1DE2A

Nmr structures of reduced bacteriophage t4 glutaredoxin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of reduced and oxidized bacteriophage T4 glutaredoxin.
pubmed doi rcsb
molecule keywords GLUTAREDOXIN
molecule tags Electron transport
total genus 16
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1de2A00
2H0IA 1U6TA 3V1WA 2EIOA 1V40A 2GSRA 1JZRA 3GTUA 3IAM2 2EC4A 3D4MA 2TRCP 4JZQA 3F3QA 1S3CA 3HHVA 6GSXA 2E0QA 1GSQA 4JR4A 1B9XC 1E2YA 1XFLA 1NSWA 5G2ZA 5D9WA 5GSSA 1B8XA 2HSYA 3GUSA 2YJ7A 1AC1A 2VAFA 4XS4A 2V1MA 2DJKA 5IPGA 1MDJA 4I5QA 4MJEA 2DJ1A 3EINA 3W8SA 2GZYA 3QPMA 3ME7A 2FWFA 4ZB9A 1BJXA 1TI1A 1T4YA 3CBUA 2PMTA 2H1GA 2O7KA 2Z9SA 4MZCA 3RBTA 4YAVA 2X8GA 1OC3A 5G31A 2YCDA 2FCHA 4PQHA 1R5PA 5LCZA 4KA0A 2E7PA 5LD0A 2MMAA 1F2EA 2H6ZA 3L9VA 1MEKA 1M0UA 3A2VA 3IRAA 2QGVA 4AJ8A 5IOWA 3KCMA 3P8WA 1BQ7A 1GSUA 2C3NA 1TJDA 4HUAA 2DJ3A 1MDKA 2L4CA 4GWRA 1CQGA 1XPVA 1KTEA 2GQMA 4PGTA 4HOJA 3IPZA 5CO3A 4HDEA 2ES7A 2YPMA 2WB9A 5ECSA 2HI7A 1HQOA 2B1LA 2LRCA 4NMUA 1X9MB 1FAAA 1G6WA 3I69A 2M80A 2DSAA 4WXTA 4AF2A 3WT2A 1O81A 4XIHA 2CX3A 2WJUA 4K0GA 5B8BA 2B5YA 2VL3A 2KP2A 3KMOA 3IA1A 2PU9C 3PINA 2ON5A 3UOMA 3M3MA 4I6XA 3KZQA 1EWXA 4GTUA 2VM2A 2FWHA 5CYYA 4ZIJA 3KH7A 2YZHA 3QAWA 2VCXA 6GSYA 3HZ4A 4IW9A 1B48A 4I2UA 5KEJA 1QUWA 5DVBA 2JZRA 2CAIA 4GQFA 3UBKA 2CX4A 1X5EA 4FYCA 2R37A 5G5FA 1WIKA 1OC9A 4LL4B 4OO5A 2O87A 1ZL9A 4G19A 1PMTA 2HZEA 1SKRB 4HU9A 3FR9A 22GSA 5CRDA 4ECCA 3EU3A 1DUGA 1K3YA 1PN9A 5DBQA 3HCZA 3GSSA 3I9V2 5KN2A 4IVFA 4ISDA 2LQQA 1HD2A 2C3TA 4AGSA 2NVLA 3GSTA 3F4TA 3GRXA 2V32A 1QK8A 1XVQA 2GZZA 2J23A 2C4JA 2K6VA 2B3SA 3KM6A 5F8BA 3TJJA 4TR1A 1GRXA 3QFAC 1TKDB 3FZ4A 1E6BA 3HY2A 4MPGA 3IC4A 2WZ9A 5ECHB 2AYTA 3FZAA 2GS3A 3F8UA 5EL8A 1QMVA 2OE1A 3KD0A 5EVOA 2XBIA 2I3YA 3GMFA 3UL3A 3HVXA 2JU5A 4LL1B 5GZZB 2O89A 6GSUA 3LYPA 1ST9A 6GSTA 5H5RA 5B6MA 1YDKA 2HFDA 3DVWA 1ACVA 3HJOA 1THXA 1OVNA 2IIYA 2CQ9A 1FVKA 5CRGA 3M0FA 3C1SA 4XRDA 3HA9A 1VF3A 4GSSA 1PD21 2X64A 5AIXA 3TJBA 6GSSA 4POLA 2H19A 5GAPD 4MP4A 3C8EA 5DQSA 4MF6A 1SENA 3UIWA 4HJ2A 4PURA 1EEMA 5HR3A 1XCCA 2H6XA 3US3A 1U87A 4IS0A 2LNSA 1ILOA 3IE3A 4ECBA 2BTOT 4EF0A 3RAZA 5IO2A 1BYEA 2X8HA 9GSSA 3IV4A 3G9BA 3G7YA 11GSA 4RI6A 1TXXA 1JZDA 4MH3A 3GL3A 1U3AA 4XCSA 3NOFA 4K0NA 2RM5A 1PKZA 2GSTA 1JLWA 3BOAA 4HQSA 3TOUA 1T4ZA 4IELA 2B7JA 2F9SA 3F0IA 2HXKA 5C00A 1M99A 4FO5A 2MZCA 1AXDA 3D5JA 2L5LA 1Q98A 3GH6A 4GCIA 2FY6A 2VUPA 1TDIA 3ZRDA 4EVMA 1M2DA 5HFKA 13GSA 4JR6A 2ZCTA 1Z7PA 4N30A 2OE3A 4OWYA 4F0BA 3VLNA 5FHIA 1GTAA 1XWBA 5DCGA 2JSZA 1J0FA 1M9AA 4ZB8A 2GT6A 1ML6A 4WETA 3QD9A 2J9HA 4AJ6A 2PVQA 1GUHA 1T8EB 4K7NA 5CNWA 1W89A 4WEYA 3TOTA 2LQOA 5DJLA 3M8NA 2DIZA 1IYHA 3E0UA 2N5BA 2EIQA 3CSJA 5D93A 1XW5A 2AUVA 2VM1A 3O3TA 2AAWA 1J08A 3L78A 3GX8A 1R26A 4I2TA 2H8LA 2YOIA 1EEJA 4J56E 4ZBBA 1LU4A 1LBKA 3AY8A 3VFIA 4V2LA 2O85A 4DSSB 1EV4A 3LEFA 2FA8A 3TJGA 1TU7A 3JCML 14GSA 1YQ1A 1WOUA 1ON4A 4QL7A 3WT1A 2LSTA 1GUMA 3ERFA 2OACA 3BD2A 4QL9A 2LV3A 2VCTA 1G7OA 2H73A 5F0GA 1EOHA 3QR6A 4TR3A 1EGRA 3PGTA 1G7EA 2AHEA 3TUEA 4MA9A 5ECPB 4YQVA 5GAND 5A5KA 5J41A 3BCIA 1TI3A 3FZ5A 2IWTA 1WMJA 2HT9A 1GTUA 10GSA 3EE2A 2HLSA 3HKRA 2AB6A 5AN1A 1XZOA 4WR5A 4EO3A 3EWLA 2XPDA 4ULXA 3TRPA 3H1NA 3WYWA 4NAXA 4G10A 3APOA 3GHAA 1OAZA 5CRHA 4NV5A 2MMOA 2VLUA 3FZ9A 2V6KA 4NPBA 1TK8B 3J7Yb 2BMXA 1SL1B 4KW6A 5IMAA 1N8JA 1YKCA 2VO4A 2XPEA 4GSTA 3UARA 1Z5YE 4L8EA 2NBSA 4PXOA 5D9TA 1A8LA 2H1DA 2V2GA 1NW2A 3LG6A 4BA7A 2BJXA 2WFCA 4E8HA 2LKUA 3VPTA 4EDYA 3TKPA 1K3OA 3FR6A 4EXJA 2TRXA 1TRWA 3ERGA 3EC3A 2JSYA 2R4VA 4KDYA 2GTUA 1GSYA 5J5NA 4MCUA 5IMFA 2ON7A 5DDLA 3FY7A 2IN3A 1GNWA 3IHQA 1TW9A 1OKDA 2IMDA 2MMNA 2NPBA 1F3AA 3ZMLA 1Y6EA 1ERWA 3F4SA 4MZWA 3VK9A 3DRNA 1BX9A 6GSVA 1FOVA 3KTLA 4MPFA 4I97A 1YF0A 1O8WA 2YNXA 4LA1A 2LJRA 1GH2A 2HYXA 2DJJA 2DIYA 1V58A 2EIRA 1JFUA 4KGIA 3ZFLA 1F37A 2FNOA 4RUVA 3U6VA 1OYJA 4ZB6A 3FR3A 5ECRB 5D73A 3VPQA 3HYPA 3RHBA 4TXVA 3S9FA 4KB3A 2K8VA 3MAKA 4OCEA 4YQMA 2K9FA 1NM3A 2VLTA 4IQ1A 3E9JB 1B9YC 3TJFA 1GWCA 1U3IA 1VRSD 4BL7A 4OFNA 2OKAA 1XW6A 2X8CA 3EURA 3O76A 2CVKA 2PWJA 5KN3A 2IMIA 2WS2A 5DJMA 3EU4A 2L59A 1EOGA 3GFKA 2LUSA 4IGJA 1V57A 1GLQA 1T3BA 3SBCA 4KUNA 4JBBA 1K0BA 17GSA 3FYGA 4F2IA 2YANA 1M9BA 2DBCA 2HRFA 1FB0A 4NV2A 2R2JA 3GYKA 2PERA 4MK3A 1TK5B 5JWQB 2F3MA 5ENUA 1WP0A 1A2MA 3ZL5A 4DSSA 4F82A 1O8XA 3Q18A 4F0CA 2GSQA 5DALA 4O32A 1X0RA 3WGXA 3QAVA 3ZLPA 3UJ1A 1X5DA 4EUYA 3M1GA 4TN8A 3CSIA 1TRVA 2C80A 2IMKA 1SK0A 3GIXA 1Z7RA 4F03A 3FEUA 1TRUA 4WBRD 3H93A 1GP1A 5LNKe 1VF4A 3GKXA 5D9XA 3C73A 3HD5A 4OFMA 3Q74A 1YEPA 3KEBA 3ZMKA 1USBA 1X9WB 2MBSA 3HVVA 1XOBA 1SKSB 3TDGA 1ZYEA 4BWQA 1WWJA 1JZOA 1V2AA 5F07A 1MD4A 3H4KA 5D96A 1LJRA 4MH2A 1Z3EA 2I1UA 4IJIA 4EDZA 5JWOB 1GTIA 2REMA 2GQLA 2VD0A 1K0AA 3NIVA 2LNTA 4TR4A 3A2XA 4FH8A 4EC0A 3MNGA 4FIWA 4IHUA 2E2MA 5EY6A 1X9SB 1A8YA 5A4UA 1EZKA 5IQYA 12GSA 4ECJA 5ECQB 2ZNMA 3W6GA 4PUAA 1SJ6A 1S3DA 4K6XA 1YZXA 3D0ZA 2RM6A 3FW2A 4DSRA 4HEA2 1UC7A 4XS1A 4GF0A 4K7IA 4KH7A 4K1FA 5ECMB 5IM9A 1A2LA 2H01A 3EVIA 2IPAA 2NDOA 2A2RA 4IQAA 2AJQB 4D73B 3C71A 3RDWA 1YEXA 4V2MA 1ERVA 1K0OA 20GSA 5IOXA 1YF1A 4MZBA 3D6IA 4MJBA 1WJKA 1XOAA 2K8SA 2LRTA 1JHBA 2VCVA 1QGVA 4EE0A 4RQRA 1VF1A 3Q6OA 5HR0A 5ID2B 3A2WA 1QQ2A 3KMNA 1ZZYA 2FWGA 1A2JA 2C0FA 2WGRA 3L9SA 2KUCA 3UVTA 2YN1A 4H86A 1RQMA 2VD1A 2L6DA 1A24A 2P5QA 2VOCA 3VI7A 4HU7A 2GSSA 1FB6A 3D22A 2P0GA 1GUKA 4TRXA 4HQZA 8GSSA 2JACA 2WULA 3VI5A 4F9ZA 4Z7XA 2VLVA 3ZIJA 5G5EA 5IMZA 2L4QA 2PBJA 3G7IA 1SK1A 4WBJA 1A0RP 3L9UA 5HR1A 1K0MA 4HZ2A 4L0WA 1XIYA 4TVEA 2IMEA 2RIIA 4NHWA 4RQXA 2LTKA 3HVSA 1F9MA 4GXZA 4IP6A 3F9UA 1WRYA 2XBQA 2H74A 1CQHA 1GSFA 2H1BA 2YZUA 3TCOA 4I8BA 3QOUA 3QDNA 3IK7A 4HJMA 4ECIA 1UN2A 3H8QA 3DYRA 3KGKA 3LQ7A 4IP1A 4K2DA 1GULA 1N2AA 3VWWA 3F6FA 3ZREA 2KP1A 1O73A 3Q19A 2QC7A 4V1Ap 3CYNA 1PL2A 3C7MA 2R6KA 3F3RA 5IMCA 5CREA 4TXOB 3HJPA 1BG5A 2KHPA 1PX7A 3CRTA 1M2AA 3MDKA 4HS1A 4BVYA 3BJ5A 1BEDA 2VCQA 3DXBA 4PNFA 3A5WA 3ZVJA 4P3YB 2RUEA 4IKHA 1O6JA 3GNJA 2FLSA 5INYA 5AGYA 4G2EA 4JE1A 3LORA 2A4VA 3GKMA 4TOPA 2GLRA 2JL4A 2M46A 1X5CA 2B1KA 2N5AA 2VCZA 1SKWB 5FWGA 5KN0A 4KSMA 2HZEB 3P90A 3ERWA 3APQA 3TJKA 4V1Ag 2C8UA 2I81A 3ZITA 1NHYA 2PUKC 2H0GA 2WDUA 4Q5FA 1PSQA 2DJ2A 4V2NA 4J2FA 3I6AA 3GV1A 5G30A 1K0CA 2CZ3A 5A4VA 4POKA 5IPHA 4IN0A 4WR4A 1XWCA 5DCHA 4CHSA 1BAYA 3HJMA 4PQ1A 2ALBA 1SL2B 1K0DA 4N0ZA 1DE2A 3KP8A 2OBIA 3DKSA 3LWAA 5B8AA 1GTBA 1FO5A 2OE0A 1JZWA 4IJ3A 2CV4A 2QKEA 3PR8A 1T1VA 3TRXA 18GSA 4TR1B 1B4PA 2GGTA 2LRNA 3LJRA 4KNDA 1B4QA 4J57E 3GA4A 1GNEA 4K8MA 3CTGA 5EPFA 2H1AA 4OO4A 2LS5A 3ZYWA 1V98A 2RUFA 2V6OA 2E2GA 2CAQA 1GSDA 3LXZA 4KCAA 4GLTA 2OA7A 3GH9A 3KIJA 3CXGA 1MDIA 4D73A 3TKRA 3KTBA 3K8NA 2I9HA 5HFIA 4ML1A 5JCWA 3KXOA 4KCEA 3GX0A 3ZIVA 1ERTA 4MJAA 3F6DA 3TRQA 2IFQB 1M2BA 7GSSA 1W4VA 1QXHA 5ID2A 3R2QA 19GSA 2ZUPA 3VURA 2IMFA 5H5SA 5L71A 3ZTLA 1XBSA 2CA8A 1KBNA 3N9JA 3G7JA 4N0VA 1XVWA 2N5FA 1R5AA 2L57A 1OE8A 4TKYA 3NZNA 3DMLA 2CVDA 4AJ7A 3LFLA 2VIMA 1AAZA 1KNGA 1YKAA 3E3EA 5DAKB 4KE3A 1SYXA 4HZ4A 4DSQA 4ZILA 4LMWA 5IO0A 3FRCA 3HZ8A 1XWAA 5E59A 3KP9A 1UVZA 5G1KA 5FT3A 1RK4A 2L5OA 3VWUA 2D2ZA 3TKSA 1WPIA 4MLYA 2C0EA 1GSSA 5ECKB 2YWMA 2H76A 1M7TA 5DQYA 3IAS2 4XTSA 2G0FA 2CT6A 2B6MA 16GSA 2H0HA 3CRUA 1OC8A 4MF5A 4DEJA 4FYBA 1NHOA 5C04A 2OADA 3L0HA 1S3AA 2FWEA 1G6YA 4XRAA 2TIRA 4X0XA 1HNBA 1TTZA 1J9BA 1TP9A 2O8VB 4EL1A 3MWHA 1FG4A 5ECNB 1EP7A 4O92A 1Q4JA 4ZBAA 3FHKA 1H4OA 2FUG2 4ILFA 3KH9A 4JRRA 3GL5A 4TXOA 1OKTA 2A2SA 1UA5A 3ME8A 4IBPA 4K9ZA 1PX6A 1AUCA 4FYUA 3CTFA 4ZXGA 5A4WA 1FW1A 3MSZA 5HR2A 2PPTA 4G9HA 3LYKA 4YQUA 1SL0B 4O5RA 3IR4A 4Q5NA 5ECOB 3TKSC 2XHFA 1AQXA 4PX1A 3WGEA 2VL9A 5G1LA 3O6TA 4GSNA 1AQVA 3TKQA 1EGOA 2JZTA 3ZFBA 1K3LA 3CSHA 1A0FA 3GKNA 5HFGA 4DVCA 1SJIA 2B5XA 3IBHA 4WKWA 1XWGA 2R3XA 2DMLA 4POMA 3QMXA 1DSBA 4PNGA 3QCPA 2OJLA 4O7HA 4TR0A 3A3TA 1HNCA 3PH9A 4NWYA 4X43A 4XHMA 3LSZA 3RHCA 2PGTA 5JCGA 3CMIA 6GSWA 2PN8A 2DJ0A 2GQKA 2H71A 2MMZA 3DGQA 2YP6A 5D8IA 4Q5RA 5AISA 2GT5A 2M72A 2AV4A 1IYIA 2C1YA 3VWXA 2FA4A 1ZCPA 3TKSE 1Y25A 3DVXA 2JZSA 3TB2A 1TU8A 3D21A 2B7KA 1I5GA 3TGZA 1TK0B 1JLVA 4BPYA 2KOKA 1O7UA 3FK8A 2C3QA 4YAPA 4QQ7A 2VL2A 2FGXA 2F8AA 5JCUA 5ECLB 2YWIA 5J4UA 3KJYA 3L4NA 2HRNA 1SK2A 2X99A 2HNLA 3EMXA 3IXRA 3FKFA 4Q5QA 3SWLA 4MDCA 3GKKA 4NHZA 3BCKA 1KEBA 4ACSA 4E8EA 1QFNA 1RW1A 4L5LA 1R4WA 1PQNA 2YV9A 3P2AA 3EYTA 5COHA 1T00A 2IFQA 5F06A 1SD9A 1AW9A 4HI7A 3QAGA 2HZFA 1R7HA 3VWVA 3ZVJD 4ZL8A 4K7OA 2LJKA 3ISOA 4KSOA 3M9KA 2H66A 2YJHA 2OBKA 2IJYA 3GTUB 1WE0A 2NTOA 5B7CA 3DD3A 3IDVA 5IMVA 2FD3A 1XWKA 4RI7A 1FVJA 1Z6MA 2R5GA 2VL2C 2G2QA 4YH2A 5DAKA 1FHEA 3DIEA 1YY7A 4PQIA 2K18A 1ZMAA 2C0GA 2C0DA 4MJCA 2GZPA 4XS4B 2IL3A 3W8JA 1AIUA 4GQCA 1F3BA 3I43A 4L5OA 2H75A 1TOFA 5J9CA 1OE7A 1VF2A 2F8FA 1XW9A 1PA3A 2PVOC 3RPPA 1HNAA 3APSA 4OFTA 1V9WA 4OMVA 3GN3A 1SYRA 4NXIA 3P7XA 5F05A 1ZOFA 2JADA 2P31A 1AQWA 4WF4A 4X1UA 5ELGA 1DBYA 5H5QA 3DEXA 5CAXA 2H72A 5CRWA 5JWRB 4ZL7A 3IK9A 1ZYQB 3ZZXA 2HE3A 4WF5A 3WGDA 2LEGA 2B5EA 3N5OA 3UVHA 1K0NA 1ERUA 3F4RA 5HQPA 2YWOA 4ML6A 1U88A 1GSEA 1URMA 4MF7A 3UAPA 4MABA 1Z9HA 3F63A 5J3RA 1T7PB 3HDCA 5AIVA 2MBTA 3D4TA 2WRTA 1H75A 2DMMA 2GDRA 4L0UA 3RPNA 2YWNA 4KAEA 1SU9A 1PKWA 2MYGA 1ZGNA 5IMDA 4CW9A 5ABRA 2F51A 3LXTA 1G0TA 1O85A 2GVPA 5B6NA 4LMVA 2LJAA 5J9BA 2WCIA 3C1RA 2HSHA 5E4WA 4N11A 1I9DA 4ID0A 4N10A 2I4AA 3M9JA 1GLPA 1VGLA 4TW5A 5GSTA 1PL1A 1SJZA 4XS6A 3UMAA 3U5RE 1XXUA 2DC5A 1ABAA 2H6YA 1THOA 1Z6NA 1PRXA 1MD3A 2FHEA 4EKZA 1GL8A 1OC9B 2DLXA 3UBLA 3H79A 5DALB 4JEDA 5CP1A 2RLIA 4GRFA 5KN1A 4BWSA 3WD6A 1C72A 3ED3A 1DE1A 3BBYA 4LLRA 5IIZA 2VCWA 2KLXA 3IOSA 3HXSA 3QFBC 1YJ6A 4KDXA 5ECIB 4ZL9A 1TRSA 4OCFA 4POBA 2P5RA 3J7Yk 3UEMA 5ELAA 2YV7A 1MTCA 4BVXA 4JU5A 1PGTA 5D9VA 2V41A 2H30A 1EP8A 4CDOA 1A23A 3EMPA 2CZ2A 2QSIA 3LGCA 4PUFC 1SD8A 1HYUA 4KX4A 4ZBDA 2CVBA 4OD7A 1F6MC 2XC2A 3OR5A 4KDUA 3GURA 4MMMA 3DWVA 2L6CA 1EV9A 2H70A
