  1TTZ A;  1BG5 A;  4AJ8 A;  3CRT A;  3P90 A;  1C72 A;  4D73 A;  2M80 A;  1MD3 A;  1Z5Y E;  1TOF A;  1ZGN A;  1XIY A;  4V1A g;  2VLU A;  2N5F A;  1VF4 A;  3FZ9 A;  3KMO A;  1YZX A;  4LA1 A;  1GWC A;  3F0I A;  1A0F A;  3KM6 A;  4IP6 A;  3BOA A;  2H73 A;  2HNL A;  2VM1 A;  3WGD A;  3EU3 A;  1JHB A;  3RPN A;  3G9B A;  4NPB A;  1B8X A;  1M2B A;  2IME A;  3VI7 A;  1UA5 A;  3TKS E;  1WWJ A;  1WOU A;  1PKZ A;  3HVX A;  3GMF A;  4LLR A;  2X8C A;  4HZ4 A;  2P5Q A;  2AHE A;  5DQS A;  3TRX A;  1V98 A;  1Z6M A;  4GQC A;  3IDV A;  22GS A;  4PNG A;  2P31 A;  3BJ5 A;  5FWG A;  2V6O A;  4PNF A;  4MMM A;  4MZB A;  1SYR A;  5DDL A;  2JZR A;  4J56 E;  2MMZ A;  3F9U A;  2C3N A;  1AW9 A;  4GLT A;  1HYU A;  1XW6 A;  3APQ A;  1JLV A;  2OE1 A;  2HYX A;  2IWT A;  2OAD A;  2XC2 A;  3L9U A;  3E3E A;  2LNS A;  1KBN A;  3NIV A;  1GNE A;  2GT5 A;  3GX0 A;  5A4W A;  1OC8 A;  4YAP A;  1YEP A;  2LRT A;  3GX8 A;  4HOJ A;  2L59 A;  3DRN A;  3ZTL A;  3TUE A;  1T8E B;  2A2R A;  4ZB6 A;  1RQM A;  2WUL A;  1OC9 A;  2R4V A;  2MZC A;  2RUF A;  3KEB A;  2TRC P;  4OD7 A;  2I3Y A;  3GH9 A;  4KCE A;  3BD2 A;  3NOF A;  4I97 A;  3TJB A;  5A4U A;  6GSS A;  5B6M A;  4KGI A;  3GIX A;  1YF1 A;  2YV7 A;  4ZIJ A;  3FZ5 A;  2JAD A;  4E8H A;  1GSQ A;  4WKW A;  3G7J A;  1TW9 A;  2PMT A;  4MJA A;  3PH9 A;  2YCD A;  2V2G A;  2IJY A;  3VPQ A;  2V6K A;  5DJL A;  1OE8 A;  2FCH A;  1SD9 A;  2CV4 A;  2CVK A;  3GV1 A;  3UEM A;  4E8E A;  1M2D A;  3GUR A;  5ENU A;  4MA9 A;  4K7O A;  4JBB A;  3TGZ A;  2VL9 A;  4IKH A;  3KH7 A;  3QPM A;  2DJK A;  2H8L A;  3ISO A;  4OWY A;  1ZOF A;  2WS2 A;  4NHW A;  6GSW A;  3ZYW A;  2F8A A;  1EOG A;  1FB0 A;  1M2A A;  4OFT A;  4EO3 A;  4DSS B;  3LGC A;  1FG4 A;  3LSZ A;  1Q98 A;  5HR2 A;  3GSS A;  3RAZ A;  4MF7 A;  5CRH A;  5IQY A;  2C3T A;  2J23 A;  3P8W A;  4HS1 A;  3LQ7 A;  3TB2 A;  4MF6 A;  1M9A A;  2IMK A;  1CQH A;  3A2V A;  1YKC A;  2HXK A;  1KEB A;  1OKD A;  1HNC A;  4NV5 A;  3WGX A;  5A4V A;  3WT2 A;  5D8I A;  4K8M A;  1BAY A;  5IIZ A;  4DEJ A;  3BBY A;  1GSE A;  2L4C A;  3MDK A;  1ERT A;  2VOC A;  2B7J A;  5GSS A;  3FR3 A;  1U87 A;  4GXZ A;  1SL0 B;  3N5O A;  1BJX A;  5LD0 A;  1GSU A;  3O3T A;  4F0B A;  4KND A;  4CHS A;  2VCQ A;  5E59 A;  5AN1 A;  1VF1 A;  5G1K A;  1S3C A;  1DSB A;  5F05 A;  2R3X A;  3H1N A;  1PX7 A;  3EMX A;  4HZ2 A;  5DAL A;  4N0Z A;  2CT6 A;  1Z7P A;  5LNK e;  4IP1 A;  3QAV A;  5B8B A;  1FB6 A;  1RK4 A;  3FW2 A;  2H6X A;  5ABR A;  3KD0 A;  3EMP A;  5ID2 B;  1I5G A;  1QXH A;  4XS1 A;  2LNT A;  5IPH A;  1OC3 A;  2N5B A;  4JE1 A;  3GN3 A;  3DXB A;  3C8E A;  4EDZ A;  4EXJ A;  2QGV A;  5ID2 A;  1AIU A;  2EIO A;  1AUC A;  4HU9 A;  3M9J A;  2MMN A;  5D9W A;  2PPT A;  3DD3 A;  3KH9 A;  4MCU A;  5CRD A;  1PA3 A;  1TK5 B;  1F37 A;  1SJI A;  1WP0 A;  2CX4 A;  1X9W B;  2LJK A;  4Q5R A;  3PR8 A;  4Q5N A;  1URM A;  2FWG A;  4IGJ A;  2VM2 A;  3WGE A;  3HXS A;  3VWV A;  4LL1 B;  5J5N A;  1A2J A;  2O7K A;  2KOK A;  3DWV A;  4FIW A;  1VGL A;  1N2A A;  2B5Y A;  2X8G A;  4HQZ A;  4WEY A;  3TJG A;  3GKN A;  5G5F A;  2PUK C;  4BWQ A;  4OCF A;  2OBK A;  3CBU A;  4ZIL A;  4KDY A;  3G7Y A;  4MJC A;  1ZL9 A;  2F51 A;  1B9X C;  5J41 A;  2VCT A;  2JZT A;  4HUA A;  2JAC A;  2B6M A;  1TI1 A;  1SEN A;  2QC7 A;  2G0F A;  5ECM B;  1FVJ A;  5J9B A;  4OFN A;  3KP9 A;  1AQX A;  4AF2 A;  5DCH A;  3UIW A;  4QQ7 A;  1GTU A;  2FUG 2;  2B5E A;  4F82 A;  1TKD B;  3HVS A;  2C0G A;  3TDG A;  4OO5 A;  3QD9 A;  2GSS A;  3ZMK A;  3ZIT A;  4PXO A;  1AAZ A;  4JZQ A;  3US3 A;  2H74 A;  1OVN A;  1U3A A;  2IL3 A;  4CW9 A;  1EP8 A;  1GP1 A;  4OFM A;  1Q4J A;  1MTC A;  2JL4 A;  1R5A A;  1DBY A;  2WGR A;  3I9V 2;  1SD8 A;  3HA9 A;  1X5D A;  2LST A;  1K3Y A;  1PQN A;  1O73 A;  3DVW A;  3GA4 A;  4TW5 A;  1X5C A;  5B8A A;  3P7X A;  4LMV A;  1ON4 A;  1Z3E A;  2YWM A;  2K9F A;  1RW1 A;  4JR4 A;  1XWB A;  3GUS A;  1IYH A;  2B3S A;  5IMZ A;  2RM5 A;  4OCE A;  3LXT A;  4ACS A;  1FO5 A;  2K6V A;  4FYB A;  3UL3 A;  3CMI A;  3APO A;  1QK8 A;  3FY7 A;  3BCI A;  3J7Y b;  3NZN A;  2WZ9 A;  5GAN D;  4IQA A;  1A24 A;  4V2M A;  3LYK A;  3ZLP A;  2F8F A;  1S3D A;  1X9M B;  1WIK A;  2LV3 A;  4ZBB A;  2CZ2 A;  4HU7 A;  3IHQ A;  4X1U A;  3TRP A;  2KP1 A;  2HZE A;  4EKZ A;  5JWR B;  2LQQ A;  4MF5 A;  5HR0 A;  4F0C A;  1F6M C;  5CRG A;  5CO3 A;  2VCW A;  8GSS A;  2VL2 C;  4JRR A;  1EEJ A;  5CRW A;  4N0V A;  5G5E A;  3HJM A;  2AYT A;  2PN8 A;  2H0I A;  4K9Z A;  2A4V A;  1UVZ A;  3QAW A;  1SYX A;  5ECK B;  1A23 A;  3F3Q A;  4L5L A;  4I2T A;  1WJK A;  5FHI A;  3FZ4 A;  2YWI A;  3GKX A;  5ELA A;  2DJJ A;  3MWH A;  4IEL A;  1MD4 A;  2B1L A;  4F9Z A;  4IW9 A;  3E0U A;  4YQV A;  2KUC A;  2NTO A;  3QMX A;  2GZY A;  3EVI A;  3Q18 A;  5AGY A;  3LEF A;  2A2S A;  4ZB8 A;  5KN3 A;  4N11 A;  2V1M A;  4DSQ A;  1PMT A;  4I6X A;  1AXD A;  4BA7 A;  2XPD A;  2FWH A;  4X0X A;  3EIN A;  4HQS A;  2H71 A;  2YWN A;  2H6Z A;  2TIR A;  5HQP A;  19GS A;  4F2I A;  4KDX A;  3GYK A;  1K0B A;  5DCG A;  2I81 A;  4TRX A;  1WMJ A;  3KGK A;  3UAP A;  2RII A;  3KCM A;  3IXR A;  5D73 A;  3I6A A;  4BPY A;  4PUR A;  4WBJ A;  3H93 A;  2FGX A;  2GQM A;  3VPT A;  4IS0 A;  2CA8 A;  3HDC A;  2AB6 A;  2VD1 A;  1ZYE A;  1QQ2 A;  