1DE1A

Nmr structures of oxidized bacteriophage t4 glutaredoxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of reduced and oxidized bacteriophage T4 glutaredoxin.
pubmed doi rcsb
molecule keywords GLUTAREDOXIN
molecule tags Electron transport
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1de1A00
4IBPA 1A0RP 3UARA 2HT9A 5C00A 4EKZA 3FK8A 4PXOA 4AJ7A 1T3BA 3FR6A 4QL9A 5CP1A 2DJ3A 2BTOT 5AIVA 1SL2B 2DIYA 4KSMA 2DJ2A 2YP6A 4BL7A 4PNGA 4WBJA 5JCWA 5ECNB 3ISOA 1TI3A 4FYBA 1PD21 1R26A 4DSSB 3FR9A 4K1FA 3D5JA 4XRDA 4DVCA 5F06A 5D93A 4EUYA 1T8EB 1ML6A 2CAIA 4YQMA 1A2MA 3RAZA 4V2LA 2V6OA 3BCKA 4L8EA 4HZ2A 3WGDA 1WP0A 2H72A 4FO5A 3E0UA 5IPGA 1XWCA 2I1UA 4MABA 4IVFA 3VPQA 1QK8A 5ELAA 3EVIA 3K8NA 1PRXA 4HJMA 3C8EA 3APOA 5ECSA 4MZCA 5EVOA 2GS3A 5JWRB 2PVQA 1R4WA 3ZTLA 3I9V2 4EDZA 1M7TA 2F8FA 4HS1A 2JADA 2GGTA 4V2MA 1Z7PA 2FWGA 5EPFA 2H30A 3QAWA 6GSYA 2BMXA 5F07A 1PX7A 3DMLA 2ZCTA 1HNBA 2PU9C 3A2XA 1Z6NA 4NV2A 1GRXA 5IIZA 4ECCA 2YWOA 2XC2A 4MP4A 4WBRD 1M99A 2WS2A 1SK0A 1EV4A 6GSUA 2H8LA 2EIQA 5IO0A 1GUMA 1T7PB 2CZ3A 3DEXA 3RDWA 2F3MA 2E2GA 3W8JA 1F3BA 3KMNA 4MF7A 4IW9A 4ZBDA 1V40A 5IMZA 22GSA 3GTUA 5ECRB 5LNKe 2B5YA 2TRCP 5D73A 4LMVA 3CSIA 2B7JA 3UMAA 1AC1A 2PWJA 2GZYA 4CHSA 1FVKA 3FYGA 3P8WA 4H86A 2OADA 3M9JA 2LEGA 1RK4A 4YQUA 4PURA 1T4ZA 2VM1A 2MMOA 3APSA 3QFAC 1XWBA 1KTEA 3C1SA 5A4WA 2V6KA 1XVWA 2LKUA 1AQWA 3QFBC 3FZ9A 4XCSA 2H1BA 1SJ6A 3BOAA 4G2EA 2EIRA 2H73A 2GSQA 3CMIA 4BWQA 3D21A 3G7YA 2R37A 2H70A 2KLXA 3KCMA 3QCPA 1J0FA 1OC9A 4MLYA 2IMIA 3GV1A 4PUAA 1N2AA 3VI5A 4GXZA 1G6YA 5G5EA 2XBQA 3ZFBA 4DSRA 1GLPA 3CSHA 4LL4B 1SU9A 1XOBA 3TJGA 2GLRA 3TUEA 4GLTA 5ECLB 5ENUA 1DSBA 1WIKA 3KIJA 2AUVA 1SKRB 3LYKA 5JCUA 5IQYA 4POBA 3QAVA 1GH2A 5DAKA 1QFNA 4ULXA 7GSSA 3FY7A 2GTUA 1A8LA 4MA9A 4OO5A 4ZXGA 3GMFA 4ZB9A 2DMLA 4HU7A 4K2DA 4O32A 2K6VA 2LTKA 3ZYWA 2VUPA 2B6MA 4XS4A 4POLA 1VRSD 3A2WA 1U88A 4HEA2 1OC9B 5D9TA 4NWYA 4KNDA 4IGJA 4PGTA 2I81A 1TJDA 2H6XA 1UVZA 6GSVA 1MD3A 3I43A 2YPMA 2YANA 2IJYA 2HZFA 3TRQA 4POKA 3LWAA 5AN1A 3HJOA 2O87A 2O8VB 3VFIA 3RPPA 1DE1A 1O85A 4IJIA 1PGTA 2KP1A 3HKRA 1T00A 2FUG2 2DMMA 2L59A 5JCGA 3IBHA 2XHFA 2M80A 1G7EA 3TCOA 4OFNA 4KCEA 1TTZA 2HLSA 4EXJA 3F6DA 3TKQA 3P2AA 5HR2A 5J4UA 5JWOB 2OKAA 1YEPA 4EDYA 3CYNA 2P0GA 5G30A 2LNTA 4IP6A 3E3EA 3L9UA 3C73A 1KEBA 3MAKA 4XS4B 4HQSA 4RI6A 2H1GA 3A3TA 5F8BA 2L6CA 2CVBA 3F8UA 3IXRA 4WXTA 1EGRA 3C71A 4N10A 2WJUA 4F82A 2AB6A 3GX0A 3L9VA 1H4OA 1M0UA 3CSJA 5F05A 1SK2A 1IYHA 2GVPA 1WJKA 2EC4A 2HZEA 1V98A 4I2UA 3Q19A 2D2ZA 5ECKB 2WB9A 5KN0A 1B4PA 4WEYA 2IWTA 5LCZA 3HZ8A 3DKSA 4O5RA 1LU4A 4V1Ap 4I2TA 4NHZA 2OE0A 3IOSA 3D4TA 1HQOA 5CRWA 4KX4A 2VCXA 1A2JA 1VF1A 3J7Yb 4V2NA 2YWIA 5CRGA 1TDIA 2NDOA 4HZ4A 4NXIA 3HJMA 3MSZA 3IC4A 4K6XA 3TB2A 2MYGA 4X0XA 1LBKA 1M9AA 2JZRA 2QKEA 2VOCA 6GSXA 4KAEA 2IPAA 3VLNA 1OE7A 1SL0B 1GLQA 4TR4A 3M0FA 2X99A 4XRAA 2P5QA 1THOA 1SKWB 3DXBA 3ME7A 2PMTA 4TW5A 2NBSA 2QSIA 4PQHA 1RQMA 4GWRA 3GL3A 1O8WA 2DJ0A 1TKDB 1K0MA 2CX4A 1Q98A 3HD5A 2AHEA 2HZEB 4WF4A 2P31A 4AGSA 2WULA 4TR1A 3IDVA 4O92A 2RUFA 3BBYA 1MTCA 2GQLA 4KDXA 1V9WA 5DCGA 2GT5A 3F4RA 3GYKA 4MJBA 3IV4A 2X8HA 1V57A 5ID2A 5B7CA 1S3AA 2IN3A 2LSTA 4TXVA 2O7KA 3KMOA 1TI1A 4TN8A 1GUKA 1PKZA 3TKPA 3WGEA 2H1DA 5GAPD 1RW1A 4IHUA 4MMMA 4BVYA 2V32A 3LXTA 2I9HA 5H5RA 1GSDA 3FRCA 4AF2A 3EWLA 3I6AA 3TKRA 3TRXA 3FZ4A 2QGVA 4NPBA 2DBCA 3GRXA 3LXZA 2YZUA 3ZL5A 4OCEA 4KB3A 1BG5A 1X9MB 2NPBA 1LJRA 2GSRA 4PQ1A 2C4JA 1DUGA 4KA0A 4N0VA 4Z7XA 5HFKA 3US3A 2WFCA 1FAAA 13GSA 5DJLA 4TR1B 2VCZA 1K0BA 2WZ9A 2A2RA 3PINA 1GTIA 5IMDA 3ZIJA 1SD8A 3F63A 2Z9SA 1A23A 1WOUA 3H4KA 3ZZXA 2C3QA 5ID2B 4F2IA 4GSSA 1TOFA 1XZOA 3JCML 2HE3A 3D22A 9GSSA 1XWKA 1GSFA 3I69A 6GSSA 1YEXA 2I4AA 3DD3A 1OKDA 4WF5A 3M3MA 1SJIA 4TOPA 1VF2A 2PBJA 3CXGA 3Q74A 4JE1A 3L4NA 2C8UA 2H01A 3EMXA 5ECPB 4F0BA 2YZHA 2AAWA 2VLVA 3M1GA 1JZWA 1TK8B 4K0NA 2RIIA 1SYXA 5AIXA 1FW1A 2PPTA 1EOGA 1AUCA 1GSSA 3L9SA 2WCIA 4LLRA 2B5EA 1SENA 3A5WA 4ZBBA 11GSA 3RPNA 1XW6A 5IM9A 2ES7A 2JU5A 1TK5B 1GTBA 3F0IA 3GSTA 20GSA 4V1Ag 2X8GA 3Q18A 3FZAA 5ABRA 4ZL9A 3VWUA 3G7IA 2DLXA 1I5GA 3Q6OA 4MH2A 1GL8A 4IJ3A 3HDCA 2FWHA 3F6FA 2GDRA 4MDCA 4D73A 3DVWA 1ZL9A 2E2MA 3TJFA 4K8MA 2KOKA 2JZSA 1QMVA 1XBSA 1K0NA 5DVBA 5G2ZA 2PGTA 1FB0A 1CQGA 1WWJA 2H19A 4KUNA 3PH9A 2L4CA 3EYTA 2XPEA 1VF3A 3IA1A 1B8XA 4WKWA 4ISDA 1VF4A 4K7NA 1O81A 3D0ZA 2H74A 5J5NA 3KH9A 1Y6EA 1T1VA 2GZZA 2C0FA 1XOAA 1YJ6A 3R2QA 2VL2A 1G6WA 1F9MA 5D8IA 4QQ7A 2H75A 2FLSA 2OBKA 2QC7A 2X64A 3SBCA 4ECIA 3E9JB 1THXA 4MJEA 5B8BA 4WR4A 3DWVA 4KH7A 2N5BA 3H8QA 1BEDA 3BJ5A 5J9CA 2FHEA 1NHYA 4D73B 2OA7A 1T4YA 2YN1A 2H0HA 4HDEA 4HUAA 1UA5A 1FHEA 3LYPA 2MBSA 3GH9A 3G9BA 3KP8A 2J23A 2JSYA 1X9WB 3WYWA 1TRVA 4NMUA 3DYRA 3F4TA 3ZFLA 3ZMLA 3ZITA 3GURA 4P3YB 2RUEA 1TRWA 3GTUB 2IIYA 2GQKA 4I5QA 5DALA 1PL2A 5HR0A 5CREA 1NHOA 4PQIA 4YH2A 1O73A 3UVTA 5AISA 3CTGA 3ERGA 5HQPA 1U6TA 2NTOA 2ON7A 3LORA 2WRTA 2LRTA 3AY8A 2JZTA 1Y25A 3TKSA 1O8XA 2O85A 4OO4A 3ZRDA 4OMVA 3UEMA 4XS1A 4RQXA 5GSSA 2VCTA 3QPMA 1TU7A 2KHPA 4JZQA 5KN2A 2AV4A 3ZVJA 2PERA 3VWXA 2HI7A 5B6NA 1X5DA 1Z3EA 2H71A 4LA1A 4CDOA 1OKTA 2FGXA 1PL1A 5DJMA 5CRHA 4FIWA 3HXSA 2J9HA 3LG6A 2E7PA 2HXKA 3GH6A 1QUWA 1X5EA 3TDGA 4XIHA 3EC3A 2CZ2A 4TVEA 5GAND 3MWHA 2DSAA 2CT6A 4TR3A 1S3CA 3DGQA 2REMA 2NVLA 2FA4A 1XCCA 2C3TA 4JU5A 1A24A 4ZB6A 3F3QA 5INYA 1Q4JA 2BJXA 1HD2A 2FCHA 5DAKB 1GSUA 5D9VA 1GTAA 1TK0B 2H76A 3ZIVA 3PGTA 2B1LA 2H6YA 3FEUA 1R5AA 1XXUA 2ZUPA 5HFGA 2R2JA 1TP9A 1YF1A 4MJAA 3G7JA 2HYXA 1ACVA 4DEJA 1MDIA 2YOIA 3FZ5A 2MMZA 5IPHA 4ML1A 1FB6A 1A2LA 3HZ4A 1EV9A 2YWMA 3TOUA 3CRUA 4JRRA 1OAZA 4IKHA 1BYEA 1HYUA 3EE2A 3VWVA 1BAYA 1AAZA 2E0QA 1XIYA 2CVKA 4EE0A 2VIMA 3QOUA 1TW9A 3TJJA 3KJYA 4Q5NA 1M2AA 5CAXA 1X0RA 3CBUA 1K3YA 4OFMA 3O6TA 4MPGA 3LEFA 2JL4A 1XWGA 2G0FA 5D96A 4TXOA 2ALBA 3LFLA 1KNGA 3MDKA 4EC0A 1YQ1A 3NOFA 3NZNA 2K18A 1X5CA 3VPTA 2DJKA 3A2VA 3ZLPA 5A5KA 3FKFA 4YAPA 2VL3A 2B7KA 3GHAA 3UVHA 4F9ZA 3WT1A 5GZZB 5ECHB 3IK7A 4ZBAA 1GNEA 1YZXA 1GULA 4ZL7A 1AQXA 3GKXA 1V58A 4L5OA 1PX6A 1F6MC 2VAFA 1JZRA 3TJKA 3GNJA 5FWGA 2CV4A 1M2DA 1IYIA 3P90A 4EO3A 3KTLA 1MD4A 2LJAA 2HRNA 2PN8A 5ELGA 1SKSB 4KE3A 2DJ1A 1QQ2A 1OC3A 3HVVA 1Z5YE 4FYCA 3FR3A 2MMNA 3DRNA 3QMXA 5IMCA 2FA8A 1O6JA 1DBYA 1FO5A 5KEJA 4TXOB 4JR6A 1F2EA 1U87A 1AIUA 1M9BA 5C04A 2B3SA 1Z9HA 4GCIA 2M46A 1GSEA 3KZQA 3CTFA 4NHWA 4J2FA 4IP1A 4OD7A 2DIZA 2XBIA 4MJCA 2CAQA 2LRNA 1EZKA 1ERWA 3HJPA 4PX1A 4IQ1A 3W6GA 1K0OA 1XW5A 1JZOA 1PA3A 3U5RE 4I8BA 1TU8A 4AJ8A 3M9KA 1G0TA 2YNXA 5DQYA 1JHBA 5ECQB 5F0GA 2MBTA 1J9BA 4PNFA 1EOHA 1AQVA 3WD6A 1ZZYA 2VL2C 1SL1B 4OCFA 4I6XA 4BWSA 4ZB8A 3LSZA 4YQVA 1C72A 1N8JA 2YV9A 2VD0A 4FH8A 3QD9A 2R5GA 4WR5A 10GSA 2VD1A 1E6BA 1R7HA 1YY7A 2C0DA 3HA9A 3QR6A 2RM6A 4OFTA 5G5FA 3LGCA 4MK3A 1XW9A 3KD0A 5ECIB 3O3TA 2XPDA 4G10A 1ERVA 2GT6A 5CYYA 18GSA 2IFQA 1K3LA 1ZMAA 2P5RA 2WGRA 5HFIA 3GUSA 3GSSA 4ML6A 2OBIA 1HNCA 2LQOA 1ZGNA 5EY6A 4HQZA 1QXHA 2YJHA 1S3DA 4N30A 1WE0A 4Q5QA 2GQMA 2H1AA 8GSSA 1ERUA 1B4QA 2CX3A 4NV5A 1EP7A 1AXDA 3KP9A 12GSA 4CW9A 4N11A 4X43A 2FNOA 2HSHA 5IMAA 2H6ZA 5E4WA 3TKSC 5GSTA 4GQFA 3WGXA 3WT2A 4ZILA 1PKWA 4ZL8A 4K7IA 1PMTA 2HRFA 4MF5A 4PUFC 2TRXA 1SD9A 4KCAA 4POMA 5J9BA 5IOXA 2N5AA 1PN9A 1TRSA 4KDYA 3FW2A 2A4VA 4ZIJA 5D9WA 3VI7A 2PUKC 5L71A 2GZPA 3BD2A 2IFQB 1K3OA 1YF0A 2F8AA 2R6KA 4L0UA 17GSA 2AJQB 3F9UA 3UAPA 4LL1B 3ZVJD 1ZYEA 4FYUA 4ACSA 5COHA 2B5XA 3HY2A 3VURA 2G2QA 16GSA 3N5OA 1JLVA 3GKKA 3ME8A 4E8EA 3UBKA 3TGZA 4N0ZA 1GP1A 1W89A 3HVXA 2JACA 2H66A 1TXXA 1MDKA 3RHCA 1OE8A 2RLIA 5G1LA 1B48A 4KDUA 3C1RA 1YKCA 4YAVA 3P7XA 1EGOA 1YKAA 1YDKA 1UC7A 2RM5A 1F3AA 3KM6A 3S9FA 2EIOA 5IOWA 4KSOA 4HOJA 4XHMA 3ZMKA 1BQ7A 1JZDA 5B6MA 4LMWA 5EL8A 1B9XC 4RI7A 4J56E 4GF0A 1FG4A 5FT3A 2M72A 1M2BA 4I97A 2C3NA 2KUCA 4TKYA 1GNWA 3D4MA 2C0GA 3D6IA 2HNLA 3QDNA 2ON5A 3UL3A 3KGKA 1B9YC 2VCQA 5AGYA 3F3RA 2IMDA 5DCHA 4HJ2A 3SWLA 4BA7A 3EINA 3KTBA 4MCUA 3F4SA 1XWAA 2LUSA 4KGIA 2X8CA 2OACA 3EU3A 1NW2A 4ECBA 1X9SB 3TRPA 2V41A 1K0CA 5JWQB 4QL7A 1SJZA 2VCVA 1AW9A 3ERFA 4GQCA 4ECJA 3GFKA 2VLTA 4ID0A 1U3IA 1GTUA 3O76A 5IMFA 1ST9A 2JSZA 3H93A 4GSTA 4AJ6A 2VLUA 3C7MA 3GIXA 5IO2A 3ZREA 2WDUA 5D9XA 5G31A 2OJLA 3DVXA 1WRYA 1SYRA 5A4VA 2B1KA 4RUVA 2GSSA 3RBTA 2KP2A 3PR8A 3MNGA 4BPYA 3J7Yk 2MZCA 3IAS2 4TRXA 5B8AA 1OVNA 2FWEA 3M8NA 3QAGA 5DALB 4KW6A 1NSWA 2OE1A 2VCWA 2CQ9A 4Q5RA 1ZOFA 4EL1A 3KEBA 19GSA 1A8YA 3ERWA 3ED3A 4MZBA 5E59A 3RHBA 1XFLA 4IS0A 1GSYA 1OYJA 3TJBA 3L0HA 3HYPA 2IMKA 4OWYA 4L0WA 2LS5A 5G1KA 3GKNA 3TKSE 5ECOB 1FOVA 4XTSA 5CRDA 4EVMA 1O7UA 1F37A 3UJ1A 4G19A 2LJKA 4JR4A 4EF0A 5HR1A 1MDJA 2L5OA 3H1NA 2V1MA 3TOTA 3W8SA 3CRTA 3U6VA 1K0DA 3L78A 3GA4A 2YJ7A 3EURA 2R3XA 1ZCPA 1ZYQB 4E8HA 4X1UA 1XVQA 2O89A 2H0GA 1PSQA 2V2GA 2GSTA 4F03A 1BX9A 5A4UA 4F0CA 2ZNMA 4Q5FA 3VK9A 2L4QA 1WMJA 2LRCA 3IPZA 4XS6A 3LJRA 4GTUA 1JLWA 2VM2A 1ABAA 2F9SA 1Z7RA 2LJRA 1V2AA 4HU9A 2FD3A 3UOMA 2CVDA 2DC5A 1W4VA 1GSQA 3OR5A 2VL9A 1K0AA 3EMPA 4DSQA 3UBLA 1EEMA 2A2SA 1NM3A 2LV3A 3IAM2 2L57A 3UIWA 4RQRA 1H75A 2C1YA 2N5FA 3APQA 4JEDA 2L5LA 1BJXA 2OE3A 4G9HA 1SK1A 2FWFA 1TRUA 2YWNA 3IRAA 4TR0A 5J41A 4BVXA 3DIEA 4L5LA 5KN1A 1J08A 1Z6MA 2F51A 2HFDA 1R5PA 14GSA 1U3AA 3HHVA 1JFUA 2R4VA 4ILFA 1I9DA 4MF6A 1EP8A 2DJJA 2H0IA 4GSNA 5DDLA 1QGVA 4K7OA 1XPVA 1USBA 4MH3A 5ECMB 4O7HA 1VGLA 6GSWA 3GKMA 1PQNA 1OC8A 2I3YA 2FY6A 4K9ZA 2K8VA 4NAXA 4MZWA 5H5SA 3V1WA 1UN2A 2L6DA 3N9JA 1E2YA 1A0FA 3EU4A 2IMFA 5DQSA 4IQAA 2K9FA 5CO3A 1GWCA 4GRFA 2YV7A 5HR3A 1EEJA 1CQHA 1FVJA 5H5QA 1HNAA 2PVOC 5FHIA 2IMEA 3BCIA 4WETA 3GL5A 1KBNA 3IE3A 3IK9A 5LD0A 1ON4A 1DE2A 1MEKA 4DSSA 3IR4A 1GUHA 3H79A 1ERTA 2HSYA 1EWXA 2AYTA 3LQ7A 2TIRA 1G7OA 3VWWA 3KH7A 3HCZA 4MPFA 4IELA 4IN0A 2LQQA 3IHQA 2VO4A 4HI7A 3NIVA 2C0EA 2LNSA 5KN3A 3FHKA 5J3RA 3GX8A 5DBQA 2IL3A 2MMAA 2K8SA 5IMVA 5CNWA 1URMA 2C80A 2YCDA 6GSTA 1WPIA 4JBBA 2CA8A 3GN3A 4J57E 3HVSA 4K0GA 1ILOA 3KXOA