chains in the Genus database with same CATH superfamily
2H0IA 1U6TA 3V1WA 2EIOA 1V40A 2GSRA 1JZRA 3GTUA 3IAM2 2EC4A 3D4MA 2TRCP 4JZQA 3F3QA 1S3CA 3HHVA 6GSXA 2E0QA 1GSQA 4JR4A 1B9XC 1E2YA 1XFLA 1NSWA 5G2ZA 5D9WA 5GSSA 1B8XA 2HSYA 3GUSA 2YJ7A 1AC1A 2VAFA 4XS4A 2V1MA 2DJKA 5IPGA 1MDJA 4I5QA 3EPTA 4MJEA 2DJ1A 3EINA 3W8SA 2GZYA 3QPMA 3ME7A 2FWFA 4ZB9A 1BJXA 1TI1A 1T4YA 3CBUA 2PMTA 2H1GA 2O7KA 2Z9SA 4MZCA 3RBTA 4A5PA 4YAVA 2X8GA 1OC3A 5G31A 2YCDA 2FCHA 4PQHA 1R5PA 5LCZA 4KA0A 2E7PA 5LD0A 2MMAA 1F2EA 2H6ZA 3L9VA 4Z2UA 1MEKA 1M0UA 2R0GA 3A2VA 3IRAA 2QGVA 4AJ8A 5IOWA 3KCMA 3P8WA 1BQ7A 1GSUA 2C3NA 1TJDA 4HUAA 2DJ3A 1MDKA 2L4CA 4GWRA 1CQGA 1XPVA 1KTEA 2GQMA 4PGTA 4HOJA 3IPZA 5CO3A 4HDEA 2ES7A 2YPMA 2WB9A 5ECSA 2HI7A 1HQOA 2B1LA 2LRCA 4NMUA 1X9MB 1FAAA 1G6WA 3I69A 2M80A 2DSAA 4WXTA 4AF2A 3WT2A 1O81A 4XIHA 2CX3A 2WJUA 4K0GA 5B8BA 2B5YA 2VL3A 2KP2A 3KMOA 3IA1A 2PU9C 3PINA 2ON5A 3UOMA 2DKIA 3M3MA 4I6XA 3KZQA 1EWXA 4GTUA 2VM2A 2FWHA 5CYYA 4ZIJA 3KH7A 2YZHA 3QAWA 2VCXA 6GSYA 3HZ4A 4K5RA 4IW9A 1B48A 4I2UA 5KEJA 1QUWA 5DVBA 2JZRA 2CAIA 4GQFA 3UBKA 2CX4A 1X5EA 4FYCA 2R37A 5G5FA 1WIKA 1OC9A 4LL4B 4OO5A 2O87A 1ZL9A 4G19A 1PMTA 2HZEA 1SKRB 4HU9A 3FR9A 22GSA 5CRDA 4ECCA 3EU3A 1DUGA 1K3YA 1PN9A 5DBQA 3HCZA 3GSSA 3I9V2 5KN2A 4IVFA 4ISDA 2LQQA 1HD2A 2C3TA 4AGSA 2NVLA 3IHGA 3GSTA 3F4TA 3GRXA 4USSA 2V32A 5BMUA 1QK8A 1XVQA 2GZZA 2J23A 2C4JA 2K6VA 2B3SA 3KM6A 5F8BA 3TJJA 4TR1A 1GRXA 3QFAC 1TKDB 3FZ4A 1E6BA 4G0LA 3HY2A 4MPGA 3IC4A 2WZ9A 5ECHB 2AYTA 3FZAA 4K2XA 2GS3A 3F8UA 5EL8A 1QMVA 2OE1A 3KD0A 5EVOA 2XBIA 2I3YA 3GMFA 3UL3A 3HVXA 2JU5A 4LL1B 5GZZB 2O89A 6GSUA 3LYPA 1ST9A 6GSTA 5H5RA 5B6MA 1YDKA 2HFDA 3DVWA 1ACVA 3HJOA 1THXA 1OVNA 2IIYA 2CQ9A 1FVKA 5CRGA 3M0FA 3C1SA 4XRDA 3HA9A 1VF3A 4GSSA 1PD21 2X64A 5AIXA 3TJBA 6GSSA 4POLA 2H19A 5GAPD 4MP4A 3C8EA 5DQSA 4MF6A 1SENA 3UIWA 4HJ2A 4PURA 1EEMA 5HR3A 1XCCA 2H6XA 3US3A 1U87A 4IS0A 2LNSA 1ILOA 3IE3A 4ECBA 2BTOT 4EF0A 4YKGA 3RAZA 5IO2A 1BYEA 2X8HA 9GSSA 3IV4A 3G9BA 3G7YA 4EIQA 11GSA 4RI6A 4YKFA 1TXXA 1JZDA 4MH3A 3GL3A 1U3AA 4XCSA 3NOFA 4K0NA 2RM5A 1PKZA 2GSTA 1JLWA 3BOAA 4HQSA 3TOUA 1T4ZA 4IELA 2B7JA 2F9SA 3F0IA 2HXKA 5C00A 1M99A 4FO5A 2MZCA 1AXDA 3D5JA 2L5LA 1Q98A 3GH6A 4GCIA 2FY6A 2A4HA 2VUPA 1TDIA 3ZRDA 4EVMA 1M2DA 5HFKA 13GSA 4JR6A 2ZCTA 1Z7PA 4N30A 2OE3A 4OWYA 4F0BA 3VLNA 5FHIA 1GTAA 1XWBA 5DCGA 2JSZA 1J0FA 1M9AA 4ZB8A 2GT6A 1ML6A 4BL7B 4WETA 3QD9A 2J9HA 4AJ6A 2PVQA 1GUHA 1T8EB 4K7NA 5CNWA 1W89A 4WEYA 3TOTA 2LQOA 5DJLA 3M8NA 2DIZA 1IYHA 3E0UA 2N5BA 2EIQA 1ZYPA 3CSJA 5D93A 1XW5A 2AUVA 4MNNA 2VM1A 3O3TA 2AAWA 1J08A 3L78A 3GX8A 1R26A 4I2TA 2H8LA 2YOIA 1EEJA 4J56E 4ZBBA 1LU4A 1LBKA 3AY8A 3VFIA 4V2LA 1PN0A 2O85A 4DSSB 1EV4A 3LEFA 2FA8A 3TJGA 1TU7A 3JCML 4CY8A 14GSA 1YQ1A 1WOUA 1ON4A 4QL7A 3WT1A 2LSTA 1GUMA 3ERFA 2OACA 3BD2A 4QL9A 2LV3A 2VCTA 1G7OA 2H73A 5F0GA 1EOHA 3QR6A 4TR3A 1EGRA 3PGTA 1G7EA 2AHEA 3TUEA 4G0KA 4MA9A 5ECPB 4YQVA 5GAND 5A5KA 5J41A 3BCIA 1TI3A 3FZ5A 2IWTA 1WMJA 2HT9A 1GTUA 10GSA 3EE2A 2HLSA 3HKRA 2AB6A 5AN1A 1XZOA 4WR5A 4EO3A 3EWLA 2XPDA 4ULXA 3TRPA 3H1NA 3WYWA 4NAXA 4G10A 3APOA 3GHAA 1OAZA 5CRHA 4NV5A 2MMOA 2VLUA 3FZ9A 2V6KA 4NPBA 1TK8B 3J7Yb 2BMXA 1SL1B 4KW6A 5IMAA 1N8JA 1YKCA 2VO4A 2XPEA 4GSTA 3UARA 1Z5YE 4L8EA 2NBSA 4PXOA 5D9TA 1A8LA 2H1DA 2V2GA 1NW2A 2X49A 3LG6A 4BA7A 2BJXA 2WFCA 4E8HA 2LKUA 3VPTA 4EDYA 3TKPA 1K3OA 3FR6A 4EXJA 2TRXA 1TRWA 3ERGA 3EC3A 2JSYA 2R4VA 4KDYA 2GTUA 1GSYA 3HVNA 5J5NA 4MCUA 5IMFA 2ON7A 3FY7A 5DDLA 2IN3A 1GNWA 3IHQA 4Z2TA 1TW9A 1OKDA 2IMDA 2MMNA 2NPBA 1F3AA 3ZMLA 1Y6EA 5KOXA 1ERWA 3F4SA 4MZWA 3VK9A 3DRNA 1BX9A 6GSVA 1FOVA 3KTLA 4MPFA 4I97A 3A5IA 1YF0A 1O8WA 2YNXA 4LA1A 2LJRA 1GH2A 2HYXA 2DJJA 2DIYA 1V58A 2EIRA 1JFUA 4KGIA 3ZFLA 1F37A 2FNOA 4RUVA 3U6VA 1OYJA 4ZB6A 3FR3A 5ECRB 5D73A 3VPQA 3HYPA 3RHBA 4TXVA 3S9FA 4KB3A 2K8VA 3MAKA 4OCEA 4YQMA 2K9FA 1NM3A 2VLTA 4IQ1A 3E9JB 1B9YC 2A2PA 3TJFA 1GWCA 1U3IA 1VRSD 4BL7A 4OFNA 2OKAA 1XW6A 2X8CA 3EURA 3O76A 2CVKA 2PWJA 5KN3A 2IMIA 2WS2A 5DJMA 3EU4A 2L59A 1EOGA 3GFKA 2LUSA 4IGJA 1V57A 1GLQA 1T3BA 3SBCA 4KUNA 4JBBA 1K0BA 17GSA 3FYGA 4F2IA 2YANA 1M9BA 2DBCA 2HRFA 1FB0A 4NV2A 2R2JA 3GYKA 2PERA 4MK3A 1TK5B 2R0CA 5JWQB 2F3MA 5ENUA 1WP0A 1A2MA 3ZL5A 4DSSA 4F82A 1O8XA 3R3EA 3Q18A 4F0CA 2GSQA 1S3RA 5DALA 4O32A 1X0RA 3WGXA 3QAVA 3ZLPA 3UJ1A 1X5DA 4EUYA 3M1GA 4TN8A 3CSIA 1TRVA 2C80A 2IMKA 1SK0A 3GIXA 1Z7RA 4F03A 3FEUA 1TRUA 4WBRD 3H93A 1GP1A 3PPUA 4KF9A 2X4AA 5LNKe 1VF4A 4BVYB 3LW9A 3GKXA 5D9XA 3C73A 3HD5A 4OFMA 3Q74A 1YEPA 3KEBA 3ZMKA 1USBA 1X9WB 2MBSA 3HVVA 1XOBA 1SKSB 3TDGA 1ZYEA 4BWQA 1WWJA 1JZOA 1V2AA 5F07A 1MD4A 3H4KA 5D96A 1LJRA 4MH2A 1Z3EA 2I1UA 4IJIA 4EDZA 5JWOB 1GTIA 2REMA 2GQLA 2VD0A 1K0AA 3NIVA 2LNTA 4TR4A 3A2XA 4FH8A 4EC0A 3MNGA 4FIWA 4IHUA 4BVXB 2E2MA 5EY6A 1X9SB 1A8YA 5A4UA 1EZKA 2HSMA 5IQYA 12GSA 4ECJA 5ECQB 1ZYNA 2ZNMA 3W6GA 4PUAA 1SJ6A 1S3DA 4K6XA 1YZXA 3D0ZA 2RM6A 3FW2A 4DSRA 4HEA2 1UC7A 4XS1A 4GF0A 4K7IA 4KH7A 4K1FA 5ECMB 5IM9A 1A2LA 2H01A 3EVIA 2IPAA 2NDOA 2A2RA 4IQAA 2AJQB 4D73B 3C71A 3RDWA 1YEXA 4V2MA 1ERVA 1K0OA 20GSA 5IOXA 1YF1A 4MZBA 3D6IA 4MJBA 1WJKA 1XOAA 2K8SA 2LRTA 1JHBA 2VCVA 1QGVA 4EE0A 4RQRA 1VF1A 3Q6OA 5HR0A 5ID2B 3A2WA 1QQ2A 3KMNA 1ZZYA 2FWGA 1A2JA 2C0FA 2WGRA 3L9SA 2KUCA 3UVTA 2YN1A 4H86A 1RQMA 2VD1A 4O5UA 2HRKA 2L6DA 1A24A 1M3JA 2P5QA 2VOCA 3VI7A 1FOHA 4HU7A 2GSSA 1FB6A 3MYDA 3D22A 2P0GA 1GUKA 4TRXA 4HQZA 8GSSA 2JACA 2WULA 3VI5A 4F9ZA 4Z7XA 2VLVA 3ZIJA 5G5EA 5IMZA 2L4QA 2PBJA 3G7IA 1SK1A 4WBJA 1A0RP 3L9UA 5HR1A 1K0MA 4HZ2A 4L0WA 1XIYA 4TVEA 2IMEA 2RIIA 4NHWA 4RQXA 2LTKA 3HVSA 1F9MA 4GXZA 4IP6A 3F9UA 1WRYA 2QA2A 2XBQA 2H74A 1CQHA 1GSFA 2H1BA 2YZUA 4HSCX 3TCOA 4I8BA 3QOUA 3QDNA 3IK7A 4HJMA 4ECIA 1UN2A 3H8QA 3DYRA 3KGKA 3LQ7A 4IP1A 4K2DA 1GULA 1N2AA 4Z2RA 3VWWA 3F6FA 3ZREA 2KP1A 1O73A 3Q19A 2QC7A 4V1Ap 3CYNA 1PL2A 3C7MA 2R6KA 3F3RA 5IMCA 5CREA 4TXOB 3HJPA 1BG5A 4FQUA 2KHPA 1PX7A 3CRTA 1M2AA 3MDKA 4HS1A 4BVYA 3BJ5A 1BEDA 2VCQA 3DXBA 4PNFA 4EIPA 3A5WA 4ICYA 3ZVJA 4P3YB 2RUEA 4IKHA 1O6JA 3GNJA 2FLSA 5INYA 5AGYA 4G2EA 4JE1A 3LORA 2A4VA 3GKMA 4TOPA 2GLRA 2JL4A 2M46A 1X5CA 2B1KA 2N5AA 2VCZA 1SKWB 5FWGA 5KN0A 4KSMA 2HZEB 3P90A 3ERWA 3APQA 3TJKA 4V1Ag 2C8UA 2I81A 3ZITA 1NHYA 2PUKC 2H0GA 2WDUA 4Q5FA 1PSQA 2DJ2A 4V2NA 4J2FA 3I6AA 3GV1A 5G30A 1K0CA 2CZ3A 5A4VA 4POKA 5IPHA 4IN0A 4WR4A 1XWCA 5DCHA 4CHSA 1BAYA 3HJMA 4PQ1A 2ALBA 1SL2B 1K0DA 4N0ZA 1DE2A 3KP8A 2OBIA 3DKSA 3LWAA 5B8AA 1GTBA 1FO5A 2OE0A 1JZWA 4IJ3A 2CV4A 2QKEA 3PR8A 1T1VA 3TRXA 18GSA 4TR1B 1B4PA 2GGTA 2LRNA 3LJRA 4KNDA 1B4QA 4J57E 3GA4A 1GNEA 4K8MA 3CTGA 5EPFA 2H1AA 4OO4A 2LS5A 3ZYWA 1V98A 2RUFA 2V6OA 2E2GA 2CAQA 1GSDA 3LXZA 4KCAA 4GLTA 2OA7A 3GH9A 3KIJA 3CXGA 1MDIA 4D73A 3TKRA 3KTBA 3K8NA 2I9HA 5HFIA 4ML1A 5JCWA 3KXOA 4KCEA 2QA1A 3GX0A 1ERTA 3ZIVA 4MJAA 3F6DA 3TRQA 2IFQB 1M2BA 7GSSA 1W4VA 1QXHA 5ID2A 3R2QA 19GSA 3MIXA 2ZUPA 3VURA 2IMFA 5H5SA 5L71A 3ZTLA 1XBSA 2CA8A 1KBNA 3N9JA 3G7JA 4N0VA 1XVWA 2N5FA 4PTSA 1R5AA 2L57A 1OE8A 4TKYA 3NZNA 3DMLA 2CVDA 4AJ7A 3LFLA 2VIMA 1AAZA 1KNGA 1YKAA 3E3EA 5DAKB 4KE3A 1SYXA 4HZ4A 4DSQA 4ZILA 4LMWA 5IO0A 3FRCA 3HZ8A 1XWAA 5E59A 3KP9A 1UVZA 5G1KA 5FT3A 1RK4A 2L5OA 3VWUA 2D2ZA 3CQFA 3TKSA 1WPIA 4MLYA 2C0EA 1GSSA 5ECKB 2YWMA 2H76A 1M7TA 5DQYA 3IAS2 4XTSA 2G0FA 2CT6A 2B6MA 16GSA 2H0HA 3CRUA 1OC8A 4MF5A 4DEJA 4FYBA 1NHOA 5C04A 2OADA 3L0HA 1S3AA 2FWEA 1G6YA 4XRAA 2TIRA 4X0XA 1HNBA 1TTZA 1J9BA 1TP9A 2O8VB 4EL1A 3MWHA 1FG4A 5ECNB 1EP7A 4O92A 1Q4JA 4ZBAA 3FHKA 1H4OA 2FUG2 4ILFA 3KH9A 4JRRA 3GL5A 4TXOA 1OKTA 2A2SA 1UA5A 3ME8A 4IBPA 4K9ZA 1PX6A 1AUCA 4FYUA 3CTFA 4ZXGA 5A4WA 1FW1A 3MSZA 1M3IA 5HR2A 2PPTA 4G9HA 3LYKA 4YQUA 1SL0B 4O5RA 3IR4A 4Q5NA 5ECOB 3TKSC 2XHFA 1AQXA 4PX1A 3WGEA 2VL9A 5G1LA 3O6TA 4CY6A 4GSNA 1AQVA 3TKQA 1EGOA 2JZTA 3ZFBA 1K3LA 3CSHA 1A0FA 3GKNA 5HFGA 4DVCA 1SJIA 2B5XA 3IBHA 4WKWA 1XWGA 2R3XA 2DMLA 4POMA 3QMXA 1DSBA 4PNGA 3QCPA 2OJLA 4O7HA 4TR0A 3A3TA 1HNCA 3PH9A 4NWYA 4X43A 4G0IA 4XHMA 3LSZA 3RHCA 2PGTA 5JCGA 3CMIA 6GSWA 2PN8A 2DJ0A 2HRAA 2GQKA 2H71A 2MMZA 3DGQA 2YP6A 5D8IA 4Q5RA 5AISA 2GT5A 2M72A 2AV4A 1IYIA 2C1YA 3VWXA 2FA4A 1ZCPA 3TKSE 1Y25A 3DVXA 2JZSA 3TB2A 1TU8A 3D21A 2B7KA 5KOWA 1I5GA 3TGZA 1TK0B 4K5SA 1JLVA 4BPYA 2KOKA 1O7UA 3FK8A 2C3QA 4YAPA 4QQ7A 2VL2A 2FGXA 2F8AA 5JCUA 5ECLB 2YWIA 5J4UA 3KJYA 3L4NA 2HRNA 1SK2A 2X99A 2HNLA 3EMXA 3IXRA 3IC8A 3FKFA 4Q5QA 3SWLA 4MDCA 4X4JA 3GKKA 4NHZA 3BCKA 1KEBA 4ACSA 4E8EA 1QFNA 5BRTA 1RW1A 4L5LA 1R4WA 1PQNA 2YV9A 3P2AA 3EYTA 5COHA 1T00A 2IFQA 5F06A 1SD9A 1AW9A 4HI7A 3QAGA 2HZFA 1R7HA 3VWVA 3ZVJD 4ZL8A 4K7OA 2LJKA 3ISOA 4KSOA 3M9KA 2H66A 2YJHA 2OBKA 2IJYA 3GTUB 1WE0A 2NTOA 1PFOA 5B7CA 3DD3A 3IDVA 5IMVA 2FD3A 1XWKA 4RI7A 1FVJA 1Z6MA 2R5GA 2VL2C 2G2QA 4YH2A 5DAKA 1FHEA 3DIEA 1YY7A 4PQIA 2K18A 1ZMAA 2C0GA 2C0DA 4MJCA 2UZ8A 2GZPA 4XS4B 2IL3A 3W8JA 1AIUA 4GQCA 1F3BA 3I43A 4L5OA 2H75A 1TOFA 5J9CA 1OE7A 1VF2A 2F8FA 1XW9A 1PA3A 2PVOC 3RPPA 1HNAA 3APSA 4OFTA 1V9WA 4OMVA 3GN3A 1SYRA 4NXIA 3P7XA 5F05A 1ZOFA 2JADA 2P31A 1AQWA 4WF4A 4X1UA 5ELGA 1DBYA 5H5QA 3DEXA 5CAXA 2H72A 5CRWA 5JWRB 4ZL7A 3IK9A 1ZYQB 3ZZXA 2HE3A 4WF5A 3WGDA 2LEGA 2B5EA 3N5OA 3UVHA 1K0NA 1ERUA 3F4RA 5HQPA 2YWOA 4ML6A 1U88A 1GSEA 1URMA 4MF7A 3UAPA 4MABA 1Z9HA 3F63A 5J3RA 1T7PB 3HDCA 5AIVA 2MBTA 3D4TA 2WRTA 1H75A 2DMMA 2GDRA 4L0UA 3RPNA 2YWNA 4KAEA 1SU9A 1PKWA 2MYGA 1ZGNA 5IMDA 4CW9A 5ABRA 2DKHA 2F51A 3LXTA 1G0TA 1O85A 2GVPA 5B6NA 4LMVA 2LJAA 5J9BA 2WCIA 3C1RA 2HSHA 5E4WA 4N11A 1I9DA 4ID0A 4N10A 2I4AA 3M9JA 4O5QA 1GLPA 1VGLA 4TW5A 5GSTA 1PL1A 1SJZA 4XS6A 2R0PA 3UMAA 4BIKA 3U5RE 1XXUA 2DC5A 1ABAA 2H6YA 1THOA 1Z6NA 1PRXA 1MD3A 2FHEA 4EKZA 1GL8A 1OC9B 2DLXA 3UBLA 3H79A 5DALB 4JEDA 5CP1A 2RLIA 4GRFA 5KN1A 4BWSA 3WD6A 1C72A 3ED3A 1DE1A 3BBYA 4LLRA 5IIZA 2VCWA 2KLXA 3IOSA 3HXSA 1XG8A 3QFBC 1YJ6A 4KDXA 5ECIB 4ZL9A 1TRSA 4OCFA 4POBA 2P5RA 3J7Yk 3UEMA 5ELAA 2YV7A 1MTCA 4BVXA 4JU5A 1PGTA 5D9VA 2V41A 2H30A 1EP8A 4CDOA 1A23A 3EMPA 2CZ2A 2QSIA 3LGCA 4PUFC 1SD8A 1HYUA 4KX4A 4ZBDA 2CVBA 4OD7A 1F6MC 2XC2A 3OR5A 4KDUA 3FMWA 3GURA 4MMMA 3DWVA 2L6CA 1EV9A 2H70A