4XIH A;  4CDO A;  1GLQ A;  3L78 A;  4PX1 A;  4MJE A;  2HFD A;  3I43 A;  3HHV A;  4TXV A;  1K0C A;  5D93 A;  1YDK A;  4HI7 A;  1OC9 B;  3F4T A;  5HFI A;  2H1G A;  1CQG A;  4ML6 A;  1EGO A;  2PU9 C;  1O8W A;  5GST A;  3FYG A;  2ES7 A;  4YH2 A;  5J9C A;  1R5P A;  1T3B A;  3G7I A;  5ECO B;  2H19 A;  3RDW A;  4N30 A;  4L0W A;  1ERW A;  2KP2 A;  3ZFL A;  2GS3 A;  1A2L A;  1ZYQ B;  1G6Y A;  5GAP D;  4KDU A;  3FKF A;  2P0G A;  2PER A;  2IMI A;  1GRX A;  3KZQ A;  2ON5 A;  2VD0 A;  5H5S A;  1E6B A;  3W8S A;  2E2M A;  2YJH A;  4I5Q A;  1BX9 A;  1FVK A;  1SJ6 A;  2IMF A;  2PVQ A;  4XTS A;  1T00 A;  5ECN B;  3Q19 A;  2HLS A;  3TJK A;  3UMA A;  4WF4 A;  1PSQ A;  2VL3 A;  5INY A;  2WB9 A;  4ECC A;  1WE0 A;  4TR0 A;  1XVW A;  3SWL A;  1UN2 A;  4TR1 A;  2HT9 A;  2L4Q A;  4XS4 A;  3FZA A;  3KXO A;  1QFN A;  1XZO A;  1A8Y A;  3FEU A;  4N10 A;  4IBP A;  3LFL A;  1YJ6 A;  1TI3 A;  3GL5 A;  3MNG A;  4NXI A;  1EWX A;  2AUV A;  2JSZ A;  3H8Q A;  4V1A p;  1HD2 A;  3ERF A;  2FNO A;  4PUA A;  5G31 A;  4KSO A;  1G7O A;  2I4A A;  1K0A A;  3IA1 A;  1X9S B;  2I1U A;  3ME7 A;  1HQO A;  2AJQ B;  2H1A A;  2YZU A;  1XFL A;  1XOB A;  3QAG A;  2HSH A;  1QUW A;  1W89 A;  5IMC A;  4BVY A;  4EDY A;  4G9H A;  5F07 A;  2BJX A;  1JLW A;  5CRE A;  2OAC A;  4V2N A;  4KSM A;  5DBQ A;  2BMX A;  5E4W A;  3HCZ A;  3VUR A;  1PN9 A;  1YEX A;  2DML A;  2F3M A;  5DAL B;  3GST A;  4ZBA A;  5EL8 A;  3EUR A;  3PIN A;  4KUN A;  3M8N A;  4TVE A;  1BYE A;  4KCA A;  14GS A;  1ERU A;  4NAX A;  4DVC A;  2X8H A;  4MH3 A;  2YPM A;  6GSX A;  1Y25 A;  1EZK A;  6GSU A;  2CAQ A;  5IPG A;  3KIJ A;  2ZCT A;  4OO4 A;  3JCM L;  3TKS A;  3GKM A;  2FHE A;  2X99 A;  3QR6 A;  4KAE A;  3RBT A;  5IMD A;  2IFQ B;  4RI7 A;  4ISD A;  2F9S A;  2ON7 A;  2LJR A;  4ZL8 A;  1BED A;  5CNW A;  4KH7 A;  1USB A;  1PX6 A;  3D4T A;  1TRS A;  2BTO T;  4TXO B;  5DQY A;  3C1R A;  5EPF A;  1LBK A;  1T7P B;  5J4U A;  4PGT A;  2IFQ A;  3GKK A;  1Z9H A;  2K8S A;  2WFC A;  2GSR A;  2WCI A;  3S9F A;  3ERW A;  4G10 A;  3J7Y k;  3TKQ A;  3M0F A;  4TXO A;  5AIV A;  1GNW A;  2YZH A;  1LJR A;  1J0F A;  1M99 A;  1XWK A;  5B7C A;  1WPI A;  1GH2 A;  2HRN A;  3L9S A;  3LG6 A;  1ZCP A;  4GWR A;  1VF2 A;  1PD2 1;  3UBK A;  5CP1 A;  1FAA A;  3F4S A;  3IR4 A;  5IMF A;  3FR6 A;  4K7N A;  2MBS A;  3KMN A;  3LOR A;  4HJM A;  4NWY A;  1MDI A;  3TKR A;  3IK9 A;  2MBT A;  3OR5 A;  1GL8 A;  3RPP A;  4XCS A;  5KN0 A;  10GS A;  3UVH A;  4EVM A;  4GST A;  1W4V A;  1FHE A;  16GS A;  5KEJ A;  1MDK A;  1ERV A;  2DIZ A;  5IO2 A;  2R37 A;  3I69 A;  4JR6 A;  5A5K A;  2GQK A;  4GF0 A;  2VUP A;  3HJO A;  1EOH A;  4L8E A;  2YAN A;  1U3I A;  1I9D A;  4LL4 B;  3M1G A;  4XHM A;  3U6V A;  5JCW A;  3IK7 A;  1GSF A;  2GLR A;  1Z6N A;  4MP4 A;  1A8L A;  1FOV A;  3SBC A;  2LJA A;  2QKE A;  2YWO A;  4G19 A;  1KNG A;  1GLP A;  4NHZ A;  1PRX A;  1SKS B;  3HVV A;  1GUK A;  1QMV A;  2XPE A;  1ACV A;  4BVX A;  4L0U A;  4MZC A;  3VWW A;  4O7H A;  1OKT A;  3DKS A;  1R4W A;  1GUH A;  1SU9 A;  5KN2 A;  1H75 A;  1M7T A;  9GSS A;  4ECB A;  3ME8 A;  5D9V A;  3Q74 A;  1XVQ A;  4AJ7 A;  5DAK A;  1SKW B;  3UOM A;  5JWQ B;  2FLS A;  2C0F A;  11GS A;  3TKP A;  3VWU A;  2VLT A;  4WR5 A;  2YN1 A;  3TOU A;  1ILO A;  1J08 A;  1Y6E A;  2EIQ A;  1IYI A;  3Q6O A;  3FHK A;  1B9Y C;  5CAX A;  3ZFB A;  3IV4 A;  4K0G A;  5ECL B;  3K8N A;  4K2D A;  3GRX A;  4GSN A;  2HZE B;  1ST9 A;  4OMV A;  3GNJ A;  4ML1 A;  13GS A;  2HE3 A;  3DEX A;  5JCG A;  4XRA A;  4NV2 A;  3L0H A;  4QL9 A;  2YP6 A;  2O85 A;  4L5O A;  1SK1 A;  2HRF A;  2JU5 A;  5H5Q A;  5C00 A;  4TOP A;  3EC3 A;  4TN8 A;  5HFG A;  3ZML A;  1O81 A;  1U88 A;  1B48 A;  2NVL A;  1TRV A;  1XWA A;  3QFB C;  2WDU A;  5IO0 A;  2D2Z A;  3A2W A;  2TRX A;  3TJF A;  4ECJ A;  1PL1 A;  4MJB A;  2C1Y A;  2LRN A;  3EYT A;  3A3T A;  3TOT A;  4GCI A;  3L9V A;  2O89 A;  2LS5 A;  2LRC A;  4PQI A;  1PGT A;  1XPV A;  4WF5 A;  1R7H A;  4FYU A;  5ECH B;  1F2E A;  5D96 A;  1XBS A;  2O8V B;  2N5A A;  2IIY A;  1H4O A;  4PQ1 A;  1VRS D;  2H75 A;  2OKA A;  2H1B A;  2WJU A;  2K8V A;  4LMW A;  4IN0 A;  1Z7R A;  5D9X A;  1TU7 A;  3TRQ A;  2HSY A;  2L5L A;  4PQH A;  1NSW A;  2KHP A;  5DVB A;  2NBS A;  3F4R A;  5EVO A;  1OE7 A;  1MDJ A;  4TR4 A;  1TRU A;  3LXZ A;  1SL2 B;  3F6D A;  3HYP A;  1O8X A;  2OE0 A;  3KP8 A;  1X0R A;  2YJ7 A;  1GSD A;  2PVO C;  2M46 A;  1AQW A;  4ZB9 A;  2E7P A;  3HD5 A;  3HKR A;  5HR3 A;  1A0R P;  1G7E A;  4MAB A;  2ALB A;  3A5W A;  1B4P A;  3QDN A;  4MH2 A;  1T4Z A;  1JZD A;  2QSI A;  1V9W A;  1VF3 A;  4MLY A;  1SKR B;  2C0E A;  4EL1 A;  2LQO A;  2MMO A;  17GS A;  4IHU A;  1LU4 A;  4KE3 A;  4POL A;  1O85 A;  3C73 A;  3MAK A;  3IAS 2;  4KA0 A;  4ZBD A;  2FWF A;  5AIS A;  3IBH A;  2VCV A;  2RM6 A;  2NPB A;  3HJP A;  2JZS A;  2AV4 A;  4MK3 A;  4WBR D;  3EWL A;  5IOW A;  3O6T A;  4JU5 A;  4EUY A;  1V40 A;  3H4K A;  4IVF A;  3KTB A;  1SJZ A;  4FH8 A;  4Z7X A;  2DJ2 A;  3C1S A;  2GGT A;  2H1D A;  1T4Y A;  2Z9S A;  2H30 A;  3CXG A;  2G2Q A;  3HY2 A;  2C3Q A;  3E9J B;  1JZW A;  1T1V A;  4F03 A;  4I2U A;  1OYJ A;  1ABA A;  2DJ3 A;  2B7K A;  4J57 E;  2ZUP A;  4ZL9 A;  1XXU A;  3DIE A;  2X64 A;  3PGT A;  2IMD A;  5ECI B;  2CZ3 A;  2C0D