chains in the Genus database with same CATH superfamily
4IBPA 1A0RP 3UARA 2HT9A 5C00A 4EKZA 3FK8A 4PXOA 4AJ7A 1T3BA 3PPUA 3FR6A 4QL9A 5CP1A 2DJ3A 2BTOT 5AIVA 1SL2B 2DIYA 4KSMA 2DJ2A 2YP6A 4BL7A 4PNGA 4WBJA 5JCWA 5ECNB 3ISOA 1TI3A 4FYBA 1PD21 1R26A 4DSSB 3FR9A 4K1FA 4USSA 3D5JA 4MNNA 4XRDA 4DVCA 5F06A 5D93A 4EUYA 1T8EB 1ML6A 2CAIA 4YQMA 1A2MA 3RAZA 4V2LA 2V6OA 3BCKA 4L8EA 4HZ2A 3WGDA 1WP0A 2H72A 4FO5A 3E0UA 5IPGA 1XWCA 2I1UA 4G0IA 4MABA 4IVFA 3VPQA 1QK8A 5ELAA 3EVIA 3K8NA 1PRXA 4HJMA 3C8EA 3APOA 5ECSA 4MZCA 5EVOA 2GS3A 5JWRB 2PVQA 1R4WA 3ZTLA 3I9V2 1ZYNA 2DKHA 4EDZA 1M7TA 2F8FA 4HS1A 2JADA 2GGTA 4V2MA 1Z7PA 2FWGA 5EPFA 2H30A 3QAWA 6GSYA 2BMXA 5F07A 1PX7A 4BL7B 3DMLA 2ZCTA 1HNBA 2PU9C 3A2XA 1Z6NA 4NV2A 1GRXA 5IIZA 4ECCA 2YWOA 2XC2A 4MP4A 4WBRD 1M99A 2WS2A 1SK0A 1EV4A 6GSUA 2H8LA 2EIQA 5IO0A 1GUMA 1T7PB 2CZ3A 4O5QA 3DEXA 3RDWA 2F3MA 2E2GA 3W8JA 1F3BA 3KMNA 4MF7A 4IW9A 4ZBDA 1V40A 5IMZA 22GSA 3GTUA 5ECRB 5LNKe 2B5YA 2TRCP 4CY6A 5D73A 4LMVA 3CSIA 2B7JA 3UMAA 1AC1A 2PWJA 2GZYA 4CHSA 1FVKA 3FYGA 3P8WA 4K5SA 2R0GA 4H86A 2OADA 3M9JA 2LEGA 1RK4A 4YQUA 4PURA 1T4ZA 2VM1A 2MMOA 2UZ8A 3APSA 3QFAC 1XWBA 1KTEA 3C1SA 5A4WA 2V6KA 1XVWA 2LKUA 1AQWA 3QFBC 3FZ9A 4XCSA 2H1BA 1SJ6A 3BOAA 4G2EA 2EIRA 2H73A 2GSQA 3CMIA 4BWQA 3D21A 3G7YA 2R37A 2H70A 2KLXA 3KCMA 3QCPA 1J0FA 1OC9A 4MLYA 2IMIA 3GV1A 4PUAA 1N2AA 3VI5A 4GXZA 1G6YA 5G5EA 2XBQA 3ZFBA 4DSRA 1GLPA 3CSHA 4LL4B 1SU9A 1XOBA 3TJGA 2GLRA 3TUEA 4GLTA 5ECLB 5ENUA 1DSBA 1WIKA 3KIJA 2AUVA 1SKRB 3LYKA 5JCUA 4HSCX 4POBA 5IQYA 3QAVA 1GH2A 5DAKA 1QFNA 4ULXA 7GSSA 3FY7A 2GTUA 1A8LA 4MA9A 4OO5A 4ZXGA 3GMFA 4ZB9A 2DMLA 4HU7A 4K2DA 4O32A 2K6VA 2LTKA 3ZYWA 2VUPA 2B6MA 4XS4A 4POLA 1VRSD 3A2WA 1U88A 4HEA2 1OC9B 5D9TA 4NWYA 4KNDA 4IGJA 4PGTA 2I81A 1TJDA 2H6XA 1UVZA 6GSVA 1MD3A 3I43A 2YPMA 2YANA 2IJYA 2HZFA 3TRQA 4POKA 3LWAA 5AN1A 3HJOA 2O87A 2O8VB 3VFIA 3RPPA 1DE1A 1O85A 4IJIA 1PGTA 2KP1A 3HKRA 1T00A 2FUG2 2DMMA 2L59A 5JCGA 3IBHA 2XHFA 2M80A 1G7EA 3TCOA 4Z2TA 4OFNA 4KCEA 1TTZA 2HLSA 4EXJA 3F6DA 3TKQA 3P2AA 5HR2A 5J4UA 5JWOB 2OKAA 1YEPA 4EDYA 3CYNA 2P0GA 5G30A 1S3RA 2LNTA 4IP6A 3E3EA 3L9UA 3C73A 1KEBA 3MAKA 4XS4B 4HQSA 4RI6A 2H1GA 3A3TA 5F8BA 2L6CA 2CVBA 3F8UA 3IXRA 4WXTA 1EGRA 3C71A 4N10A 2WJUA 4F82A 2AB6A 3GX0A 3L9VA 1H4OA 1M0UA 3CSJA 5F05A 1SK2A 1IYHA 2GVPA 1WJKA 1ZYPA 2EC4A 2HZEA 1V98A 4I2UA 3Q19A 2D2ZA 5ECKB 2WB9A 5KN0A 1B4PA 4WEYA 2IWTA 5LCZA 3HZ8A 4EIPA 3DKSA 4O5RA 1LU4A 4V1Ap 4I2TA 4NHZA 2OE0A 3IOSA 3D4TA 1HQOA 5CRWA 4KX4A 2VCXA 1A2JA 1VF1A 3J7Yb 4V2NA 2YWIA 5CRGA 1TDIA 2NDOA 4HZ4A 4NXIA 3HJMA 3MSZA 3IC4A 4K6XA 3TB2A 2MYGA 4X0XA 1LBKA 1M9AA 2JZRA 2QKEA 2VOCA 6GSXA 4KAEA 2IPAA 3VLNA 1OE7A 1SL0B 4PTSA 1GLQA 4TR4A 3M0FA 2X99A 4XRAA 2P5QA 1THOA 1SKWB 3DXBA 3ME7A 2PMTA 4TW5A 2NBSA 2QSIA 4PQHA 1RQMA 4GWRA 3GL3A 1O8WA 2DJ0A 1TKDB 1K0MA 2CX4A 1Q98A 3HD5A 2AHEA 2HZEB 4WF4A 2P31A 4AGSA 2WULA 4TR1A 3FMWA 3IDVA 4O92A 2RUFA 3BBYA 1MTCA 2GQLA 4KDXA 1V9WA 5DCGA 2GT5A 3F4RA 3GYKA 4MJBA 3IV4A 2X8HA 1V57A 5ID2A 5B7CA 1S3AA 2IN3A 2LSTA 4TXVA 2O7KA 3KMOA 1TI1A 4TN8A 1GUKA 1PKZA 3TKPA 3WGEA 2H1DA 5GAPD 1RW1A 4IHUA 4MMMA 4BVYA 2V32A 3LXTA 2I9HA 5H5RA 1GSDA 3FRCA 4AF2A 3EWLA 3I6AA 3TKRA 3TRXA 3FZ4A 2QGVA 4NPBA 2DBCA 3GRXA 3LXZA 2YZUA 3ZL5A 4OCEA 4KB3A 1BG5A 1X9MB 2NPBA 1LJRA 4A5PA 2GSRA 4PQ1A 2C4JA 1DUGA 4KA0A 4N0VA 4Z7XA 5HFKA 3US3A 2WFCA 1FAAA 13GSA 5DJLA 4TR1B 2VCZA 1K0BA 2WZ9A 2A2RA 3PINA 1GTIA 5IMDA 3ZIJA 1SD8A 3F63A 2Z9SA 1A23A 1WOUA 3H4KA 3ZZXA 2C3QA 5ID2B 4F2IA 4GSSA 1TOFA 1XZOA 3JCML 2HE3A 3D22A 9GSSA 1XWKA 1GSFA 3I69A 6GSSA 1YEXA 2I4AA 3DD3A 1OKDA 4WF5A 3M3MA 1SJIA 4TOPA 4BVYB 1VF2A 2PBJA 3CXGA 3Q74A 4JE1A 3L4NA 2C8UA 2H01A 3EMXA 5ECPB 4F0BA 2YZHA 2AAWA 2VLVA 3M1GA 1JZWA 1TK8B 4K0NA 2RIIA 1SYXA 5AIXA 1FW1A 2PPTA 1EOGA 1AUCA 1GSSA 3L9SA 2WCIA 4LLRA 2B5EA 1SENA 3A5WA 4ZBBA 11GSA 3CQFA 3RPNA 1XW6A 5IM9A 2ES7A 2JU5A 1TK5B 1GTBA 3F0IA 3GSTA 20GSA 4V1Ag 2X8GA 3Q18A 3FZAA 5ABRA 4ZL9A 2X4AA 3VWUA 3G7IA 2DLXA 1I5GA 3Q6OA 4MH2A 1GL8A 4IJ3A 3HDCA 2FWHA 3F6FA 2GDRA 4MDCA 4D73A 3DVWA 1ZL9A 2E2MA 3TJFA 4K8MA 2KOKA 2JZSA 1QMVA 1XBSA 1K0NA 5DVBA 5G2ZA 2PGTA 1FB0A 1CQGA 1WWJA 2H19A 4KUNA 3PH9A 2L4CA 3EPTA 2XPEA 3EYTA 1VF3A 3IA1A 1B8XA 4WKWA 4ISDA 1VF4A 4K7NA 1O81A 3D0ZA 2H74A 5J5NA 3KH9A 1Y6EA 1T1VA 2GZZA 4YKGA 2C0FA 1XOAA 1YJ6A 3R2QA 2VL2A 1G6WA 1F9MA 5D8IA 4QQ7A 2QA2A 2H75A 2FLSA 2OBKA 2QC7A 2X64A 3SBCA 4ECIA 4YKFA 3E9JB 1THXA 4MJEA 5B8BA 4WR4A 3DWVA 4KH7A 2N5BA 3H8QA 1BEDA 3BJ5A 5J9CA 2FHEA 1NHYA 4D73B 2OA7A 1T4YA 2YN1A 2H0HA 4HDEA 4HUAA 1UA5A 1FHEA 3LYPA 2MBSA 3GH9A 3G9BA 3KP8A 2J23A 2JSYA 1X9WB 3WYWA 1TRVA 4NMUA 3DYRA 3F4TA 3ZFLA 3ZMLA 3ZITA 3GURA 4P3YB 2RUEA 1TRWA 3GTUB 2IIYA 2GQKA 4I5QA 5DALA 1PL2A 5HR0A 5CREA 1XG8A 1NHOA 5KOWA 4PQIA 4YH2A 1O73A 3UVTA 5AISA 3CTGA 3ERGA 5HQPA 1U6TA 2NTOA 2ON7A 3LORA 2WRTA 2LRTA 3AY8A 2JZTA 1Y25A 3TKSA 1O8XA 2O85A 4OO4A 3ZRDA 4OMVA 3UEMA 4XS1A 4RQXA 5GSSA 2VCTA 3QPMA 1TU7A 2KHPA 4JZQA 5KN2A 2AV4A 3ZVJA 2PERA 3VWXA 2HI7A 5B6NA 1X5DA 1Z3EA 2H71A 4LA1A 4CDOA 1OKTA 2FGXA 4Z2RA 1PL1A 5DJMA 5CRHA 4FIWA 3HXSA 2J9HA 3LG6A 2E7PA 2HXKA 3GH6A 1QUWA 1X5EA 3TDGA 4XIHA 3EC3A 2CZ2A 4TVEA 5GAND 3MWHA 2DSAA 2CT6A 4TR3A 1S3CA 3DGQA 2REMA 2NVLA 2FA4A 1XCCA 2C3TA 4JU5A 1A24A 4ZB6A 3F3QA 2HRKA 5INYA 1Q4JA 2BJXA 1HD2A 2FCHA 2A4HA 5DAKB 1GSUA 5D9VA 1GTAA 1TK0B 4FQUA 2H76A 3ZIVA 3PGTA 2B1LA 2H6YA 3FEUA 1R5AA 1XXUA 2ZUPA 5HFGA 2R2JA 1TP9A 1YF1A 4MJAA 3G7JA 2HYXA 1ACVA 4DEJA 1MDIA 2YOIA 3FZ5A 2MMZA 5IPHA 4ML1A 1FB6A 1A2LA 3MYDA 3HZ4A 1EV9A 2YWMA 3TOUA 3CRUA 4JRRA 1OAZA 4IKHA 1BYEA 1HYUA 3EE2A 3VWVA 1BAYA 1AAZA 2E0QA 5BMUA 1XIYA 2CVKA 4EE0A 2VIMA 3QOUA 1TW9A 3TJJA 3KJYA 4Q5NA 1M2AA 5CAXA 1X0RA 3CBUA 1K3YA 4OFMA 3O6TA 4MPGA 3LEFA 2JL4A 1XWGA 2G0FA 5D96A 4TXOA 2ALBA 3LFLA 1KNGA 3MDKA 4EC0A 1YQ1A 3NOFA 3NZNA 2K18A 1X5CA 3VPTA 2DJKA 3A2VA 3ZLPA 5A5KA 3FKFA 4YAPA 2VL3A 2B7KA 3GHAA 3UVHA 4F9ZA 3WT1A 5GZZB 5ECHB 3IK7A 4ZBAA 1GNEA 1YZXA 1GULA 4ZL7A 1AQXA 3GKXA 1V58A 4L5OA 1PX6A 1F6MC 2VAFA 1JZRA 1PFOA 3TJKA 3GNJA 5FWGA 2CV4A 1M2DA 1IYIA 3P90A 4EO3A 3KTLA 1MD4A 2LJAA 2HRNA 2PN8A 5ELGA 1SKSB 4KE3A 2DJ1A 1M3JA 1QQ2A 1OC3A 3HVVA 1Z5YE 4FYCA 3FR3A 2MMNA 3DRNA 3QMXA 5IMCA 2FA8A 1O6JA 1DBYA 1FO5A 5KEJA 4TXOB 4JR6A 1F2EA 1U87A 1AIUA 1M9BA 5C04A 2B3SA 1Z9HA 4GCIA 2M46A 1GSEA 3KZQA 3CTFA 4NHWA 4J2FA 4IP1A 4OD7A 3IHGA 2DIZA 2XBIA 4MJCA 2CAQA 2LRNA 1EZKA 1ERWA 3HJPA 4PX1A 4IQ1A 3W6GA 1K0OA 1XW5A 1JZOA 4KF9A 1PA3A 3U5RE 4I8BA 1TU8A 4AJ8A 3M9KA 1G0TA 2YNXA 5DQYA 1JHBA 5ECQB 5F0GA 2MBTA 1J9BA 4PNFA 1EOHA 1AQVA 3WD6A 1ZZYA 2VL2C 1SL1B 4OCFA 4I6XA 4BWSA 4ZB8A 3LSZA 2A2PA 4YQVA 1C72A 1N8JA 4K5RA 2YV9A 4O5UA 2VD0A 4FH8A 3QD9A 2R5GA 4WR5A 10GSA 2VD1A 1E6BA 1R7HA 1YY7A 2C0DA 3HA9A 3QR6A 2RM6A 4OFTA 5G5FA 3LGCA 4MK3A 1XW9A 3KD0A 5ECIB 3O3TA 2XPDA 4G10A 1ERVA 2GT6A 1FOHA 5CYYA 18GSA 2IFQA 1K3LA 1ZMAA 2P5RA 3HVNA 2WGRA 5HFIA 3GUSA 3GSSA 4ML6A 2OBIA 1HNCA 2LQOA 1ZGNA 4HQZA 5EY6A 1QXHA 2YJHA 1S3DA 4N30A 1WE0A 4Q5QA 2GQMA 2H1AA 8GSSA 1ERUA 1B4QA 2CX3A 4NV5A 1EP7A 1AXDA 3KP9A 12GSA 4CW9A 4N11A 4X43A 2FNOA 2HSHA 5IMAA 2H6ZA 5E4WA 3TKSC 5GSTA 4GQFA 3WGXA 3WT2A 4ZILA 1PKWA 4ZL8A 4K7IA 1PMTA 2HRFA 4MF5A 2R0PA 4PUFC 2TRXA 1SD9A 4KCAA 4POMA 5J9BA 5IOXA 2N5AA 1PN9A 1TRSA 4KDYA 2HRAA 3FW2A 2A4VA 4ZIJA 5D9WA 3VI7A 2PUKC 5L71A 2GZPA 3BD2A 2IFQB 2R0CA 1K3OA 1YF0A 2F8AA 2R6KA 4L0UA 17GSA 2AJQB 3F9UA 3UAPA 4LL1B 3ZVJD 4X4JA 1ZYEA 4FYUA 4ACSA 5COHA 2B5XA 3HY2A 3VURA 2G2QA 16GSA 3N5OA 4CY8A 1JLVA 3GKKA 3ME8A 4E8EA 3UBKA 3TGZA 4N0ZA 1GP1A 1W89A 3HVXA 2JACA 2H66A 1TXXA 1MDKA 3RHCA 4K2XA 1OE8A 2RLIA 5G1LA 1B48A 4KDUA 3C1RA 1YKCA 4YAVA 3P7XA 1EGOA 1YKAA 1YDKA 1UC7A 2RM5A 1F3AA 3KM6A 3S9FA 2EIOA 5IOWA 4KSOA 4HOJA 4XHMA 3ZMKA 1BQ7A 1JZDA 5B6MA 4LMWA 5EL8A 1B9XC 4RI7A 4J56E 4GF0A 1FG4A 5FT3A 2M72A 1M2BA 4I97A 2C3NA 2KUCA 4TKYA 4EIQA 1GNWA 3D4MA 2C0GA 3D6IA 2HNLA 3QDNA 2ON5A 3UL3A 3KGKA 1B9YC 3MIXA 2VCQA 5AGYA 3F3RA 2IMDA 5DCHA 4HJ2A 3SWLA 4BA7A 3EINA 3KTBA 4MCUA 3F4SA 1XWAA 2LUSA 4KGIA 2X8CA 2OACA 3EU3A 1NW2A 4ECBA 1X9SB 4Z2UA 3TRPA 2V41A 1K0CA 5JWQB 4QL7A 1SJZA 2VCVA 1AW9A 3LW9A 3ERFA 4GQCA 4ECJA 3GFKA 2VLTA 4ID0A 1U3IA 1GTUA 3O76A 5IMFA 1ST9A 2JSZA 2QA1A 3H93A 4GSTA 4AJ6A 2VLUA 3C7MA 3GIXA 5IO2A 3ZREA 2WDUA 5D9XA 5G31A 2OJLA 3DVXA 1WRYA 1SYRA 2DKIA 5A4VA 2B1KA 4RUVA 2GSSA 3RBTA 2KP2A 3PR8A 3MNGA 4BPYA 3J7Yk 2MZCA 3IAS2 4TRXA 5B8AA 1OVNA 2FWEA 3M8NA 3QAGA 5DALB 2X49A 4KW6A 1NSWA 2OE1A 2VCWA 2CQ9A 4Q5RA 1ZOFA 4EL1A 3KEBA 19GSA 1A8YA 3ERWA 3ED3A 4MZBA 5E59A 3RHBA 1XFLA 4IS0A 1GSYA 1OYJA 3TJBA 3L0HA 3HYPA 2IMKA 4OWYA 4L0WA 2LS5A 5G1KA 3GKNA 5BRTA 3TKSE 5ECOB 1FOVA 4XTSA 5CRDA 4EVMA 1O7UA 2HSMA 3A5IA 1F37A 3UJ1A 4G19A 2LJKA 4JR4A 4EF0A 5HR1A 1MDJA 2L5OA 3H1NA 2V1MA 3TOTA 3W8SA 3CRTA 3U6VA 1K0DA 3L78A 3GA4A 2YJ7A 3EURA 2R3XA 1ZCPA 1ZYQB 1M3IA 4E8HA 4X1UA 1XVQA 2O89A 2H0GA 1PSQA 2V2GA 2GSTA 4F03A 1BX9A 5A4UA 4F0CA 2ZNMA 4Q5FA 4G0KA 3VK9A 2L4QA 1WMJA 2LRCA 3IPZA 4XS6A 3LJRA 4GTUA 1JLWA 2VM2A 1ABAA 2F9SA 1Z7RA 2LJRA 1V2AA 4HU9A 2FD3A 3UOMA 2CVDA 2DC5A 1W4VA 1GSQA 3OR5A 2VL9A 1K0AA 3EMPA 4DSQA 3UBLA 1EEMA 2A2SA 1NM3A 2LV3A 3IAM2 2L57A 3UIWA 4RQRA 1H75A 2C1YA 2N5FA 3APQA 4JEDA 2L5LA 1BJXA 2OE3A 4G9HA 1SK1A 2FWFA 1TRUA 2YWNA 3IRAA 4TR0A 5J41A 4BVXA 3DIEA 4L5LA 5KN1A 1J08A 1Z6MA 2F51A 2HFDA 1R5PA 14GSA 1U3AA 3HHVA 1JFUA 2R4VA 4ILFA 1I9DA 4MF6A 3R3EA 1EP8A 2DJJA 2H0IA 4GSNA 5DDLA 1QGVA 4K7OA 1XPVA 1USBA 4MH3A 5ECMB 4O7HA 1VGLA 6GSWA 3GKMA 1PQNA 1OC8A 2I3YA 2FY6A 4K9ZA 2K8VA 4NAXA 4MZWA 5H5SA 3V1WA 1UN2A 2L6DA 3N9JA 1E2YA 1A0FA 3EU4A 2IMFA 5DQSA 4IQAA 2K9FA 5CO3A 1GWCA 4GRFA 2YV7A 5HR3A 1EEJA 1CQHA 1FVJA 5H5QA 1HNAA 2PVOC 5FHIA 2IMEA 3BCIA 4WETA 3GL5A 1KBNA 3IE3A 3IK9A 5LD0A 4BVXB 1ON4A 1PN0A 1DE2A 1MEKA 4DSSA 3IR4A 4ICYA 1GUHA 3H79A 1ERTA 2HSYA 1EWXA 2AYTA 5KOXA 3LQ7A 2TIRA 1G7OA 3VWWA 3KH7A 3HCZA 4MPFA 4IELA 4IN0A 2LQQA 3IHQA 2VO4A 4HI7A 3NIVA 4G0LA 2C0EA 2LNSA 5KN3A 3FHKA 5J3RA 3GX8A 5DBQA 2IL3A 2MMAA 2K8SA 5IMVA 5CNWA 1URMA 2C80A 2YCDA 6GSTA 1WPIA 4JBBA 3IC8A 2CA8A 3GN3A 4BIKA 4J57E 3HVSA 4K0GA 1ILOA 3KXOA