chains in the Genus database with same CATH topology
2H0IA 1U6TA 3V1WA 2EIOA 1V40A 2GSRA 1JZRA 3GTUA 3IAM2 2EC4A 3D4MA 2TRCP 4JZQA 3F3QA 1S3CA 3HHVA 6GSXA 2E0QA 1GSQA 4JR4A 1B9XC 1E2YA 1XFLA 1NSWA 5G2ZA 5D9WA 5GSSA 1B8XA 2HSYA 3GUSA 2YJ7A 1AC1A 2VAFA 4XS4A 2V1MA 2DJKA 5IPGA 1MDJA 4I5QA 3EPTA 4MJEA 2DJ1A 3EINA 3W8SA 2GZYA 3QPMA 3ME7A 2FWFA 4ZB9A 1BJXA 1TI1A 1T4YA 3CBUA 2PMTA 2H1GA 2O7KA 2Z9SA 4MZCA 3RBTA 4A5PA 4YAVA 2X8GA 1OC3A 5G31A 2YCDA 2FCHA 4PQHA 1R5PA 5LCZA 4KA0A 2E7PA 5LD0A 2MMAA 1F2EA 2H6ZA 3L9VA 4Z2UA 1MEKA 1M0UA 2R0GA 3A2VA 3IRAA 2QGVA 4AJ8A 5IOWA 3KCMA 3P8WA 1BQ7A 1GSUA 2C3NA 1TJDA 4HUAA 2DJ3A 1MDKA 2L4CA 4GWRA 1CQGA 1XPVA 1KTEA 2GQMA 4PGTA 4HOJA 3IPZA 5CO3A 4HDEA 2ES7A 2YPMA 2WB9A 5ECSA 2HI7A 1HQOA 2B1LA 2LRCA 4NMUA 1X9MB 1FAAA 1G6WA 3I69A 2M80A 2DSAA 4WXTA 4AF2A 3WT2A 1O81A 4XIHA 2CX3A 2WJUA 4K0GA 5B8BA 2B5YA 2VL3A 2KP2A 3KMOA 3IA1A 2PU9C 3PINA 2ON5A 3UOMA 2DKIA 3M3MA 4I6XA 3KZQA 1EWXA 4GTUA 2VM2A 2FWHA 5CYYA 4ZIJA 3KH7A 2YZHA 3QAWA 2VCXA 6GSYA 3HZ4A 4K5RA 4IW9A 1B48A 4I2UA 5KEJA 1QUWA 5DVBA 2JZRA 2CAIA 4GQFA 3UBKA 2CX4A 1X5EA 4FYCA 2R37A 5G5FA 1WIKA 1OC9A 4LL4B 4OO5A 2O87A 1ZL9A 4G19A 1PMTA 2HZEA 1SKRB 4HU9A 3FR9A 22GSA 5CRDA 4ECCA 3EU3A 1DUGA 1K3YA 1PN9A 5DBQA 3HCZA 3GSSA 3I9V2 5KN2A 4IVFA 4ISDA 2LQQA 1HD2A 2C3TA 4AGSA 2NVLA 3IHGA 3GSTA 3F4TA 3GRXA 4USSA 2V32A 5BMUA 1QK8A 1XVQA 2GZZA 2J23A 2C4JA 2K6VA 2B3SA 3KM6A 5F8BA 3TJJA 4TR1A 1GRXA 3QFAC 1TKDB 3FZ4A 1E6BA 4G0LA 3HY2A 4MPGA 3IC4A 2WZ9A 5ECHB 2AYTA 3FZAA 4K2XA 2GS3A 3F8UA 5EL8A 1QMVA 2OE1A 3KD0A 5EVOA 2XBIA 2I3YA 3GMFA 3UL3A 3HVXA 2JU5A 4LL1B 5GZZB 2O89A 6GSUA 3LYPA 1ST9A 6GSTA 5H5RA 5B6MA 1YDKA 2HFDA 3DVWA 1ACVA 3HJOA 1THXA 1OVNA 2IIYA 2CQ9A 1FVKA 5CRGA 3M0FA 3C1SA 4XRDA 3HA9A 1VF3A 4GSSA 1PD21 2X64A 5AIXA 3TJBA 6GSSA 4POLA 2H19A 5GAPD 4MP4A 3C8EA 5DQSA 4MF6A 1SENA 3UIWA 4HJ2A 4PURA 1EEMA 5HR3A 1XCCA 2H6XA 3US3A 1U87A 4IS0A 2LNSA 1ILOA 3IE3A 4ECBA 2BTOT 4EF0A 4YKGA 3RAZA 5IO2A 1BYEA 2X8HA 9GSSA 3IV4A 3G9BA 3G7YA 4EIQA 11GSA 4RI6A 4YKFA 1TXXA 1JZDA 4MH3A 3GL3A 1U3AA 4XCSA 3NOFA 4K0NA 2RM5A 1PKZA 2GSTA 1JLWA 3BOAA 4HQSA 3TOUA 1T4ZA 4IELA 2B7JA 2F9SA 3F0IA 2HXKA 5C00A 1M99A 4FO5A 2MZCA 1AXDA 3D5JA 2L5LA 1Q98A 3GH6A 4GCIA 2FY6A 2A4HA 2VUPA 1TDIA 3ZRDA 4EVMA 1M2DA 5HFKA 13GSA 4JR6A 2ZCTA 1Z7PA 4N30A 2OE3A 4OWYA 4F0BA 3VLNA 5FHIA 1GTAA 1XWBA 5DCGA 2JSZA 1J0FA 1M9AA 4ZB8A 2GT6A 1ML6A 4BL7B 4WETA 3QD9A 2J9HA 4AJ6A 2PVQA 1GUHA 1T8EB 4K7NA 5CNWA 1W89A 4WEYA 3TOTA 2LQOA 5DJLA 3M8NA 2DIZA 1IYHA 3E0UA 2N5BA 2EIQA 1ZYPA 3CSJA 5D93A 1XW5A 2AUVA 4MNNA 2VM1A 3O3TA 2AAWA 1J08A 3L78A 3GX8A 1R26A 4I2TA 2H8LA 2YOIA 1EEJA 4J56E 4ZBBA 1LU4A 1LBKA 3AY8A 3VFIA 4V2LA 1PN0A 2O85A 4DSSB 1EV4A 3LEFA 2FA8A 3TJGA 1TU7A 3JCML 4CY8A 14GSA 1YQ1A 1WOUA 1ON4A 4QL7A 3WT1A 2LSTA 1GUMA 3ERFA 2OACA 3BD2A 4QL9A 2LV3A 2VCTA 1G7OA 2H73A 5F0GA 1EOHA 3QR6A 4TR3A 1EGRA 3PGTA 1G7EA 2AHEA 3TUEA 4G0KA 4MA9A 5ECPB 4YQVA 5GAND 5A5KA 5J41A 3BCIA 1TI3A 3FZ5A 2IWTA 1WMJA 2HT9A 1GTUA 10GSA 3EE2A 2HLSA 3HKRA 2AB6A 5AN1A 1XZOA 4WR5A 4EO3A 3EWLA 2XPDA 4ULXA 3TRPA 3H1NA 3WYWA 4NAXA 4G10A 3APOA 3GHAA 1OAZA 5CRHA 4NV5A 2MMOA 2VLUA 3FZ9A 2V6KA 4NPBA 1TK8B 3J7Yb 2BMXA 1SL1B 4KW6A 5IMAA 1N8JA 1YKCA 2VO4A 2XPEA 4GSTA 3UARA 1Z5YE 4L8EA 2NBSA 4PXOA 5D9TA 1A8LA 2H1DA 2V2GA 1NW2A 2X49A 3LG6A 4BA7A 2BJXA 2WFCA 4E8HA 2LKUA 3VPTA 4EDYA 3TKPA 1K3OA 3FR6A 4EXJA 2TRXA 1TRWA 3ERGA 3EC3A 2JSYA 2R4VA 4KDYA 2GTUA 1GSYA 5J5NA 4MCUA 5IMFA 2ON7A 3FY7A 5DDLA 2IN3A 1GNWA 3IHQA 4Z2TA 1TW9A 1OKDA 2IMDA 2MMNA 2NPBA 1F3AA 3ZMLA 1Y6EA 5KOXA 1ERWA 3F4SA 4MZWA 3VK9A 3DRNA 1BX9A 6GSVA 1FOVA 3KTLA 4MPFA 4I97A 3A5IA 1YF0A 1O8WA 2YNXA 4LA1A 2LJRA 1GH2A 2HYXA 2DJJA 2DIYA 1V58A 2EIRA 1JFUA 4KGIA 3ZFLA 1F37A 2FNOA 4RUVA 3U6VA 1OYJA 4ZB6A 3FR3A 5ECRB 5D73A 3VPQA 3HYPA 3RHBA 4TXVA 3S9FA 4KB3A 2K8VA 3MAKA 4OCEA 4YQMA 2K9FA 1NM3A 2VLTA 4IQ1A 3E9JB 1B9YC 2A2PA 3TJFA 1GWCA 1U3IA 1VRSD 4BL7A 4OFNA 2OKAA 1XW6A 2X8CA 3EURA 3O76A 2CVKA 2PWJA 5KN3A 2IMIA 2WS2A 5DJMA 3EU4A 2L59A 1EOGA 3GFKA 2LUSA 4IGJA 1V57A 1GLQA 1T3BA 3SBCA 4KUNA 4JBBA 1K0BA 17GSA 3FYGA 4F2IA 2YANA 1M9BA 2DBCA 2HRFA 1FB0A 4NV2A 2R2JA 3GYKA 2PERA 4MK3A 1TK5B 2R0CA 5JWQB 2F3MA 5ENUA 1WP0A 1A2MA 3ZL5A 4DSSA 4F82A 1O8XA 3R3EA 3Q18A 4F0CA 2GSQA 5DALA 4O32A 1X0RA 3WGXA 3QAVA 3ZLPA 3UJ1A 1X5DA 4EUYA 3M1GA 4TN8A 3CSIA 1TRVA 2C80A 2IMKA 1SK0A 3GIXA 1Z7RA 4F03A 3FEUA 1TRUA 4WBRD 3H93A 1GP1A 3PPUA 4KF9A 2X4AA 5LNKe 1VF4A 4BVYB 3LW9A 3GKXA 5D9XA 3C73A 3HD5A 4OFMA 3Q74A 1YEPA 3KEBA 3ZMKA 1USBA 1X9WB 2MBSA 3HVVA 1XOBA 1SKSB 3TDGA 1ZYEA 4BWQA 1WWJA 1JZOA 1V2AA 5F07A 1MD4A 3H4KA 5D96A 1LJRA 4MH2A 1Z3EA 2I1UA 4IJIA 4EDZA 5JWOB 1GTIA 2REMA 2GQLA 2VD0A 1K0AA 3NIVA 2LNTA 4TR4A 3A2XA 4FH8A 4EC0A 3MNGA 4FIWA 4IHUA 4BVXB 2E2MA 5EY6A 1X9SB 1A8YA 5A4UA 1EZKA 2HSMA 5IQYA 12GSA 4ECJA 5ECQB 1ZYNA 2ZNMA 3W6GA 4PUAA 1SJ6A 1S3DA 4K6XA 1YZXA 3D0ZA 2RM6A 3FW2A 4DSRA 4HEA2 1UC7A 4XS1A 4GF0A 4K7IA 4KH7A 4K1FA 5ECMB 5IM9A 1A2LA 2H01A 3EVIA 2IPAA 2NDOA 2A2RA 4IQAA 2AJQB 4D73B 3C71A 3RDWA 1YEXA 4V2MA 1ERVA 1K0OA 20GSA 5IOXA 1YF1A 4MZBA 3D6IA 4MJBA 1WJKA 1XOAA 2K8SA 2LRTA 1JHBA 2VCVA 1QGVA 4EE0A 4RQRA 1VF1A 3Q6OA 5HR0A 5ID2B 3A2WA 1QQ2A 3KMNA 1ZZYA 2FWGA 1A2JA 2C0FA 2WGRA 3L9SA 2KUCA 3UVTA 2YN1A 4H86A 1RQMA 2VD1A 4O5UA 2HRKA 2L6DA 1A24A 2P5QA 2VOCA 3VI7A 1FOHA 4HU7A 2GSSA 1FB6A 3MYDA 3D22A 2P0GA 1GUKA 4TRXA 4HQZA 8GSSA 2JACA 2WULA 3VI5A 4F9ZA 4Z7XA 2VLVA 3ZIJA 5G5EA 5IMZA 2L4QA 2PBJA 3G7IA 1SK1A 4WBJA 1A0RP 3L9UA 5HR1A 1K0MA 4HZ2A 4L0WA 1XIYA 4TVEA 2IMEA 2RIIA 4NHWA 4RQXA 2LTKA 3HVSA 1F9MA 4GXZA 4IP6A 3F9UA 1WRYA 2QA2A 2XBQA 2H74A 1CQHA 1GSFA 2H1BA 2YZUA 3TCOA 4I8BA 3QOUA 3QDNA 3IK7A 4HJMA 4ECIA 1UN2A 3H8QA 3DYRA 3KGKA 3LQ7A 4IP1A 4K2DA 1GULA 1N2AA 4Z2RA 3VWWA 3F6FA 3ZREA 2KP1A 1O73A 3Q19A 2QC7A 4V1Ap 3CYNA 1PL2A 3C7MA 2R6KA 3F3RA 5IMCA 5CREA 4TXOB 3HJPA 1BG5A 4FQUA 2KHPA 1PX7A 3CRTA 1M2AA 3MDKA 4HS1A 4BVYA 3BJ5A 1BEDA 2VCQA 3DXBA 4PNFA 4EIPA 3A5WA 4ICYA 3ZVJA 4P3YB 2RUEA 4IKHA 1O6JA 3GNJA 2FLSA 5INYA 5AGYA 4G2EA 4JE1A 3LORA 2A4VA 3GKMA 4TOPA 2GLRA 2JL4A 2M46A 1X5CA 2B1KA 2N5AA 2VCZA 1SKWB 5FWGA 5KN0A 4KSMA 2HZEB 3P90A 3ERWA 3APQA 3TJKA 4V1Ag 2C8UA 2I81A 3ZITA 1NHYA 2PUKC 2H0GA 2WDUA 4Q5FA 1PSQA 2DJ2A 4V2NA 4J2FA 3I6AA 3GV1A 5G30A 1K0CA 2CZ3A 5A4VA 4POKA 5IPHA 4IN0A 4WR4A 1XWCA 5DCHA 4CHSA 1BAYA 3HJMA 4PQ1A 2ALBA 1SL2B 1K0DA 4N0ZA 1DE2A 3KP8A 2OBIA 3DKSA 3LWAA 5B8AA 1GTBA 1FO5A 2OE0A 1JZWA 4IJ3A 2CV4A 2QKEA 3PR8A 1T1VA 3TRXA 18GSA 4TR1B 1B4PA 2GGTA 2LRNA 3LJRA 4KNDA 1B4QA 4J57E 3GA4A 1GNEA 4K8MA 3CTGA 5EPFA 2H1AA 4OO4A 2LS5A 3ZYWA 1V98A 2RUFA 2V6OA 2E2GA 2CAQA 1GSDA 3LXZA 4KCAA 4GLTA 2OA7A 3GH9A 3KIJA 3CXGA 1MDIA 4D73A 3TKRA 3KTBA 3K8NA 2I9HA 5HFIA 4ML1A 5JCWA 3KXOA 4KCEA 2QA1A 3GX0A 1ERTA 3ZIVA 4MJAA 3F6DA 3TRQA 2IFQB 1M2BA 7GSSA 1W4VA 1QXHA 5ID2A 3R2QA 19GSA 3MIXA 2ZUPA 3VURA 2IMFA 5H5SA 5L71A 3ZTLA 1XBSA 2CA8A 1KBNA 3N9JA 3G7JA 4N0VA 1XVWA 2N5FA 4PTSA 1R5AA 2L57A 1OE8A 4TKYA 3NZNA 3DMLA 2CVDA 4AJ7A 3LFLA 2VIMA 1AAZA 1KNGA 1YKAA 3E3EA 5DAKB 4KE3A 1SYXA 4HZ4A 4DSQA 4ZILA 4LMWA 5IO0A 3FRCA 3HZ8A 1XWAA 5E59A 3KP9A 1UVZA 5G1KA 5FT3A 1RK4A 2L5OA 3VWUA 2D2ZA 3TKSA 1WPIA 4MLYA 2C0EA 1GSSA 5ECKB 2YWMA 2H76A 1M7TA 5DQYA 3IAS2 4XTSA 2G0FA 2CT6A 2B6MA 16GSA 2H0HA 3CRUA 1OC8A 4MF5A 4DEJA 4FYBA 1NHOA 5C04A 2OADA 3L0HA 1S3AA 2FWEA 1G6YA 4XRAA 2TIRA 4X0XA 1HNBA 1TTZA 1J9BA 1TP9A 2O8VB 4EL1A 3MWHA 1FG4A 5ECNB 1EP7A 4O92A 1Q4JA 4ZBAA 3FHKA 1H4OA 2FUG2 4ILFA 3KH9A 4JRRA 3GL5A 4TXOA 1OKTA 2A2SA 1UA5A 3ME8A 4IBPA 4K9ZA 1PX6A 1AUCA 4FYUA 3CTFA 4ZXGA 5A4WA 1FW1A 3MSZA 5HR2A 2PPTA 4G9HA 3LYKA 4YQUA 1SL0B 4O5RA 3IR4A 4Q5NA 5ECOB 3TKSC 2XHFA 1AQXA 4PX1A 3WGEA 2VL9A 5G1LA 3O6TA 4CY6A 4GSNA 1AQVA 3TKQA 1EGOA 2JZTA 3ZFBA 1K3LA 3CSHA 1A0FA 3GKNA 5HFGA 4DVCA 1SJIA 2B5XA 3IBHA 4WKWA 1XWGA 2R3XA 2DMLA 4POMA 3QMXA 1DSBA 4PNGA 3QCPA 2OJLA 4O7HA 4TR0A 3A3TA 1HNCA 3PH9A 4NWYA 4X43A 4G0IA 4XHMA 3LSZA 3RHCA 2PGTA 5JCGA 3CMIA 6GSWA 