A;  2DC5 A;  1GTI A;  4TR1 B;  3TCO A;  4XS4 B;  2GSQ A;  1DE1 A;  2HI7 A;  3UVT A;  2I9H A;  3CRU A;  4BL7 A;  3HZ8 A;  1EGR A;  4K1F A;  1GTB A;  3UAR A;  2FWE A;  1EP7 A;  2CAI A;  3AY8 A;  4X43 A;  1SL1 B;  3IC4 A;  1K0N A;  3IE3 A;  3VI5 A;  4ZL7 A;  2V32 A;  3H79 A;  1PL2 A;  2H6Y A;  1O6J A;  4JED A;  1V57 A;  2OJL A;  2GVP A;  1QGV A;  5ECQ B;  3FK8 A;  4O5R A;  4GQF A;  3LWA A;  2GQL A;  2OE3 A;  5G30 A;  5F0G A;  2C80 A;  2XBQ A;  4MPG A;  1R26 A;  3BCK A;  5H5R A;  2VO4 A;  3DML A;  2DJ1 A;  2DMM A;  5JWO B;  2R5G A;  4IJI A;  3M9K A;  2L57 A;  4DSS A;  1MEK A;  1XW9 A;  2LUS A;  2PGT A;  5HFK A;  3R2Q A;  5D9T A;  12GS A;  1SK0 A;  2CVD A;  3GHA A;  4HDE A;  1JZO A;  2L6C A;  4G2E A;  4TR3 A;  2LTK A;  1YY7 A;  2GTU A;  3KJY A;  3CYN A;  2H66 A;  1YF0 A;  1TU8 A;  3ZRE A;  3QFA C;  4ZXG A;  1NHO A;  4EE0 A;  1EV9 A;  4XS6 A;  2FA4 A;  5IMA A;  2H70 A;  5EY6 A;  18GS A;  2NDO A;  3CSH A;  3CTF A;  2VCZ A;  4QL7 A;  3WT1 A;  2DIY A;  5GZZ B;  2YNX A;  1GUM A;  3LJR A;  4IJ3 A;  3D22 A;  3CSI A;  5IM9 A;  1GSS A;  5IOX A;  2PBJ A;  2H01 A;  1V2A A;  1ZMA A;  5JCU A;  3F6F A;  2L5O A;  4POK A;  1DE2 A;  1WRY A;  3HZ4 A;  1OAZ A;  1TDI A;  4K7I A;  4P3Y B;  1YKA A;  3ZIJ A;  1NHY A;  2RLI A;  3V1W A;  5ECP B;  1SK2 A;  1AC1 A;  3APS A;  1N8J A;  4GTU A;  3WYW A;  4K6X A;  4MPF A;  2B5X A;  3MSZ A;  4NMU A;  3C7M A;  4KB3 A;  4POM A;  2ZNM A;  1THX A;  1A2M A;  2AAW A;  4BWS A;  3VWX A;  3DGQ A;  1THO A;  3EU4 A;  1TJD A;  4HJ2 A;  1J9B A;  5G1L A;  3F8U A;  4KW6 A;  1AQV A; 
#chains in the Genus database with same CATH topology
 4G0K A;  3ED3 A;  5LCZ A;  4O32 A;  1K0M A;  2IPA A;  1X5E A;  2VL2 A;  1PKW A;  2R2J A;  2H76 A;  4ECI A;  5HR1 A;  3UBL A;  1ML6 A;  1V58 A;  3FR9 A;  5J3R A;  3FRC A;  5ECS A;  1YQ1 A;  4GSS A;  1U6T A;  3CTG A;  1XOA A;  3IOS A;  3UJ1 A;  1GTA A;  1EV4 A;  2P5R A;  3D5J A;  2OBI A;  3IAM 2;  5B6N A;  3IPZ A;  4FYC A;  4XRD A;  1K0O A;  3TJJ A;  3P2A A;  2WRT A;  1XWG A;  5COH A;  5C04 A;  3DYR A;  2MYG A;  3C71 A;  4H86 A;  2GST A;  4FO5 A;  1B4Q A;  2H0H A;  2V41 A;  2GZZ A;  1XWC A;  3GL3 A;  6GSV A;  3LYP A;  1M9B A;  1F3A A;  2DLX A;  3L4N A;  5F06 A;  1G0T A;  3VK9 A;  1S3A A;  4I8B A;  1K3L A;  3M3M A;  2YOI A;  1M3I A;  2MMA A;  2XBI A;  2B1K A;  3QCP A;  4YKF A;  3W6G A;  4WXT A;  1K0D A;  2C4J A;  4TKY A;  3WD6 A;  1FW1 A;  3A2X A;  4YQM A;  3VFI A;  1TP9 A;  2DKI A;  1GSY A;  3CSJ A;  5ECR B;  4ULX A;  1XW5 A;  1TRW A;  3DVX A;  1E2Y A;  3GTU B;  2REM A;  3ZVJ A;  3GH6 A;  4O92 A;  3F3R A;  1BQ7 A;  3RHB A;  2R6K A;  20GS A;  3ZRD A;  2L6D A;  1TK0 B;  2OA7 A;  3ZL5 A;  5FT3 A;  4YQU A;  1JZR A;  2PWJ A;  1NM3 A;  3GTU A;  4V2L A;  4Q5Q A;  1M0U A;  3LW9 A;  4HEA 2;  3ZVJ D;  2XHF A;  5DAK B;  4EF0 A;  4PUF C;  2K18 A;  1EEM A;  5AIX A;  1UC7 A;  3D0Z A;  4RQX A;  1GUL A;  4GRF A;  4AGS A;  2FA8 A;  5KN1 A;  5ELG A;  3O76 A;  1HNB A;  3RHC A;  5IMV A;  3ZZX A;  4WET A;  2GDR A;  2KLX A;  4J2F A;  7GSS A;  2CVB A;  4AJ6 A;  2C8U A;  3QOU A;  3F63 A;  5DJM A;  2H0G A;  2YV9 A;  2EIR A;  2LEG A;  2M72 A;  3D6I A;  4Q5F A;  2DBC A;  2VAF A;  2GZP A;  1K3O A;  2DKH A;  3U5R E;  4YKG A;  2CX3 A;  3GFK A;  4K0N A;  1JFU A;  2VLV A;  3IRA A;  3D4M A;  3TKS C;  2O87 A;  6GST A;  2EC4 A;  2VCX A;  2JSY A;  4HSC X;  4IQ1 A;  1HNA A;  4MDC A;  5CYY A;  1O7U A;  2DJ0 A;  3HVN A;  1S3R A;  4WR4 A;  1TK8 B;  3ERG A;  2LKU A;  1F9M A;  4ILF A;  3D21 A;  3ZIV A;  2CQ9 A;  1ZZY A;  4POB A;  3N9J A;  4ID0 A;  5G2Z A;  3W8J A;  1XCC A;  2HZF A;  1F3B A;  1TXX A;  2E0Q A;  2IN3 A;  4MZW A;  4DSR A;  6GSY A;  2FY6 A;  2FD3 A;  4KX4 A;  4RQR A;  3KTL A;  1G6W A;  4YAV A;  2VIM A;  3EE2 A;  2E2G A;  2DSA A;  1NW2 A;  4D73 B;  4RI6 A;  2GT6 A;  2J9H A;  1DUG A;  4EC0 A;  1KTE A;  2RUE A;  5F8B A;  3VLN A;  5L71 A;  2H72 A;  4RUV A;  1TTZ A;  1BG5 A;  4AJ8 A;  3CRT A;  3P90 A;  1C72 A;  4D73 A;  2M80 A;  1MD3 A;  1Z5Y E;  1TOF A;  1ZGN A;  1XIY A;  5BRT A;  4V1A g;  2VLU A;  2N5F A;  1VF4 A;  3FZ9 A;  3KMO A;  1YZX A;  4LA1 A;  1GWC A;  3F0I A;  1A0F A;  3KM6 A;  1PN0 A;  4IP6 A;  3BOA A;  2H73 A;  2HNL A;  2VM1 A;  3WGD A;  3EU3 A;  1JHB A;  3RPN A;  3G9B A;  4NPB A;  1B8X A;  1M2B A;  2IME A;  3VI7 A;  1UA5 A;  3TKS E;  1WWJ A;  1WOU A;  1PKZ A;  3HVX A;  3GMF A;  4LLR A;  2X8C A;  4HZ4 A;  2P5Q A;  2AHE A;  5DQS A;  3TRX A;  1V98 A;  1Z6M A;  4GQC A;  3IDV A;  22GS A;  4PNG A;  2P31 A;  3BJ5 A;  5FWG A;  2V6O A;  4PNF A;  4MMM A;  4MZB A;  1SYR A;  5DDL A;  2JZR A;  4J56 E;  2MMZ A;  3F9U A;  2C3N A;  1AW9 A;  4GLT A;  1HYU A;  4K5R A;  2UZ8 A;  1XW6 A;  3APQ A;  1JLV A;  2OE1 A;  2HYX A;  2IWT A;  2OAD A;  2XC2 A;  3L9U A;  3E3E A;  2LNS A;  2X4A A;  1KBN A;  3NIV A;  1GNE A;  2GT5 A;  3GX0 A;  5A4W A;  1OC8 A;  4YAP A;  1YEP A;  2LRT A;  3GX8 A;  4HOJ A;  2L59 A;  3DRN A;  3ZTL A;  3TUE A;  1T8E B;  2A2R A;  4ZB6 A;  1RQM A;  2WUL A;  1OC9 A;  2R4V A;  2MZC A;  2RUF A;  3KEB A;  2TRC P;  4OD7 A;  2I3Y A;  3GH9 A;  4KCE A;  3BD2 A;  3NOF A;  4I97 A;  3TJB A;  5A4U A;  6GSS A;  5B6M A;  4KGI A;  3GIX A;  1YF1 A;  2YV7 A;  4ZIJ A;  3FZ5 A;  2JAD A;  4E8H A;  1GSQ A;  4WKW A;  3G7J A;  