chains in the Genus database with same CATH topology
4IBPA 1A0RP 3UARA 2HT9A 5C00A 4EKZA 3FK8A 4PXOA 4AJ7A 1T3BA 3PPUA 3FR6A 4QL9A 5CP1A 2DJ3A 2BTOT 5AIVA 1SL2B 2DIYA 4KSMA 2DJ2A 2YP6A 4BL7A 4PNGA 4WBJA 5JCWA 5ECNB 3ISOA 1TI3A 4FYBA 1PD21 1R26A 4DSSB 3FR9A 4K1FA 4USSA 3D5JA 4MNNA 4XRDA 4DVCA 5F06A 5D93A 4EUYA 1T8EB 1ML6A 2CAIA 4YQMA 1A2MA 3RAZA 4V2LA 2V6OA 3BCKA 4L8EA 4HZ2A 3WGDA 1WP0A 2H72A 4FO5A 3E0UA 5IPGA 1XWCA 2I1UA 4G0IA 4MABA 4IVFA 3VPQA 1QK8A 5ELAA 3EVIA 3K8NA 1PRXA 4HJMA 3C8EA 3APOA 5ECSA 4MZCA 5EVOA 2GS3A 5JWRB 2PVQA 1R4WA 3ZTLA 3I9V2 1ZYNA 2DKHA 4EDZA 1M7TA 2F8FA 4HS1A 2JADA 2GGTA 4V2MA 1Z7PA 2FWGA 5EPFA 2H30A 3QAWA 6GSYA 2BMXA 5F07A 1PX7A 4BL7B 3DMLA 2ZCTA 1HNBA 2PU9C 3A2XA 1Z6NA 4NV2A 1GRXA 5IIZA 4ECCA 2YWOA 2XC2A 4MP4A 4WBRD 1M99A 2WS2A 1SK0A 1EV4A 6GSUA 2H8LA 2EIQA 5IO0A 1GUMA 1T7PB 2CZ3A 4O5QA 3DEXA 3RDWA 2F3MA 2E2GA 3W8JA 1F3BA 3KMNA 4MF7A 4IW9A 4ZBDA 1V40A 5IMZA 22GSA 3GTUA 5ECRB 5LNKe 2B5YA 2TRCP 4CY6A 5D73A 4LMVA 3CSIA 2B7JA 3UMAA 1AC1A 2PWJA 2GZYA 4CHSA 1FVKA 3FYGA 3P8WA 4K5SA 2R0GA 4H86A 2OADA 3M9JA 2LEGA 1RK4A 4YQUA 4PURA 1T4ZA 2VM1A 2MMOA 2UZ8A 3APSA 3QFAC 1XWBA 1KTEA 3C1SA 5A4WA 2V6KA 1XVWA 2LKUA 1AQWA 3QFBC 3FZ9A 4XCSA 2H1BA 1SJ6A 3BOAA 4G2EA 2EIRA 2H73A 2GSQA 3CMIA 4BWQA 3D21A 3G7YA 2R37A 2H70A 2KLXA 3KCMA 3QCPA 1J0FA 1OC9A 4MLYA 2IMIA 3GV1A 4PUAA 1N2AA 3VI5A 4GXZA 1G6YA 5G5EA 2XBQA 3ZFBA 4DSRA 1GLPA 3CSHA 4LL4B 1SU9A 1XOBA 3TJGA 2GLRA 3TUEA 4GLTA 5ECLB 5ENUA 1DSBA 1WIKA 3KIJA 2AUVA 1SKRB 3LYKA 5JCUA 5IQYA 4POBA 3QAVA 1GH2A 5DAKA 1QFNA 4ULXA 7GSSA 3FY7A 2GTUA 1A8LA 4MA9A 4OO5A 4ZXGA 3GMFA 4ZB9A 2DMLA 4HU7A 4K2DA 4O32A 2K6VA 2LTKA 3ZYWA 2VUPA 2B6MA 4XS4A 4POLA 1VRSD 3A2WA 1U88A 4HEA2 1OC9B 5D9TA 4NWYA 4KNDA 4IGJA 4PGTA 2I81A 1TJDA 2H6XA 1UVZA 6GSVA 1MD3A 3I43A 2YPMA 2YANA 2IJYA 2HZFA 3TRQA 4POKA 3LWAA 5AN1A 3HJOA 2O87A 2O8VB 3VFIA 3RPPA 1DE1A 1O85A 4IJIA 1PGTA 2KP1A 3HKRA 1T00A 2FUG2 2DMMA 2L59A 5JCGA 3IBHA 2XHFA 2M80A 1G7EA 3TCOA 4Z2TA 4OFNA 4KCEA 1TTZA 2HLSA 4EXJA 3F6DA 3TKQA 3P2AA 5HR2A 5J4UA 5JWOB 2OKAA 1YEPA 4EDYA 3CYNA 2P0GA 5G30A 2LNTA 4IP6A 3E3EA 3L9UA 3C73A 1KEBA 3MAKA 4XS4B 4HQSA 4RI6A 2H1GA 3A3TA 5F8BA 2L6CA 2CVBA 3F8UA 3IXRA 4WXTA 1EGRA 3C71A 4N10A 2WJUA 4F82A 2AB6A 3GX0A 3L9VA 1H4OA 1M0UA 3CSJA 5F05A 1SK2A 1IYHA 2GVPA 1WJKA 1ZYPA 2EC4A 2HZEA 1V98A 4I2UA 3Q19A 2D2ZA 5ECKB 2WB9A 5KN0A 1B4PA 4WEYA 2IWTA 5LCZA 3HZ8A 4EIPA 3DKSA 4O5RA 1LU4A 4V1Ap 4I2TA 4NHZA 2OE0A 3IOSA 3D4TA 1HQOA 5CRWA 4KX4A 2VCXA 1A2JA 1VF1A 3J7Yb 4V2NA 2YWIA 5CRGA 1TDIA 2NDOA 4HZ4A 4NXIA 3HJMA 3MSZA 3IC4A 4K6XA 3TB2A 2MYGA 4X0XA 1LBKA 1M9AA 2JZRA 2QKEA 2VOCA 6GSXA 4KAEA 2IPAA 3VLNA 1OE7A 1SL0B 4PTSA 1GLQA 4TR4A 3M0FA 2X99A 4XRAA 2P5QA 1THOA 1SKWB 3DXBA 3ME7A 2PMTA 4TW5A 2NBSA 2QSIA 4PQHA 1RQMA 4GWRA 3GL3A 1O8WA 2DJ0A 1TKDB 1K0MA 2CX4A 1Q98A 3HD5A 2AHEA 2HZEB 4WF4A 2P31A 4AGSA 2WULA 4TR1A 3FMWA 3IDVA 4O92A 2RUFA 3BBYA 1MTCA 2GQLA 4KDXA 1V9WA 5DCGA 2GT5A 3F4RA 3GYKA 4MJBA 3IV4A 2X8HA 1V57A 5ID2A 5B7CA 1S3AA 2IN3A 2LSTA 4TXVA 2O7KA 3KMOA 1TI1A 4TN8A 1GUKA 1PKZA 3TKPA 3WGEA 2H1DA 5GAPD 1RW1A 4IHUA 4MMMA 4BVYA 2V32A 3LXTA 2I9HA 5H5RA 1GSDA 3FRCA 4AF2A 3EWLA 3I6AA 3TKRA 3TRXA 3FZ4A 2QGVA 4NPBA 2DBCA 3GRXA 3LXZA 2YZUA 3ZL5A 4OCEA 4KB3A 1BG5A 1X9MB 2NPBA 1LJRA 4A5PA 2GSRA 4PQ1A 2C4JA 1DUGA 4KA0A 4N0VA 4Z7XA 5HFKA 3US3A 2WFCA 1FAAA 13GSA 5DJLA 4TR1B 2VCZA 1K0BA 2WZ9A 2A2RA 3PINA 1GTIA 5IMDA 3ZIJA 1SD8A 3F63A 2Z9SA 1A23A 1WOUA 3H4KA 3ZZXA 2C3QA 5ID2B 4F2IA 4GSSA 1TOFA 1XZOA 3JCML 2HE3A 3D22A 9GSSA 1XWKA 1GSFA 3I69A 6GSSA 1YEXA 2I4AA 3DD3A 1OKDA 4WF5A 3M3MA 1SJIA 4TOPA 4BVYB 1VF2A 2PBJA 3CXGA 3Q74A 4JE1A 3L4NA 2C8UA 2H01A 3EMXA 5ECPB 4F0BA 2YZHA 2AAWA 2VLVA 3M1GA 1JZWA 1TK8B 4K0NA 2RIIA 1SYXA 5AIXA 1FW1A 2PPTA 1EOGA 1AUCA 1GSSA 3L9SA 2WCIA 4LLRA 2B5EA 1SENA 3A5WA 4ZBBA 11GSA 3RPNA 1XW6A 5IM9A 2ES7A 2JU5A 1TK5B 1GTBA 3F0IA 3GSTA 20GSA 4V1Ag 2X8GA 3Q18A 3FZAA 5ABRA 4ZL9A 2X4AA 3VWUA 3G7IA 2DLXA 1I5GA 3Q6OA 4MH2A 1GL8A 4IJ3A 3HDCA 2FWHA 3F6FA 2GDRA 4MDCA 4D73A 3DVWA 1ZL9A 2E2MA 3TJFA 4K8MA 2KOKA 2JZSA 1QMVA 1XBSA 1K0NA 5DVBA 5G2ZA 2PGTA 1FB0A 1CQGA 1WWJA 2H19A 4KUNA 3PH9A 2L4CA 3EPTA 2XPEA 3EYTA 1VF3A 3IA1A 1B8XA 4WKWA 4ISDA 1VF4A 4K7NA 1O81A 3D0ZA 2H74A 5J5NA 3KH9A 1Y6EA 1T1VA 2GZZA 4YKGA 2C0FA 1XOAA 1YJ6A 3R2QA 2VL2A 1G6WA 1F9MA 5D8IA 4QQ7A 2QA2A 2H75A 2FLSA 2OBKA 2QC7A 2X64A 3SBCA 4ECIA 4YKFA 3E9JB 1THXA 4MJEA 5B8BA 4WR4A 3DWVA 4KH7A 2N5BA 3H8QA 1BEDA 3BJ5A 5J9CA 2FHEA 1NHYA 4D73B 2OA7A 1T4YA 2YN1A 2H0HA 4HDEA 4HUAA 1UA5A 1FHEA 3LYPA 2MBSA 3GH9A 3G9BA 3KP8A 2J23A 2JSYA 1X9WB 3WYWA 1TRVA 4NMUA 3DYRA 3F4TA 3ZFLA 3ZMLA 3ZITA 3GURA 4P3YB 2RUEA 1TRWA 3GTUB 2IIYA 2GQKA 4I5QA 5DALA 1PL2A 5HR0A 5CREA 1NHOA 5KOWA 4PQIA 4YH2A 1O73A 3UVTA 5AISA 3CTGA 3ERGA 5HQPA 1U6TA 2NTOA 2ON7A 3LORA 2WRTA 2LRTA 3AY8A 2JZTA 1Y25A 3TKSA 1O8XA 2O85A 4OO4A 3ZRDA 4OMVA 3UEMA 4XS1A 4RQXA 5GSSA 2VCTA 3QPMA 1TU7A 2KHPA 4JZQA 5KN2A 2AV4A 3ZVJA 2PERA 3VWXA 2HI7A 5B6NA 1X5DA 1Z3EA 2H71A 4LA1A 4CDOA 1OKTA 2FGXA 4Z2RA 1PL1A 5DJMA 5CRHA 4FIWA 3HXSA 2J9HA 3LG6A 2E7PA 2HXKA 3GH6A 1QUWA 1X5EA 3TDGA 4XIHA 3EC3A 2CZ2A 4TVEA 5GAND 3MWHA 2DSAA 2CT6A 4TR3A 1S3CA 3DGQA 2REMA 2NVLA 2FA4A 1XCCA 2C3TA 4JU5A 1A24A 4ZB6A 3F3QA 2HRKA 5INYA 1Q4JA 2BJXA 1HD2A 2FCHA 2A4HA 5DAKB 1GSUA 5D9VA 1GTAA 1TK0B 4FQUA 2H76A 3ZIVA 3PGTA 2B1LA 2H6YA 3FEUA 1R5AA 1XXUA 2ZUPA 5HFGA 2R2JA 1TP9A 1YF1A 4MJAA 3G7JA 2HYXA 1ACVA 4DEJA 1MDIA 2YOIA 3FZ5A 2MMZA 5IPHA 4ML1A 1FB6A 1A2LA 3MYDA 3HZ4A 1EV9A 2YWMA 3TOUA 3CRUA 4JRRA 1OAZA 4IKHA 1BYEA 1HYUA 3EE2A 3VWVA 1BAYA 1AAZA 2E0QA 5BMUA 1XIYA 2CVKA 4EE0A 2VIMA 3QOUA 1TW9A 3TJJA 3KJYA 4Q5NA 1M2AA 5CAXA 1X0RA 3CBUA 1K3YA 4OFMA 3O6TA 4MPGA 3LEFA 2JL4A 1XWGA 2G0FA 5D96A 4TXOA 2ALBA 3LFLA 1KNGA 3MDKA 4EC0A 1YQ1A 3NOFA 3NZNA 2K18A 1X5CA 3VPTA 2DJKA 3A2VA 3ZLPA 5A5KA 3FKFA 4YAPA 2VL3A 2B7KA 3GHAA 3UVHA 4F9ZA 3WT1A 5GZZB 5ECHB 3IK7A 4ZBAA 1GNEA 1YZXA 1GULA 4ZL7A 1AQXA 3GKXA 1V58A 4L5OA 1PX6A 1F6MC 2VAFA 1JZRA 3TJKA 3GNJA 5FWGA 2CV4A 1M2DA 1IYIA 3P90A 4EO3A 3KTLA 1MD4A 2LJAA 2HRNA 2PN8A 5ELGA 1SKSB 4KE3A 2DJ1A 1QQ2A 1OC3A 3HVVA 1Z5YE 4FYCA 3FR3A 2MMNA 3DRNA 3QMXA 5IMCA 2FA8A 1O6JA 1DBYA 1FO5A 5KEJA 4TXOB 4JR6A 1F2EA 1U87A 1AIUA 1M9BA 5C04A 2B3SA 1Z9HA 4GCIA 2M46A 1GSEA 3KZQA 3CTFA 4NHWA 4J2FA 4IP1A 4OD7A 3IHGA 2DIZA 2XBIA 4MJCA 2CAQA 2LRNA 1EZKA 1ERWA 3HJPA 4PX1A 4IQ1A 3W6GA 1K0OA 1XW5A 1JZOA 4KF9A 1PA3A 3U5RE 4I8BA 1TU8A 4AJ8A 3M9KA 1G0TA 2YNXA 5DQYA 1JHBA 5ECQB 5F0GA 2MBTA 1J9BA 4PNFA 1EOHA 1AQVA 3WD6A 1ZZYA 2VL2C 1SL1B 4OCFA 4I6XA 4BWSA 4ZB8A 3LSZA 2A2PA 4YQVA 1C72A 1N8JA 4K5RA 2YV9A 4O5UA 2VD0A 4FH8A 3QD9A 2R5GA 4WR5A 10GSA 2VD1A 1E6BA 1R7HA 1YY7A 2C0DA 3HA9A 3QR6A 2RM6A 4OFTA 5G5FA 3LGCA 4MK3A 1XW9A 3KD0A 5ECIB 3O3TA 2XPDA 4G10A 1ERVA 2GT6A 1FOHA 5CYYA 18GSA 2IFQA 1K3LA 1ZMAA 2P5RA 2WGRA 5HFIA 3GUSA 3GSSA 4ML6A 2OBIA 1HNCA 2LQOA 1ZGNA 4HQZA 5EY6A 1QXHA 2YJHA 1S3DA 4N30A 1WE0A 4Q5QA 2GQMA 2H1AA 8GSSA 1ERUA 1B4QA 2CX3A 4NV5A 1EP7A 1AXDA 3KP9A 12GSA 4CW9A 4N11A 4X43A 2FNOA 2HSHA 5IMAA 2H6ZA 5E4WA 3TKSC 5GSTA 4GQFA 3WGXA 3WT2A 4ZILA 1PKWA 4ZL8A 4K7IA 1PMTA 2HRFA 4MF5A 2R0PA 4PUFC 2TRXA 1SD9A 4KCAA 4POMA 5J9BA 5IOXA 2N5AA 1PN9A 1TRSA 4KDYA 2HRAA 3FW2A 2A4VA 4ZIJA 5D9WA 3VI7A 2PUKC 5L71A 2GZPA 3BD2A 2IFQB 2R0CA 1K3OA 1YF0A 2F8AA 2R6KA 4L0UA 17GSA 2AJQB 3F9UA 3UAPA 4LL1B 3ZVJD 4X4JA 1ZYEA 4FYUA 4ACSA 5COHA 2B5XA 3HY2A 3VURA 2G2QA 16GSA 3N5OA 4CY8A 1JLVA 3GKKA 3ME8A 4E8EA 3UBKA 3TGZA 4N0ZA 1GP1A 1W89A 3HVXA 2JACA 2H66A 1TXXA 1MDKA 3RHCA 4K2XA 1OE8A 2RLIA 5G1LA 1B48A 4KDUA 3C1RA 1YKCA 4YAVA 3P7XA 1EGOA 1YKAA 1YDKA 1UC7A 2RM5A 1F3AA 3KM6A 3S9FA 2EIOA 5IOWA 4KSOA 4HOJA 4XHMA 3ZMKA 1BQ7A 1JZDA 5B6MA 4LMWA 5EL8A 1B9XC 4RI7A 4J56E 4GF0A 1FG4A 5FT3A 2M72A 1M2BA 4I97A 2C3NA 2KUCA 4TKYA 4EIQA 1GNWA 3D4MA 2C0GA 3D6IA 2HNLA 3QDNA 2ON5A 3UL3A 3KGKA 1B9YC 3MIXA 2VCQA 5AGYA 3F3RA 2IMDA 5DCHA 4HJ2A 3SWLA 4BA7A 3EINA 3KTBA 4MCUA 3F4SA 1XWAA 2LUSA 4KGIA 2X8CA 