2PN8A 2DJ0A 2HRAA 2GQKA 2H71A 2MMZA 3DGQA 2YP6A 5D8IA 4Q5RA 5AISA 2GT5A 2M72A 2AV4A 1IYIA 2C1YA 3VWXA 2FA4A 1ZCPA 3TKSE 1Y25A 3DVXA 2JZSA 3TB2A 1TU8A 3D21A 2B7KA 5KOWA 1I5GA 3TGZA 1TK0B 4K5SA 1JLVA 4BPYA 2KOKA 1O7UA 3FK8A 2C3QA 4YAPA 4QQ7A 2VL2A 2FGXA 2F8AA 5JCUA 5ECLB 2YWIA 5J4UA 3KJYA 3L4NA 2HRNA 1SK2A 2X99A 2HNLA 3EMXA 3IXRA 3IC8A 3FKFA 4Q5QA 3SWLA 4MDCA 4X4JA 3GKKA 4NHZA 3BCKA 1KEBA 4ACSA 4E8EA 1QFNA 5BRTA 1RW1A 4L5LA 1R4WA 1PQNA 2YV9A 3P2AA 3EYTA 5COHA 1T00A 2IFQA 5F06A 1SD9A 1AW9A 4HI7A 3QAGA 2HZFA 1R7HA 3VWVA 3ZVJD 4ZL8A 4K7OA 2LJKA 3ISOA 4KSOA 3M9KA 2H66A 2YJHA 2OBKA 2IJYA 3GTUB 1WE0A 2NTOA 5B7CA 3DD3A 3IDVA 5IMVA 2FD3A 1XWKA 4RI7A 1FVJA 1Z6MA 2R5GA 2VL2C 2G2QA 4YH2A 5DAKA 1FHEA 3DIEA 1YY7A 4PQIA 2K18A 1ZMAA 2C0GA 2C0DA 4MJCA 2UZ8A 2GZPA 4XS4B 2IL3A 3W8JA 1AIUA 4GQCA 1F3BA 3I43A 4L5OA 2H75A 1TOFA 5J9CA 1OE7A 1VF2A 2F8FA 1XW9A 1PA3A 2PVOC 3RPPA 1HNAA 3APSA 4OFTA 1V9WA 4OMVA 3GN3A 1SYRA 4NXIA 3P7XA 5F05A 1ZOFA 2JADA 2P31A 1AQWA 4WF4A 4X1UA 5ELGA 1DBYA 5H5QA 3DEXA 5CAXA 2H72A 5CRWA 5JWRB 4ZL7A 3IK9A 1ZYQB 3ZZXA 2HE3A 4WF5A 3WGDA 2LEGA 2B5EA 3N5OA 3UVHA 1K0NA 1ERUA 3F4RA 5HQPA 2YWOA 4ML6A 1U88A 1GSEA 1URMA 4MF7A 3UAPA 4MABA 1Z9HA 3F63A 5J3RA 1T7PB 3HDCA 5AIVA 2MBTA 3D4TA 2WRTA 1H75A 2DMMA 2GDRA 4L0UA 3RPNA 2YWNA 4KAEA 1SU9A 1PKWA 2MYGA 1ZGNA 5IMDA 4CW9A 5ABRA 2DKHA 2F51A 3LXTA 1G0TA 1O85A 2GVPA 5B6NA 4LMVA 2LJAA 5J9BA 2WCIA 3C1RA 2HSHA 5E4WA 4N11A 1I9DA 4ID0A 4N10A 2I4AA 3M9JA 4O5QA 1GLPA 1VGLA 4TW5A 5GSTA 1PL1A 1SJZA 4XS6A 2R0PA 3UMAA 3U5RE 1XXUA 2DC5A 1ABAA 2H6YA 1THOA 1Z6NA 1PRXA 1MD3A 2FHEA 4EKZA 1GL8A 1OC9B 2DLXA 3UBLA 3H79A 5DALB 4JEDA 5CP1A 2RLIA 4GRFA 5KN1A 4BWSA 3WD6A 1C72A 3ED3A 1DE1A 3BBYA 4LLRA 5IIZA 2VCWA 2KLXA 3IOSA 3HXSA 3QFBC 1YJ6A 4KDXA 5ECIB 4ZL9A 1TRSA 4OCFA 4POBA 2P5RA 3J7Yk 3UEMA 5ELAA 2YV7A 1MTCA 4BVXA 4JU5A 1PGTA 5D9VA 2V41A 2H30A 1EP8A 4CDOA 1A23A 3EMPA 2CZ2A 2QSIA 3LGCA 4PUFC 1SD8A 1HYUA 4KX4A 4ZBDA 2CVBA 4OD7A 1F6MC 2XC2A 3OR5A 4KDUA 3FMWA 3GURA 4MMMA 3DWVA 2L6CA 1EV9A 2H70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0I A;  1U6T A;  3V1W A;  2EIO A;  1V40 A;  2GSR A;  1JZR A;  3GTU A;  3IAM 2;  2EC4 A;  3D4M A;  2TRC P;  4JZQ A;  3F3Q A;  1S3C A;  3HHV A;  6GSX A;  2E0Q A;  1GSQ A;  4JR4 A;  1B9X C;  1E2Y A;  1XFL A;  1NSW A;  5G2Z A;  5D9W A;  5GSS A;  1B8X A;  2HSY A;  3GUS A;  2YJ7 A;  1AC1 A;  2VAF A;  4XS4 A;  2V1M A;  2DJK A;  5IPG A;  1MDJ A;  4I5Q A;  4MJE A;  2DJ1 A;  3EIN A;  3W8S A;  2GZY A;  3QPM A;  3ME7 A;  2FWF A;  4ZB9 A;  1BJX A;  1TI1 A;  1T4Y A;  3CBU A;  2PMT A;  2H1G A;  2O7K A;  2Z9S A;  4MZC A;  3RBT A;  4YAV A;  2X8G A;  1OC3 A;  5G31 A;  2YCD A;  2FCH A;  4PQH A;  1R5P A;  5LCZ A;  4KA0 A;  2E7P A;  5LD0 A;  2MMA A;  1F2E A;  2H6Z A;  3L9V A;  1MEK A;  1M0U A;  3A2V A;  3IRA A;  2QGV A;  4AJ8 A;  5IOW A;  3KCM A;  3P8W A;  1BQ7 A;  1GSU A;  2C3N A;  1TJD A;  4HUA A;  2DJ3 A;  1MDK A;  2L4C A;  4GWR A;  1CQG A;  1XPV A;  1KTE A;  2GQM A;  4PGT A;  4HOJ A;  3IPZ A;  5CO3 A;  4HDE A;  2ES7 A;  2YPM A;  2WB9 A;  5ECS A;  2HI7 A;  1HQO A;  2B1L A;  2LRC A;  4NMU A;  1X9M B;  1FAA A;  1G6W A;  3I69 A;  2M80 A;  2DSA A;  4WXT A;  4AF2 A;  3WT2 A;  1O81 A;  4XIH A;  2CX3 A;  2WJU A;  4K0G A;  5B8B A;  2B5Y A;  2VL3 A;  2KP2 A;  3KMO A;  3IA1 A;  2PU9 C;  3PIN A;  2ON5 A;  3UOM A;  3M3M A;  4I6X A;  3KZQ A;  1EWX A;  4GTU A;  2VM2 A;  2FWH A;  5CYY A;  4ZIJ A;  3KH7 A;  2YZH A;  3QAW A;  2VCX A;  6GSY A;  3HZ4 A;  4IW9 A;  1B48 A;  4I2U A;  5KEJ A;  1QUW A;  5DVB A;  2JZR A;  2CAI A;  4GQF A;  3UBK A;  2CX4 A;  1X5E A;  4FYC A;  2R37 A;  5G5F A;  1WIK A;  1OC9 A;  4LL4 B;  4OO5 A;  2O87 A;  1ZL9 A;  4G19 A;  1PMT A;  2HZE A;  1SKR B;  4HU9 A;  3FR9 A;  22GS A;  5CRD A;  4ECC A;  3EU3 A;  1DUG A;  1K3Y A;  1PN9 A;  5DBQ A;  3HCZ A;  3GSS A;  3I9V 2;  5KN2 A;  4IVF A;  4ISD A;  2LQQ A;  1HD2 A;  2C3T A;  4AGS A;  2NVL A;  3GST A;  3F4T A;  3GRX A;  2V32 A;  1QK8 A;  1XVQ A;  2GZZ A;  2J23 A;  2C4J A;  2K6V A;  2B3S A;  3KM6 A;  5F8B A;  3TJJ A;  4TR1 A;  1GRX A;  3QFA C;  1TKD B;  3FZ4 A;  1E6B A;  3HY2 A;  4MPG A;  3IC4 A;  2WZ9 A;  5ECH B;  2AYT A;  3FZA A;  2GS3 A;  3F8U A;  5EL8 A;  1QMV A;  2OE1 A;  3KD0 A;  5EVO A;  2XBI A;  2I3Y A;  3GMF A;  3UL3 A;  3HVX A;  2JU5 A;  4LL1 B;  5GZZ B;  2O89 A;  6GSU A;  3LYP A;  1ST9 A;  6GST A;  5H5R A;  5B6M A;  1YDK A;  2HFD A;  3DVW A;  1ACV A;  3HJO A;  1THX A;  1OVN A;  2IIY A;  2CQ9 A;  1FVK A;  5CRG A;  3M0F A;  3C1S A;  4XRD A;  3HA9 A;  1VF3 A;  4GSS A;  1PD2 1;  2X64 A;  5AIX A;  3TJB A;  6GSS A;  4POL A;  2H19 A;  5GAP D;  4MP4 A;  3C8E A;  5DQS A;  4MF6 A;  1SEN A;  3UIW A;  4HJ2 A;  4PUR A;  1EEM A;  5HR3 A;  1XCC A;  2H6X A;  3US3 A;  1U87 A;  4IS0 A;  2LNS A;  1ILO A;  3IE3 A;  4ECB A;  2BTO T;  4EF0 A;  3RAZ A;  5IO2 A;  1BYE A;  2X8H A;  9GSS A;  3IV4 A;  3G9B A;  3G7Y A;  11GS A;  4RI6 A;  1TXX A;  1JZD A;  4MH3 A;  3GL3 A;  1U3A A;  4XCS A;  3NOF A;  4K0N A;  2RM5 A;  1PKZ A;  2GST A;  1JLW A;  3BOA A;  4HQS A;  3TOU A;  1T4Z A;  4IEL A;  2B7J A;  2F9S A;  3F0I A;  2HXK A;  5C00 A;  1M99 A;  4FO5 A;  2MZC A;  1AXD A;  3D5J A;  2L5L A;  1Q98 A;  3GH6 A;  4GCI A;  2FY6 A;  2VUP A;  1TDI A;  3ZRD A;  4EVM A;  1M2D A;  5HFK A;  13GS A;  4JR6 A;  2ZCT A;  1Z7P A;  4N30 A;  2OE3 A;  4OWY A;  4F0B A;  3VLN A;  5FHI A;  1GTA A;  1XWB A;  5DCG A;  2JSZ A;  1J0F A;  1M9A A;  4ZB8 A;  2GT6 A;  1ML6 A;  4WET A;  3QD9 A;  2J9H A;  4AJ6 A;  2PVQ A;  1GUH A;  1T8E B;  4K7N A;  5CNW A;  1W89 A;  4WEY A;  3TOT A;  2LQO A;  5DJL A;  3M8N A;  2DIZ A;  1IYH A;  3E0U A;  2N5B A;  2EIQ A;  3CSJ A;  5D93 A;  1XW5 A;  2AUV A;  2VM1 A;  3O3T A;  2AAW A;  1J08 A;  3L78 A;  3GX8 A;  1R26 A;  4I2T A;  2H8L A;  2YOI A;  1EEJ A;  4J56 E;  4ZBB A;  1LU4 A;  1LBK A;  3AY8 A;  3VFI A;  4V2L A;  2O85 A;  4DSS B;  1EV4 A;  3LEF A;  2FA8 A;  3TJG A;  1TU7 A;  3JCM L;  14GS A;  1YQ1 A;  1WOU A;  1ON4 A;  4QL7 A;  3WT1 A;  2LST A;  1GUM A;  3ERF A;  2OAC A;  3BD2 A;  4QL9 A;  2LV3 A;  2VCT A;  1G7O A;  2H73 A;  5F0G A;  1EOH A;  3QR6 A;  4TR3 A;  1EGR A;  3PGT A;  1G7E A;  2AHE A;  3TUE A;  4MA9 A;  5ECP B;  4YQV A;  5GAN D;  5A5K A;  5J41 A;  3BCI A;  1TI3 A;  3FZ5 A;  2IWT A;  1WMJ A;  2HT9 A;  1GTU A;  10GS A;  3EE2 A;  2HLS A;  3HKR A;  2AB6 A;  5AN1 A;  1XZO A;  4WR5 A;  4EO3 A;  3EWL A;  2XPD A;  4ULX A;  3TRP A;  3H1N A;  3WYW A;  4NAX A;  4G10 A;  3APO A;  3GHA A;  1OAZ A;  5CRH A;  4NV5 A;  2MMO A;  2VLU A;  3FZ9 A;  2V6K A;  4NPB A;  1TK8 B;  3J7Y b;  2BMX A;  1SL1 B;  4KW6 A;  5IMA A;  1N8J A;  1YKC A;  2VO4 A;  2XPE A;  4GST A;  3UAR A;  1Z5Y E;  4L8E A;  2NBS A;  4PXO A;  5D9T A;  1A8L A;  2H1D A;  2V2G A;  1NW2 A;  3LG6 A;  4BA7 A;  2BJX A;  2WFC A;  4E8H A;  2LKU A;  3VPT A;  4EDY A;  3TKP A;  1K3O A;  3FR6 A;  4EXJ A;  2TRX A;  1TRW A;  3ERG A;  3EC3 A;  2JSY A;  2R4V A;  4KDY A;  2GTU A;  1GSY A;  5J5N A;  4MCU A;  5IMF A;  2ON7 A;  5DDL A;  3FY7 A;  2IN3 A;  1GNW A;  3IHQ A;  1TW9 A;  1OKD A;  2IMD A;  2MMN A;  2NPB A;  1F3A A;  3ZML A;  1Y6E A;  1ERW A;  3F4S A;  4MZW A;  3VK9 A;  3DRN A;  1BX9 A;  6GSV A;  1FOV A;  3KTL A;  4MPF A;  4I97 A;  1YF0 A;  1O8W A;  2YNX A;  4LA1 A;  2LJR A;  1GH2 A;  2HYX A;  2DJJ A;  2DIY A;  1V58 A;  2EIR A;  1JFU A;  4KGI A;  3ZFL A;  1F37 A;  2FNO A;  4RUV A;  3U6V A;  1OYJ A;  4ZB6 A;  3FR3 A;  5ECR B;  5D73 A;  3VPQ A;  3HYP A;  3RHB A;  4TXV A;  3S9F A;  4KB3 A;  2K8V A;  3MAK A;  4OCE A;  4YQM A;  2K9F A;  1NM3 A;  2VLT A;  4IQ1 A;  3E9J B;  1B9Y C;  3TJF A;  1GWC A;  1U3I A;  1VRS D;  4BL7 A;  4OFN A;  2OKA A;  1XW6 A;  2X8C A;  3EUR A;  3O76 A;  2CVK A;  2PWJ A;  5KN3 A;  2IMI A;  2WS2 A;  5DJM A;  3EU4 A;  2L59 A;  1EOG A;  3GFK A;  2LUS A;  4IGJ A;  1V57 A;  1GLQ A;  1T3B A;  3SBC A;  4KUN A;  4JBB A;  1K0B A;  17GS A;  3FYG A;  4F2I A;  2YAN A;  1M9B A;  2DBC A;  2HRF A;  1FB0 A;  4NV2 A;  2R2J A;  3GYK A;  2PER A;  4MK3 A;  1TK5 B;  5JWQ B;  2F3M A;  5ENU A;  1WP0 A;  1A2M A;  3ZL5 A;  4DSS A;  4F82 A;  1O8X A;  3Q18 A;  4F0C A;  2GSQ A;  5DAL A;  4O32 A;  1X0R A;  3WGX A;  3QAV A;  3ZLP A;  3UJ1 A;  1X5D A;  4EUY A;  3M1G A;  4TN8 A;  3CSI A;  1TRV A;  2C80 A;  2IMK A;  1SK0 A;  3GIX A;  1Z7R A;  4F03 A;  3FEU A;  1TRU A;  4WBR D;  3H93 A;  1GP1 A;  5LNK e;  1VF4 A;  3GKX A;  5D9X A;  3C73 A;  3HD5 A;  4OFM A;  3Q74 A;  1YEP A;  3KEB A;  3ZMK A;  1USB A;  1X9W B;  2MBS A;  3HVV A;  1XOB A;  1SKS B;  3TDG A;  1ZYE A;  4BWQ A;  1WWJ A;  1JZO A;  1V2A A;  5F07 A;  1MD4 A;  3H4K A;  5D96 A;  1LJR A;  4MH2 A;  1Z3E A;  2I1U A;  4IJI A;  4EDZ A;  5JWO B;  1GTI A;  2REM A;  2GQL A;  2VD0 A;  1K0A A;  3NIV A;  2LNT A;  4TR4 A;  3A2X A;  4FH8 A;  4EC0 A;  3MNG A;  4FIW A;  4IHU A;  2E2M A;  5EY6 A;  1X9S B;  1A8Y A;  5A4U A;  1EZK A;  5IQY A;  12GS A;  4ECJ A;  5ECQ B;  2ZNM A;  3W6G A;  4PUA A;  1SJ6 A;  1S3D A;  4K6X A;  1YZX A;  3D0Z A;  2RM6 A;  3FW2 A;  4DSR A;  4HEA 2;  1UC7 A;  4XS1 A;  4GF0 A;  4K7I A;  4KH7 A;  4K1F A;  5ECM B;  5IM9 A;  1A2L A;  2H01 A;  3EVI A;  2IPA A;  2NDO A;  2A2R A;  4IQA A;  2AJQ B;  4D73 B;  3C71 A;  3RDW A;  1YEX A;  4V2M A;  1ERV A;  1K0O A;  20GS A;  5IOX A;  1YF1 A;  4MZB A;  