1TW9 A;  2PMT A;  4MJA A;  3PH9 A;  2YCD A;  2V2G A;  2IJY A;  4USS A;  3VPQ A;  2V6K A;  5DJL A;  1OE8 A;  2FCH A;  1SD9 A;  2CV4 A;  2CVK A;  3GV1 A;  3UEM A;  4E8E A;  1M2D A;  3GUR A;  5ENU A;  4MA9 A;  4K7O A;  4JBB A;  3TGZ A;  2VL9 A;  4IKH A;  3KH7 A;  3QPM A;  2DJK A;  2H8L A;  3ISO A;  4OWY A;  1ZOF A;  2WS2 A;  4NHW A;  6GSW A;  3ZYW A;  4PTS A;  2F8A A;  1EOG A;  1FB0 A;  1M2A A;  4OFT A;  4EO3 A;  4DSS B;  3LGC A;  1FG4 A;  3LSZ A;  1Q98 A;  5HR2 A;  3GSS A;  3RAZ A;  4MF7 A;  5CRH A;  5IQY A;  2C3T A;  2J23 A;  3P8W A;  4HS1 A;  3LQ7 A;  3TB2 A;  4MF6 A;  1M9A A;  2IMK A;  1CQH A;  3A2V A;  1YKC A;  2HXK A;  1KEB A;  4G0I A;  1OKD A;  1HNC A;  4NV5 A;  3WGX A;  5A4V A;  3WT2 A;  5D8I A;  4K8M A;  1BAY A;  1ZYN A;  5IIZ A;  4DEJ A;  3BBY A;  1GSE A;  2L4C A;  3MDK A;  1ERT A;  2VOC A;  2B7J A;  5GSS A;  3FR3 A;  1U87 A;  4GXZ A;  1SL0 B;  3N5O A;  1BJX A;  5LD0 A;  1GSU A;  3O3T A;  4F0B A;  4KND A;  4CHS A;  2VCQ A;  5E59 A;  5AN1 A;  1VF1 A;  1XG8 A;  5G1K A;  1S3C A;  1DSB A;  5F05 A;  2R3X A;  3H1N A;  1PX7 A;  3EMX A;  4HZ2 A;  2A4H A;  5DAL A;  4N0Z A;  2CT6 A;  1Z7P A;  5LNK e;  4IP1 A;  3QAV A;  5B8B A;  1FB6 A;  1RK4 A;  3FW2 A;  2H6X A;  5ABR A;  3KD0 A;  3EMP A;  5ID2 B;  1I5G A;  1QXH A;  4XS1 A;  2LNT A;  5IPH A;  1OC3 A;  2N5B A;  4JE1 A;  3GN3 A;  3DXB A;  3C8E A;  4EDZ A;  4EXJ A;  2QGV A;  5ID2 A;  1AIU A;  2EIO A;  1AUC A;  4HU9 A;  3M9J A;  2MMN A;  4ICY A;  5D9W A;  2PPT A;  3DD3 A;  3KH9 A;  4MCU A;  5CRD A;  1PA3 A;  1TK5 B;  1F37 A;  1SJI A;  1WP0 A;  2CX4 A;  1X9W B;  2LJK A;  4Q5R A;  3PR8 A;  4Q5N A;  1URM A;  2FWG A;  4IGJ A;  4A5P A;  2VM2 A;  3WGE A;  3HXS A;  3VWV A;  4LL1 B;  5J5N A;  1A2J A;  2O7K A;  2KOK A;  3DWV A;  4FIW A;  1VGL A;  1N2A A;  2B5Y A;  2X8G A;  4HQZ A;  4WEY A;  3TJG A;  3GKN A;  5G5F A;  2PUK C;  4BWQ A;  4OCF A;  2OBK A;  3CBU A;  4ZIL A;  4KDY A;  3G7Y A;  4MJC A;  1ZL9 A;  2F51 A;  1B9X C;  5J41 A;  2VCT A;  2JZT A;  4HUA A;  2JAC A;  2B6M A;  1TI1 A;  1SEN A;  2QC7 A;  2G0F A;  5ECM B;  1FVJ A;  5J9B A;  4OFN A;  3KP9 A;  1AQX A;  4AF2 A;  5DCH A;  3UIW A;  4QQ7 A;  1GTU A;  2FUG 2;  2B5E A;  4F82 A;  1TKD B;  3HVS A;  2C0G A;  3TDG A;  4OO5 A;  3QD9 A;  2X49 A;  2GSS A;  3ZMK A;  3ZIT A;  4PXO A;  1AAZ A;  4JZQ A;  3US3 A;  2H74 A;  1OVN A;  1U3A A;  2IL3 A;  4CW9 A;  1EP8 A;  1GP1 A;  4OFM A;  1Q4J A;  1MTC A;  2JL4 A;  1R5A A;  1DBY A;  2WGR A;  3I9V 2;  1SD8 A;  3HA9 A;  1X5D A;  2LST A;  1K3Y A;  1PQN A;  1O73 A;  3DVW A;  3GA4 A;  4TW5 A;  1X5C A;  5B8A A;  3P7X A;  4LMV A;  1ON4 A;  5BMU A;  1Z3E A;  2YWM A;  2K9F A;  1RW1 A;  4JR4 A;  1XWB A;  3GUS A;  1IYH A;  2B3S A;  5IMZ A;  2RM5 A;  3IC8 A;  4OCE A;  3LXT A;  2HRA A;  4ACS A;  1FO5 A;  2K6V A;  4FYB A;  3UL3 A;  3EPT A;  3CMI A;  3APO A;  1QK8 A;  3FY7 A;  3BCI A;  3J7Y b;  3NZN A;  2WZ9 A;  5GAN D;  4IQA A;  1A24 A;  4V2M A;  3LYK A;  3ZLP A;  2F8F A;  1S3D A;  1X9M B;  1WIK A;  2LV3 A;  4ZBB A;  3PPU A;  2CZ2 A;  4HU7 A;  3IHQ A;  4X1U A;  3TRP A;  2KP1 A;  2HZE A;  4EKZ A;  5JWR B;  2LQQ A;  4MF5 A;  5HR0 A;  4F0C A;  1F6M C;  5CRG A;  5CO3 A;  2VCW A;  8GSS A;  2VL2 C;  4JRR A;  1EEJ A;  5CRW A;  4N0V A;  5G5E A;  3HJM A;  2AYT A;  2PN8 A;  2H0I A;  4K9Z A;  2A4V A;  1UVZ A;  3QAW A;  1SYX A;  5ECK B;  1A23 A;  3F3Q A;  4L5L A;  4I2T A;  1WJK A;  5FHI A;  3FZ4 A;  2YWI A;  3GKX A;  5ELA A;  2DJJ A;  3MWH A;  4IEL A;  1MD4 A;  1ZYP A;  2B1L A;  4F9Z A;  4IW9 A;  4X4J A;  3E0U A;  4YQV A;  2KUC A;  2NTO A;  3QMX A;  2GZY A;  3EVI A;  3Q18 A;  5AGY A;  3LEF A;  2A2S A;  4ZB8 A;  5KN3 A;  4N11 A;  2V1M A;  4DSQ A;  5KOX A;  1PMT A;  4I6X A;  1AXD A;  4BA7 A;  4Z2T A;  2XPD A;  2FWH A;  4X0X A;  3EIN A;  4HQS A;  2H71 A;  2YWN A;  2H6Z A;  2TIR A;  5HQP A;  19GS A;  3A5I A;  4F2I A;  4KDX A;  3GYK A;  1K0B A;  5DCG A;  2I81 A;  4TRX A;  1WMJ A;  3KGK A;  3UAP A;  2RII A;  3KCM A;  3IXR A;  5D73 A;  3I6A A;  4BPY A;  4PUR A;  4WBJ A;  3H93 A;  2FGX A;  2GQM A;  3VPT A;  4IS0 A;  2CA8 A;  3HDC A;  2AB6 A;  2VD1 A;  1ZYE A;  1QQ2 A;  4XIH A;  4CDO A;  1GLQ A;  3L78 A;  4PX1 A;  4MJE A;  2HFD A;  3I43 A;  3HHV A;  4TXV A;  1K0C A;  5D93 A;  1YDK A;  4HI7 A;  1OC9 B;  3F4T A;  5HFI A;  2H1G A;  1CQG A;  4ML6 A;  1EGO A;  2PU9 C;  1O8W A;  5GST A;  3FYG A;  2ES7 A;  4YH2 A;  5J9C A;  3CQF A;  1R5P A;  1T3B A;  3G7I A;  5ECO B;  2H19 A;  3RDW A;  4N30 A;  1FOH A;  4L0W A;  1ERW A;  4K5S A;  2KP2 A;  3ZFL A;  2GS3 A;  1A2L A;  1ZYQ B;  1G6Y A;  5GAP D;  4KDU A;  3FKF A;  2P0G A;  2PER A;  2IMI A;  4MNN A;  1GRX A;  3KZQ A;  2ON5 A;  2VD0 A;  5H5S A;  1E6B A;  3W8S A;  2E2M A;  2YJH A;  4I5Q A;  1BX9 A;  1FVK A;  1SJ6 A;  2IMF A;  2PVQ A;  4XTS A;  4CY8 A;  1T00 A;  5ECN B;  3Q19 A;  2HLS A;  3TJK A;  3UMA A;  4WF4 A;  1PSQ A;  2VL3 A;  5INY A;  2WB9 A;  4ECC A;  1WE0 A;  4TR0 A;  1XVW A;  3SWL A;  1UN2 A;  4TR1 A;  2HT9 A;  2L4Q A;  4XS4 A;  3FZA A;  3KXO A;  1QFN A;  1XZO A;  1A8Y A;  3FEU A;  4N10 A;  4IBP A;  3LFL A;  1YJ6 A;  1TI3 A;  3GL5 A;  3MNG A;  4NXI A;  1EWX A;  2AUV A;  2JSZ A;  3H8Q A;  4V1A p;  1HD2 A;  3ERF A;  2FNO A;  4PUA A;  5G31 A;  4KSO A;  4BVY B;  1G7O A;  