2OACA 3EU3A 1NW2A 4ECBA 1X9SB 4Z2UA 3TRPA 2V41A 1K0CA 5JWQB 4QL7A 1SJZA 2VCVA 1AW9A 3LW9A 3ERFA 4GQCA 4ECJA 3GFKA 2VLTA 4ID0A 1U3IA 1GTUA 3O76A 5IMFA 1ST9A 2JSZA 2QA1A 3H93A 4GSTA 4AJ6A 2VLUA 3C7MA 3GIXA 5IO2A 3ZREA 2WDUA 5D9XA 5G31A 2OJLA 3DVXA 1WRYA 1SYRA 2DKIA 5A4VA 2B1KA 4RUVA 2GSSA 3RBTA 2KP2A 3PR8A 3MNGA 4BPYA 3J7Yk 2MZCA 3IAS2 4TRXA 5B8AA 1OVNA 2FWEA 3M8NA 3QAGA 5DALB 2X49A 4KW6A 1NSWA 2OE1A 2VCWA 2CQ9A 4Q5RA 1ZOFA 4EL1A 3KEBA 19GSA 1A8YA 3ERWA 3ED3A 4MZBA 5E59A 3RHBA 1XFLA 4IS0A 1GSYA 1OYJA 3TJBA 3L0HA 3HYPA 2IMKA 4OWYA 4L0WA 2LS5A 5G1KA 3GKNA 5BRTA 3TKSE 5ECOB 1FOVA 4XTSA 5CRDA 4EVMA 1O7UA 2HSMA 3A5IA 1F37A 3UJ1A 4G19A 2LJKA 4JR4A 4EF0A 5HR1A 1MDJA 2L5OA 3H1NA 2V1MA 3TOTA 3W8SA 3CRTA 3U6VA 1K0DA 3L78A 3GA4A 2YJ7A 3EURA 2R3XA 1ZCPA 1ZYQB 4E8HA 4X1UA 1XVQA 2O89A 2H0GA 1PSQA 2V2GA 2GSTA 4F03A 1BX9A 5A4UA 4F0CA 2ZNMA 4Q5FA 4G0KA 3VK9A 2L4QA 1WMJA 2LRCA 3IPZA 4XS6A 3LJRA 4GTUA 1JLWA 2VM2A 1ABAA 2F9SA 1Z7RA 2LJRA 1V2AA 4HU9A 2FD3A 3UOMA 2CVDA 2DC5A 1W4VA 1GSQA 3OR5A 2VL9A 1K0AA 3EMPA 4DSQA 3UBLA 1EEMA 2A2SA 1NM3A 2LV3A 3IAM2 2L57A 3UIWA 4RQRA 1H75A 2C1YA 2N5FA 3APQA 4JEDA 2L5LA 1BJXA 2OE3A 4G9HA 1SK1A 2FWFA 1TRUA 2YWNA 3IRAA 4TR0A 5J41A 4BVXA 3DIEA 4L5LA 5KN1A 1J08A 1Z6MA 2F51A 2HFDA 1R5PA 14GSA 1U3AA 3HHVA 1JFUA 2R4VA 4ILFA 1I9DA 4MF6A 3R3EA 1EP8A 2DJJA 2H0IA 4GSNA 5DDLA 1QGVA 4K7OA 1XPVA 1USBA 4MH3A 5ECMB 4O7HA 1VGLA 6GSWA 3GKMA 1PQNA 1OC8A 2I3YA 2FY6A 4K9ZA 2K8VA 4NAXA 4MZWA 5H5SA 3V1WA 1UN2A 2L6DA 3N9JA 1E2YA 1A0FA 3EU4A 2IMFA 5DQSA 4IQAA 2K9FA 5CO3A 1GWCA 4GRFA 2YV7A 5HR3A 1EEJA 1CQHA 1FVJA 5H5QA 1HNAA 2PVOC 5FHIA 2IMEA 3BCIA 4WETA 3GL5A 1KBNA 3IE3A 3IK9A 5LD0A 4BVXB 1ON4A 1PN0A 1DE2A 1MEKA 4DSSA 3IR4A 4ICYA 1GUHA 3H79A 1ERTA 2HSYA 1EWXA 2AYTA 5KOXA 3LQ7A 2TIRA 1G7OA 3VWWA 3KH7A 3HCZA 4MPFA 4IELA 4IN0A 2LQQA 3IHQA 2VO4A 4HI7A 3NIVA 4G0LA 2C0EA 2LNSA 5KN3A 3FHKA 5J3RA 3GX8A 5DBQA 2IL3A 2MMAA 2K8SA 5IMVA 5CNWA 1URMA 2C80A 2YCDA 6GSTA 1WPIA 4JBBA 3IC8A 2CA8A 3GN3A 4J57E 3HVSA 4K0GA 1ILOA 3KXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBP A;  1A0R P;  3UAR A;  2HT9 A;  5C00 A;  4EKZ A;  3FK8 A;  4PXO A;  4AJ7 A;  1T3B A;  3FR6 A;  4QL9 A;  5CP1 A;  2DJ3 A;  2BTO T;  5AIV A;  1SL2 B;  2DIY A;  4KSM A;  2DJ2 A;  2YP6 A;  4BL7 A;  4PNG A;  4WBJ A;  5JCW A;  5ECN B;  3ISO A;  1TI3 A;  4FYB A;  1PD2 1;  1R26 A;  4DSS B;  3FR9 A;  4K1F A;  3D5J A;  4XRD A;  4DVC A;  5F06 A;  5D93 A;  4EUY A;  1T8E B;  1ML6 A;  2CAI A;  4YQM A;  1A2M A;  3RAZ A;  4V2L A;  2V6O A;  3BCK A;  4L8E A;  4HZ2 A;  3WGD A;  1WP0 A;  2H72 A;  4FO5 A;  3E0U A;  5IPG A;  1XWC A;  2I1U A;  4MAB A;  4IVF A;  3VPQ A;  1QK8 A;  5ELA A;  3EVI A;  3K8N A;  1PRX A;  4HJM A;  3C8E A;  3APO A;  5ECS A;  4MZC A;  5EVO A;  2GS3 A;  5JWR B;  2PVQ A;  1R4W A;  3ZTL A;  3I9V 2;  4EDZ A;  1M7T A;  2F8F A;  4HS1 A;  2JAD A;  2GGT A;  4V2M A;  1Z7P A;  2FWG A;  5EPF A;  2H30 A;  3QAW A;  6GSY A;  2BMX A;  5F07 A;  1PX7 A;  3DML A;  2ZCT A;  1HNB A;  2PU9 C;  3A2X A;  1Z6N A;  4NV2 A;  1GRX A;  5IIZ A;  4ECC A;  2YWO A;  2XC2 A;  4MP4 A;  4WBR D;  1M99 A;  2WS2 A;  1SK0 A;  1EV4 A;  6GSU A;  2H8L A;  2EIQ A;  5IO0 A;  1GUM A;  1T7P B;  2CZ3 A;  3DEX A;  3RDW A;  2F3M A;  2E2G A;  3W8J A;  1F3B A;  3KMN A;  4MF7 A;  4IW9 A;  4ZBD A;  1V40 A;  5IMZ A;  22GS A;  3GTU A;  5ECR B;  5LNK e;  2B5Y A;  2TRC P;  5D73 A;  4LMV A;  3CSI A;  2B7J A;  3UMA A;  1AC1 A;  2PWJ A;  2GZY A;  4CHS A;  1FVK A;  3FYG A;  3P8W A;  4H86 A;  2OAD A;  3M9J A;  2LEG A;  1RK4 A;  4YQU A;  4PUR A;  1T4Z A;  2VM1 A;  2MMO A;  3APS A;  3QFA C;  1XWB A;  1KTE A;  3C1S A;  5A4W A;  2V6K A;  1XVW A;  2LKU A;  1AQW A;  3QFB C;  3FZ9 A;  4XCS A;  2H1B A;  1SJ6 A;  3BOA A;  4G2E A;  2EIR A;  2H73 A;  2GSQ A;  3CMI A;  4BWQ A;  3D21 A;  3G7Y A;  2R37 A;  2H70 A;  2KLX A;  3KCM A;  3QCP A;  1J0F A;  1OC9 A;  4MLY A;  2IMI A;  3GV1 A;  4PUA A;  1N2A A;  3VI5 A;  4GXZ A;  1G6Y A;  5G5E A;  2XBQ A;  3ZFB A;  4DSR A;  1GLP A;  3CSH A;  4LL4 B;  1SU9 A;  1XOB A;  3TJG A;  2GLR A;  3TUE A;  4GLT A;  5ECL B;  5ENU A;  1DSB A;  1WIK A;  3KIJ A;  2AUV A;  1SKR B;  3LYK A;  5JCU A;  5IQY A;  4POB A;  3QAV A;  1GH2 A;  5DAK A;  1QFN A;  4ULX A;  7GSS A;  3FY7 A;  2GTU A;  1A8L A;  4MA9 A;  4OO5 A;  4ZXG A;  3GMF A;  4ZB9 A;  2DML A;  4HU7 A;  4K2D A;  4O32 A;  2K6V A;  2LTK A;  3ZYW A;  2VUP A;  2B6M A;  4XS4 A;  4POL A;  1VRS D;  3A2W A;  1U88 A;  4HEA 2;  1OC9 B;  5D9T A;  4NWY A;  4KND A;  4IGJ A;  4PGT A;  2I81 A;  1TJD A;  2H6X A;  1UVZ A;  6GSV A;  1MD3 A;  3I43 A;  2YPM A;  2YAN A;  2IJY A;  2HZF A;  3TRQ A;  4POK A;  3LWA A;  5AN1 A;  3HJO A;  2O87 A;  2O8V B;  3VFI A;  3RPP A;  1DE1 A;  1O85 A;  4IJI A;  1PGT A;  2KP1 A;  3HKR A;  1T00 A;  2FUG 2;  2DMM A;  2L59 A;  5JCG A;  3IBH A;  2XHF A;  2M80 A;  1G7E A;  3TCO A;  4OFN A;  4KCE A;  1TTZ A;  2HLS A;  4EXJ A;  3F6D A;  3TKQ A;  3P2A A;  5HR2 A;  5J4U A;  5JWO B;  2OKA A;  1YEP A;  4EDY A;  3CYN A;  2P0G A;  5G30 A;  2LNT A;  4IP6 A;  3E3E A;  3L9U A;  3C73 A;  1KEB A;  3MAK A;  4XS4 B;  4HQS A;  4RI6 A;  2H1G A;  3A3T A;  5F8B A;  2L6C A;  2CVB A;  3F8U A;  3IXR A;  4WXT A;  1EGR A;  3C71 A;  4N10 A;  2WJU A;  4F82 A;  2AB6 A;  3GX0 A;  3L9V A;  1H4O A;  1M0U A;  3CSJ A;  5F05 A;  1SK2 A;  1IYH A;  2GVP A;  1WJK A;  2EC4 A;  2HZE A;  1V98 A;  4I2U A;  3Q19 A;  2D2Z A;  5ECK B;  2WB9 A;  5KN0 A;  1B4P A;  4WEY A;  2IWT A;  5LCZ A;  3HZ8 A;  3DKS A;  4O5R A;  1LU4 A;  4V1A p;  4I2T A;  4NHZ A;  2OE0 A;  3IOS A;  3D4T A;  1HQO A;  5CRW A;  4KX4 A;  2VCX A;  1A2J A;  1VF1 A;  3J7Y b;  4V2N A;  2YWI A;  5CRG A;  1TDI A;  2NDO A;  4HZ4 A;  4NXI A;  3HJM A;  3MSZ A;  3IC4 A;  4K6X A;  3TB2 A;  2MYG A;  4X0X A;  1LBK A;  1M9A A;  2JZR A;  2QKE A;  2VOC A;  6GSX A;  4KAE A;  2IPA A;  3VLN A;  1OE7 A;  1SL0 B;  1GLQ A;  4TR4 A;  3M0F A;  2X99 A;  4XRA A;  2P5Q A;  1THO A;  1SKW B;  3DXB A;  3ME7 A;  2PMT A;  4TW5 A;  2NBS A;  2QSI A;  4PQH A;  1RQM A;  4GWR A;  3GL3 A;  1O8W A;  2DJ0 A;  1TKD B;  1K0M A;  2CX4 A;  1Q98 A;  3HD5 A;  2AHE A;  2HZE B;  4WF4 A;  2P31 A;  4AGS A;  2WUL A;  4TR1 A;  3IDV A;  4O92 A;  2RUF A;  3BBY A;  1MTC A;  2GQL A;  4KDX A;  1V9W A;  5DCG A;  2GT5 A;  3F4R A;  3GYK A;  4MJB A;  3IV4 A;  2X8H A;  1V57 A;  5ID2 A;  5B7C A;  1S3A A;  2IN3 A;  2LST A;  4TXV A;  2O7K A;  3KMO A;  1TI1 A;  4TN8 A;  1GUK A;  1PKZ A;  3TKP A;  3WGE A;  2H1D A;  5GAP D;  1RW1 A;  4IHU A;  4MMM A;  4BVY A;  2V32 A;  3LXT A;  2I9H A;  5H5R A;  1GSD A;  3FRC A;  4AF2 A;  3EWL A;  3I6A A;  3TKR A;  3TRX A;  3FZ4 A;  2QGV A;  4NPB A;  2DBC A;  3GRX A;  3LXZ A;  2YZU A;  3ZL5 A;  4OCE A;  4KB3 A;  1BG5 A;  1X9M B;  2NPB A;  1LJR A;  2GSR A;  4PQ1 A;  2C4J A;  1DUG A;  4KA0 A;  4N0V A;  4Z7X A;  5HFK A;  3US3 A;  2WFC A;  1FAA A;  13GS A;  5DJL A;  4TR1 B;  2VCZ A;  1K0B A;  2WZ9 A;  2A2R A;  3PIN A;  1GTI A;  5IMD A;  3ZIJ A;  1SD8 A;  3F63 A;  2Z9S A;  1A23 A;  1WOU A;  3H4K A;  3ZZX A;  2C3Q A;  5ID2 B;  4F2I A;  4GSS A;  1TOF A;  1XZO A;  3JCM L;  2HE3 A;  3D22 A;  9GSS A;  1XWK A;  1GSF A;  3I69 A;  6GSS A;  1YEX A;  2I4A A;  3DD3 A;  1OKD A;  4WF5 A;  3M3M A;  1SJI A;  4TOP A;  1VF2 A;  2PBJ A;  3CXG A;  3Q74 A;  4JE1 A;  3L4N A;  2C8U A;  2H01 A;  3EMX A;  5ECP B;  4F0B A;  2YZH A;  2AAW A;  2VLV A;  3M1G A;  1JZW A;  1TK8 B;  4K0N A;  2RII A;  1SYX A;  5AIX A;  1FW1 A;  2PPT A;  1EOG A;  1AUC A;  1GSS A;  3L9S A;  2WCI A;  4LLR A;  2B5E A;  1SEN A;  3A5W A;  4ZBB A;  11GS A;  3RPN A;  1XW6 A;  5IM9 A;  2ES7 A;  2JU5 A;  1TK5 B;  1GTB A;  3F0I A;  3GST A;  20GS A;  4V1A g;  2X8G A;  3Q18 A;  3FZA A;  5ABR A;  4ZL9 A;  3VWU A;  3G7I A;  2DLX A;  1I5G A;  3Q6O A;  4MH2 A;  1GL8 A;  4IJ3 A;  3HDC A;  2FWH A;  3F6F A;  2GDR A;  4MDC A;  4D73 A;  3DVW A;  1ZL9 A;  2E2M A;  3TJF A;  4K8M A;  2KOK A;  2JZS A;  1QMV A;  1XBS A;  1K0N A;  5DVB A;  5G2Z A;  2PGT A;  1FB0 A;  1CQG A;  1WWJ A;  2H19 A;  4KUN A;  3PH9 A;  2L4C A;  3EYT A;  2XPE A;  1VF3 A;  3IA1 A;  1B8X A;  4WKW A;  4ISD A;  1VF4 A;  4K7N A;  1O81 A;  3D0Z A;  2H74 A;  5J5N A;  3KH9 A;  1Y6E A;  1T1V A;  2GZZ A;  2C0F A;  1XOA A;  1YJ6 A;  3R2Q A;  2VL2 A;  1G6W A;  1F9M A;  5D8I A;  4QQ7 A;  2H75 A;  2FLS A;  2OBK A;  2QC7 A;  2X64 A;  3SBC A;  4ECI A;  3E9J B;  1THX A;  4MJE A;  5B8B A;  4WR4 A;  3DWV A;  4KH7 A;  2N5B A;  3H8Q A;  1BED A;  3BJ5 A;  5J9C A;  2FHE A;  1NHY A;  4D73 B;  2OA7 A;  1T4Y A;  2YN1 A;  2H0H A;  4HDE A;  4HUA A;  1UA5 A;  1FHE A;  3LYP A;  2MBS A;  3GH9 A;  3G9B A;  3KP8 A;  2J23 A;  2JSY A;  1X9W B;  3WYW A;  1TRV A;  4NMU A;  3DYR A;  3F4T A;  3ZFL A;  3ZML A;  3ZIT A;  3GUR A;  4P3Y B;  2RUE A;  1TRW A;  3GTU B;  2IIY A;  2GQK A;  4I5Q A;  5DAL A;  1PL2 A;  5HR0 A;  5CRE A;  1NHO A;  4PQI A;  4YH2 A;  1O73 A;  3UVT A;  5AIS A;  3CTG A;  3ERG A;  5HQP A;  1U6T A;  2NTO A;  2ON7 A;  3LOR A;  2WRT A;  2LRT A;  3AY8 A;  2JZT A;  1Y25 A;  3TKS A;  1O8X A;  2O85 A;  4OO4 A;  3ZRD A;  4OMV A;  3UEM A;  4XS1 A;  4RQX A;  5GSS A;  2VCT A;  3QPM A;  1TU7 A;  2KHP A;  4JZQ A;  5KN2 A;  2AV4 A;  3ZVJ A;  2PER A;  3VWX A;  2HI7 A;  5B6N A;  1X5D A;  1Z3E A;  2H71 A;  4LA1 A;  4CDO A;  1OKT A;  2FGX