3D6I A;  4MJB A;  1WJK A;  1XOA A;  2K8S A;  2LRT A;  1JHB A;  2VCV A;  1QGV A;  4EE0 A;  4RQR A;  1VF1 A;  3Q6O A;  5HR0 A;  5ID2 B;  3A2W A;  1QQ2 A;  3KMN A;  1ZZY A;  2FWG A;  1A2J A;  2C0F A;  2WGR A;  3L9S A;  2KUC A;  3UVT A;  2YN1 A;  4H86 A;  1RQM A;  2VD1 A;  2L6D A;  1A24 A;  2P5Q A;  2VOC A;  3VI7 A;  4HU7 A;  2GSS A;  1FB6 A;  3D22 A;  2P0G A;  1GUK A;  4TRX A;  4HQZ A;  8GSS A;  2JAC A;  2WUL A;  3VI5 A;  4F9Z A;  4Z7X A;  2VLV A;  3ZIJ A;  5G5E A;  5IMZ A;  2L4Q A;  2PBJ A;  3G7I A;  1SK1 A;  4WBJ A;  1A0R P;  3L9U A;  5HR1 A;  1K0M A;  4HZ2 A;  4L0W A;  1XIY A;  4TVE A;  2IME A;  2RII A;  4NHW A;  4RQX A;  2LTK A;  3HVS A;  1F9M A;  4GXZ A;  4IP6 A;  3F9U A;  1WRY A;  2XBQ A;  2H74 A;  1CQH A;  1GSF A;  2H1B A;  2YZU A;  3TCO A;  4I8B A;  3QOU A;  3QDN A;  3IK7 A;  4HJM A;  4ECI A;  1UN2 A;  3H8Q A;  3DYR A;  3KGK A;  3LQ7 A;  4IP1 A;  4K2D A;  1GUL A;  1N2A A;  3VWW A;  3F6F A;  3ZRE A;  2KP1 A;  1O73 A;  3Q19 A;  2QC7 A;  4V1A p;  3CYN A;  1PL2 A;  3C7M A;  2R6K A;  3F3R A;  5IMC A;  5CRE A;  4TXO B;  3HJP A;  1BG5 A;  2KHP A;  1PX7 A;  3CRT A;  1M2A A;  3MDK A;  4HS1 A;  4BVY A;  3BJ5 A;  1BED A;  2VCQ A;  3DXB A;  4PNF A;  3A5W A;  3ZVJ A;  4P3Y B;  2RUE A;  4IKH A;  1O6J A;  3GNJ A;  2FLS A;  5INY A;  5AGY A;  4G2E A;  4JE1 A;  3LOR A;  2A4V A;  3GKM A;  4TOP A;  2GLR A;  2JL4 A;  2M46 A;  1X5C A;  2B1K A;  2N5A A;  2VCZ A;  1SKW B;  5FWG A;  5KN0 A;  4KSM A;  2HZE B;  3P90 A;  3ERW A;  3APQ A;  3TJK A;  4V1A g;  2C8U A;  2I81 A;  3ZIT A;  1NHY A;  2PUK C;  2H0G A;  2WDU A;  4Q5F A;  1PSQ A;  2DJ2 A;  4V2N A;  4J2F A;  3I6A A;  3GV1 A;  5G30 A;  1K0C A;  2CZ3 A;  5A4V A;  4POK A;  5IPH A;  4IN0 A;  4WR4 A;  1XWC A;  5DCH A;  4CHS A;  1BAY A;  3HJM A;  4PQ1 A;  2ALB A;  1SL2 B;  1K0D A;  4N0Z A;  1DE2 A;  3KP8 A;  2OBI A;  3DKS A;  3LWA A;  5B8A A;  1GTB A;  1FO5 A;  2OE0 A;  1JZW A;  4IJ3 A;  2CV4 A;  2QKE A;  3PR8 A;  1T1V A;  3TRX A;  18GS A;  4TR1 B;  1B4P A;  2GGT A;  2LRN A;  3LJR A;  4KND A;  1B4Q A;  4J57 E;  3GA4 A;  1GNE A;  4K8M A;  3CTG A;  5EPF A;  2H1A A;  4OO4 A;  2LS5 A;  3ZYW A;  1V98 A;  2RUF A;  2V6O A;  2E2G A;  2CAQ A;  1GSD A;  3LXZ A;  4KCA A;  4GLT A;  2OA7 A;  3GH9 A;  3KIJ A;  3CXG A;  1MDI A;  4D73 A;  3TKR A;  3KTB A;  3K8N A;  2I9H A;  5HFI A;  4ML1 A;  5JCW A;  3KXO A;  4KCE A;  3GX0 A;  3ZIV A;  1ERT A;  4MJA A;  3F6D A;  3TRQ A;  2IFQ B;  1M2B A;  7GSS A;  1W4V A;  1QXH A;  5ID2 A;  3R2Q A;  19GS A;  2ZUP A;  3VUR A;  2IMF A;  5H5S A;  5L71 A;  3ZTL A;  1XBS A;  2CA8 A;  1KBN A;  3N9J A;  3G7J A;  4N0V A;  1XVW A;  2N5F A;  1R5A A;  2L57 A;  1OE8 A;  4TKY A;  3NZN A;  3DML A;  2CVD A;  4AJ7 A;  3LFL A;  2VIM A;  1AAZ A;  1KNG A;  1YKA A;  3E3E A;  5DAK B;  4KE3 A;  1SYX A;  4HZ4 A;  4DSQ A;  4ZIL A;  4LMW A;  5IO0 A;  3FRC A;  3HZ8 A;  1XWA A;  5E59 A;  3KP9 A;  1UVZ A;  5G1K A;  5FT3 A;  1RK4 A;  2L5O A;  3VWU A;  2D2Z A;  3TKS A;  1WPI A;  4MLY A;  2C0E A;  1GSS A;  5ECK B;  2YWM A;  2H76 A;  1M7T A;  5DQY A;  3IAS 2;  4XTS A;  2G0F A;  2CT6 A;  2B6M A;  16GS A;  2H0H A;  3CRU A;  1OC8 A;  4MF5 A;  4DEJ A;  4FYB A;  1NHO A;  5C04 A;  2OAD A;  3L0H A;  1S3A A;  2FWE A;  1G6Y A;  4XRA A;  2TIR A;  4X0X A;  1HNB A;  1TTZ A;  1J9B A;  1TP9 A;  2O8V B;  4EL1 A;  3MWH A;  1FG4 A;  5ECN B;  1EP7 A;  4O92 A;  1Q4J A;  4ZBA A;  3FHK A;  1H4O A;  2FUG 2;  4ILF A;  3KH9 A;  4JRR A;  3GL5 A;  4TXO A;  1OKT A;  2A2S A;  1UA5 A;  3ME8 A;  4IBP A;  4K9Z A;  1PX6 A;  1AUC A;  4FYU A;  3CTF A;  4ZXG A;  5A4W A;  1FW1 A;  3MSZ A;  5HR2 A;  2PPT A;  4G9H A;  3LYK A;  4YQU A;  1SL0 B;  4O5R A;  3IR4 A;  4Q5N A;  5ECO B;  3TKS C;  2XHF A;  1AQX A;  4PX1 A;  3WGE A;  2VL9 A;  5G1L A;  3O6T A;  4GSN A;  1AQV A;  3TKQ A;  1EGO A;  2JZT A;  3ZFB A;  1K3L A;  3CSH A;  1A0F A;  3GKN A;  5HFG A;  4DVC A;  1SJI A;  2B5X A;  3IBH A;  4WKW A;  1XWG A;  2R3X A;  2DML A;  4POM A;  3QMX A;  1DSB A;  4PNG A;  3QCP A;  2OJL A;  4O7H A;  4TR0 A;  3A3T A;  1HNC A;  3PH9 A;  4NWY A;  4X43 A;  4XHM A;  3LSZ A;  3RHC A;  2PGT A;  5JCG A;  3CMI A;  6GSW A;  2PN8 A;  2DJ0 A;  2GQK A;  2H71 A;  2MMZ A;  3DGQ A;  2YP6 A;  5D8I A;  4Q5R A;  5AIS A;  2GT5 A;  2M72 A;  2AV4 A;  1IYI A;  2C1Y A;  3VWX A;  2FA4 A;  1ZCP A;  3TKS E;  1Y25 A;  3DVX A;  2JZS A;  3TB2 A;  1TU8 A;  3D21 A;  2B7K A;  1I5G A;  3TGZ A;  1TK0 B;  1JLV A;  4BPY A;  2KOK A;  1O7U A;  3FK8 A;  2C3Q A;  4YAP A;  4QQ7 A;  2VL2 A;  2FGX A;  2F8A A;  5JCU A;  5ECL B;  2YWI A;  5J4U A;  3KJY A;  3L4N A;  2HRN A;  1SK2 A;  2X99 A;  2HNL A;  3EMX A;  3IXR A;  3FKF A;  4Q5Q A;  3SWL A;  4MDC A;  3GKK A;  4NHZ A;  3BCK A;  1KEB A;  4ACS A;  4E8E A;  1QFN A;  1RW1 A;  4L5L A;  1R4W A;  1PQN A;  2YV9 A;  3P2A A;  3EYT A;  5COH A;  1T00 A;  2IFQ A;  5F06 A;  1SD9 A;  1AW9 A;  4HI7 A;  3QAG A;  2HZF A;  1R7H A;  3VWV A;  3ZVJ D;  4ZL8 A;  4K7O A;  2LJK A;  3ISO A;  4KSO A;  3M9K A;  2H66 A;  2YJH A;  2OBK A;  2IJY A;  3GTU B;  1WE0 A;  2NTO A;  5B7C A;  3DD3 A;  3IDV A;  5IMV A;  2FD3 A;  1XWK A;  4RI7 A;  1FVJ A;  1Z6M A;  2R5G A;  2VL2 C;  2G2Q A;  4YH2 A;  5DAK A;  1FHE A;  3DIE A;  1YY7 A;  4PQI A;  2K18 A;  1ZMA A;  2C0G A;  2C0D A;  4MJC A;  2GZP A;  4XS4 B;  2IL3 A;  3W8J A;  1AIU A;  4GQC A;  1F3B A;  3I43 A;  4L5O A;  2H75 A;  1TOF A;  5J9C A;  1OE7 A;  1VF2 A;  2F8F A;  1XW9 A;  1PA3 A;  2PVO C;  3RPP A;  1HNA A;  3APS A;  4OFT A;  1V9W A;  4OMV A;  3GN3 A;  1SYR A;  4NXI A;  3P7X A;  5F05 A;  1ZOF A;  2JAD A;  2P31 A;  1AQW A;  4WF4 A;  4X1U A;  5ELG A;  1DBY A;  5H5Q A;  3DEX A;  5CAX A;  2H72 A;  5CRW A;  5JWR B;  4ZL7 A;  3IK9 A;  1ZYQ B;  3ZZX A;  2HE3 A;  4WF5 A;  3WGD A;  2LEG A;  2B5E A;  3N5O A;  3UVH A;  1K0N A;  1ERU A;  3F4R A;  5HQP A;  2YWO A;  4ML6 A;  1U88 A;  1GSE A;  1URM A;  4MF7 A;  3UAP A;  4MAB A;  1Z9H A;  3F63 A;  5J3R A;  1T7P B;  3HDC A;  5AIV A;  2MBT A;  3D4T A;  2WRT A;  1H75 A;  2DMM A;  2GDR A;  4L0U A;  3RPN A;  2YWN A;  4KAE A;  1SU9 A;  1PKW A;  2MYG A;  1ZGN A;  5IMD A;  4CW9 A;  5ABR A;  2F51 A;  3LXT A;  1G0T A;  1O85 A;  2GVP A;  5B6N A;  4LMV A;  2LJA A;  5J9B A;  2WCI A;  3C1R A;  2HSH A;  5E4W A;  4N11 A;  1I9D A;  4ID0 A;  4N10 A;  2I4A A;  3M9J A;  1GLP A;  1VGL A;  4TW5 A;  5GST A;  1PL1 A;  1SJZ A;  4XS6 A;  3UMA A;  3U5R E;  1XXU A;  2DC5 A;  1ABA A;  2H6Y A;  1THO A;  1Z6N A;  1PRX A;  1MD3 A;  2FHE A;  4EKZ A;  1GL8 A;  1OC9 B;  2DLX A;  3UBL A;  3H79 A;  5DAL B;  4JED A;  5CP1 A;  2RLI A;  4GRF A;  5KN1 A;  4BWS A;  3WD6 A;  1C72 A;  3ED3 A;  1DE1 A;  3BBY A;  4LLR A;  5IIZ A;  2VCW A;  2KLX A;  3IOS A;  3HXS A;  3QFB C;  1YJ6 A;  4KDX A;  5ECI B;  4ZL9 A;  1TRS A;  4OCF A;  4POB A;  2P5R A;  3J7Y k;  3UEM A;  5ELA A;  2YV7 A;  1MTC A;  4BVX A;  4JU5 A;  1PGT A;  5D9V A;  2V41 A;  2H30 A;  1EP8 A;  4CDO A;  1A23 A;  3EMP A;  2CZ2 A;  2QSI A;  3LGC A;  4PUF C;  1SD8 A;  1HYU A;  4KX4 A;  4ZBD A;  2CVB A;  4OD7 A;  1F6M C;  2XC2 A;  3OR5 A;  4KDU A;  3GUR A;  4MMM A;  3DWV A;  2L6C A;  1EV9 A;  2H70 A; 
#chains in the Genus database with same CATH topology
 2H0I A;  1U6T A;  3V1W A;  2EIO A;  1V40 A;  2GSR A;  1JZR A;  3GTU A;  3IAM 2;  2EC4 A;  3D4M A;  2TRC P;  4JZQ A;  3F3Q A;  1S3C A;  3HHV A;  6GSX A;  2E0Q A;  1GSQ A;  4JR4 A;  1B9X C;  1E2Y A;  1XFL A;  1NSW A;  5G2Z A;  5D9W A;  5GSS A;  1B8X A;  2HSY A;  3GUS A;  2YJ7 A;  1AC1 A;  2VAF A;  4XS4 A;  2V1M A;  2DJK A;  5IPG A;  1MDJ A;  4I5Q A;  3EPT A;  4MJE A;  2DJ1 A;  3EIN A;  3W8S A;  2GZY A;  3QPM A;  3ME7 A;  2FWF A;  4ZB9 A;  1BJX A;  1TI1 A;  1T4Y A;  3CBU A;  2PMT A;  2H1G A;  2O7K A;  2Z9S A;  4MZC A;  3RBT A;  4A5P A;  4YAV A;  2X8G A;  1OC3 A;  5G31 A;  2YCD A;  2FCH A;  4PQH A;  1R5P A;  5LCZ A;  4KA0 A;  2E7P A;  5LD0 A;  2MMA A;  1F2E A;  2H6Z A;  3L9V A;  4Z2U A;  1MEK A;  1M0U A;  2R0G A;  3A2V A;  3IRA A;  2QGV A;  4AJ8 A;  5IOW A;  3KCM A;  3P8W A;  1BQ7 A;  1GSU A;  2C3N A;  1TJD A;  4HUA A;  2DJ3 A;  1MDK A;  2L4C A;  4GWR A;  1CQG A;  1XPV A;  1KTE A;  2GQM A;  4PGT A;  4HOJ A;  3IPZ A;  5CO3 A;  4HDE A;  2ES7 A;  2YPM A;  2WB9 A;  5ECS A;  2HI7 A;  1HQO A;  2B1L A;  2LRC A;  4NMU A;  1X9M B;  1FAA A;  1G6W A;  3I69 A;  2M80 A;  2DSA A;  4WXT A;  4AF2 A;  3WT2 A;  1O81 A;  4XIH A;  2CX3 A;  2WJU A;  4K0G A;  5B8B A;  2B5Y A;  2VL3 A;  2KP2 A;  3KMO A;  3IA1 A;  2PU9 C;  3PIN A;  2ON5 A;  3UOM A;  2DKI A;  3M3M A;  4I6X A;  3KZQ A;  1EWX A;  4GTU A;  2VM2 A;  2FWH A;  5CYY A;  4ZIJ A;  3KH7 A;  2YZH A;  3QAW A;  2VCX A;  6GSY A;  3HZ4 A;  4K5R A;  4IW9 A;  1B48 A;  4I2U A;  5KEJ A;  1QUW A;  5DVB A;  2JZR A;  2CAI A;  4GQF A;  3UBK A;  2CX4 A;  1X5E A;  4FYC A;  2R37 A;  5G5F A;  1WIK A;  1OC9 A;  4LL4 B;  4OO5 A;  2O87 A;  1ZL9 A;  4G19 A;  1PMT A;  2HZE A;  1SKR B;  4HU9 A;  3FR9 A;  22GS A;  5CRD A;  4ECC A;  3EU3 A;  1DUG A;  1K3Y A;  1PN9 A;  5DBQ A;  3HCZ A;  3GSS A;  3I9V 2;  5KN2 A;  4IVF A;  4ISD A;  2LQQ A;  1HD2 A;  2C3T A;  4AGS A;  2NVL A;  3IHG A;  3GST A;  3F4T A;  3GRX A;  4USS A;  2V32 A;  5BMU A;  1QK8 A;  1XVQ A;  2GZZ A;  2J23 A;  2C4J A;  2K6V A;  2B3S A;  3KM6 A;  5F8B A;  3TJJ A;  4TR1 A;  1GRX A;  3QFA C;  1TKD B;  3FZ4 