2I4A A;  1K0A A;  3IA1 A;  1X9S B;  2I1U A;  3ME7 A;  1HQO A;  2AJQ B;  2H1A A;  2YZU A;  1XFL A;  1XOB A;  3QAG A;  2HSH A;  1QUW A;  1W89 A;  5IMC A;  4BVY A;  4EDY A;  4G9H A;  5F07 A;  2BJX A;  1JLW A;  5CRE A;  2OAC A;  4V2N A;  4KSM A;  5DBQ A;  1PFO A;  2BMX A;  5E4W A;  3HCZ A;  3VUR A;  1PN9 A;  1YEX A;  2DML A;  2F3M A;  5DAL B;  4O5Q A;  3GST A;  4ZBA A;  5EL8 A;  3EUR A;  3PIN A;  4KUN A;  3M8N A;  4TVE A;  1BYE A;  4KCA A;  14GS A;  1ERU A;  4NAX A;  4DVC A;  3IHG A;  2X8H A;  4MH3 A;  2YPM A;  6GSX A;  1Y25 A;  1EZK A;  6GSU A;  2CAQ A;  5IPG A;  3KIJ A;  2ZCT A;  4OO4 A;  3JCM L;  3TKS A;  3GKM A;  2FHE A;  2X99 A;  3QR6 A;  4KAE A;  3RBT A;  5IMD A;  2IFQ B;  4RI7 A;  4ISD A;  2F9S A;  2ON7 A;  2LJR A;  4ZL8 A;  1BED A;  5CNW A;  4KH7 A;  1USB A;  1PX6 A;  3D4T A;  4KF9 A;  1TRS A;  2BTO T;  4TXO B;  5DQY A;  3C1R A;  5EPF A;  1LBK A;  1T7P B;  5J4U A;  4PGT A;  2IFQ A;  3GKK A;  1Z9H A;  2K8S A;  2WFC A;  2GSR A;  2WCI A;  3S9F A;  3ERW A;  4G10 A;  3J7Y k;  3TKQ A;  3M0F A;  4TXO A;  5AIV A;  1GNW A;  2YZH A;  1LJR A;  1J0F A;  1M99 A;  1XWK A;  5B7C A;  1WPI A;  1GH2 A;  2HRN A;  3L9S A;  3LG6 A;  1ZCP A;  4GWR A;  1VF2 A;  1PD2 1;  3UBK A;  5CP1 A;  1FAA A;  3F4S A;  3IR4 A;  5IMF A;  3FR6 A;  4K7N A;  3MIX A;  2MBS A;  3KMN A;  3LOR A;  4HJM A;  4NWY A;  1MDI A;  3TKR A;  3IK9 A;  2MBT A;  3OR5 A;  4O5U A;  1GL8 A;  3RPP A;  4XCS A;  5KN0 A;  10GS A;  3UVH A;  4EVM A;  4GST A;  1W4V A;  1FHE A;  16GS A;  5KEJ A;  1MDK A;  1ERV A;  2DIZ A;  5IO2 A;  2R37 A;  3I69 A;  4JR6 A;  5A5K A;  2GQK A;  4GF0 A;  2VUP A;  3HJO A;  1EOH A;  4L8E A;  2YAN A;  1U3I A;  1I9D A;  4LL4 B;  3M1G A;  4XHM A;  3U6V A;  5JCW A;  3IK7 A;  1GSF A;  2GLR A;  1Z6N A;  4MP4 A;  1A8L A;  1FOV A;  4G0L A;  3SBC A;  2LJA A;  2QKE A;  4EIP A;  2YWO A;  4BVX B;  4G19 A;  1KNG A;  1GLP A;  4EIQ A;  4NHZ A;  1PRX A;  1SKS B;  3HVV A;  1GUK A;  1QMV A;  2XPE A;  1ACV A;  4BVX A;  4Z2U A;  4L0U A;  4MZC A;  3VWW A;  4O7H A;  1OKT A;  3DKS A;  1R4W A;  1GUH A;  4BIK A;  1SU9 A;  5KN2 A;  1H75 A;  1M7T A;  9GSS A;  4ECB A;  3ME8 A;  5D9V A;  3Q74 A;  1XVQ A;  4AJ7 A;  5DAK A;  1SKW B;  3UOM A;  5JWQ B;  2FLS A;  3R3E A;  2C0F A;  11GS A;  3TKP A;  3VWU A;  2VLT A;  4WR5 A;  2YN1 A;  3TOU A;  1ILO A;  1J08 A;  1Y6E A;  2EIQ A;  1IYI A;  4FQU A;  3Q6O A;  3FHK A;  1B9Y C;  5CAX A;  3ZFB A;  2QA2 A;  3IV4 A;  4K0G A;  5ECL B;  3K8N A;  4K2D A;  3GRX A;  4GSN A;  2HZE B;  2R0C A;  1ST9 A;  4OMV A;  3GNJ A;  4ML1 A;  13GS A;  2R0P A;  2HE3 A;  3DEX A;  5JCG A;  4XRA A;  4NV2 A;  3L0H A;  4QL9 A;  2YP6 A;  2O85 A;  4L5O A;  1SK1 A;  2HRF A;  2JU5 A;  5H5Q A;  5C00 A;  4TOP A;  3EC3 A;  4TN8 A;  5HFG A;  3ZML A;  1O81 A;  1U88 A;  1B48 A;  2NVL A;  1TRV A;  1XWA A;  3QFB C;  2WDU A;  5IO0 A;  2D2Z A;  3A2W A;  2TRX A;  3TJF A;  4ECJ A;  1PL1 A;  4MJB A;  2C1Y A;  2LRN A;  3EYT A;  3A3T A;  3TOT A;  4GCI A;  3L9V A;  3MYD A;  2O89 A;  2LS5 A;  2LRC A;  4PQI A;  1PGT A;  1XPV A;  4WF5 A;  1R7H A;  4FYU A;  5ECH B;  1F2E A;  5D96 A;  1XBS A;  2O8V B;  2N5A A;  2IIY A;  1H4O A;  4PQ1 A;  1VRS D;  2H75 A;  2OKA A;  2H1B A;  2WJU A;  2K8V A;  4LMW A;  4IN0 A;  4Z2R A;  1Z7R A;  5D9X A;  1TU7 A;  3TRQ A;  2HSY A;  2L5L A;  4PQH A;  1NSW A;  2KHP A;  5DVB A;  2NBS A;  3F4R A;  5EVO A;  1OE7 A;  1MDJ A;  4TR4 A;  2R0G A;  1TRU A;  3LXZ A;  1SL2 B;  3F6D A;  3HYP A;  1O8X A;  2OE0 A;  5KOW A;  3KP8 A;  1X0R A;  2YJ7 A;  1GSD A;  2PVO C;  2M46 A;  1AQW A;  4ZB9 A;  2E7P A;  3HD5 A;  3HKR A;  5HR3 A;  1A0R P;  1G7E A;  4MAB A;  2ALB A;  3A5W A;  1B4P A;  3QDN A;  4MH2 A;  1T4Z A;  1JZD A;  2HSM A;  2QSI A;  1V9W A;  1VF3 A;  4MLY A;  1SKR B;  2C0E A;  4EL1 A;  2LQO A;  2MMO A;  17GS A;  4IHU A;  1LU4 A;  4KE3 A;  4POL A;  1O85 A;  3C73 A;  3MAK A;  3IAS 2;  4KA0 A;  4ZBD A;  2FWF A;  5AIS A;  3IBH A;  2VCV A;  2RM6 A;  2NPB A;  3HJP A;  2JZS A;  2AV4 A;  4MK3 A;  4WBR D;  3EWL A;  5IOW A;  3O6T A;  4JU5 A;  4EUY A;  1V40 A;  3H4K A;  4IVF A;  3KTB A;  1SJZ A;  4FH8 A;  4Z7X A;  2DJ2 A;  3C1S A;  2GGT A;  2H1D A;  1T4Y A;  2Z9S A;  2H30 A;  3CXG A;  2G2Q A;  3HY2 A;  2C3Q A;  3E9J B;  1JZW A;  1T1V A;  4F03 A;  4I2U A;  1OYJ A;  1ABA A;  2DJ3 A;  2B7K A;  4J57 E;  2ZUP A;  4ZL9 A;  1XXU A;  3DIE A;  2X64 A;  3PGT A;  4BL7 B;  2IMD A;  5ECI B;  2CZ3 A;  2C0D A;  2DC5 A;  1GTI A;  4TR1 B;  3TCO A;  4XS4 B;  2GSQ A;  1DE1 A;  2HI7 A;  3UVT A;  2I9H A;  3CRU A;  4BL7 A;  3HZ8 A;  1EGR A;  4K1F A;  1GTB A;  3UAR A;  2FWE A;  1EP7 A;  2CAI A;  3AY8 A;  4X43 A;  1SL1 B;  3IC4 A;  1K0N A;  3IE3 A;  3VI5 A;  2QA1 A;  4ZL7 A;  2V32 A;  3H79 A;  2A2P A;  1PL2 A;  2H6Y A;  1O6J A;  4JED A;  1V57 A;  4CY6 A;  2OJL A;  2GVP A;  1QGV A;  3FK8 A;  4O5R A;  5ECQ B;  4GQF A;  2HRK A;  3LWA A;  2GQL A;  2OE3 A;  3FMW A;  5G30 A;  5F0G A;  2C80 A;  2XBQ A;  4MPG A;  1R26 A;  3BCK A;  5H5R A;  2VO4 A;  3DML A;  2DJ1 A;  2DMM A;  5JWO B;  2R5G A;  4IJI A;  3M9K A;  2L57 A;  4DSS A;  1MEK A;  1XW9 A;  2LUS A;  2PGT A;  5HFK A;  3R2Q A;  5D9T A;  12GS A;  1SK0 A;  2CVD A;  3GHA A;  4HDE A;  1JZO A;  2L6C A;  4G2E A;  4TR3 A;  2LTK A;  1YY7 A;  2GTU A;  3KJY A;  3CYN