A;  1PL1 A;  5DJM A;  5CRH A;  4FIW A;  3HXS A;  2J9H A;  3LG6 A;  2E7P A;  2HXK A;  3GH6 A;  1QUW A;  1X5E A;  3TDG A;  4XIH A;  3EC3 A;  2CZ2 A;  4TVE A;  5GAN D;  3MWH A;  2DSA A;  2CT6 A;  4TR3 A;  1S3C A;  3DGQ A;  2REM A;  2NVL A;  2FA4 A;  1XCC A;  2C3T A;  4JU5 A;  1A24 A;  4ZB6 A;  3F3Q A;  5INY A;  1Q4J A;  2BJX A;  1HD2 A;  2FCH A;  5DAK B;  1GSU A;  5D9V A;  1GTA A;  1TK0 B;  2H76 A;  3ZIV A;  3PGT A;  2B1L A;  2H6Y A;  3FEU A;  1R5A A;  1XXU A;  2ZUP A;  5HFG A;  2R2J A;  1TP9 A;  1YF1 A;  4MJA A;  3G7J A;  2HYX A;  1ACV A;  4DEJ A;  1MDI A;  2YOI A;  3FZ5 A;  2MMZ A;  5IPH A;  4ML1 A;  1FB6 A;  1A2L A;  3HZ4 A;  1EV9 A;  2YWM A;  3TOU A;  3CRU A;  4JRR A;  1OAZ A;  4IKH A;  1BYE A;  1HYU A;  3EE2 A;  3VWV A;  1BAY A;  1AAZ A;  2E0Q A;  1XIY A;  2CVK A;  4EE0 A;  2VIM A;  3QOU A;  1TW9 A;  3TJJ A;  3KJY A;  4Q5N A;  1M2A A;  5CAX A;  1X0R A;  3CBU A;  1K3Y A;  4OFM A;  3O6T A;  4MPG A;  3LEF A;  2JL4 A;  1XWG A;  2G0F A;  5D96 A;  4TXO A;  2ALB A;  3LFL A;  1KNG A;  3MDK A;  4EC0 A;  1YQ1 A;  3NOF A;  3NZN A;  2K18 A;  1X5C A;  3VPT A;  2DJK A;  3A2V A;  3ZLP A;  5A5K A;  3FKF A;  4YAP A;  2VL3 A;  2B7K A;  3GHA A;  3UVH A;  4F9Z A;  3WT1 A;  5GZZ B;  5ECH B;  3IK7 A;  4ZBA A;  1GNE A;  1YZX A;  1GUL A;  4ZL7 A;  1AQX A;  3GKX A;  1V58 A;  4L5O A;  1PX6 A;  1F6M C;  2VAF A;  1JZR A;  3TJK A;  3GNJ A;  5FWG A;  2CV4 A;  1M2D A;  1IYI A;  3P90 A;  4EO3 A;  3KTL A;  1MD4 A;  2LJA A;  2HRN A;  2PN8 A;  5ELG A;  1SKS B;  4KE3 A;  2DJ1 A;  1QQ2 A;  1OC3 A;  3HVV A;  1Z5Y E;  4FYC A;  3FR3 A;  2MMN A;  3DRN A;  3QMX A;  5IMC A;  2FA8 A;  1O6J A;  1DBY A;  1FO5 A;  5KEJ A;  4TXO B;  4JR6 A;  1F2E A;  1U87 A;  1AIU A;  1M9B A;  5C04 A;  2B3S A;  1Z9H A;  4GCI A;  2M46 A;  1GSE A;  3KZQ A;  3CTF A;  4NHW A;  4J2F A;  4IP1 A;  4OD7 A;  2DIZ A;  2XBI A;  4MJC A;  2CAQ A;  2LRN A;  1EZK A;  1ERW A;  3HJP A;  4PX1 A;  4IQ1 A;  3W6G A;  1K0O A;  1XW5 A;  1JZO A;  1PA3 A;  3U5R E;  4I8B A;  1TU8 A;  4AJ8 A;  3M9K A;  1G0T A;  2YNX A;  5DQY A;  1JHB A;  5ECQ B;  5F0G A;  2MBT A;  1J9B A;  4PNF A;  1EOH A;  1AQV A;  3WD6 A;  1ZZY A;  2VL2 C;  1SL1 B;  4OCF A;  4I6X A;  4BWS A;  4ZB8 A;  3LSZ A;  4YQV A;  1C72 A;  1N8J A;  2YV9 A;  2VD0 A;  4FH8 A;  3QD9 A;  2R5G A;  4WR5 A;  10GS A;  2VD1 A;  1E6B A;  1R7H A;  1YY7 A;  2C0D A;  3HA9 A;  3QR6 A;  2RM6 A;  4OFT A;  5G5F A;  3LGC A;  4MK3 A;  1XW9 A;  3KD0 A;  5ECI B;  3O3T A;  2XPD A;  4G10 A;  1ERV A;  2GT6 A;  5CYY A;  18GS A;  2IFQ A;  1K3L A;  1ZMA A;  2P5R A;  2WGR A;  5HFI A;  3GUS A;  3GSS A;  4ML6 A;  2OBI A;  1HNC A;  2LQO A;  1ZGN A;  5EY6 A;  4HQZ A;  1QXH A;  2YJH A;  1S3D A;  4N30 A;  1WE0 A;  4Q5Q A;  2GQM A;  2H1A A;  8GSS A;  1ERU A;  1B4Q A;  2CX3 A;  4NV5 A;  1EP7 A;  1AXD A;  3KP9 A;  12GS A;  4CW9 A;  4N11 A;  4X43 A;  2FNO A;  2HSH A;  5IMA A;  2H6Z A;  5E4W A;  3TKS C;  5GST A;  4GQF A;  3WGX A;  3WT2 A;  4ZIL A;  1PKW A;  4ZL8 A;  4K7I A;  1PMT A;  2HRF A;  4MF5 A;  4PUF C;  2TRX A;  1SD9 A;  4KCA A;  4POM A;  5J9B A;  5IOX A;  2N5A A;  1PN9 A;  1TRS A;  4KDY A;  3FW2 A;  2A4V A;  4ZIJ A;  5D9W A;  3VI7 A;  2PUK C;  5L71 A;  2GZP A;  3BD2 A;  2IFQ B;  1K3O A;  1YF0 A;  2F8A A;  2R6K A;  4L0U A;  17GS A;  2AJQ B;  3F9U A;  3UAP A;  4LL1 B;  3ZVJ D;  1ZYE A;  4FYU A;  4ACS A;  5COH A;  2B5X A;  3HY2 A;  3VUR A;  2G2Q A;  16GS A;  3N5O A;  1JLV A;  3GKK A;  3ME8 A;  4E8E A;  3UBK A;  3TGZ A;  4N0Z A;  1GP1 A;  1W89 A;  3HVX A;  2JAC A;  2H66 A;  1TXX A;  1MDK A;  3RHC A;  1OE8 A;  2RLI A;  5G1L A;  1B48 A;  4KDU A;  3C1R A;  1YKC A;  4YAV A;  3P7X A;  1EGO A;  1YKA A;  1YDK A;  1UC7 A;  2RM5 A;  1F3A A;  3KM6 A;  3S9F A;  2EIO A;  5IOW A;  4KSO A;  4HOJ A;  4XHM A;  3ZMK A;  1BQ7 A;  1JZD A;  5B6M A;  4LMW A;  5EL8 A;  1B9X C;  4RI7 A;  4J56 E;  4GF0 A;  1FG4 A;  5FT3 A;  2M72 A;  1M2B A;  4I97 A;  2C3N A;  2KUC A;  4TKY A;  1GNW A;  3D4M A;  2C0G A;  3D6I A;  2HNL A;  3QDN A;  2ON5 A;  3UL3 A;  3KGK A;  1B9Y C;  2VCQ A;  5AGY A;  3F3R A;  2IMD A;  5DCH A;  4HJ2 A;  3SWL A;  4BA7 A;  3EIN A;  3KTB A;  4MCU A;  3F4S A;  1XWA A;  2LUS A;  4KGI A;  2X8C A;  2OAC A;  3EU3 A;  1NW2 A;  4ECB A;  1X9S B;  3TRP A;  2V41 A;  1K0C A;  5JWQ B;  4QL7 A;  1SJZ A;  2VCV A;  1AW9 A;  3ERF A;  4GQC A;  4ECJ A;  3GFK A;  2VLT A;  4ID0 A;  1U3I A;  1GTU A;  3O76 A;  5IMF A;  1ST9 A;  2JSZ A;  3H93 A;  4GST A;  4AJ6 A;  2VLU A;  3C7M A;  3GIX A;  5IO2 A;  3ZRE A;  2WDU A;  5D9X A;  5G31 A;  2OJL A;  3DVX A;  1WRY A;  1SYR A;  5A4V A;  2B1K A;  4RUV A;  2GSS A;  3RBT A;  2KP2 A;  3PR8 A;  3MNG A;  4BPY A;  3J7Y k;  2MZC A;  3IAS 2;  4TRX A;  5B8A A;  1OVN A;  2FWE A;  3M8N A;  3QAG A;  5DAL B;  4KW6 A;  1NSW A;  2OE1 A;  2VCW A;  2CQ9 A;  4Q5R A;  1ZOF A;  4EL1 A;  3KEB A;  19GS A;  1A8Y A;  3ERW A;  3ED3 A;  4MZB A;  5E59 A;  3RHB A;  1XFL A;  4IS0 A;  1GSY A;  1OYJ A;  3TJB A;  3L0H A;  3HYP A;  2IMK A;  4OWY A;  4L0W A;  2LS5 A;  5G1K A;  3GKN A;  3TKS E;  5ECO B;  1FOV A;  4XTS A;  5CRD A;  4EVM A;  1O7U A;  1F37 A;  3UJ1 A;  4G19 A;  2LJK A;  4JR4 A;  4EF0 A;  5HR1 A;  1MDJ A;  2L5O A;  3H1N A;  2V1M A;  3TOT A;  3W8S A;  3CRT A;  3U6V A;  1K0D A;  3L78 A;  3GA4 A;  2YJ7 A;  3EUR A;  2R3X A;  1ZCP A;  1ZYQ B;  4E8H A;  4X1U A;  1XVQ A;  2O89 A;  2H0G A;  1PSQ A;  2V2G A;  2GST A;  4F03 A;  1BX9 A;  5A4U A;  4F0C A;  2ZNM A;  4Q5F A;  3VK9 A;  2L4Q A;  1WMJ A;  2LRC A;  3IPZ A;  4XS6 A;  3LJR A;  4GTU A;  1JLW A;  2VM2 A;  1ABA A;  2F9S A;  1Z7R A;  2LJR A;  1V2A A;  4HU9 A;  2FD3 A;  3UOM A;  2CVD A;  2DC5 A;  1W4V A;  1GSQ A;  3OR5 A;  2VL9 A;  1K0A A;  3EMP A;  4DSQ A;  3UBL A;  1EEM A;  2A2S A;  1NM3 A;  2LV3 A;  3IAM 2;  2L57 A;  3UIW A;  4RQR A;  1H75 A;  2C1Y A;  2N5F A;  3APQ A;  4JED A;  2L5L A;  1BJX A;  2OE3 A;  4G9H A;  1SK1 A;  2FWF A;  1TRU A;  2YWN A;  3IRA A;  4TR0 A;  5J41 A;  4BVX A;  3DIE A;  4L5L A;  5KN1 A;  1J08 A;  1Z6M A;  2F51 A;  2HFD A;  1R5P A;  14GS A;  1U3A A;  3HHV A;  1JFU A;  2R4V A;  4ILF A;  1I9D A;  4MF6 A;  1EP8 A;  2DJJ A;  2H0I A;  4GSN A;  5DDL A;  1QGV A;  4K7O A;  1XPV A;  1USB A;  4MH3 A;  5ECM B;  4O7H A;  1VGL A;  6GSW A;  3GKM A;  1PQN A;  1OC8 A;  2I3Y A;  2FY6 A;  4K9Z A;  2K8V A;  4NAX A;  4MZW A;  5H5S A;  3V1W A;  1UN2 A;  2L6D A;  3N9J A;  1E2Y A;  1A0F A;  3EU4 A;  2IMF A;  5DQS A;  4IQA A;  2K9F A;  5CO3 A;  1GWC A;  4GRF A;  2YV7 A;  5HR3 A;  1EEJ A;  1CQH A;  1FVJ A;  5H5Q A;  1HNA A;  2PVO C;  5FHI A;  2IME A;  3BCI A;  4WET A;  3GL5 A;  1KBN A;  3IE3 A;  3IK9 A;  5LD0 A;  1ON4 A;  1DE2 A;  1MEK A;  4DSS A;  3IR4 A;  1GUH A;  3H79 A;  1ERT A;  2HSY A;  1EWX A;  2AYT A;  3LQ7 A;  2TIR A;  1G7O A;  3VWW A;  3KH7 A;  3HCZ A;  4MPF A;  4IEL A;  4IN0 A;  2LQQ A;  3IHQ A;  2VO4 A;  4HI7 A;  3NIV A;  2C0E A;  2LNS A;  5KN3 A;  3FHK A;  5J3R A;  3GX8 A;  5DBQ A;  2IL3 A;  2MMA A;  2K8S A;  5IMV A;  5CNW A;  1URM A;  2C80 A;  2YCD A;  6GST A;  1WPI A;  4JBB A;  2CA8 A;  3GN3 A;  4J57 E;  3HVS A;  4K0G A;  1ILO A;  3KXO A; 
#chains in the Genus database with same CATH topology
 4IBP A;  1A0R P;  3UAR A;  2HT9 A;  5C00 A;  4EKZ A;  3FK8 A;  4PXO A;  4AJ7 A;  1T3B A;  3PPU A;  3FR6 A;  4QL9 A;  5CP1 A;  2DJ3 A;  2BTO T;  5AIV A;  1SL2 B;  2DIY A;  4KSM A;  2DJ2 A;  2YP6 A;  4BL7 A;  4PNG A;  4WBJ A;  5JCW A;  5ECN B;  3ISO A;  1TI3 A;  4FYB A;  1PD2 1;  1R26 A;  4DSS B;  3FR9 A;  4K1F A;  4USS A;  3D5J A;  4MNN A;  4XRD A;  4DVC A;  5F06 A;  5D93 A;  4EUY A;  1T8E B;  1ML6 A;  2CAI A;  4YQM A;  1A2M A;  3RAZ A;  4V2L A;  2V6O A;  3BCK A;  4L8E A;  4HZ2 A;  3WGD A;  1WP0 A;  2H72 A;  4FO5 A;  3E0U A;  5IPG A;  1XWC A;  2I1U A;  4G0I A;  4MAB A;  4IVF A;  3VPQ A;  1QK8 A;  5ELA A;  3EVI A;  3K8N A;  1PRX A;  4HJM A;  3C8E A;  3APO A;  5ECS A;  4MZC A;  5EVO A;  2GS3 A;  5JWR B;  2PVQ A;  1R4W A;  3ZTL A;  3I9V 2;  1ZYN A;  2DKH A;  4EDZ A;  1M7T A;  2F8F A;  4HS1 A;  2JAD A;  2GGT A;  4V2M A;  1Z7P A;  2FWG A;  5EPF A;  2H30 A;  3QAW A;  6GSY A;  2BMX A;  5F07 A;  1PX7 A;  4BL7 B;  3DML A;  2ZCT A;  1HNB A;  2PU9 C;  3A2X A;  1Z6N A;  4NV2 A;  1GRX A;  5IIZ A;  4ECC A;  2YWO A;  2XC2 A;  4MP4 A;  4WBR D;  1M99 A;  2WS2 A;  1SK0 A;  1EV4 A;  6GSU A;  2H8L A;  2EIQ A;  5IO0 A;  1GUM A;  1T7P B;  2CZ3 A;  4O5Q A;  3DEX A;  3RDW A;  2F3M A;  2E2G A;  3W8J A;  1F3B A;  3KMN A;  4MF7 A;  4IW9 A;  4ZBD A;  1V40 A;  5IMZ A;  22GS A;  3GTU A;  5ECR B;  5LNK e;  2B5Y A;  2TRC P;  4CY6 A;  5D73 A;  4LMV A;  3CSI A;  2B7J A;  3UMA A;  1AC1 A;  2PWJ A;  2GZY A;  4CHS A;  1FVK A;  3FYG A;  3P8W A;  4K5S A;  2R0G A;  4H86 A;  2OAD A;  3M9J A;  2LEG A;  1RK4 A;  4YQU A;  4PUR A;  1T4Z A;  2VM1 A;  2MMO A;  2UZ8 A;  3APS A;  3QFA C;  1XWB A;  1KTE A;  3C1S A;  5A4W A;  2V6K A;  1XVW A;  2LKU A;  1AQW A;  3QFB C;  3FZ9 A;  4XCS A;  2H1B A;  1SJ6 A;  3BOA A;  4G2E A;  2EIR A;  2H73 A;  2GSQ A;  3CMI A;  4BWQ A;  3D21 A;  3G7Y A;  2R37 A;  2H70 A;  2KLX A;  3KCM A;  3QCP A;  1J0F A;  1OC9 A;  4MLY A;  2IMI A;  3GV1 A;  4PUA A;  1N2A A;  3VI5 A;  4GXZ A;  1G6Y A;  5G5E A;  2XBQ A;  3ZFB A;  4DSR A;  1GLP A;  3CSH A;  4LL4 B;  1SU9 A;  1XOB A;  3TJG A;  2GLR A;  3TUE A;  