A;  1E6B A;  4G0L A;  3HY2 A;  4MPG A;  3IC4 A;  2WZ9 A;  5ECH B;  2AYT A;  3FZA A;  4K2X A;  2GS3 A;  3F8U A;  5EL8 A;  1QMV A;  2OE1 A;  3KD0 A;  5EVO A;  2XBI A;  2I3Y A;  3GMF A;  3UL3 A;  3HVX A;  2JU5 A;  4LL1 B;  5GZZ B;  2O89 A;  6GSU A;  3LYP A;  1ST9 A;  6GST A;  5H5R A;  5B6M A;  1YDK A;  2HFD A;  3DVW A;  1ACV A;  3HJO A;  1THX A;  1OVN A;  2IIY A;  2CQ9 A;  1FVK A;  5CRG A;  3M0F A;  3C1S A;  4XRD A;  3HA9 A;  1VF3 A;  4GSS A;  1PD2 1;  2X64 A;  5AIX A;  3TJB A;  6GSS A;  4POL A;  2H19 A;  5GAP D;  4MP4 A;  3C8E A;  5DQS A;  4MF6 A;  1SEN A;  3UIW A;  4HJ2 A;  4PUR A;  1EEM A;  5HR3 A;  1XCC A;  2H6X A;  3US3 A;  1U87 A;  4IS0 A;  2LNS A;  1ILO A;  3IE3 A;  4ECB A;  2BTO T;  4EF0 A;  4YKG A;  3RAZ A;  5IO2 A;  1BYE A;  2X8H A;  9GSS A;  3IV4 A;  3G9B A;  3G7Y A;  4EIQ A;  11GS A;  4RI6 A;  4YKF A;  1TXX A;  1JZD A;  4MH3 A;  3GL3 A;  1U3A A;  4XCS A;  3NOF A;  4K0N A;  2RM5 A;  1PKZ A;  2GST A;  1JLW A;  3BOA A;  4HQS A;  3TOU A;  1T4Z A;  4IEL A;  2B7J A;  2F9S A;  3F0I A;  2HXK A;  5C00 A;  1M99 A;  4FO5 A;  2MZC A;  1AXD A;  3D5J A;  2L5L A;  1Q98 A;  3GH6 A;  4GCI A;  2FY6 A;  2A4H A;  2VUP A;  1TDI A;  3ZRD A;  4EVM A;  1M2D A;  5HFK A;  13GS A;  4JR6 A;  2ZCT A;  1Z7P A;  4N30 A;  2OE3 A;  4OWY A;  4F0B A;  3VLN A;  5FHI A;  1GTA A;  1XWB A;  5DCG A;  2JSZ A;  1J0F A;  1M9A A;  4ZB8 A;  2GT6 A;  1ML6 A;  4BL7 B;  4WET A;  3QD9 A;  2J9H A;  4AJ6 A;  2PVQ A;  1GUH A;  1T8E B;  4K7N A;  5CNW A;  1W89 A;  4WEY A;  3TOT A;  2LQO A;  5DJL A;  3M8N A;  2DIZ A;  1IYH A;  3E0U A;  2N5B A;  2EIQ A;  1ZYP A;  3CSJ A;  5D93 A;  1XW5 A;  2AUV A;  4MNN A;  2VM1 A;  3O3T A;  2AAW A;  1J08 A;  3L78 A;  3GX8 A;  1R26 A;  4I2T A;  2H8L A;  2YOI A;  1EEJ A;  4J56 E;  4ZBB A;  1LU4 A;  1LBK A;  3AY8 A;  3VFI A;  4V2L A;  1PN0 A;  2O85 A;  4DSS B;  1EV4 A;  3LEF A;  2FA8 A;  3TJG A;  1TU7 A;  3JCM L;  4CY8 A;  14GS A;  1YQ1 A;  1WOU A;  1ON4 A;  4QL7 A;  3WT1 A;  2LST A;  1GUM A;  3ERF A;  2OAC A;  3BD2 A;  4QL9 A;  2LV3 A;  2VCT A;  1G7O A;  2H73 A;  5F0G A;  1EOH A;  3QR6 A;  4TR3 A;  1EGR A;  3PGT A;  1G7E A;  2AHE A;  3TUE A;  4G0K A;  4MA9 A;  5ECP B;  4YQV A;  5GAN D;  5A5K A;  5J41 A;  3BCI A;  1TI3 A;  3FZ5 A;  2IWT A;  1WMJ A;  2HT9 A;  1GTU A;  10GS A;  3EE2 A;  2HLS A;  3HKR A;  2AB6 A;  5AN1 A;  1XZO A;  4WR5 A;  4EO3 A;  3EWL A;  2XPD A;  4ULX A;  3TRP A;  3H1N A;  3WYW A;  4NAX A;  4G10 A;  3APO A;  3GHA A;  1OAZ A;  5CRH A;  4NV5 A;  2MMO A;  2VLU A;  3FZ9 A;  2V6K A;  4NPB A;  1TK8 B;  3J7Y b;  2BMX A;  1SL1 B;  4KW6 A;  5IMA A;  1N8J A;  1YKC A;  2VO4 A;  2XPE A;  4GST A;  3UAR A;  1Z5Y E;  4L8E A;  2NBS A;  4PXO A;  5D9T A;  1A8L A;  2H1D A;  2V2G A;  1NW2 A;  2X49 A;  3LG6 A;  4BA7 A;  2BJX A;  2WFC A;  4E8H A;  2LKU A;  3VPT A;  4EDY A;  3TKP A;  1K3O A;  3FR6 A;  4EXJ A;  2TRX A;  1TRW A;  3ERG A;  3EC3 A;  2JSY A;  2R4V A;  4KDY A;  2GTU A;  1GSY A;  3HVN A;  5J5N A;  4MCU A;  5IMF A;  2ON7 A;  3FY7 A;  5DDL A;  2IN3 A;  1GNW A;  3IHQ A;  4Z2T A;  1TW9 A;  1OKD A;  2IMD A;  2MMN A;  2NPB A;  1F3A A;  3ZML A;  1Y6E A;  5KOX A;  1ERW A;  3F4S A;  4MZW A;  3VK9 A;  3DRN A;  1BX9 A;  6GSV A;  1FOV A;  3KTL A;  4MPF A;  4I97 A;  3A5I A;  1YF0 A;  1O8W A;  2YNX A;  4LA1 A;  2LJR A;  1GH2 A;  2HYX A;  2DJJ A;  2DIY A;  1V58 A;  2EIR A;  1JFU A;  4KGI A;  3ZFL A;  1F37 A;  2FNO A;  4RUV A;  3U6V A;  1OYJ A;  4ZB6 A;  3FR3 A;  5ECR B;  5D73 A;  3VPQ A;  3HYP A;  3RHB A;  4TXV A;  3S9F A;  4KB3 A;  2K8V A;  3MAK A;  4OCE A;  4YQM A;  2K9F A;  1NM3 A;  2VLT A;  4IQ1 A;  3E9J B;  1B9Y C;  2A2P A;  3TJF A;  1GWC A;  1U3I A;  1VRS D;  4BL7 A;  4OFN A;  2OKA A;  1XW6 A;  2X8C A;  3EUR A;  3O76 A;  2CVK A;  2PWJ A;  5KN3 A;  2IMI A;  2WS2 A;  5DJM A;  3EU4 A;  2L59 A;  1EOG A;  3GFK A;  2LUS A;  4IGJ A;  1V57 A;  1GLQ A;  1T3B A;  3SBC A;  4KUN A;  4JBB A;  1K0B A;  17GS A;  3FYG A;  4F2I A;  2YAN A;  1M9B A;  2DBC A;  2HRF A;  1FB0 A;  4NV2 A;  2R2J A;  3GYK A;  2PER A;  4MK3 A;  1TK5 B;  2R0C A;  5JWQ B;  2F3M A;  5ENU A;  1WP0 A;  1A2M A;  3ZL5 A;  4DSS A;  4F82 A;  1O8X A;  3R3E A;  3Q18 A;  4F0C A;  2GSQ A;  1S3R A;  5DAL A;  4O32 A;  1X0R A;  3WGX A;  3QAV A;  3ZLP A;  3UJ1 A;  1X5D A;  4EUY A;  3M1G A;  4TN8 A;  3CSI A;  1TRV A;  2C80 A;  2IMK A;  1SK0 A;  3GIX A;  1Z7R A;  4F03 A;  3FEU A;  1TRU A;  4WBR D;  3H93 A;  1GP1 A;  3PPU A;  4KF9 A;  2X4A A;  5LNK e;  1VF4 A;  4BVY B;  3LW9 A;  3GKX A;  5D9X A;  3C73 A;  3HD5 A;  4OFM A;  3Q74 A;  1YEP A;  3KEB A;  3ZMK A;  1USB A;  1X9W B;  2MBS A;  3HVV A;  1XOB A;  1SKS B;  3TDG A;  1ZYE A;  4BWQ A;  1WWJ A;  1JZO A;  1V2A A;  5F07 A;  1MD4 A;  3H4K A;  5D96 A;  1LJR A;  4MH2 A;  1Z3E A;  2I1U A;  4IJI A;  4EDZ A;  5JWO B;  1GTI A;  2REM A;  2GQL A;  2VD0 A;  1K0A A;  3NIV A;  2LNT A;  4TR4 A;  3A2X A;  4FH8 A;  4EC0 A;  3MNG A;  4FIW A;  4IHU A;  4BVX B;  2E2M A;  5EY6 A;  1X9S B;  1A8Y A;  5A4U A;  1EZK A;  2HSM A;  5IQY A;  12GS A;  4ECJ A;  5ECQ B;  1ZYN A;  2ZNM A;  3W6G A;  4PUA A;  1SJ6 A;  1S3D A;  4K6X A;  1YZX A;  3D0Z A;  2RM6 A;  3FW2 A;  4DSR A;  4HEA 2;  1UC7 A;  4XS1 A;  4GF0 A;  4K7I A;  4KH7 A;  4K1F A;  5ECM B;  5IM9 A;  1A2L A;  2H01 A;  3EVI A;  2IPA A;  2NDO A;  2A2R A;  4IQA A;  2AJQ B;  4D73 B;  3C71 A;  3RDW A;  1YEX A;  4V2M A;  1ERV A;  1K0O A;  20GS A;  5IOX A;  1YF1 A;  4MZB A;  3D6I A;  4MJB A;  1WJK A;  1XOA A;  2K8S A;  2LRT A;  1JHB A;  2VCV A;  1QGV A;  4EE0 A;  4RQR A;  1VF1 A;  3Q6O A;  5HR0 A;  5ID2 B;  3A2W A;  1QQ2 A;  3KMN A;  1ZZY A;  2FWG A;  1A2J A;  2C0F A;  2WGR A;  3L9S A;  2KUC A;  3UVT A;  2YN1 A;  4H86 A;  1RQM A;  2VD1 A;  4O5U A;  2HRK A;  2L6D A;  1A24 A;  1M3J A;  2P5Q A;  2VOC A;  3VI7 A;  1FOH A;  4HU7 A;  2GSS A;  1FB6 A;  3MYD A;  3D22 A;  2P0G A;  1GUK A;  4TRX A;  4HQZ A;  8GSS A;  2JAC A;  2WUL A;  3VI5 A;  4F9Z A;  4Z7X A;  2VLV A;  3ZIJ A;  5G5E A;  5IMZ A;  2L4Q A;  2PBJ A;  3G7I A;  1SK1 A;  4WBJ A;  1A0R P;  3L9U A;  5HR1 A;  1K0M A;  4HZ2 A;  4L0W A;  1XIY A;  4TVE A;  2IME A;  2RII A;  4NHW A;  4RQX A;  2LTK A;  3HVS A;  1F9M A;  4GXZ A;  4IP6 A;  3F9U A;  1WRY A;  2QA2 A;  2XBQ A;  2H74 A;  1CQH A;  1GSF A;  2H1B A;  2YZU A;  4HSC X;  3TCO A;  4I8B A;  3QOU A;  3QDN A;  3IK7 A;  4HJM A;  4ECI A;  1UN2 A;  3H8Q A;  3DYR A;  3KGK A;  3LQ7 A;  4IP1 A;  4K2D A;  1GUL A;  1N2A A;  4Z2R A;  3VWW A;  3F6F A;  3ZRE A;  2KP1 A;  1O73 A;  3Q19 A;  2QC7 A;  4V1A p;  3CYN A;  1PL2 A;  3C7M A;  2R6K A;  3F3R A;  5IMC A;  5CRE A;  4TXO B;  3HJP A;  1BG5 A;  4FQU A;  2KHP A;  1PX7 A;  3CRT A;  1M2A A;  3MDK A;  4HS1 A;  4BVY A;  3BJ5 A;  1BED A;  2VCQ A;  3DXB A;  4PNF A;  4EIP A;  3A5W A;  4ICY A;  3ZVJ A;  4P3Y B;  2RUE A;  4IKH A;  1O6J A;  3GNJ A;  2FLS A;  5INY A;  5AGY A;  4G2E A;  4JE1 A;  3LOR A;  2A4V A;  3GKM A;  4TOP A;  2GLR A;  2JL4 A;  2M46 A;  1X5C A;  2B1K A;  2N5A A;  2VCZ A;  1SKW B;  5FWG A;  5KN0 A;  4KSM A;  2HZE B;  3P90 A;  3ERW A;  3APQ A;  3TJK A;  4V1A g;  2C8U A;  2I81 A;  3ZIT A;  1NHY A;  2PUK C;  2H0G A;  2WDU A;  4Q5F A;  1PSQ A;  2DJ2 A;  4V2N A;  4J2F A;  3I6A A;  3GV1 A;  5G30 A;  1K0C A;  2CZ3 A;  5A4V A;  4POK A;  5IPH A;  4IN0 A;  4WR4 A;  1XWC A;  5DCH A;  4CHS A;  1BAY A;  3HJM A;  4PQ1 A;  2ALB A;  1SL2 B;  1K0D A;  4N0Z A;  1DE2 A;  3KP8 A;  2OBI A;  3DKS A;  3LWA A;  5B8A A;  1GTB A;  1FO5 A;  2OE0 A;  1JZW A;  4IJ3 A;  2CV4 A;  2QKE A;  3PR8 A;  1T1V A;  3TRX A;  18GS A;  4TR1 B;  1B4P A;  2GGT A;  2LRN A;  3LJR A;  4KND A;  1B4Q A;  4J57 E;  3GA4 A;  1GNE A;  4K8M A;  3CTG A;  5EPF A;  2H1A A;  4OO4 A;  2LS5 A;  3ZYW A;  1V98 A;  2RUF A;  2V6O A;  2E2G A;  2CAQ A;  1GSD A;  3LXZ A;  4KCA A;  4GLT A;  2OA7 A;  3GH9 A;  3KIJ A;  3CXG A;  1MDI A;  4D73 A;  3TKR A;  3KTB A;  3K8N A;  2I9H A;  5HFI A;  4ML1 A;  5JCW A;  3KXO A;  4KCE A;  2QA1 A;  3GX0 A;  1ERT A;  3ZIV A;  4MJA A;  3F6D A;  3TRQ A;  2IFQ B;  1M2B A;  7GSS A;  1W4V A;  1QXH A;  5ID2 A;  3R2Q A;  19GS A;  3MIX A;  2ZUP A;  3VUR A;  2IMF A;  5H5S A;  5L71 A;  3ZTL A;  1XBS A;  2CA8 A;  1KBN A;  3N9J A;  3G7J A;  4N0V A;  1XVW A;  2N5F A;  4PTS A;  1R5A A;  2L57 A;  1OE8 A;  4TKY A;  3NZN A;  3DML A;  2CVD A;  4AJ7 A;  3LFL A;  2VIM A;  1AAZ A;  1KNG A;  1YKA A;  3E3E A;  5DAK B;  4KE3 A;  1SYX A;  4HZ4 A;  4DSQ A;  4ZIL A;  4LMW A;  5IO0 A;  3FRC A;  3HZ8 A;  1XWA A;  5E59 A;  3KP9 A;  1UVZ A;  5G1K A;  5FT3 A;  1RK4 A;  2L5O A;  3VWU A;  2D2Z A;  3CQF A;  3TKS A;  1WPI A;  4MLY A;  2C0E A;  1GSS A;  5ECK B;  2YWM A;  2H76 A;  1M7T A;  5DQY A;  3IAS 2;  4XTS A;  2G0F A;  2CT6 A;  2B6M A;  16GS A;  2H0H A;  3CRU A;  1OC8 A;  4MF5 A;  4DEJ A;  4FYB A;  1NHO A;  5C04 A;  2OAD A;  3L0H A;  1S3A A;  2FWE A;  1G6Y A;  4XRA A;  2TIR A;  4X0X A;  1HNB A;  1TTZ A;  1J9B A;  1TP9 A;  2O8V B;  4EL1 A;  3MWH A;  1FG4 A;  5ECN B;  1EP7 A;  4O92 A;  1Q4J A;  4ZBA A;  3FHK A;  1H4O A;  2FUG 2;  4ILF A;  3KH9 A;  4JRR A;  3GL5 A;  4TXO A;  1OKT A;  2A2S A;  1UA5 A;  3ME8 A;  4IBP A;  4K9Z A;  1PX6 A;  1AUC A;  4FYU A;  3CTF A;  4ZXG A;  5A4W A;  1FW1 A;  3MSZ A;  1M3I A;  5HR2 A;  2PPT A;  4G9H A;  3LYK A;  4YQU A;  1SL0 B;  4O5R A;  3IR4 A;  