A;  2H66 A;  1YF0 A;  1TU8 A;  1M3J A;  3ZRE A;  3QFA C;  4ZXG A;  1NHO A;  4EE0 A;  1EV9 A;  4XS6 A;  2FA4 A;  5IMA A;  2H70 A;  5EY6 A;  18GS A;  2NDO A;  3CSH A;  3CTF A;  2VCZ A;  4QL7 A;  3WT1 A;  2DIY A;  5GZZ B;  2YNX A;  1GUM A;  3LJR A;  4IJ3 A;  3D22 A;  3CSI A;  5IM9 A;  1GSS A;  5IOX A;  2PBJ A;  2H01 A;  1V2A A;  1ZMA A;  5JCU A;  3F6F A;  2L5O A;  4POK A;  1DE2 A;  1WRY A;  3HZ4 A;  1OAZ A;  1TDI A;  4K7I A;  4P3Y B;  1YKA A;  3ZIJ A;  1NHY A;  2RLI A;  3V1W A;  5ECP B;  1SK2 A;  1AC1 A;  3APS A;  1N8J A;  4GTU A;  3WYW A;  4K6X A;  4MPF A;  2B5X A;  3MSZ A;  4NMU A;  3C7M A;  4KB3 A;  4POM A;  2ZNM A;  1THX A;  1A2M A;  2AAW A;  4BWS A;  3VWX A;  3DGQ A;  4K2X A;  1THO A;  3EU4 A;  1TJD A;  4HJ2 A;  1J9B A;  5G1L A;  3F8U A;  4KW6 A;  1AQV A; 
#chains in the Genus database with same CATH homology
 4G0K A;  3ED3 A;  5LCZ A;  4O32 A;  1K0M A;  2IPA A;  1X5E A;  2VL2 A;  1PKW A;  2R2J A;  2H76 A;  4ECI A;  5HR1 A;  3UBL A;  1ML6 A;  1V58 A;  3FR9 A;  5J3R A;  3FRC A;  5ECS A;  1YQ1 A;  4GSS A;  1U6T A;  3CTG A;  1XOA A;  3IOS A;  3UJ1 A;  1GTA A;  1EV4 A;  2P5R A;  3D5J A;  2OBI A;  3IAM 2;  5B6N A;  3IPZ A;  4FYC A;  4XRD A;  1K0O A;  3TJJ A;  3P2A A;  2WRT A;  1XWG A;  5COH A;  5C04 A;  3DYR A;  2MYG A;  3C71 A;  4H86 A;  2GST A;  4FO5 A;  1B4Q A;  2H0H A;  2V41 A;  2GZZ A;  1XWC A;  3GL3 A;  6GSV A;  3LYP A;  1M9B A;  1F3A A;  2DLX A;  3L4N A;  5F06 A;  1G0T A;  3VK9 A;  1S3A A;  4I8B A;  1K3L A;  3M3M A;  2YOI A;  2MMA A;  2XBI A;  2B1K A;  3QCP A;  4YKF A;  3W6G A;  4WXT A;  1K0D A;  2C4J A;  4TKY A;  3WD6 A;  1FW1 A;  3A2X A;  4YQM A;  3VFI A;  1TP9 A;  2DKI A;  1GSY A;  3CSJ A;  5ECR B;  4ULX A;  1XW5 A;  1TRW A;  3DVX A;  1E2Y A;  3GTU B;  2REM A;  3ZVJ A;  3GH6 A;  4O92 A;  3F3R A;  1BQ7 A;  3RHB A;  2R6K A;  20GS A;  3ZRD A;  2L6D A;  1TK0 B;  2OA7 A;  3ZL5 A;  5FT3 A;  4YQU A;  1JZR A;  2PWJ A;  1NM3 A;  3GTU A;  4V2L A;  4Q5Q A;  1M0U A;  3LW9 A;  4HEA 2;  3ZVJ D;  2XHF A;  5DAK B;  4EF0 A;  4PUF C;  2K18 A;  1EEM A;  5AIX A;  1UC7 A;  3D0Z A;  4RQX A;  1GUL A;  4GRF A;  4AGS A;  2FA8 A;  5KN1 A;  5ELG A;  3O76 A;  1HNB A;  3RHC A;  5IMV A;  3ZZX A;  4WET A;  2GDR A;  2KLX A;  4J2F A;  7GSS A;  2CVB A;  4AJ6 A;  2C8U A;  3QOU A;  3F63 A;  5DJM A;  2H0G A;  2YV9 A;  2EIR A;  2LEG A;  2M72 A;  3D6I A;  4Q5F A;  2DBC A;  2VAF A;  2GZP A;  1K3O A;  2DKH A;  3U5R E;  4YKG A;  2CX3 A;  3GFK A;  4K0N A;  1JFU A;  2VLV A;  3IRA A;  3D4M A;  3TKS C;  2O87 A;  6GST A;  2EC4 A;  2VCX A;  2JSY A;  4IQ1 A;  1HNA A;  4MDC A;  5CYY A;  1O7U A;  2DJ0 A;  4WR4 A;  1TK8 B;  3ERG A;  2LKU A;  1F9M A;  4ILF A;  3D21 A;  3ZIV A;  2CQ9 A;  1ZZY A;  4POB A;  3N9J A;  4ID0 A;  5G2Z A;  3W8J A;  1XCC A;  2HZF A;  1F3B A;  1TXX A;  2E0Q A;  2IN3 A;  4MZW A;  4DSR A;  6GSY A;  2FY6 A;  2FD3 A;  4KX4 A;  4RQR A;  3KTL A;  1G6W A;  4YAV A;  2VIM A;  3EE2 A;  2E2G A;  2DSA A;  1NW2 A;  4D73 B;  4RI6 A;  2GT6 A;  2J9H A;  1DUG A;  4EC0 A;  1KTE A;  2RUE A;  5F8B A;  3VLN A;  5L71 A;  2H72 A;  4RUV A;  1TTZ A;  1BG5 A;  4AJ8 A;  3CRT A;  3P90 A;  1C72 A;  4D73 A;  2M80 A;  1MD3 A;  1Z5Y E;  1TOF A;  1ZGN A;  1XIY A;  5BRT A;  4V1A g;  2VLU A;  2N5F A;  1VF4 A;  3FZ9 A;  3KMO A;  1YZX A;  4LA1 A;  1GWC A;  3F0I A;  1A0F A;  3KM6 A;  1PN0 A;  4IP6 A;  3BOA A;  2H73 A;  2HNL A;  2VM1 A;  3WGD A;  3EU3 A;  1JHB A;  3RPN A;  3G9B A;  4NPB A;  1B8X A;  1M2B A;  2IME A;  3VI7 A;  1UA5 A;  3TKS E;  1WWJ A;  1WOU A;  1PKZ A;  3HVX A;  3GMF A;  4LLR A;  2X8C A;  4HZ4 A;  2P5Q A;  2AHE A;  5DQS A;  3TRX A;  1V98 A;  1Z6M A;  4GQC A;  3IDV A;  22GS A;  4PNG A;  2P31 A;  3BJ5 A;  5FWG A;  2V6O A;  4PNF A;  4MMM A;  4MZB A;  1SYR A;  5DDL A;  2JZR A;  4J56 E;  2MMZ A;  3F9U A;  2C3N A;  1AW9 A;  4GLT A;  1HYU A;  4K5R A;  2UZ8 A;  1XW6 A;  3APQ A;  1JLV A;  2OE1 A;  2HYX A;  2IWT A;  2OAD A;  2XC2 A;  3L9U A;  3E3E A;  2LNS A;  2X4A A;  1KBN A;  3NIV A;  1GNE A;  2GT5 A;  3GX0 A;  5A4W A;  1OC8 A;  4YAP A;  1YEP A;  2LRT A;  3GX8 A;  4HOJ A;  2L59 A;  3DRN A;  3ZTL A;  3TUE A;  1T8E B;  2A2R A;  4ZB6 A;  1RQM A;  2WUL A;  1OC9 A;  2R4V A;  2MZC A;  2RUF A;  3KEB A;  2TRC P;  4OD7 A;  2I3Y A;  3GH9 A;  4KCE A;  3BD2 A;  3NOF A;  4I97 A;  3TJB A;  5A4U A;  6GSS A;  5B6M A;  4KGI A;  3GIX A;  1YF1 A;  2YV7 A;  4ZIJ A;  3FZ5 A;  2JAD A;  4E8H A;  1GSQ A;  4WKW A;  3G7J A;  1TW9 A;  2PMT A;  4MJA A;  3PH9 A;  2YCD A;  2V2G A;  2IJY A;  4USS A;  3VPQ A;  2V6K A;  5DJL A;  1OE8 A;  2FCH A;  1SD9 A;  2CV4 A;  2CVK A;  3GV1 A;  3UEM A;  4E8E A;  1M2D A;  3GUR A;  5ENU A;  4MA9 A;  4K7O A;  4JBB A;  3TGZ A;  2VL9 A;  4IKH A;  3KH7 A;  3QPM A;  2DJK A;  2H8L A;  3ISO A;  4OWY A;  1ZOF A;  2WS2 A;  4NHW A;  6GSW A;  3ZYW A;  4PTS A;  2F8A A;  1EOG A;  1FB0 A;  1M2A A;  4OFT A;  4EO3 A;  4DSS B;  3LGC A;  1FG4 A;  3LSZ A;  1Q98 A;  5HR2 A;  3GSS A;  3RAZ A;  4MF7 A;  5CRH A;  5IQY A;  2C3T A;  2J23 A;  3P8W A;  4HS1 A;  3LQ7 A;  3TB2 A;  4MF6 A;  1M9A A;  2IMK A;  1CQH A;  3A2V A;  1YKC A;  2HXK A;  1KEB A;  4G0I A;  1OKD A;  1HNC A;  4NV5 A;  3WGX A;  5A4V A;  3WT2 A;  5D8I A;  4K8M A;  1BAY A;  1ZYN A;  5IIZ A;  4DEJ A;  3BBY A;  1GSE A;  