4GLT A;  5ECL B;  5ENU A;  1DSB A;  1WIK A;  3KIJ A;  2AUV A;  1SKR B;  3LYK A;  5JCU A;  4HSC X;  4POB A;  5IQY A;  3QAV A;  1GH2 A;  5DAK A;  1QFN A;  4ULX A;  7GSS A;  3FY7 A;  2GTU A;  1A8L A;  4MA9 A;  4OO5 A;  4ZXG A;  3GMF A;  4ZB9 A;  2DML A;  4HU7 A;  4K2D A;  4O32 A;  2K6V A;  2LTK A;  3ZYW A;  2VUP A;  2B6M A;  4XS4 A;  4POL A;  1VRS D;  3A2W A;  1U88 A;  4HEA 2;  1OC9 B;  5D9T A;  4NWY A;  4KND A;  4IGJ A;  4PGT A;  2I81 A;  1TJD A;  2H6X A;  1UVZ A;  6GSV A;  1MD3 A;  3I43 A;  2YPM A;  2YAN A;  2IJY A;  2HZF A;  3TRQ A;  4POK A;  3LWA A;  5AN1 A;  3HJO A;  2O87 A;  2O8V B;  3VFI A;  3RPP A;  1DE1 A;  1O85 A;  4IJI A;  1PGT A;  2KP1 A;  3HKR A;  1T00 A;  2FUG 2;  2DMM A;  2L59 A;  5JCG A;  3IBH A;  2XHF A;  2M80 A;  1G7E A;  3TCO A;  4Z2T A;  4OFN A;  4KCE A;  1TTZ A;  2HLS A;  4EXJ A;  3F6D A;  3TKQ A;  3P2A A;  5HR2 A;  5J4U A;  5JWO B;  2OKA A;  1YEP A;  4EDY A;  3CYN A;  2P0G A;  5G30 A;  1S3R A;  2LNT A;  4IP6 A;  3E3E A;  3L9U A;  3C73 A;  1KEB A;  3MAK A;  4XS4 B;  4HQS A;  4RI6 A;  2H1G A;  3A3T A;  5F8B A;  2L6C A;  2CVB A;  3F8U A;  3IXR A;  4WXT A;  1EGR A;  3C71 A;  4N10 A;  2WJU A;  4F82 A;  2AB6 A;  3GX0 A;  3L9V A;  1H4O A;  1M0U A;  3CSJ A;  5F05 A;  1SK2 A;  1IYH A;  2GVP A;  1WJK A;  1ZYP A;  2EC4 A;  2HZE A;  1V98 A;  4I2U A;  3Q19 A;  2D2Z A;  5ECK B;  2WB9 A;  5KN0 A;  1B4P A;  4WEY A;  2IWT A;  5LCZ A;  3HZ8 A;  4EIP A;  3DKS A;  4O5R A;  1LU4 A;  4V1A p;  4I2T A;  4NHZ A;  2OE0 A;  3IOS A;  3D4T A;  1HQO A;  5CRW A;  4KX4 A;  2VCX A;  1A2J A;  1VF1 A;  3J7Y b;  4V2N A;  2YWI A;  5CRG A;  1TDI A;  2NDO A;  4HZ4 A;  4NXI A;  3HJM A;  3MSZ A;  3IC4 A;  4K6X A;  3TB2 A;  2MYG A;  4X0X A;  1LBK A;  1M9A A;  2JZR A;  2QKE A;  2VOC A;  6GSX A;  4KAE A;  2IPA A;  3VLN A;  1OE7 A;  1SL0 B;  4PTS A;  1GLQ A;  4TR4 A;  3M0F A;  2X99 A;  4XRA A;  2P5Q A;  1THO A;  1SKW B;  3DXB A;  3ME7 A;  2PMT A;  4TW5 A;  2NBS A;  2QSI A;  4PQH A;  1RQM A;  4GWR A;  3GL3 A;  1O8W A;  2DJ0 A;  1TKD B;  1K0M A;  2CX4 A;  1Q98 A;  3HD5 A;  2AHE A;  2HZE B;  4WF4 A;  2P31 A;  4AGS A;  2WUL A;  4TR1 A;  3FMW A;  3IDV A;  4O92 A;  2RUF A;  3BBY A;  1MTC A;  2GQL A;  4KDX A;  1V9W A;  5DCG A;  2GT5 A;  3F4R A;  3GYK A;  4MJB A;  3IV4 A;  2X8H A;  1V57 A;  5ID2 A;  5B7C A;  1S3A A;  2IN3 A;  2LST A;  4TXV A;  2O7K A;  3KMO A;  1TI1 A;  4TN8 A;  1GUK A;  1PKZ A;  3TKP A;  3WGE A;  2H1D A;  5GAP D;  1RW1 A;  4IHU A;  4MMM A;  4BVY A;  2V32 A;  3LXT A;  2I9H A;  5H5R A;  1GSD A;  3FRC A;  4AF2 A;  3EWL A;  3I6A A;  3TKR A;  3TRX A;  3FZ4 A;  2QGV A;  4NPB A;  2DBC A;  3GRX A;  3LXZ A;  2YZU A;  3ZL5 A;  4OCE A;  4KB3 A;  1BG5 A;  1X9M B;  2NPB A;  1LJR A;  4A5P A;  2GSR A;  4PQ1 A;  2C4J A;  1DUG A;  4KA0 A;  4N0V A;  4Z7X A;  5HFK A;  3US3 A;  2WFC A;  1FAA A;  13GS A;  5DJL A;  4TR1 B;  2VCZ A;  1K0B A;  2WZ9 A;  2A2R A;  3PIN A;  1GTI A;  5IMD A;  3ZIJ A;  1SD8 A;  3F63 A;  2Z9S A;  1A23 A;  1WOU A;  3H4K A;  3ZZX A;  2C3Q A;  5ID2 B;  4F2I A;  4GSS A;  1TOF A;  1XZO A;  3JCM L;  2HE3 A;  3D22 A;  9GSS A;  1XWK A;  1GSF A;  3I69 A;  6GSS A;  1YEX A;  2I4A A;  3DD3 A;  1OKD A;  4WF5 A;  3M3M A;  1SJI A;  4TOP A;  4BVY B;  1VF2 A;  2PBJ A;  3CXG A;  3Q74 A;  4JE1 A;  3L4N A;  2C8U A;  2H01 A;  3EMX A;  5ECP B;  4F0B A;  2YZH A;  2AAW A;  2VLV A;  3M1G A;  1JZW A;  1TK8 B;  4K0N A;  2RII A;  1SYX A;  5AIX A;  1FW1 A;  2PPT A;  1EOG A;  1AUC A;  1GSS A;  3L9S A;  2WCI A;  4LLR A;  2B5E A;  1SEN A;  3A5W A;  4ZBB A;  11GS A;  3CQF A;  3RPN A;  1XW6 A;  5IM9 A;  2ES7 A;  2JU5 A;  1TK5 B;  1GTB A;  3F0I A;  3GST A;  20GS A;  4V1A g;  2X8G A;  3Q18 A;  3FZA A;  5ABR A;  4ZL9 A;  2X4A A;  3VWU A;  3G7I A;  2DLX A;  1I5G A;  3Q6O A;  4MH2 A;  1GL8 A;  4IJ3 A;  3HDC A;  2FWH A;  3F6F A;  2GDR A;  4MDC A;  4D73 A;  3DVW A;  1ZL9 A;  2E2M A;  3TJF A;  4K8M A;  2KOK A;  2JZS A;  1QMV A;  1XBS A;  1K0N A;  5DVB A;  5G2Z A;  2PGT A;  1FB0 A;  1CQG A;  1WWJ A;  2H19 A;  4KUN A;  3PH9 A;  2L4C A;  3EPT A;  2XPE A;  3EYT A;  1VF3 A;  3IA1 A;  1B8X A;  4WKW A;  4ISD A;  1VF4 A;  4K7N A;  1O81 A;  3D0Z A;  2H74 A;  5J5N A;  3KH9 A;  1Y6E A;  1T1V A;  2GZZ A;  4YKG A;  2C0F A;  1XOA A;  1YJ6 A;  3R2Q A;  2VL2 A;  1G6W A;  1F9M A;  5D8I A;  4QQ7 A;  2QA2 A;  2H75 A;  2FLS A;  2OBK A;  2QC7 A;  2X64 A;  3SBC A;  4ECI A;  4YKF A;  3E9J B;  1THX A;  4MJE A;  5B8B A;  4WR4 A;  3DWV A;  4KH7 A;  2N5B A;  3H8Q A;  1BED A;  3BJ5 A;  5J9C A;  2FHE A;  1NHY A;  4D73 B;  2OA7 A;  1T4Y A;  2YN1 A;  2H0H A;  4HDE A;  4HUA A;  1UA5 A;  1FHE A;  3LYP A;  2MBS A;  3GH9 A;  3G9B A;  3KP8 A;  2J23 A;  2JSY A;  1X9W B;  3WYW A;  1TRV A;  4NMU A;  3DYR A;  3F4T A;  3ZFL A;  3ZML A;  3ZIT A;  3GUR A;  4P3Y B;  2RUE A;  1TRW A;  3GTU B;  2IIY A;  2GQK A;  4I5Q A;  5DAL A;  1PL2 A;  5HR0 A;  5CRE A;  1XG8 A;  1NHO A;  5KOW A;  4PQI A;  4YH2 A;  1O73 A;  3UVT A;  5AIS A;  3CTG A;  3ERG A;  5HQP A;  1U6T A;  2NTO A;  2ON7 A;  3LOR A;  2WRT A;  2LRT A;  3AY8 A;  2JZT A;  1Y25 A;  3TKS A;  1O8X A;  2O85 A;  4OO4 A;  3ZRD A;  4OMV A;  3UEM A;  4XS1 A;  4RQX A;  5GSS A;  2VCT A;  3QPM A;  1TU7 A;  2KHP A;  4JZQ A;  5KN2 A;  2AV4 A;  3ZVJ A;  2PER A;  3VWX A;  2HI7 A;  5B6N A;  1X5D A;  1Z3E A;  2H71 A;  4LA1 A;  4CDO A;  1OKT A;  2FGX A;  4Z2R A;  1PL1 A;  5DJM A;  5CRH A;  4FIW A;  3HXS A;  2J9H A;  3LG6 A;  2E7P A;  2HXK A;  3GH6 A;  1QUW A;  1X5E A;  3TDG A;  4XIH A;  3EC3 A;  2CZ2 A;  4TVE A;  5GAN D;  3MWH A;  2DSA A;  2CT6 A;  4TR3 A;  1S3C A;  3DGQ A;  2REM A;  2NVL A;  2FA4 A;  1XCC A;  2C3T A;  4JU5 A;  1A24 A;  4ZB6 A;  3F3Q A;  2HRK A;  5INY A;  1Q4J A;  2BJX A;  1HD2 A;  2FCH A;  2A4H A;  5DAK B;  1GSU A;  5D9V A;  1GTA A;  1TK0 B;  4FQU A;  2H76 A;  3ZIV A;  3PGT A;  2B1L A;  2H6Y A;  3FEU A;  1R5A A;  1XXU A;  2ZUP A;  5HFG A;  2R2J A;  1TP9 A;  1YF1 A;  4MJA A;  3G7J A;  2HYX A;  1ACV A;  4DEJ A;  1MDI A;  2YOI A;  3FZ5 A;  2MMZ A;  5IPH A;  4ML1 A;  1FB6 A;  1A2L A;  3MYD A;  3HZ4 A;  1EV9 A;  2YWM A;  3TOU A;  3CRU A;  4JRR A;  1OAZ A;  4IKH A;  1BYE A;  1HYU A;  3EE2 A;  3VWV A;  1BAY A;  1AAZ A;  2E0Q A;  5BMU A;  1XIY A;  2CVK A;  4EE0 A;  2VIM A;  3QOU A;  1TW9 A;  3TJJ A;  3KJY A;  4Q5N A;  1M2A A;  5CAX A;  1X0R A;  3CBU A;  1K3Y A;  4OFM A;  3O6T A;  4MPG A;  3LEF A;  2JL4 A;  1XWG A;  2G0F A;  5D96 A;  4TXO A;  2ALB A;  3LFL A;  1KNG A;  3MDK A;  4EC0 A;  1YQ1 A;  3NOF A;  3NZN A;  2K18 A;  1X5C A;  3VPT A;  2DJK A;  3A2V A;  3ZLP A;  5A5K A;  3FKF A;  4YAP A;  2VL3 A;  2B7K A;  3GHA A;  3UVH A;  4F9Z A;  3WT1 A;  5GZZ B;  5ECH B;  3IK7 A;  4ZBA A;  1GNE A;  1YZX A;  1GUL A;  4ZL7 A;  1AQX A;  3GKX A;  1V58 A;  4L5O A;  1PX6 A;  1F6M C;  2VAF A;  1JZR A;  1PFO A;  3TJK A;  3GNJ A;  5FWG A;  2CV4 A;  1M2D A;  1IYI A;  3P90 A;  4EO3 A;  3KTL A;  1MD4 A;  2LJA A;  2HRN A;  2PN8 A;  5ELG A;  1SKS B;  4KE3 A;  2DJ1 A;  1M3J A;  1QQ2 A;  1OC3 A;  3HVV A;  1Z5Y E;  4FYC A;  3FR3 A;  2MMN A;  3DRN A;  3QMX A;  5IMC A;  2FA8 A;  1O6J A;  1DBY A;  1FO5 A;  5KEJ A;  4TXO B;  4JR6 A;  1F2E A;  1U87 A;  1AIU A;  1M9B A;  5C04 A;  2B3S A;  1Z9H A;  4GCI A;  2M46 A;  1GSE A;  3KZQ A;  3CTF A;  4NHW A;  4J2F A;  4IP1 A;  4OD7 A;  3IHG A;  2DIZ A;  2XBI A;  4MJC A;  2CAQ A;  2LRN A;  1EZK A;  1ERW A;  3HJP A;  4PX1 A;  4IQ1 A;  3W6G A;  1K0O A;  1XW5 A;  1JZO A;  4KF9 A;  1PA3 A;  3U5R E;  4I8B A;  1TU8 A;  4AJ8 A;  3M9K A;  1G0T A;  2YNX A;  5DQY A;  1JHB A;  5ECQ B;  5F0G A;  2MBT A;  1J9B A;  4PNF A;  1EOH A;  1AQV A;  3WD6 A;  1ZZY A;  2VL2 C;  1SL1 B;  4OCF A;  4I6X A;  4BWS A;  4ZB8 A;  3LSZ A;  2A2P A;  4YQV A;  1C72 A;  1N8J A;  4K5R A;  2YV9 A;  4O5U A;  2VD0 A;  4FH8 A;  3QD9 A;  2R5G A;  4WR5 A;  10GS A;  2VD1 A;  1E6B A;  1R7H A;  1YY7 A;  2C0D A;  3HA9 A;  3QR6 A;  2RM6 A;  4OFT A;  5G5F A;  3LGC A;  4MK3 A;  1XW9 A;  3KD0 A;  5ECI B;  3O3T A;  2XPD A;  4G10 A;  1ERV A;  2GT6 A;  1FOH A;  5CYY A;  18GS A;  2IFQ A;  1K3L A;  1ZMA A;  2P5R A;  3HVN A;  2WGR A;  5HFI A;  3GUS A;  3GSS A;  4ML6 A;  2OBI A;  1HNC A;  2LQO A;  1ZGN A;  4HQZ A;  5EY6 A;  1QXH A;  2YJH A;  1S3D A;  4N30 A;  1WE0 A;  4Q5Q A;  2GQM A;  2H1A A;  8GSS A;  1ERU A;  1B4Q A;  2CX3 A;  4NV5 A;  1EP7 A;  1AXD A;  3KP9 A;  12GS A;  4CW9 A;  4N11 A;  4X43 A;  2FNO A;  2HSH A;  5IMA A;  2H6Z A;  5E4W A;  3TKS C;  5GST A;  4GQF A;  3WGX A;  3WT2 A;  4ZIL A;  1PKW A;  4ZL8 A;  4K7I A;  1PMT A;  2HRF A;  4MF5 A;  2R0P A;  4PUF C;  2TRX A;  1SD9 A;  4KCA A;  4POM A;  5J9B A;  5IOX A;  2N5A A;  1PN9 A;  1TRS A;  4KDY A;  2HRA A;  3FW2 A;  2A4V A;  4ZIJ A;  5D9W A;  3VI7 A;  2PUK C;  5L71 A;  2GZP A;  3BD2 A;  2IFQ B;  2R0C A;  1K3O A;  1YF0 A;  2F8A A;  2R6K A;  4L0U A;  17GS A;  2AJQ B;  3F9U A;  3UAP A;  4LL1 B;  3ZVJ D;  4X4J A;  1ZYE A;  4FYU A;  4ACS A;  5COH A;  2B5X A;  3HY2 A;  3VUR A;  2G2Q A;  16GS A;  3N5O A;  4CY8 A;  1JLV A;  3GKK A;  3ME8 A;  4E8E A;  3UBK A;  3TGZ A;  4N0Z A;  1GP1 A;  1W89 A;  3HVX A;  2JAC A;  2H66 A;  1TXX A;  1MDK A;  3RHC A;  4K2X A;  1OE8 A;  2RLI A;  5G1L A;  1B48 A;  4KDU A;  3C1R A;  1YKC A;  4YAV A;  3P7X A;  1EGO A;  1YKA A;  1YDK A;  1UC7 A;  2RM5 A;  1F3A A;  3KM6 