4Q5N A;  5ECO B;  3TKS C;  2XHF A;  1AQX A;  4PX1 A;  3WGE A;  2VL9 A;  5G1L A;  3O6T A;  4CY6 A;  4GSN A;  1AQV A;  3TKQ A;  1EGO A;  2JZT A;  3ZFB A;  1K3L A;  3CSH A;  1A0F A;  3GKN A;  5HFG A;  4DVC A;  1SJI A;  2B5X A;  3IBH A;  4WKW A;  1XWG A;  2R3X A;  2DML A;  4POM A;  3QMX A;  1DSB A;  4PNG A;  3QCP A;  2OJL A;  4O7H A;  4TR0 A;  3A3T A;  1HNC A;  3PH9 A;  4NWY A;  4X43 A;  4G0I A;  4XHM A;  3LSZ A;  3RHC A;  2PGT A;  5JCG A;  3CMI A;  6GSW A;  2PN8 A;  2DJ0 A;  2HRA A;  2GQK A;  2H71 A;  2MMZ A;  3DGQ A;  2YP6 A;  5D8I A;  4Q5R A;  5AIS A;  2GT5 A;  2M72 A;  2AV4 A;  1IYI A;  2C1Y A;  3VWX A;  2FA4 A;  1ZCP A;  3TKS E;  1Y25 A;  3DVX A;  2JZS A;  3TB2 A;  1TU8 A;  3D21 A;  2B7K A;  5KOW A;  1I5G A;  3TGZ A;  1TK0 B;  4K5S A;  1JLV A;  4BPY A;  2KOK A;  1O7U A;  3FK8 A;  2C3Q A;  4YAP A;  4QQ7 A;  2VL2 A;  2FGX A;  2F8A A;  5JCU A;  5ECL B;  2YWI A;  5J4U A;  3KJY A;  3L4N A;  2HRN A;  1SK2 A;  2X99 A;  2HNL A;  3EMX A;  3IXR A;  3IC8 A;  3FKF A;  4Q5Q A;  3SWL A;  4MDC A;  4X4J A;  3GKK A;  4NHZ A;  3BCK A;  1KEB A;  4ACS A;  4E8E A;  1QFN A;  5BRT A;  1RW1 A;  4L5L A;  1R4W A;  1PQN A;  2YV9 A;  3P2A A;  3EYT A;  5COH A;  1T00 A;  2IFQ A;  5F06 A;  1SD9 A;  1AW9 A;  4HI7 A;  3QAG A;  2HZF A;  1R7H A;  3VWV A;  3ZVJ D;  4ZL8 A;  4K7O A;  2LJK A;  3ISO A;  4KSO A;  3M9K A;  2H66 A;  2YJH A;  2OBK A;  2IJY A;  3GTU B;  1WE0 A;  2NTO A;  1PFO A;  5B7C A;  3DD3 A;  3IDV A;  5IMV A;  2FD3 A;  1XWK A;  4RI7 A;  1FVJ A;  1Z6M A;  2R5G A;  2VL2 C;  2G2Q A;  4YH2 A;  5DAK A;  1FHE A;  3DIE A;  1YY7 A;  4PQI A;  2K18 A;  1ZMA A;  2C0G A;  2C0D A;  4MJC A;  2UZ8 A;  2GZP A;  4XS4 B;  2IL3 A;  3W8J A;  1AIU A;  4GQC A;  1F3B A;  3I43 A;  4L5O A;  2H75 A;  1TOF A;  5J9C A;  1OE7 A;  1VF2 A;  2F8F A;  1XW9 A;  1PA3 A;  2PVO C;  3RPP A;  1HNA A;  3APS A;  4OFT A;  1V9W A;  4OMV A;  3GN3 A;  1SYR A;  4NXI A;  3P7X A;  5F05 A;  1ZOF A;  2JAD A;  2P31 A;  1AQW A;  4WF4 A;  4X1U A;  5ELG A;  1DBY A;  5H5Q A;  3DEX A;  5CAX A;  2H72 A;  5CRW A;  5JWR B;  4ZL7 A;  3IK9 A;  1ZYQ B;  3ZZX A;  2HE3 A;  4WF5 A;  3WGD A;  2LEG A;  2B5E A;  3N5O A;  3UVH A;  1K0N A;  1ERU A;  3F4R A;  5HQP A;  2YWO A;  4ML6 A;  1U88 A;  1GSE A;  1URM A;  4MF7 A;  3UAP A;  4MAB A;  1Z9H A;  3F63 A;  5J3R A;  1T7P B;  3HDC A;  5AIV A;  2MBT A;  3D4T A;  2WRT A;  1H75 A;  2DMM A;  2GDR A;  4L0U A;  3RPN A;  2YWN A;  4KAE A;  1SU9 A;  1PKW A;  2MYG A;  1ZGN A;  5IMD A;  4CW9 A;  5ABR A;  2DKH A;  2F51 A;  3LXT A;  1G0T A;  1O85 A;  2GVP A;  5B6N A;  4LMV A;  2LJA A;  5J9B A;  2WCI A;  3C1R A;  2HSH A;  5E4W A;  4N11 A;  1I9D A;  4ID0 A;  4N10 A;  2I4A A;  3M9J A;  4O5Q A;  1GLP A;  1VGL A;  4TW5 A;  5GST A;  1PL1 A;  1SJZ A;  4XS6 A;  2R0P A;  3UMA A;  4BIK A;  3U5R E;  1XXU A;  2DC5 A;  1ABA A;  2H6Y A;  1THO A;  1Z6N A;  1PRX A;  1MD3 A;  2FHE A;  4EKZ A;  1GL8 A;  1OC9 B;  2DLX A;  3UBL A;  3H79 A;  5DAL B;  4JED A;  5CP1 A;  2RLI A;  4GRF A;  5KN1 A;  4BWS A;  3WD6 A;  1C72 A;  3ED3 A;  1DE1 A;  3BBY A;  4LLR A;  5IIZ A;  2VCW A;  2KLX A;  3IOS A;  3HXS A;  1XG8 A;  3QFB C;  1YJ6 A;  4KDX A;  5ECI B;  4ZL9 A;  1TRS A;  4OCF A;  4POB A;  2P5R A;  3J7Y k;  3UEM A;  5ELA A;  2YV7 A;  1MTC A;  4BVX A;  4JU5 A;  1PGT A;  5D9V A;  2V41 A;  2H30 A;  1EP8 A;  4CDO A;  1A23 A;  3EMP A;  2CZ2 A;  2QSI A;  3LGC A;  4PUF C;  1SD8 A;  1HYU A;  4KX4 A;  4ZBD A;  2CVB A;  4OD7 A;  1F6M C;  2XC2 A;  3OR5 A;  4KDU A;  3FMW A;  3GUR A;  4MMM A;  3DWV A;  2L6C A;  1EV9 A;  2H70 A; 
#chains in the Genus database with same CATH homology
 2H0I A;  1U6T A;  3V1W A;  2EIO A;  1V40 A;  2GSR A;  1JZR A;  3GTU A;  3IAM 2;  2EC4 A;  3D4M A;  2TRC P;  4JZQ A;  3F3Q A;  1S3C A;  3HHV A;  6GSX A;  2E0Q A;  1GSQ A;  4JR4 A;  1B9X C;  1E2Y A;  1XFL A;  1NSW A;  5G2Z A;  5D9W A;  5GSS A;  1B8X A;  2HSY A;  3GUS A;  2YJ7 A;  1AC1 A;  2VAF A;  4XS4 A;  2V1M A;  2DJK A;  5IPG A;  1MDJ A;  4I5Q A;  3EPT A;  4MJE A;  2DJ1 A;  3EIN A;  3W8S A;  2GZY A;  3QPM A;  3ME7 A;  2FWF A;  4ZB9 A;  1BJX A;  1TI1 A;  1T4Y A;  3CBU A;  2PMT A;  2H1G A;  2O7K A;  2Z9S A;  4MZC A;  3RBT A;  4A5P A;  4YAV A;  2X8G A;  1OC3 A;  5G31 A;  2YCD A;  2FCH A;  4PQH A;  1R5P A;  5LCZ A;  4KA0 A;  2E7P A;  5LD0 A;  2MMA A;  1F2E A;  2H6Z A;  3L9V A;  4Z2U A;  1MEK A;  1M0U A;  2R0G A;  3A2V A;  3IRA A;  2QGV A;  4AJ8 A;  5IOW A;  3KCM A;  3P8W A;  1BQ7 A;  1GSU A;  2C3N A;  1TJD A;  4HUA A;  2DJ3 A;  1MDK A;  2L4C A;  4GWR A;  1CQG A;  1XPV A;  1KTE A;  2GQM A;  4PGT A;  4HOJ A;  3IPZ A;  5CO3 A;  4HDE A;  2ES7 A;  2YPM A;  2WB9 A;  5ECS A;  2HI7 A;  1HQO A;  2B1L A;  2LRC A;  4NMU A;  1X9M B;  1FAA A;  1G6W A;  3I69 A;  2M80 A;  2DSA A;  4WXT A;  4AF2 A;  3WT2 A;  1O81 A;  4XIH A;  2CX3 A;  2WJU A;  4K0G A;  5B8B A;  2B5Y A;  2VL3 A;  2KP2 A;  3KMO A;  3IA1 A;  2PU9 C;  3PIN A;  2ON5 A;  3UOM A;  2DKI A;  3M3M A;  4I6X A;  3KZQ A;  1EWX A;  4GTU A;  2VM2 A;  2FWH A;  5CYY A;  4ZIJ A;  3KH7 A;  2YZH A;  3QAW A;  2VCX A;  6GSY A;  3HZ4 A;  4K5R A;  4IW9 A;  1B48 A;  4I2U A;  5KEJ A;  1QUW A;  5DVB A;  2JZR A;  2CAI A;  4GQF A;  3UBK A;  2CX4 A;  1X5E A;  4FYC A;  2R37 A;  5G5F A;  1WIK A;  1OC9 A;  4LL4 B;  4OO5 A;  2O87 A;  1ZL9 A;  4G19 A;  1PMT A;  2HZE A;  1SKR B;  4HU9 A;  3FR9 A;  22GS A;  5CRD A;  4ECC A;  3EU3 A;  1DUG A;  1K3Y A;  1PN9 A;  5DBQ A;  3HCZ A;  3GSS A;  3I9V 2;  5KN2 A;  4IVF A;  4ISD A;  2LQQ A;  1HD2 A;  2C3T A;  4AGS A;  2NVL A;  3IHG A;  3GST A;  3F4T A;  3GRX A;  4USS A;  2V32 A;  5BMU A;  1QK8 A;  1XVQ A;  2GZZ A;  2J23 A;  2C4J A;  2K6V A;  2B3S A;  3KM6 A;  5F8B A;  3TJJ A;  4TR1 A;  1GRX A;  3QFA C;  1TKD B;  3FZ4 A;  1E6B A;  4G0L A;  3HY2 A;  4MPG A;  3IC4 A;  2WZ9 A;  5ECH B;  2AYT A;  3FZA A;  4K2X A;  2GS3 A;  3F8U A;  5EL8 A;  1QMV A;  2OE1 A;  3KD0 A;  5EVO A;  2XBI A;  2I3Y A;  3GMF A;  3UL3 A;  3HVX A;  2JU5 A;  4LL1 B;  5GZZ B;  2O89 A;  6GSU A;  3LYP A;  1ST9 A;  6GST A;  5H5R A;  5B6M A;  1YDK A;  2HFD A;  3DVW A;  1ACV A;  3HJO A;  1THX A;  1OVN A;  2IIY A;  2CQ9 A;  1FVK A;  5CRG A;  3M0F A;  3C1S A;  4XRD A;  3HA9 A;  1VF3 A;  4GSS A;  1PD2 1;  2X64 A;  5AIX A;  3TJB A;  6GSS A;  4POL A;  2H19 A;  5GAP D;  4MP4 A;  3C8E A;  5DQS A;  4MF6 A;  1SEN A;  3UIW A;  4HJ2 A;  4PUR A;  1EEM A;  5HR3 A;  1XCC A;  2H6X A;  3US3 A;  1U87 A;  4IS0 A;  2LNS A;  1ILO A;  3IE3 A;  4ECB A;  2BTO T;  4EF0 A;  4YKG A;  3RAZ A;  5IO2 A;  1BYE A;  2X8H A;  9GSS A;  3IV4 A;  3G9B A;  3G7Y A;  4EIQ A;  11GS A;  4RI6 A;  4YKF A;  1TXX A;  1JZD A;  4MH3 A;  3GL3 A;  1U3A A;  4XCS A;  3NOF A;  4K0N A;  2RM5 A;  1PKZ A;  2GST A;  1JLW A;  3BOA A;  4HQS A;  3TOU A;  1T4Z A;  4IEL A;  2B7J A;  2F9S A;  3F0I A;  2HXK A;  5C00 A;  1M99 A;  4FO5 A;  2MZC A;  1AXD A;  3D5J A;  2L5L A;  1Q98 A;  3GH6 A;  4GCI A;  2FY6 A;  2A4H A;  2VUP A;  1TDI A;  3ZRD A;  4EVM A;  1M2D A;  5HFK A;  13GS A;  4JR6 A;  2ZCT A;  1Z7P A;  4N30 A;  2OE3 A;  4OWY A;  4F0B A;  3VLN A;  5FHI A;  1GTA A;  1XWB A;  5DCG A;  2JSZ A;  1J0F A;  1M9A A;  4ZB8 A;  2GT6 A;  1ML6 A;  4BL7 B;  4WET A;  3QD9 A;  2J9H A;  4AJ6 A;  2PVQ A;  1GUH A;  1T8E B;  4K7N A;  5CNW A;  1W89 A;  4WEY A;  3TOT A;  2LQO A;  5DJL A;  3M8N A;  2DIZ A;  1IYH A;  3E0U A;  2N5B A;  2EIQ A;  1ZYP A;  3CSJ A;  5D93 A;  1XW5 A;  2AUV A;  4MNN A;  2VM1 A;  3O3T A;  2AAW A;  1J08 A;  3L78 A;  3GX8 A;  1R26 A;  4I2T A;  2H8L A;  2YOI A;  1EEJ A;  4J56 E;  4ZBB A;  1LU4 A;  1LBK A;  3AY8 A;  3VFI A;  4V2L A;  1PN0 A;  2O85 A;  4DSS B;  1EV4 A;  3LEF A;  2FA8 A;  3TJG A;  1TU7 A;  3JCM L;  4CY8 A;  14GS A;  1YQ1 A;  1WOU A;  1ON4 A;  4QL7 A;  3WT1 A;  2LST A;  1GUM A;  3ERF A;  2OAC A;  3BD2 A;  4QL9 A;  2LV3 A;  2VCT A;  1G7O A;  2H73 A;  5F0G A;  1EOH A;  3QR6 A;  4TR3 A;  1EGR A;  3PGT A;  1G7E A;  2AHE A;  3TUE A;  4G0K A;  4MA9 A;  5ECP B;  4YQV A;  5GAN D;  5A5K A;  5J41 A;  3BCI A;  1TI3 A;  3FZ5 A;  2IWT A;  1WMJ A;  2HT9 A;  1GTU A;  10GS A;  3EE2 A;  2HLS A;  3HKR A;  2AB6 A;  5AN1 A;  1XZO A;  4WR5 A;  4EO3 A;  3EWL A;  2XPD A;  4ULX A;  3TRP A;  3H1N A;  3WYW A;  4NAX A;  4G10 A;  3APO A;  3GHA A;  1OAZ A;  5CRH A;  4NV5 A;  2MMO A;  2VLU A;  3FZ9 A;  2V6K A;  4NPB A;  1TK8 B;  3J7Y b;  2BMX A;  1SL1 B;  4KW6 A;  5IMA A;  1N8J A;  1YKC A;  2VO4 A;  2XPE A;  4GST A;  3UAR A;  1Z5Y E;  4L8E A;  2NBS A;  4PXO A;  5D9T A;  1A8L A;  2H1D A;  2V2G A;  1NW2 A;  2X49 A;  3LG6 A;  4BA7 A;  2BJX A;  2WFC A;  4E8H A;  2LKU A;  3VPT A;  4EDY A;  3TKP A;  1K3O A;  3FR6 A;  4EXJ A;  2TRX A;  1TRW A;  3ERG A;  3EC3 A;  2JSY A;  2R4V A;  4KDY A;  2GTU A;  1GSY A;  5J5N A;  4MCU A;  5IMF A;  2ON7 A;  3FY7 A;  5DDL A;  2IN3 A;  1GNW A;  3IHQ A;  4Z2T A;  1TW9 A;  1OKD A;  2IMD A;  2MMN A;  2NPB A;  1F3A A;  3ZML A;  1Y6E A;  5KOX A;  1ERW A;  3F4S A;  4MZW A;  3VK9 A;  3DRN A;  1BX9 A;  6GSV A;  1FOV A;  3KTL A;  4MPF A;  4I97 A;  3A5I A;  1YF0 A;  1O8W A;  2YNX A;  4LA1 A;  2LJR A;  1GH2 A;  2HYX A;  2DJJ A;  2DIY A;  1V58 A;  2EIR A;  1JFU A;  4KGI A;  3ZFL A;  1F37 A;  2FNO A;  4RUV A;  3U6V A;  1OYJ A;  4ZB6 A;  3FR3 A;  5ECR B;  5D73 A;  3VPQ A;  3HYP A;  3RHB A;  4TXV A;  3S9F A;  4KB3 A;  