2L4C A;  3MDK A;  1ERT A;  2VOC A;  2B7J A;  5GSS A;  3FR3 A;  1U87 A;  4GXZ A;  1SL0 B;  3N5O A;  1BJX A;  5LD0 A;  1GSU A;  3O3T A;  4F0B A;  4KND A;  4CHS A;  2VCQ A;  5E59 A;  5AN1 A;  1VF1 A;  5G1K A;  1S3C A;  1DSB A;  5F05 A;  2R3X A;  3H1N A;  1PX7 A;  3EMX A;  4HZ2 A;  2A4H A;  5DAL A;  4N0Z A;  2CT6 A;  1Z7P A;  5LNK e;  4IP1 A;  3QAV A;  5B8B A;  1FB6 A;  1RK4 A;  3FW2 A;  2H6X A;  5ABR A;  3KD0 A;  3EMP A;  5ID2 B;  1I5G A;  1QXH A;  4XS1 A;  2LNT A;  5IPH A;  1OC3 A;  2N5B A;  4JE1 A;  3GN3 A;  3DXB A;  3C8E A;  4EDZ A;  4EXJ A;  2QGV A;  5ID2 A;  1AIU A;  2EIO A;  1AUC A;  4HU9 A;  3M9J A;  2MMN A;  4ICY A;  5D9W A;  2PPT A;  3DD3 A;  3KH9 A;  4MCU A;  5CRD A;  1PA3 A;  1TK5 B;  1F37 A;  1SJI A;  1WP0 A;  2CX4 A;  1X9W B;  2LJK A;  4Q5R A;  3PR8 A;  4Q5N A;  1URM A;  2FWG A;  4IGJ A;  4A5P A;  2VM2 A;  3WGE A;  3HXS A;  3VWV A;  4LL1 B;  5J5N A;  1A2J A;  2O7K A;  2KOK A;  3DWV A;  4FIW A;  1VGL A;  1N2A A;  2B5Y A;  2X8G A;  4HQZ A;  4WEY A;  3TJG A;  3GKN A;  5G5F A;  2PUK C;  4BWQ A;  4OCF A;  2OBK A;  3CBU A;  4ZIL A;  4KDY A;  3G7Y A;  4MJC A;  1ZL9 A;  2F51 A;  1B9X C;  5J41 A;  2VCT A;  2JZT A;  4HUA A;  2JAC A;  2B6M A;  1TI1 A;  1SEN A;  2QC7 A;  2G0F A;  5ECM B;  1FVJ A;  5J9B A;  4OFN A;  3KP9 A;  1AQX A;  4AF2 A;  5DCH A;  3UIW A;  4QQ7 A;  1GTU A;  2FUG 2;  2B5E A;  4F82 A;  1TKD B;  3HVS A;  2C0G A;  3TDG A;  4OO5 A;  3QD9 A;  2X49 A;  2GSS A;  3ZMK A;  3ZIT A;  4PXO A;  1AAZ A;  4JZQ A;  3US3 A;  2H74 A;  1OVN A;  1U3A A;  2IL3 A;  4CW9 A;  1EP8 A;  1GP1 A;  4OFM A;  1Q4J A;  1MTC A;  2JL4 A;  1R5A A;  1DBY A;  2WGR A;  3I9V 2;  1SD8 A;  3HA9 A;  1X5D A;  2LST A;  1K3Y A;  1PQN A;  1O73 A;  3DVW A;  3GA4 A;  4TW5 A;  1X5C A;  5B8A A;  3P7X A;  4LMV A;  1ON4 A;  5BMU A;  1Z3E A;  2YWM A;  2K9F A;  1RW1 A;  4JR4 A;  1XWB A;  3GUS A;  1IYH A;  2B3S A;  5IMZ A;  2RM5 A;  3IC8 A;  4OCE A;  3LXT A;  2HRA A;  4ACS A;  1FO5 A;  2K6V A;  4FYB A;  3UL3 A;  3EPT A;  3CMI A;  3APO A;  1QK8 A;  3FY7 A;  3BCI A;  3J7Y b;  3NZN A;  2WZ9 A;  5GAN D;  4IQA A;  1A24 A;  4V2M A;  3LYK A;  3ZLP A;  2F8F A;  1S3D A;  1X9M B;  1WIK A;  2LV3 A;  4ZBB A;  3PPU A;  2CZ2 A;  4HU7 A;  3IHQ A;  4X1U A;  3TRP A;  2KP1 A;  2HZE A;  4EKZ A;  5JWR B;  2LQQ A;  4MF5 A;  5HR0 A;  4F0C A;  1F6M C;  5CRG A;  5CO3 A;  2VCW A;  8GSS A;  2VL2 C;  4JRR A;  1EEJ A;  5CRW A;  4N0V A;  5G5E A;  3HJM A;  2AYT A;  2PN8 A;  2H0I A;  4K9Z A;  2A4V A;  1UVZ A;  3QAW A;  1SYX A;  5ECK B;  1A23 A;  3F3Q A;  4L5L A;  4I2T A;  1WJK A;  5FHI A;  3FZ4 A;  2YWI A;  3GKX A;  5ELA A;  2DJJ A;  3MWH A;  4IEL A;  1MD4 A;  1ZYP A;  2B1L A;  4F9Z A;  4IW9 A;  4X4J A;  3E0U A;  4YQV A;  2KUC A;  2NTO A;  3QMX A;  2GZY A;  3EVI A;  3Q18 A;  5AGY A;  3LEF A;  2A2S A;  4ZB8 A;  5KN3 A;  4N11 A;  2V1M A;  4DSQ A;  5KOX A;  1PMT A;  4I6X A;  1AXD A;  4BA7 A;  4Z2T A;  2XPD A;  2FWH A;  4X0X A;  3EIN A;  4HQS A;  2H71 A;  2YWN A;  2H6Z A;  2TIR A;  5HQP A;  19GS A;  3A5I A;  4F2I A;  4KDX A;  3GYK A;  1K0B A;  5DCG A;  2I81 A;  4TRX A;  1WMJ A;  3KGK A;  3UAP A;  2RII A;  3KCM A;  3IXR A;  5D73 A;  3I6A A;  4BPY A;  4PUR A;  4WBJ A;  3H93 A;  2FGX A;  2GQM A;  3VPT A;  4IS0 A;  2CA8 A;  3HDC A;  2AB6 A;  2VD1 A;  1ZYE A;  1QQ2 A;  4XIH A;  4CDO A;  1GLQ A;  3L78 A;  4PX1 A;  4MJE A;  2HFD A;  3I43 A;  3HHV A;  4TXV A;  1K0C A;  5D93 A;  1YDK A;  4HI7 A;  1OC9 B;  3F4T A;  5HFI A;  2H1G A;  1CQG A;  4ML6 A;  1EGO A;  2PU9 C;  1O8W A;  5GST A;  3FYG A;  2ES7 A;  4YH2 A;  5J9C A;  1R5P A;  1T3B A;  3G7I A;  5ECO B;  2H19 A;  3RDW A;  4N30 A;  1FOH A;  4L0W A;  1ERW A;  4K5S A;  2KP2 A;  3ZFL A;  2GS3 A;  1A2L A;  1ZYQ B;  1G6Y A;  5GAP D;  4KDU A;  3FKF A;  2P0G A;  2PER A;  2IMI A;  4MNN A;  1GRX A;  3KZQ A;  2ON5 A;  2VD0 A;  5H5S A;  1E6B A;  3W8S A;  2E2M A;  2YJH A;  4I5Q A;  1BX9 A;  1FVK A;  1SJ6 A;  2IMF A;  2PVQ A;  4XTS A;  4CY8 A;  1T00 A;  5ECN B;  3Q19 A;  2HLS A;  3TJK A;  3UMA A;  4WF4 A;  1PSQ A;  2VL3 A;  5INY A;  2WB9 A;  4ECC A;  1WE0 A;  4TR0 A;  1XVW A;  3SWL A;  1UN2 A;  4TR1 A;  2HT9 A;  2L4Q A;  4XS4 A;  3FZA A;  3KXO A;  1QFN A;  1XZO A;  1A8Y A;  3FEU A;  4N10 A;  4IBP A;  3LFL A;  1YJ6 A;  1TI3 A;  3GL5 A;  3MNG A;  4NXI A;  1EWX A;  2AUV A;  2JSZ A;  3H8Q A;  4V1A p;  1HD2 A;  3ERF A;  2FNO A;  4PUA A;  5G31 A;  4KSO A;  4BVY B;  1G7O A;  2I4A A;  1K0A A;  3IA1 A;  1X9S B;  2I1U A;  3ME7 A;  1HQO A;  2AJQ B;  2H1A A;  2YZU A;  1XFL A;  1XOB A;  3QAG A;  2HSH A;  1QUW A;  1W89 A;  5IMC A;  4BVY A;  4EDY A;  4G9H A;  5F07 A;  2BJX A;  1JLW A;  5CRE A;  2OAC A;  4V2N A;  4KSM A;  5DBQ A;  2BMX A;  5E4W A;  3HCZ A;  3VUR A;  1PN9 A;  1YEX A;  2DML A;  2F3M A;  5DAL B;  4O5Q A;  3GST A;  4ZBA A;  5EL8 A;  3EUR A;  3PIN A;  4KUN A;  3M8N A;  4TVE A;  1BYE A;  4KCA A;  14GS A;  1ERU A;  4NAX A;  4DVC A;  3IHG A;  2X8H A;  4MH3 A;  2YPM A;  6GSX A;  1Y25 A;  1EZK A;  6GSU A;  2CAQ A;  5IPG A;  3KIJ A;  2ZCT A;  4OO4 A;  3JCM L;  3TKS A;  3GKM A;  2FHE A;  2X99 A;  3QR6 A;  4KAE A;  3RBT A;  5IMD A;  2IFQ B;  4RI7 A;  4ISD A;  2F9S A;  2ON7 A;  2LJR A;  4ZL8 A;  1BED A;  5CNW A;  4KH7 A;  1USB A;  1PX6 A;  3D4T A;  4KF9 A;  