A;  3S9F A;  2EIO A;  5IOW A;  4KSO A;  4HOJ A;  4XHM A;  3ZMK A;  1BQ7 A;  1JZD A;  5B6M A;  4LMW A;  5EL8 A;  1B9X C;  4RI7 A;  4J56 E;  4GF0 A;  1FG4 A;  5FT3 A;  2M72 A;  1M2B A;  4I97 A;  2C3N A;  2KUC A;  4TKY A;  4EIQ A;  1GNW A;  3D4M A;  2C0G A;  3D6I A;  2HNL A;  3QDN A;  2ON5 A;  3UL3 A;  3KGK A;  1B9Y C;  3MIX A;  2VCQ A;  5AGY A;  3F3R A;  2IMD A;  5DCH A;  4HJ2 A;  3SWL A;  4BA7 A;  3EIN A;  3KTB A;  4MCU A;  3F4S A;  1XWA A;  2LUS A;  4KGI A;  2X8C A;  2OAC A;  3EU3 A;  1NW2 A;  4ECB A;  1X9S B;  4Z2U A;  3TRP A;  2V41 A;  1K0C A;  5JWQ B;  4QL7 A;  1SJZ A;  2VCV A;  1AW9 A;  3LW9 A;  3ERF A;  4GQC A;  4ECJ A;  3GFK A;  2VLT A;  4ID0 A;  1U3I A;  1GTU A;  3O76 A;  5IMF A;  1ST9 A;  2JSZ A;  2QA1 A;  3H93 A;  4GST A;  4AJ6 A;  2VLU A;  3C7M A;  3GIX A;  5IO2 A;  3ZRE A;  2WDU A;  5D9X A;  5G31 A;  2OJL A;  3DVX A;  1WRY A;  1SYR A;  2DKI A;  5A4V A;  2B1K A;  4RUV A;  2GSS A;  3RBT A;  2KP2 A;  3PR8 A;  3MNG A;  4BPY A;  3J7Y k;  2MZC A;  3IAS 2;  4TRX A;  5B8A A;  1OVN A;  2FWE A;  3M8N A;  3QAG A;  5DAL B;  2X49 A;  4KW6 A;  1NSW A;  2OE1 A;  2VCW A;  2CQ9 A;  4Q5R A;  1ZOF A;  4EL1 A;  3KEB A;  19GS A;  1A8Y A;  3ERW A;  3ED3 A;  4MZB A;  5E59 A;  3RHB A;  1XFL A;  4IS0 A;  1GSY A;  1OYJ A;  3TJB A;  3L0H A;  3HYP A;  2IMK A;  4OWY A;  4L0W A;  2LS5 A;  5G1K A;  3GKN A;  5BRT A;  3TKS E;  5ECO B;  1FOV A;  4XTS A;  5CRD A;  4EVM A;  1O7U A;  2HSM A;  3A5I A;  1F37 A;  3UJ1 A;  4G19 A;  2LJK A;  4JR4 A;  4EF0 A;  5HR1 A;  1MDJ A;  2L5O A;  3H1N A;  2V1M A;  3TOT A;  3W8S A;  3CRT A;  3U6V A;  1K0D A;  3L78 A;  3GA4 A;  2YJ7 A;  3EUR A;  2R3X A;  1ZCP A;  1ZYQ B;  1M3I A;  4E8H A;  4X1U A;  1XVQ A;  2O89 A;  2H0G A;  1PSQ A;  2V2G A;  2GST A;  4F03 A;  1BX9 A;  5A4U A;  4F0C A;  2ZNM A;  4Q5F A;  4G0K A;  3VK9 A;  2L4Q A;  1WMJ A;  2LRC A;  3IPZ A;  4XS6 A;  3LJR A;  4GTU A;  1JLW A;  2VM2 A;  1ABA A;  2F9S A;  1Z7R A;  2LJR A;  1V2A A;  4HU9 A;  2FD3 A;  3UOM A;  2CVD A;  2DC5 A;  1W4V A;  1GSQ A;  3OR5 A;  2VL9 A;  1K0A A;  3EMP A;  4DSQ A;  3UBL A;  1EEM A;  2A2S A;  1NM3 A;  2LV3 A;  3IAM 2;  2L57 A;  3UIW A;  4RQR A;  1H75 A;  2C1Y A;  2N5F A;  3APQ A;  4JED A;  2L5L A;  1BJX A;  2OE3 A;  4G9H A;  1SK1 A;  2FWF A;  1TRU A;  2YWN A;  3IRA A;  4TR0 A;  5J41 A;  4BVX A;  3DIE A;  4L5L A;  5KN1 A;  1J08 A;  1Z6M A;  2F51 A;  2HFD A;  1R5P A;  14GS A;  1U3A A;  3HHV A;  1JFU A;  2R4V A;  4ILF A;  1I9D A;  4MF6 A;  3R3E A;  1EP8 A;  2DJJ A;  2H0I A;  4GSN A;  5DDL A;  1QGV A;  4K7O A;  1XPV A;  1USB A;  4MH3 A;  5ECM B;  4O7H A;  1VGL A;  6GSW A;  3GKM A;  1PQN A;  1OC8 A;  2I3Y A;  2FY6 A;  4K9Z A;  2K8V A;  4NAX A;  4MZW A;  5H5S A;  3V1W A;  1UN2 A;  2L6D A;  3N9J A;  1E2Y A;  1A0F A;  3EU4 A;  2IMF A;  5DQS A;  4IQA A;  2K9F A;  5CO3 A;  1GWC A;  4GRF A;  2YV7 A;  5HR3 A;  1EEJ A;  1CQH A;  1FVJ A;  5H5Q A;  1HNA A;  2PVO C;  5FHI A;  2IME A;  3BCI A;  4WET A;  3GL5 A;  1KBN A;  3IE3 A;  3IK9 A;  5LD0 A;  4BVX B;  1ON4 A;  1PN0 A;  1DE2 A;  1MEK A;  4DSS A;  3IR4 A;  4ICY A;  1GUH A;  3H79 A;  1ERT A;  2HSY A;  1EWX A;  2AYT A;  5KOX A;  3LQ7 A;  2TIR A;  1G7O A;  3VWW A;  3KH7 A;  3HCZ A;  4MPF A;  4IEL A;  4IN0 A;  2LQQ A;  3IHQ A;  2VO4 A;  4HI7 A;  3NIV A;  4G0L A;  2C0E A;  2LNS A;  5KN3 A;  3FHK A;  5J3R A;  3GX8 A;  5DBQ A;  2IL3 A;  2MMA A;  2K8S A;  5IMV A;  5CNW A;  1URM A;  2C80 A;  2YCD A;  6GST A;  1WPI A;  4JBB A;  3IC8 A;  2CA8 A;  3GN3 A;  4BIK A;  4J57 E;  3HVS A;  4K0G A;  1ILO A;  3KXO A; 
#chains in the Genus database with same CATH homology
 4IBP A;  1A0R P;  3UAR A;  2HT9 A;  5C00 A;  4EKZ A;  3FK8 A;  4PXO A;  4AJ7 A;  1T3B A;  3PPU A;  3FR6 A;  4QL9 A;  5CP1 A;  2DJ3 A;  2BTO T;  5AIV A;  1SL2 B;  2DIY A;  4KSM A;  2DJ2 A;  2YP6 A;  4BL7 A;  4PNG A;  4WBJ A;  5JCW A;  5ECN B;  3ISO A;  1TI3 A;  4FYB A;  1PD2 1;  1R26 A;  4DSS B;  3FR9 A;  4K1F A;  4USS A;  3D5J A;  4MNN A;  4XRD A;  4DVC A;  5F06 A;  5D93 A;  4EUY A;  1T8E B;  1ML6 A;  2CAI A;  4YQM A;  1A2M A;  3RAZ A;  4V2L A;  2V6O A;  3BCK A;  4L8E A;  4HZ2 A;  3WGD A;  1WP0 A;  2H72 A;  4FO5 A;  3E0U A;  5IPG A;  1XWC A;  2I1U A;  4G0I A;  4MAB A;  4IVF A;  3VPQ A;  1QK8 A;  5ELA A;  3EVI A;  3K8N A;  1PRX A;  4HJM A;  3C8E A;  3APO A;  5ECS A;  4MZC A;  5EVO A;  2GS3 A;  5JWR B;  2PVQ A;  1R4W A;  3ZTL A;  3I9V 2;  1ZYN A;  2DKH A;  4EDZ A;  1M7T A;  2F8F A;  4HS1 A;  2JAD A;  2GGT A;  4V2M A;  1Z7P A;  2FWG A;  5EPF A;  2H30 A;  3QAW A;  6GSY A;  2BMX A;  5F07 A;  1PX7 A;  4BL7 B;  3DML A;  2ZCT A;  1HNB A;  2PU9 C;  3A2X A;  1Z6N A;  4NV2 A;  1GRX A;  5IIZ A;  4ECC A;  2YWO A;  2XC2 A;  4MP4 A;  4WBR D;  1M99 A;  2WS2 A;  1SK0 A;  1EV4 A;  6GSU A;  2H8L A;  2EIQ A;  5IO0 A;  1GUM A;  1T7P B;  2CZ3 A;  4O5Q A;  3DEX A;  3RDW A;  2F3M A;  2E2G A;  3W8J A;  1F3B A;  3KMN A;  4MF7 A;  4IW9 A;  4ZBD A;  1V40 A;  5IMZ A;  22GS A;  3GTU A;  5ECR B;  5LNK e;  2B5Y A;  2TRC P;  4CY6 A;  5D73 A;  4LMV A;  3CSI A;  2B7J A;  3UMA A;  1AC1 A;  2PWJ A;  2GZY A;  4CHS A;  1FVK A;  3FYG A;  3P8W A;  4K5S A;  2R0G A;  4H86 A;  2OAD A;  3M9J A;  2LEG A;  1RK4 A;  4YQU A;  4PUR A;  1T4Z A;  2VM1 A;  2MMO A;  2UZ8 A;  3APS A;  3QFA C;  1XWB A;  1KTE A;  3C1S A;  5A4W A;  2V6K A;  1XVW A;  2LKU A;  1AQW A;  3QFB C;  3FZ9 A;  4XCS A;  2H1B A;  1SJ6 A;  3BOA A;  4G2E A;  2EIR A;  2H73 A;  2GSQ A;  3CMI A;  4BWQ A;  3D21 A;  3G7Y A;  2R37 A;  2H70 A;  2KLX A;  3KCM A;  3QCP A;  1J0F A;  1OC9 A;  4MLY A;  2IMI A;  3GV1 A;  4PUA A;  1N2A A;  3VI5 A;  4GXZ A;  1G6Y A;  5G5E A;  2XBQ A;  3ZFB A;  4DSR A;  1GLP A;  3CSH A;  4LL4 B;  1SU9 A;  1XOB A;  3TJG A;  2GLR A;  3TUE A;  4GLT A;  5ECL B;  5ENU A;  1DSB A;  1WIK A;  3KIJ A;  2AUV A;  1SKR B;  3LYK A;  5JCU A;  5IQY A;  4POB A;  3QAV A;  1GH2 A;  5DAK A;  1QFN A;  4ULX A;  7GSS A;  3FY7 A;  2GTU A;  1A8L A;  4MA9 A;  4OO5 A;  4ZXG A;  3GMF A;  4ZB9 A;  2DML A;  4HU7 A;  4K2D A;  4O32 A;  2K6V A;  2LTK A;  3ZYW A;  2VUP A;  2B6M A;  4XS4 A;  4POL A;  1VRS D;  3A2W A;  1U88 A;  4HEA 2;  1OC9 B;  5D9T A;  4NWY A;  4KND A;  4IGJ A;  4PGT A;  2I81 A;  1TJD A;  2H6X A;  1UVZ A;  6GSV A;  1MD3 A;  3I43 A;  2YPM A;  2YAN A;  2IJY A;  2HZF A;  3TRQ A;  4POK A;  3LWA A;  5AN1 A;  3HJO A;  2O87 A;  2O8V B;  3VFI A;  3RPP A;  1DE1 A;  1O85 A;  4IJI A;  1PGT A;  2KP1 A;  3HKR A;  1T00 A;  2FUG 2;  2DMM A;  2L59 A;  5JCG A;  3IBH A;  2XHF A;  2M80 A;  1G7E A;  3TCO A;  4Z2T A;  4OFN A;  4KCE A;  1TTZ A;  2HLS A;  4EXJ A;  3F6D A;  3TKQ A;  3P2A A;  5HR2 A;  5J4U A;  5JWO B;  2OKA A;  1YEP A;  4EDY A;  3CYN A;  2P0G A;  5G30 A;  2LNT A;  4IP6 A;  3E3E A;  3L9U A;  3C73 A;  1KEB A;  3MAK A;  4XS4 B;  4HQS A;  4RI6 A;  2H1G A;  3A3T A;  5F8B A;  2L6C A;  2CVB A;  3F8U A;  3IXR A;  4WXT A;  1EGR A;  3C71 A;  4N10 A;  2WJU A;  4F82 A;  2AB6 A;  3GX0 A;  3L9V A;  1H4O A;  1M0U A;  3CSJ A;  5F05 A;  1SK2 A;  1IYH A;  2GVP A;  1WJK A;  1ZYP A;  2EC4 A;  2HZE A;  1V98 A;  4I2U A;  3Q19 A;  2D2Z A;  5ECK B;  2WB9 A;  5KN0 A;  1B4P A;  4WEY A;  2IWT A;  5LCZ A;  3HZ8 A;  4EIP A;  3DKS A;  4O5R A;  1LU4 A;  4V1A p;  4I2T A;  4NHZ A;  2OE0 A;  3IOS A;  3D4T A;  1HQO A;  5CRW A;  4KX4 A;  2VCX A;  1A2J A;  1VF1 A;  3J7Y b;  4V2N A;  2YWI A;  5CRG A;  1TDI A;  2NDO A;  4HZ4 A;  4NXI A;  3HJM A;  3MSZ A;  3IC4 A;  4K6X A;  3TB2 A;  2MYG A;  4X0X A;  1LBK A;  1M9A A;  2JZR A;  2QKE A;  2VOC A;  6GSX A;  4KAE A;  2IPA A;  3VLN A;  1OE7 A;  1SL0 B;  4PTS A;  1GLQ A;  4TR4 A;  3M0F A;  2X99 A;  4XRA A;  2P5Q A;  1THO A;  1SKW B;  3DXB A;  3ME7 A;  2PMT A;  4TW5 A;  2NBS A;  2QSI A;  4PQH A;  1RQM A;  4GWR A;  3GL3 A;  1O8W A;  2DJ0 A;  1TKD B;  1K0M A;  2CX4 A;  1Q98 A;  3HD5 A;  2AHE A;  2HZE B;  4WF4 A;  2P31 A;  4AGS A;  2WUL A;  4TR1 A;  3FMW A;  3IDV A;  4O92 A;  2RUF A;  3BBY A;  1MTC A;  2GQL A;  4KDX A;  1V9W A;  5DCG A;  2GT5 A;  3F4R A;  3GYK A;  4MJB A;  3IV4 A;  2X8H A;  1V57 A;  5ID2 A;  5B7C A;  1S3A A;  2IN3 A;  2LST A;  4TXV A;  2O7K A;  3KMO A;  1TI1 A;  4TN8 A;  1GUK A;  1PKZ A;  3TKP A;  3WGE A;  2H1D A;  5GAP D;  1RW1 A;  4IHU A;  4MMM A;  4BVY A;  2V32 A;  3LXT A;  2I9H A;  5H5R A;  1GSD A;  3FRC A;  4AF2 A;  3EWL A;  3I6A A;  3TKR A;  3TRX A;  3FZ4 A;  2QGV A;  4NPB A;  2DBC A;  3GRX A;  3LXZ A;  2YZU A;  3ZL5 A;  4OCE A;  4KB3 A;  1BG5 A;  1X9M B;  2NPB A;  1LJR A;  4A5P A;  2GSR A;  4PQ1 A;  2C4J A;  1DUG A;  4KA0 A;  4N0V A;  4Z7X A;  5HFK A;  3US3 A;  2WFC A;  1FAA A;  13GS A;  5DJL A;  4TR1 B;  2VCZ A;  1K0B A;  2WZ9 A;  2A2R A;  3PIN A;  1GTI A;  5IMD A;  3ZIJ A;  1SD8 A;  3F63 A;  2Z9S A;  1A23 A;  1WOU A;  3H4K A;  3ZZX A;  2C3Q A;  5ID2 B;  4F2I A;  4GSS A;  1TOF A;  1XZO A;  3JCM L;  2HE3 A;  3D22 A;  9GSS A;  1XWK A;  1GSF A;  3I69 A;  6GSS A;  1YEX A;  2I4A A;  3DD3 A;  1OKD A;  4WF5 A;  3M3M A;  1SJI A;  4TOP A;  4BVY B;  1VF2 A;  2PBJ A;  3CXG A;  3Q74 A;  4JE1 A;  3L4N A;  2C8U A;  2H01 A;  3EMX A;  5ECP B;  4F0B A;  2YZH A;  2AAW A;  2VLV A;  3M1G A;  1JZW A;  1TK8 B;  4K0N A;  2RII A;  1SYX A;  5AIX A;  1FW1 A;  2PPT A;  1EOG A;  1AUC A;  1GSS A;  3L9S A;  2WCI A;  4LLR A;  2B5E A;  1SEN A;  3A5W A;  4ZBB A;  