2K8V A;  3MAK A;  4OCE A;  4YQM A;  2K9F A;  1NM3 A;  2VLT A;  4IQ1 A;  3E9J B;  1B9Y C;  2A2P A;  3TJF A;  1GWC A;  1U3I A;  1VRS D;  4BL7 A;  4OFN A;  2OKA A;  1XW6 A;  2X8C A;  3EUR A;  3O76 A;  2CVK A;  2PWJ A;  5KN3 A;  2IMI A;  2WS2 A;  5DJM A;  3EU4 A;  2L59 A;  1EOG A;  3GFK A;  2LUS A;  4IGJ A;  1V57 A;  1GLQ A;  1T3B A;  3SBC A;  4KUN A;  4JBB A;  1K0B A;  17GS A;  3FYG A;  4F2I A;  2YAN A;  1M9B A;  2DBC A;  2HRF A;  1FB0 A;  4NV2 A;  2R2J A;  3GYK A;  2PER A;  4MK3 A;  1TK5 B;  2R0C A;  5JWQ B;  2F3M A;  5ENU A;  1WP0 A;  1A2M A;  3ZL5 A;  4DSS A;  4F82 A;  1O8X A;  3R3E A;  3Q18 A;  4F0C A;  2GSQ A;  5DAL A;  4O32 A;  1X0R A;  3WGX A;  3QAV A;  3ZLP A;  3UJ1 A;  1X5D A;  4EUY A;  3M1G A;  4TN8 A;  3CSI A;  1TRV A;  2C80 A;  2IMK A;  1SK0 A;  3GIX A;  1Z7R A;  4F03 A;  3FEU A;  1TRU A;  4WBR D;  3H93 A;  1GP1 A;  3PPU A;  4KF9 A;  2X4A A;  5LNK e;  1VF4 A;  4BVY B;  3LW9 A;  3GKX A;  5D9X A;  3C73 A;  3HD5 A;  4OFM A;  3Q74 A;  1YEP A;  3KEB A;  3ZMK A;  1USB A;  1X9W B;  2MBS A;  3HVV A;  1XOB A;  1SKS B;  3TDG A;  1ZYE A;  4BWQ A;  1WWJ A;  1JZO A;  1V2A A;  5F07 A;  1MD4 A;  3H4K A;  5D96 A;  1LJR A;  4MH2 A;  1Z3E A;  2I1U A;  4IJI A;  4EDZ A;  5JWO B;  1GTI A;  2REM A;  2GQL A;  2VD0 A;  1K0A A;  3NIV A;  2LNT A;  4TR4 A;  3A2X A;  4FH8 A;  4EC0 A;  3MNG A;  4FIW A;  4IHU A;  4BVX B;  2E2M A;  5EY6 A;  1X9S B;  1A8Y A;  5A4U A;  1EZK A;  2HSM A;  5IQY A;  12GS A;  4ECJ A;  5ECQ B;  1ZYN A;  2ZNM A;  3W6G A;  4PUA A;  1SJ6 A;  1S3D A;  4K6X A;  1YZX A;  3D0Z A;  2RM6 A;  3FW2 A;  4DSR A;  4HEA 2;  1UC7 A;  4XS1 A;  4GF0 A;  4K7I A;  4KH7 A;  4K1F A;  5ECM B;  5IM9 A;  1A2L A;  2H01 A;  3EVI A;  2IPA A;  2NDO A;  2A2R A;  4IQA A;  2AJQ B;  4D73 B;  3C71 A;  3RDW A;  1YEX A;  4V2M A;  1ERV A;  1K0O A;  20GS A;  5IOX A;  1YF1 A;  4MZB A;  3D6I A;  4MJB A;  1WJK A;  1XOA A;  2K8S A;  2LRT A;  1JHB A;  2VCV A;  1QGV A;  4EE0 A;  4RQR A;  1VF1 A;  3Q6O A;  5HR0 A;  5ID2 B;  3A2W A;  1QQ2 A;  3KMN A;  1ZZY A;  2FWG A;  1A2J A;  2C0F A;  2WGR A;  3L9S A;  2KUC A;  3UVT A;  2YN1 A;  4H86 A;  1RQM A;  2VD1 A;  4O5U A;  2HRK A;  2L6D A;  1A24 A;  2P5Q A;  2VOC A;  3VI7 A;  1FOH A;  4HU7 A;  2GSS A;  1FB6 A;  3MYD A;  3D22 A;  2P0G A;  1GUK A;  4TRX A;  4HQZ A;  8GSS A;  2JAC A;  2WUL A;  3VI5 A;  4F9Z A;  4Z7X A;  2VLV A;  3ZIJ A;  5G5E A;  5IMZ A;  2L4Q A;  2PBJ A;  3G7I A;  1SK1 A;  4WBJ A;  1A0R P;  3L9U A;  5HR1 A;  1K0M A;  4HZ2 A;  4L0W A;  1XIY A;  4TVE A;  2IME A;  2RII A;  4NHW A;  4RQX A;  2LTK A;  3HVS A;  1F9M A;  4GXZ A;  4IP6 A;  3F9U A;  1WRY A;  2QA2 A;  2XBQ A;  2H74 A;  1CQH A;  1GSF A;  2H1B A;  2YZU A;  3TCO A;  4I8B A;  3QOU A;  3QDN A;  3IK7 A;  4HJM A;  4ECI A;  1UN2 A;  3H8Q A;  3DYR A;  3KGK A;  3LQ7 A;  4IP1 A;  4K2D A;  1GUL A;  1N2A A;  4Z2R A;  3VWW A;  3F6F A;  3ZRE A;  2KP1 A;  1O73 A;  3Q19 A;  2QC7 A;  4V1A p;  3CYN A;  1PL2 A;  3C7M A;  2R6K A;  3F3R A;  5IMC A;  5CRE A;  4TXO B;  3HJP A;  1BG5 A;  4FQU A;  2KHP A;  1PX7 A;  3CRT A;  1M2A A;  3MDK A;  4HS1 A;  4BVY A;  3BJ5 A;  1BED A;  2VCQ A;  3DXB A;  4PNF A;  4EIP A;  3A5W A;  4ICY A;  3ZVJ A;  4P3Y B;  2RUE A;  4IKH A;  1O6J A;  3GNJ A;  2FLS A;  5INY A;  5AGY A;  4G2E A;  4JE1 A;  3LOR A;  2A4V A;  3GKM A;  4TOP A;  2GLR A;  2JL4 A;  2M46 A;  1X5C A;  2B1K A;  2N5A A;  2VCZ A;  1SKW B;  5FWG A;  5KN0 A;  4KSM A;  2HZE B;  3P90 A;  3ERW A;  3APQ A;  3TJK A;  4V1A g;  2C8U A;  2I81 A;  3ZIT A;  1NHY A;  2PUK C;  2H0G A;  2WDU A;  4Q5F A;  1PSQ A;  2DJ2 A;  4V2N A;  4J2F A;  3I6A A;  3GV1 A;  5G30 A;  1K0C A;  2CZ3 A;  5A4V A;  4POK A;  5IPH A;  4IN0 A;  4WR4 A;  1XWC A;  5DCH A;  4CHS A;  1BAY A;  3HJM A;  4PQ1 A;  2ALB A;  1SL2 B;  1K0D A;  4N0Z A;  1DE2 A;  3KP8 A;  2OBI A;  3DKS A;  3LWA A;  5B8A A;  1GTB A;  1FO5 A;  2OE0 A;  1JZW A;  4IJ3 A;  2CV4 A;  2QKE A;  3PR8 A;  1T1V A;  3TRX A;  18GS A;  4TR1 B;  1B4P A;  2GGT A;  2LRN A;  3LJR A;  4KND A;  1B4Q A;  4J57 E;  3GA4 A;  1GNE A;  4K8M A;  3CTG A;  5EPF A;  2H1A A;  4OO4 A;  2LS5 A;  3ZYW A;  1V98 A;  2RUF A;  2V6O A;  2E2G A;  2CAQ A;  1GSD A;  3LXZ A;  4KCA A;  4GLT A;  2OA7 A;  3GH9 A;  3KIJ A;  3CXG A;  1MDI A;  4D73 A;  3TKR A;  3KTB A;  3K8N A;  2I9H A;  5HFI A;  4ML1 A;  5JCW A;  3KXO A;  4KCE A;  2QA1 A;  3GX0 A;  1ERT A;  3ZIV A;  4MJA A;  3F6D A;  3TRQ A;  2IFQ B;  1M2B A;  7GSS A;  1W4V A;  1QXH A;  5ID2 A;  3R2Q A;  19GS A;  3MIX A;  2ZUP A;  3VUR A;  2IMF A;  5H5S A;  5L71 A;  3ZTL A;  1XBS A;  2CA8 A;  1KBN A;  3N9J A;  3G7J A;  4N0V A;  1XVW A;  2N5F A;  4PTS A;  1R5A A;  2L57 A;  1OE8 A;  4TKY A;  3NZN A;  3DML A;  2CVD A;  4AJ7 A;  3LFL A;  2VIM A;  1AAZ A;  1KNG A;  1YKA A;  3E3E A;  5DAK B;  4KE3 A;  1SYX A;  4HZ4 A;  4DSQ A;  4ZIL A;  4LMW A;  5IO0 A;  3FRC A;  3HZ8 A;  1XWA A;  5E59 A;  3KP9 A;  1UVZ A;  5G1K A;  5FT3 A;  1RK4 A;  2L5O A;  3VWU A;  2D2Z A;  3TKS A;  1WPI A;  4MLY A;  2C0E A;  1GSS A;  5ECK B;  2YWM A;  2H76 A;  1M7T A;  5DQY A;  3IAS 2;  4XTS A;  2G0F A;  2CT6 A;  2B6M A;  16GS A;  2H0H A;  3CRU A;  1OC8 A;  4MF5 A;  4DEJ A;  4FYB A;  1NHO A;  5C04 A;  2OAD A;  3L0H A;  1S3A A;  2FWE A;  1G6Y A;  4XRA A;  2TIR A;  4X0X A;  1HNB A;  1TTZ A;  1J9B A;  1TP9 A;  2O8V B;  4EL1 A;  3MWH A;  1FG4 A;  5ECN B;  1EP7 A;  4O92 A;  1Q4J A;  4ZBA A;  3FHK A;  1H4O A;  2FUG 2;  4ILF A;  3KH9 A;  4JRR A;  3GL5 A;  4TXO A;  1OKT A;  2A2S A;  1UA5 A;  3ME8 A;  4IBP A;  4K9Z A;  1PX6 A;  1AUC A;  4FYU A;  3CTF A;  4ZXG A;  5A4W A;  1FW1 A;  3MSZ A;  5HR2 A;  2PPT A;  4G9H A;  3LYK A;  4YQU A;  1SL0 B;  4O5R A;  3IR4 A;  4Q5N A;  5ECO B;  3TKS C;  2XHF A;  1AQX A;  4PX1 A;  3WGE A;  2VL9 A;  5G1L A;  3O6T A;  4CY6 A;  4GSN A;  1AQV A;  3TKQ A;  1EGO A;  2JZT A;  3ZFB A;  1K3L A;  3CSH A;  1A0F A;  3GKN A;  5HFG A;  4DVC A;  1SJI A;  2B5X A;  3IBH A;  4WKW A;  1XWG A;  2R3X A;  2DML A;  4POM A;  3QMX A;  1DSB A;  4PNG A;  3QCP A;  2OJL A;  4O7H A;  4TR0 A;  3A3T A;  1HNC A;  3PH9 A;  4NWY A;  4X43 A;  4G0I A;  4XHM A;  3LSZ A;  3RHC A;  2PGT A;  5JCG A;  3CMI A;  6GSW A;  2PN8 A;  2DJ0 A;  2HRA A;  2GQK A;  2H71 A;  2MMZ A;  3DGQ A;  2YP6 A;  5D8I A;  4Q5R A;  5AIS A;  2GT5 A;  2M72 A;  2AV4 A;  1IYI A;  2C1Y A;  3VWX A;  2FA4 A;  1ZCP A;  3TKS E;  1Y25 A;  3DVX A;  2JZS A;  3TB2 A;  1TU8 A;  3D21 A;  2B7K A;  5KOW A;  1I5G A;  3TGZ A;  1TK0 B;  4K5S A;  1JLV A;  4BPY A;  2KOK A;  1O7U A;  3FK8 A;  2C3Q A;  4YAP A;  4QQ7 A;  2VL2 A;  2FGX A;  2F8A A;  5JCU A;  5ECL B;  2YWI A;  5J4U A;  3KJY A;  3L4N A;  2HRN A;  1SK2 A;  2X99 A;  2HNL A;  3EMX A;  3IXR A;  3IC8 A;  3FKF A;  4Q5Q A;  3SWL A;  4MDC A;  4X4J A;  3GKK A;  4NHZ A;  3BCK A;  1KEB A;  4ACS A;  4E8E A;  1QFN A;  5BRT A;  1RW1 A;  4L5L A;  1R4W A;  1PQN A;  2YV9 A;  3P2A A;  3EYT A;  5COH A;  1T00 A;  2IFQ A;  5F06 A;  1SD9 A;  1AW9 A;  4HI7 A;  3QAG A;  2HZF A;  1R7H A;  3VWV A;  3ZVJ D;  4ZL8 A;  4K7O A;  2LJK A;  3ISO A;  4KSO A;  3M9K A;  2H66 A;  2YJH A;  2OBK A;  2IJY A;  3GTU B;  1WE0 A;  2NTO A;  5B7C A;  3DD3 A;  3IDV A;  5IMV A;  2FD3 A;  1XWK A;  4RI7 A;  1FVJ A;  1Z6M A;  2R5G A;  2VL2 C;  2G2Q A;  4YH2 A;  5DAK A;  1FHE A;  3DIE A;  1YY7 A;  4PQI A;  2K18 A;  1ZMA A;  2C0G A;  2C0D A;  4MJC A;  2UZ8 A;  2GZP A;  4XS4 B;  2IL3 A;  3W8J A;  1AIU A;  4GQC A;  1F3B A;  3I43 A;  4L5O A;  2H75 A;  1TOF A;  5J9C A;  1OE7 A;  1VF2 A;  2F8F A;  1XW9 A;  1PA3 A;  2PVO C;  3RPP A;  1HNA A;  3APS A;  4OFT A;  1V9W A;  4OMV A;  3GN3 A;  1SYR A;  4NXI A;  3P7X A;  5F05 A;  1ZOF A;  2JAD A;  2P31 A;  1AQW A;  4WF4 A;  4X1U A;  5ELG A;  1DBY A;  5H5Q A;  3DEX A;  5CAX A;  2H72 A;  5CRW A;  5JWR B;  4ZL7 A;  3IK9 A;  1ZYQ B;  3ZZX A;  2HE3 A;  4WF5 A;  3WGD A;  2LEG A;  2B5E A;  3N5O A;  3UVH A;  1K0N A;  1ERU A;  3F4R A;  5HQP A;  2YWO A;  4ML6 A;  1U88 A;  1GSE A;  1URM A;  4MF7 A;  3UAP A;  4MAB A;  1Z9H A;  3F63 A;  5J3R A;  1T7P B;  3HDC A;  5AIV A;  2MBT A;  3D4T A;  2WRT A;  1H75 A;  2DMM A;  2GDR A;  4L0U A;  3RPN A;  2YWN A;  4KAE A;  1SU9 A;  1PKW A;  2MYG A;  1ZGN A;  5IMD A;  4CW9 A;  5ABR A;  2DKH A;  2F51 A;  3LXT A;  1G0T A;  1O85 A;  2GVP A;  5B6N A;  4LMV A;  2LJA A;  5J9B A;  2WCI A;  3C1R A;  2HSH A;  5E4W A;  4N11 A;  1I9D A;  4ID0 A;  4N10 A;  2I4A A;  3M9J A;  4O5Q A;  1GLP A;  1VGL A;  4TW5 A;  5GST A;  1PL1 A;  1SJZ A;  4XS6 A;  2R0P A;  3UMA A;  3U5R E;  1XXU A;  2DC5 A;  1ABA A;  2H6Y A;  1THO A;  1Z6N A;  1PRX A;  1MD3 A;  2FHE A;  4EKZ A;  1GL8 A;  1OC9 B;  2DLX A;  3UBL A;  3H79 A;  5DAL B;  4JED A;  5CP1 A;  2RLI A;  4GRF A;  5KN1 A;  4BWS A;  3WD6 A;  1C72 A;  3ED3 A;  1DE1 A;  3BBY A;  4LLR A;  5IIZ A;  2VCW A;  2KLX A;  3IOS A;  3HXS A;  3QFB C;  1YJ6 A;  4KDX A;  5ECI B;  4ZL9 A;  1TRS A;  4OCF A;  4POB A;  2P5R A;  3J7Y k;  3UEM A;  5ELA A;  2YV7 A;  1MTC A;  4BVX A;  4JU5 A;  1PGT A;  5D9V A;  2V41 A;  2H30 A;  1EP8 A;  4CDO A;  1A23 A;  3EMP A;  2CZ2 A;  2QSI A;  3LGC A;  4PUF C;  1SD8 A;  1HYU A;  4KX4 A;  4ZBD A;  2CVB A;  4OD7 A;  1F6M C;  2XC2 A;  3OR5 A;  4KDU A;  3FMW A;  3GUR A;  4MMM A;  3DWV A;  2L6C A;  1EV9 A;  2H70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...