1TRS A;  2BTO T;  4TXO B;  5DQY A;  3C1R A;  5EPF A;  1LBK A;  1T7P B;  5J4U A;  4PGT A;  2IFQ A;  3GKK A;  1Z9H A;  2K8S A;  2WFC A;  2GSR A;  2WCI A;  3S9F A;  3ERW A;  4G10 A;  3J7Y k;  3TKQ A;  3M0F A;  4TXO A;  5AIV A;  1GNW A;  2YZH A;  1LJR A;  1J0F A;  1M99 A;  1XWK A;  5B7C A;  1WPI A;  1GH2 A;  2HRN A;  3L9S A;  3LG6 A;  1ZCP A;  4GWR A;  1VF2 A;  1PD2 1;  3UBK A;  5CP1 A;  1FAA A;  3F4S A;  3IR4 A;  5IMF A;  3FR6 A;  4K7N A;  3MIX A;  2MBS A;  3KMN A;  3LOR A;  4HJM A;  4NWY A;  1MDI A;  3TKR A;  3IK9 A;  2MBT A;  3OR5 A;  4O5U A;  1GL8 A;  3RPP A;  4XCS A;  5KN0 A;  10GS A;  3UVH A;  4EVM A;  4GST A;  1W4V A;  1FHE A;  16GS A;  5KEJ A;  1MDK A;  1ERV A;  2DIZ A;  5IO2 A;  2R37 A;  3I69 A;  4JR6 A;  5A5K A;  2GQK A;  4GF0 A;  2VUP A;  3HJO A;  1EOH A;  4L8E A;  2YAN A;  1U3I A;  1I9D A;  4LL4 B;  3M1G A;  4XHM A;  3U6V A;  5JCW A;  3IK7 A;  1GSF A;  2GLR A;  1Z6N A;  4MP4 A;  1A8L A;  1FOV A;  4G0L A;  3SBC A;  2LJA A;  2QKE A;  4EIP A;  2YWO A;  4BVX B;  4G19 A;  1KNG A;  1GLP A;  4EIQ A;  4NHZ A;  1PRX A;  1SKS B;  3HVV A;  1GUK A;  1QMV A;  2XPE A;  1ACV A;  4BVX A;  4Z2U A;  4L0U A;  4MZC A;  3VWW A;  4O7H A;  1OKT A;  3DKS A;  1R4W A;  1GUH A;  1SU9 A;  5KN2 A;  1H75 A;  1M7T A;  9GSS A;  4ECB A;  3ME8 A;  5D9V A;  3Q74 A;  1XVQ A;  4AJ7 A;  5DAK A;  1SKW B;  3UOM A;  5JWQ B;  2FLS A;  3R3E A;  2C0F A;  11GS A;  3TKP A;  3VWU A;  2VLT A;  4WR5 A;  2YN1 A;  3TOU A;  1ILO A;  1J08 A;  1Y6E A;  2EIQ A;  1IYI A;  4FQU A;  3Q6O A;  3FHK A;  1B9Y C;  5CAX A;  3ZFB A;  2QA2 A;  3IV4 A;  4K0G A;  5ECL B;  3K8N A;  4K2D A;  3GRX A;  4GSN A;  2HZE B;  2R0C A;  1ST9 A;  4OMV A;  3GNJ A;  4ML1 A;  13GS A;  2R0P A;  2HE3 A;  3DEX A;  5JCG A;  4XRA A;  4NV2 A;  3L0H A;  4QL9 A;  2YP6 A;  2O85 A;  4L5O A;  1SK1 A;  2HRF A;  2JU5 A;  5H5Q A;  5C00 A;  4TOP A;  3EC3 A;  4TN8 A;  5HFG A;  3ZML A;  1O81 A;  1U88 A;  1B48 A;  2NVL A;  1TRV A;  1XWA A;  3QFB C;  2WDU A;  5IO0 A;  2D2Z A;  3A2W A;  2TRX A;  3TJF A;  4ECJ A;  1PL1 A;  4MJB A;  2C1Y A;  2LRN A;  3EYT A;  3A3T A;  3TOT A;  4GCI A;  3L9V A;  3MYD A;  2O89 A;  2LS5 A;  2LRC A;  4PQI A;  1PGT A;  1XPV A;  4WF5 A;  1R7H A;  4FYU A;  5ECH B;  1F2E A;  5D96 A;  1XBS A;  2O8V B;  2N5A A;  2IIY A;  1H4O A;  4PQ1 A;  1VRS D;  2H75 A;  2OKA A;  2H1B A;  2WJU A;  2K8V A;  4LMW A;  4IN0 A;  4Z2R A;  1Z7R A;  5D9X A;  1TU7 A;  3TRQ A;  2HSY A;  2L5L A;  4PQH A;  1NSW A;  2KHP A;  5DVB A;  2NBS A;  3F4R A;  5EVO A;  1OE7 A;  1MDJ A;  4TR4 A;  2R0G A;  1TRU A;  3LXZ A;  1SL2 B;  3F6D A;  3HYP A;  1O8X A;  2OE0 A;  5KOW A;  3KP8 A;  1X0R A;  2YJ7 A;  1GSD A;  2PVO C;  2M46 A;  1AQW A;  4ZB9 A;  2E7P A;  3HD5 A;  3HKR A;  5HR3 A;  1A0R P;  1G7E A;  4MAB A;  2ALB A;  3A5W A;  1B4P A;  3QDN A;  4MH2 A;  1T4Z A;  1JZD A;  2HSM A;  2QSI A;  1V9W A;  1VF3 A;  4MLY A;  1SKR B;  2C0E A;  4EL1 A;  2LQO A;  2MMO A;  17GS A;  4IHU A;  1LU4 A;  4KE3 A;  4POL A;  1O85 A;  3C73 A;  3MAK A;  3IAS 2;  4KA0 A;  4ZBD A;  2FWF A;  5AIS A;  3IBH A;  2VCV A;  2RM6 A;  2NPB A;  3HJP A;  2JZS A;  2AV4 A;  4MK3 A;  4WBR D;  3EWL A;  5IOW A;  3O6T A;  4JU5 A;  4EUY A;  1V40 A;  3H4K A;  4IVF A;  3KTB A;  1SJZ A;  4FH8 A;  4Z7X A;  2DJ2 A;  3C1S A;  2GGT A;  2H1D A;  1T4Y A;  2Z9S A;  2H30 A;  3CXG A;  2G2Q A;  3HY2 A;  2C3Q A;  3E9J B;  1JZW A;  1T1V A;  4F03 A;  4I2U A;  1OYJ A;  1ABA A;  2DJ3 A;  2B7K A;  4J57 E;  2ZUP A;  4ZL9 A;  1XXU A;  3DIE A;  2X64 A;  3PGT A;  4BL7 B;  2IMD A;  5ECI B;  2CZ3 A;  2C0D A;  2DC5 A;  1GTI A;  4TR1 B;  3TCO A;  4XS4 B;  2GSQ A;  1DE1 A;  2HI7 A;  3UVT A;  2I9H A;  3CRU A;  4BL7 A;  3HZ8 A;  1EGR A;  4K1F A;  1GTB A;  3UAR A;  2FWE A;  1EP7 A;  2CAI A;  3AY8 A;  4X43 A;  1SL1 B;  3IC4 A;  1K0N A;  3IE3 A;  3VI5 A;  2QA1 A;  4ZL7 A;  2V32 A;  3H79 A;  2A2P A;  1PL2 A;  2H6Y A;  1O6J A;  4JED A;  1V57 A;  4CY6 A;  2OJL A;  2GVP A;  1QGV A;  3FK8 A;  4O5R A;  5ECQ B;  4GQF A;  2HRK A;  3LWA A;  2GQL A;  2OE3 A;  3FMW A;  5G30 A;  5F0G A;  2C80 A;  2XBQ A;  4MPG A;  1R26 A;  3BCK A;  5H5R A;  2VO4 A;  3DML A;  2DJ1 A;  2DMM A;  5JWO B;  2R5G A;  4IJI A;  3M9K A;  2L57 A;  4DSS A;  1MEK A;  1XW9 A;  2LUS A;  2PGT A;  5HFK A;  3R2Q A;  5D9T A;  12GS A;  1SK0 A;  2CVD A;  3GHA A;  4HDE A;  1JZO A;  2L6C A;  4G2E A;  4TR3 A;  2LTK A;  1YY7 A;  2GTU A;  3KJY A;  3CYN A;  2H66 A;  1YF0 A;  1TU8 A;  3ZRE A;  3QFA C;  4ZXG A;  1NHO A;  4EE0 A;  1EV9 A;  4XS6 A;  2FA4 A;  5IMA A;  2H70 A;  5EY6 A;  18GS A;  2NDO A;  3CSH A;  3CTF A;  2VCZ A;  4QL7 A;  3WT1 A;  2DIY A;  5GZZ B;  2YNX A;  1GUM A;  3LJR A;  4IJ3 A;  3D22 A;  3CSI A;  5IM9 A;  1GSS A;  5IOX A;  2PBJ A;  2H01 A;  1V2A A;  1ZMA A;  5JCU A;  3F6F A;  2L5O A;  4POK A;  1DE2 A;  1WRY A;  3HZ4 A;  1OAZ A;  1TDI A;  4K7I A;  4P3Y B;  1YKA A;  3ZIJ A;  1NHY A;  2RLI A;  3V1W A;  5ECP B;  1SK2 A;  1AC1 A;  3APS A;  1N8J A;  4GTU A;  3WYW A;  4K6X A;  4MPF A;  2B5X A;  3MSZ A;  4NMU A;  3C7M A;  4KB3 A;  4POM A;  2ZNM A;  1THX A;  1A2M A;  2AAW A;  4BWS A;  3VWX A;  3DGQ A;  4K2X A;  1THO A;  3EU4 A;  1TJD A;  4HJ2 A;  1J9B A;  5G1L A;  3F8U A;  4KW6 A;  1AQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...