11GS A;  3RPN A;  1XW6 A;  5IM9 A;  2ES7 A;  2JU5 A;  1TK5 B;  1GTB A;  3F0I A;  3GST A;  20GS A;  4V1A g;  2X8G A;  3Q18 A;  3FZA A;  5ABR A;  4ZL9 A;  2X4A A;  3VWU A;  3G7I A;  2DLX A;  1I5G A;  3Q6O A;  4MH2 A;  1GL8 A;  4IJ3 A;  3HDC A;  2FWH A;  3F6F A;  2GDR A;  4MDC A;  4D73 A;  3DVW A;  1ZL9 A;  2E2M A;  3TJF A;  4K8M A;  2KOK A;  2JZS A;  1QMV A;  1XBS A;  1K0N A;  5DVB A;  5G2Z A;  2PGT A;  1FB0 A;  1CQG A;  1WWJ A;  2H19 A;  4KUN A;  3PH9 A;  2L4C A;  3EPT A;  2XPE A;  3EYT A;  1VF3 A;  3IA1 A;  1B8X A;  4WKW A;  4ISD A;  1VF4 A;  4K7N A;  1O81 A;  3D0Z A;  2H74 A;  5J5N A;  3KH9 A;  1Y6E A;  1T1V A;  2GZZ A;  4YKG A;  2C0F A;  1XOA A;  1YJ6 A;  3R2Q A;  2VL2 A;  1G6W A;  1F9M A;  5D8I A;  4QQ7 A;  2QA2 A;  2H75 A;  2FLS A;  2OBK A;  2QC7 A;  2X64 A;  3SBC A;  4ECI A;  4YKF A;  3E9J B;  1THX A;  4MJE A;  5B8B A;  4WR4 A;  3DWV A;  4KH7 A;  2N5B A;  3H8Q A;  1BED A;  3BJ5 A;  5J9C A;  2FHE A;  1NHY A;  4D73 B;  2OA7 A;  1T4Y A;  2YN1 A;  2H0H A;  4HDE A;  4HUA A;  1UA5 A;  1FHE A;  3LYP A;  2MBS A;  3GH9 A;  3G9B A;  3KP8 A;  2J23 A;  2JSY A;  1X9W B;  3WYW A;  1TRV A;  4NMU A;  3DYR A;  3F4T A;  3ZFL A;  3ZML A;  3ZIT A;  3GUR A;  4P3Y B;  2RUE A;  1TRW A;  3GTU B;  2IIY A;  2GQK A;  4I5Q A;  5DAL A;  1PL2 A;  5HR0 A;  5CRE A;  1NHO A;  5KOW A;  4PQI A;  4YH2 A;  1O73 A;  3UVT A;  5AIS A;  3CTG A;  3ERG A;  5HQP A;  1U6T A;  2NTO A;  2ON7 A;  3LOR A;  2WRT A;  2LRT A;  3AY8 A;  2JZT A;  1Y25 A;  3TKS A;  1O8X A;  2O85 A;  4OO4 A;  3ZRD A;  4OMV A;  3UEM A;  4XS1 A;  4RQX A;  5GSS A;  2VCT A;  3QPM A;  1TU7 A;  2KHP A;  4JZQ A;  5KN2 A;  2AV4 A;  3ZVJ A;  2PER A;  3VWX A;  2HI7 A;  5B6N A;  1X5D A;  1Z3E A;  2H71 A;  4LA1 A;  4CDO A;  1OKT A;  2FGX A;  4Z2R A;  1PL1 A;  5DJM A;  5CRH A;  4FIW A;  3HXS A;  2J9H A;  3LG6 A;  2E7P A;  2HXK A;  3GH6 A;  1QUW A;  1X5E A;  3TDG A;  4XIH A;  3EC3 A;  2CZ2 A;  4TVE A;  5GAN D;  3MWH A;  2DSA A;  2CT6 A;  4TR3 A;  1S3C A;  3DGQ A;  2REM A;  2NVL A;  2FA4 A;  1XCC A;  2C3T A;  4JU5 A;  1A24 A;  4ZB6 A;  3F3Q A;  2HRK A;  5INY A;  1Q4J A;  2BJX A;  1HD2 A;  2FCH A;  2A4H A;  5DAK B;  1GSU A;  5D9V A;  1GTA A;  1TK0 B;  4FQU A;  2H76 A;  3ZIV A;  3PGT A;  2B1L A;  2H6Y A;  3FEU A;  1R5A A;  1XXU A;  2ZUP A;  5HFG A;  2R2J A;  1TP9 A;  1YF1 A;  4MJA A;  3G7J A;  2HYX A;  1ACV A;  4DEJ A;  1MDI A;  2YOI A;  3FZ5 A;  2MMZ A;  5IPH A;  4ML1 A;  1FB6 A;  1A2L A;  3MYD A;  3HZ4 A;  1EV9 A;  2YWM A;  3TOU A;  3CRU A;  4JRR A;  1OAZ A;  4IKH A;  1BYE A;  1HYU A;  3EE2 A;  3VWV A;  1BAY A;  1AAZ A;  2E0Q A;  5BMU A;  1XIY A;  2CVK A;  4EE0 A;  2VIM A;  3QOU A;  1TW9 A;  3TJJ A;  3KJY A;  4Q5N A;  1M2A A;  5CAX A;  1X0R A;  3CBU A;  1K3Y A;  4OFM A;  3O6T A;  4MPG A;  3LEF A;  2JL4 A;  1XWG A;  2G0F A;  5D96 A;  4TXO A;  2ALB A;  3LFL A;  1KNG A;  3MDK A;  4EC0 A;  1YQ1 A;  3NOF A;  3NZN A;  2K18 A;  1X5C A;  3VPT A;  2DJK A;  3A2V A;  3ZLP A;  5A5K A;  3FKF A;  4YAP A;  2VL3 A;  2B7K A;  3GHA A;  3UVH A;  4F9Z A;  3WT1 A;  5GZZ B;  5ECH B;  3IK7 A;  4ZBA A;  1GNE A;  1YZX A;  1GUL A;  4ZL7 A;  1AQX A;  3GKX A;  1V58 A;  4L5O A;  1PX6 A;  1F6M C;  2VAF A;  1JZR A;  3TJK A;  3GNJ A;  5FWG A;  2CV4 A;  1M2D A;  1IYI A;  3P90 A;  4EO3 A;  3KTL A;  1MD4 A;  2LJA A;  2HRN A;  2PN8 A;  5ELG A;  1SKS B;  4KE3 A;  2DJ1 A;  1QQ2 A;  1OC3 A;  3HVV A;  1Z5Y E;  4FYC A;  3FR3 A;  2MMN A;  3DRN A;  3QMX A;  5IMC A;  2FA8 A;  1O6J A;  1DBY A;  1FO5 A;  5KEJ A;  4TXO B;  4JR6 A;  1F2E A;  1U87 A;  1AIU A;  1M9B A;  5C04 A;  2B3S A;  1Z9H A;  4GCI A;  2M46 A;  1GSE A;  3KZQ A;  3CTF A;  4NHW A;  4J2F A;  4IP1 A;  4OD7 A;  3IHG A;  2DIZ A;  2XBI A;  4MJC A;  2CAQ A;  2LRN A;  1EZK A;  1ERW A;  3HJP A;  4PX1 A;  4IQ1 A;  3W6G A;  1K0O A;  1XW5 A;  1JZO A;  4KF9 A;  1PA3 A;  3U5R E;  4I8B A;  1TU8 A;  4AJ8 A;  3M9K A;  1G0T A;  2YNX A;  5DQY A;  1JHB A;  5ECQ B;  5F0G A;  2MBT A;  1J9B A;  4PNF A;  1EOH A;  1AQV A;  3WD6 A;  1ZZY A;  2VL2 C;  1SL1 B;  4OCF A;  4I6X A;  4BWS A;  4ZB8 A;  3LSZ A;  2A2P A;  4YQV A;  1C72 A;  1N8J A;  4K5R A;  2YV9 A;  4O5U A;  2VD0 A;  4FH8 A;  3QD9 A;  2R5G A;  4WR5 A;  10GS A;  2VD1 A;  1E6B A;  1R7H A;  1YY7 A;  2C0D A;  3HA9 A;  3QR6 A;  2RM6 A;  4OFT A;  5G5F A;  3LGC A;  4MK3 A;  1XW9 A;  3KD0 A;  5ECI B;  3O3T A;  2XPD A;  4G10 A;  1ERV A;  2GT6 A;  1FOH A;  5CYY A;  18GS A;  2IFQ A;  1K3L A;  1ZMA A;  2P5R A;  2WGR A;  5HFI A;  3GUS A;  3GSS A;  4ML6 A;  2OBI A;  1HNC A;  2LQO A;  1ZGN A;  4HQZ A;  5EY6 A;  1QXH A;  2YJH A;  1S3D A;  4N30 A;  1WE0 A;  4Q5Q A;  2GQM A;  2H1A A;  8GSS A;  1ERU A;  1B4Q A;  2CX3 A;  4NV5 A;  1EP7 A;  1AXD A;  3KP9 A;  12GS A;  4CW9 A;  4N11 A;  4X43 A;  2FNO A;  2HSH A;  5IMA A;  2H6Z A;  5E4W A;  3TKS C;  5GST A;  4GQF A;  3WGX A;  3WT2 A;  4ZIL A;  1PKW A;  4ZL8 A;  4K7I A;  1PMT A;  2HRF A;  4MF5 A;  2R0P A;  4PUF C;  2TRX A;  1SD9 A;  4KCA A;  4POM A;  5J9B A;  5IOX A;  2N5A A;  1PN9 A;  1TRS A;  4KDY A;  2HRA A;  3FW2 A;  2A4V A;  4ZIJ A;  5D9W A;  3VI7 A;  2PUK C;  5L71 A;  2GZP A;  3BD2 A;  2IFQ B;  2R0C A;  1K3O A;  1YF0 A;  2F8A A;  2R6K A;  4L0U A;  17GS A;  2AJQ B;  3F9U A;  3UAP A;  4LL1 B;  3ZVJ D;  4X4J A;  1ZYE A;  4FYU A;  4ACS A;  5COH A;  2B5X A;  3HY2 A;  3VUR A;  2G2Q A;  16GS A;  3N5O A;  4CY8 A;  1JLV A;  3GKK A;  3ME8 A;  4E8E A;  3UBK A;  3TGZ A;  4N0Z A;  1GP1 A;  1W89 A;  3HVX A;  2JAC A;  2H66 A;  1TXX A;  1MDK A;  3RHC A;  4K2X A;  1OE8 A;  2RLI A;  5G1L A;  1B48 A;  4KDU A;  3C1R A;  1YKC A;  4YAV A;  3P7X A;  1EGO A;  1YKA A;  1YDK A;  1UC7 A;  2RM5 A;  1F3A A;  3KM6 A;  3S9F A;  2EIO A;  5IOW A;  4KSO A;  4HOJ A;  4XHM A;  3ZMK A;  1BQ7 A;  1JZD A;  5B6M A;  4LMW A;  5EL8 A;  1B9X C;  4RI7 A;  4J56 E;  4GF0 A;  1FG4 A;  5FT3 A;  2M72 A;  1M2B A;  4I97 A;  2C3N A;  2KUC A;  4TKY A;  4EIQ A;  1GNW A;  3D4M A;  2C0G A;  3D6I A;  2HNL A;  3QDN A;  2ON5 A;  3UL3 A;  3KGK A;  1B9Y C;  3MIX A;  2VCQ A;  5AGY A;  3F3R A;  2IMD A;  5DCH A;  4HJ2 A;  3SWL A;  4BA7 A;  3EIN A;  3KTB A;  4MCU A;  3F4S A;  1XWA A;  2LUS A;  4KGI A;  2X8C A;  2OAC A;  3EU3 A;  1NW2 A;  4ECB A;  1X9S B;  4Z2U A;  3TRP A;  2V41 A;  1K0C A;  5JWQ B;  4QL7 A;  1SJZ A;  2VCV A;  1AW9 A;  3LW9 A;  3ERF A;  4GQC A;  4ECJ A;  3GFK A;  2VLT A;  4ID0 A;  1U3I A;  1GTU A;  3O76 A;  5IMF A;  1ST9 A;  2JSZ A;  2QA1 A;  3H93 A;  4GST A;  4AJ6 A;  2VLU A;  3C7M A;  3GIX A;  5IO2 A;  3ZRE A;  2WDU A;  5D9X A;  5G31 A;  2OJL A;  3DVX A;  1WRY A;  1SYR A;  2DKI A;  5A4V A;  2B1K A;  4RUV A;  2GSS A;  3RBT A;  2KP2 A;  3PR8 A;  3MNG A;  4BPY A;  3J7Y k;  2MZC A;  3IAS 2;  4TRX A;  5B8A A;  1OVN A;  2FWE A;  3M8N A;  3QAG A;  5DAL B;  2X49 A;  4KW6 A;  1NSW A;  2OE1 A;  2VCW A;  2CQ9 A;  4Q5R A;  1ZOF A;  4EL1 A;  3KEB A;  19GS A;  1A8Y A;  3ERW A;  3ED3 A;  4MZB A;  5E59 A;  3RHB A;  1XFL A;  4IS0 A;  1GSY A;  1OYJ A;  3TJB A;  3L0H A;  3HYP A;  2IMK A;  4OWY A;  4L0W A;  2LS5 A;  5G1K A;  3GKN A;  5BRT A;  3TKS E;  5ECO B;  1FOV A;  4XTS A;  5CRD A;  4EVM A;  1O7U A;  2HSM A;  3A5I A;  1F37 A;  3UJ1 A;  4G19 A;  2LJK A;  4JR4 A;  4EF0 A;  5HR1 A;  1MDJ A;  2L5O A;  3H1N A;  2V1M A;  3TOT A;  3W8S A;  3CRT A;  3U6V A;  1K0D A;  3L78 A;  3GA4 A;  2YJ7 A;  3EUR A;  2R3X A;  1ZCP A;  1ZYQ B;  4E8H A;  4X1U A;  1XVQ A;  2O89 A;  2H0G A;  1PSQ A;  2V2G A;  2GST A;  4F03 A;  1BX9 A;  5A4U A;  4F0C A;  2ZNM A;  4Q5F A;  4G0K A;  3VK9 A;  2L4Q A;  1WMJ A;  2LRC A;  3IPZ A;  4XS6 A;  3LJR A;  4GTU A;  1JLW A;  2VM2 A;  1ABA A;  2F9S A;  1Z7R A;  2LJR A;  1V2A A;  4HU9 A;  2FD3 A;  3UOM A;  2CVD A;  2DC5 A;  1W4V A;  1GSQ A;  3OR5 A;  2VL9 A;  1K0A A;  3EMP A;  4DSQ A;  3UBL A;  1EEM A;  2A2S A;  1NM3 A;  2LV3 A;  3IAM 2;  2L57 A;  3UIW A;  4RQR A;  1H75 A;  2C1Y A;  2N5F A;  3APQ A;  4JED A;  2L5L A;  1BJX A;  2OE3 A;  4G9H A;  1SK1 A;  2FWF A;  1TRU A;  2YWN A;  3IRA A;  4TR0 A;  5J41 A;  4BVX A;  3DIE A;  4L5L A;  5KN1 A;  1J08 A;  1Z6M A;  2F51 A;  2HFD A;  1R5P A;  14GS A;  1U3A A;  3HHV A;  1JFU A;  2R4V A;  4ILF A;  1I9D A;  4MF6 A;  3R3E A;  1EP8 A;  2DJJ A;  2H0I A;  4GSN A;  5DDL A;  1QGV A;  4K7O A;  1XPV A;  1USB A;  4MH3 A;  5ECM B;  4O7H A;  1VGL A;  6GSW A;  3GKM A;  1PQN A;  1OC8 A;  2I3Y A;  2FY6 A;  4K9Z A;  2K8V A;  4NAX A;  4MZW A;  5H5S A;  3V1W A;  1UN2 A;  2L6D A;  3N9J A;  1E2Y A;  1A0F A;  3EU4 A;  2IMF A;  5DQS A;  4IQA A;  2K9F A;  5CO3 A;  1GWC A;  4GRF A;  2YV7 A;  5HR3 A;  1EEJ A;  1CQH A;  1FVJ A;  5H5Q A;  1HNA A;  2PVO C;  5FHI A;  2IME A;  3BCI A;  4WET A;  3GL5 A;  1KBN A;  3IE3 A;  3IK9 A;  5LD0 A;  4BVX B;  1ON4 A;  1PN0 A;  1DE2 A;  1MEK A;  4DSS A;  3IR4 A;  4ICY A;  1GUH A;  3H79 A;  1ERT A;  2HSY A;  1EWX A;  2AYT A;  5KOX A;  3LQ7 A;  2TIR A;  1G7O A;  3VWW A;  3KH7 A;  3HCZ A;  4MPF A;  4IEL A;  4IN0 A;  2LQQ A;  3IHQ A;  2VO4 A;  4HI7 A;  3NIV A;  4G0L A;  2C0E A;  2LNS A;  5KN3 A;  3FHK A;  5J3R A;  3GX8 A;  5DBQ A;  2IL3 A;  2MMA A;  2K8S A;  5IMV A;  5CNW A;  1URM A;  2C80 A;  2YCD A;  6GST A;  1WPI A;  4JBB A;  3IC8 A;  2CA8 A;  3GN3 A;  4J57 E;  3HVS A;  4K0G A;  1ILO A;  3KXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...