1DXWA

Structure of hetero complex of non structural protein (ns) of hepatitis c virus (hcv) and synthetic peptidic compound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
165
structure length
165
Chain Sequence
b'TGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRASKKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE PROTEASE
publication title Inhibitor Binding Induces Active Site Stabilisation of the Hcv Ns3 Protein Serine Protease Domain
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 22
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2000-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dxwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1dxwA01
5GCHF 1G3CA 1K21H 1L1NA 1O30A 4K8YA 1PQ8A 3PTBA 1MTNB 3URCA 1LHFH 4BTTB 2J9NA 3RM2H 4NA7A 1C2GA 3KCGH 1BRAA 1VJ9U 4PROA 1C4V2 1TMUH 2TGTA 4WMEA 5GXPA 1SGDE 2ZHDA 2I6SA 4X6MA 1QA0A 1C5YB 1BRCE 1TRMA 1NTPA 2XXLA 2A4RA 3DFLA 3H09A 1GBTA 4BOHA 2JETB 1HNEE 1QHRB 1DICA 1TGNA 4ABAA 2AYWA 1NRRH 2HNTC 4DGJA 1P3CA 1DFPA 3LC5A 1TRYA 3OTPA 9ESTA 3T29A 3A86A 4FUHA 5TCAA 2XWBI 1S85A 5GDSH 1O3PB 3A8CA 3K9XB 3TH4H 1GHVH 2ZZUH 1D4PB 4ABGA 2SGAA 1T4UH 2TIOA 2IOTA 1C2LA 2BD5A 2Y81A 3M3VA 1Q31A 1GG6B 1W7XH 1GHWH 3D65E 1UK4A 2JKHA 1LTOA 3SBKA 4B2AA 1G32B 3BTTE 3ZZDA 2AGEX 1C4Y2 1YGCH 2OBQA 3NCLA 3BTWE 5C1YA 1RRKA 1QCPA 3RXMA 3SJKA 1G9IE 3I78A 1O37A 1W8BH 3EDXB 1ELBA 3OY6U 3EAJA 2AIPA 6CHAC 2FS9A 4FUJA 2W7SA 2QCYA 1D6RA 4RKOB 1Y5UT 3V12A 4Y71A 1VGCB 4XE4A 2ZDKA 2FEQH 2KAIB 4MPXA 4KTCA 1XUJA 1GJ4H 1GCTC 4FUCA 2Z94A 1F5KU 3MNXA 4M7GA 3BN9A 3MO6A 4BXWA 4MNXA 4OS7A 1EJAA 4CRBA 2XWAA 2ZFQH 1O3LA 1MU6B 3RXCA 3VB6A 2ZDVH 1C4U2 1O3MA 3RU4D 2RG3A 2B5TB 3SJIA 5DJ7A 1MCTA 3AW1A 2V3OH 1CGJE 3GISB 3UNSA 5DP5A 4KP0A 1HAOH 2PUXB 1S0RA 3SZEA 1RIWC 2OCVB 1P12E 1JIRA 1KLIH 1THPB 3P92A 1S81A 1GPZA 4IMZA 2BDGA 3P8GA 5EU8A 1EAIA 2FX4A 3HKIB 4UEHH 3VFEA 1BBRK 3SGQE 5E0HA 1BTXA 1P03A 3VXEH 4XFQA 1PQ5A 4A1VA 2WPMS 1JRTA 1O3AA 4LK4A 1AHTH 3AW0A 4Y10E 4NGAH 5FPTA 4RI0A 4UD9H 1JWTA 1XMNB 2OINA 1XUHA 1CA8B 1SGFA 2VWLA 4YOGA 4B76A 2PFEA 1TE0A 2D1JA 4R0IA 2WZQA 1GMDF 1HAIH 1K28D 1O2ZA 4X1RU 2P3TB 1O2IA 1C1MA 3AVZA 2PGQB 3UUZA 3LIWA 1MAXA 1HAHH 1C9TA 1NU9A 5SGAE 1SGFG 1Z6JH 2QXJA 3A80A 3SNEA 2BD9A 5C3NA 4OS2A 4INKA 1C5OH 1O2QA 1HCGA 4O3UA 4Z0KA 4ISLA 1H9LB 4BAQB 1KDQA 1LVMA 3IWMA 4ISHH 2BY7X 1G36A 3B23B 3BTEE 2SFAA 5JB8S 1C1RA 3F9FA 5IYTA 5C5OA 3LKWA 1SI5H 5F6MA 1CU1A 4U30A 2ESTE 1TYNA 1AGJA 1SL3A 3W94A 4LXBH 3MFJA 3QK1A 2BD3A 1LO6A 1V2RT 3Q3KA 1DWBH 1PPGE 1CHGA 1T4VH 2BX3A 2ZFTA 4Z6AH 2H5DA 2WYGA 3STJA 1VCQA 1FPCH 5FCRA 4WVPE 1VZQH 1TPPA 3M7QA 4B6EA 1OWHA 1AZ8A 1GBMA 3SJOA 4IC6A 3UQOA 1RJXB 1AB9C 1S83A 3TU7H 1EPTA 3ZYDA 4XBDA 1T31A 1FIWA 2ZO3H 4WJG2 5A0BA 3TH3H 1WOFA 2OD3B 4LZ1H 2BDYA 4ZUHA 1EOLA 1VITH 4KKDA 3PV2A 1C5QA 4WXVA 1O5CB 2GV6A 1PYTC 1L1GA 2GDDA 5CHAB 2OC1A 4H6TA 1W14U 3B8JA 2AMQA 1HXEH 3M37A 1MQ5A 1QFKH 3TJNA 1OP2A 2VWOA 1C2FA 1C2JA 5G4BA 3GDVA 3RXDA 3O8BA 4ZHMU 1LHGH 1J14A 4YESB 5DGJA 3R3GB 2JH0D 4JYUH 2F9BH 1GVKB 2FYQA 2VIDA 1T32A 2NU2E 4Y76A 2XCFA 3T25A 1IQMA 7GCHG 3Q3XA 2ZI2H 3FP6E 4E05H 2BY5X 1EAUA 1ZGVA 2FPZA 5A8ZA 1C1VH 1TBRH 2F3CE 5LPRA 1F7ZA 4X1SU 1J17T 1LKAA 1O3EA 2GZ7A 1V3XA 1FN6A 3BEUA 1FQ3A 2FOCA 1BTHH 1FY5A 4I8HA 5C1XA 1F0SA 3MU0A 3UOPA 4IBLH 4FXGH 2G4TA 3GOVB 2BQ7B 3NUMA 2VIOA 1XVOA 1DT2A 2Z3EA 2G5NA 2SGEE 1HBTH 1HJAB 1MKWH 2FOBA 2BD2A 1MTUA 4CBNA 1QQUA 2A5KA 3TIUA 1GJ5H 1ZOMA 4D9RA 3MU5A 3ZZ4A 4B6FA 1OP8A 1KYNA 2ZDLA 2Y5GA 1MAYA 1UK2A 1Y5BT 4Y79A 1YBWA 3L33A 5A8XA 4UFEH 1C2DA 2P3FH 2C90B 2ZDMA 2ZA5A 3BTGE 1O3FA 3E0PB 2WUCA 2GDEH 2AERH 1LPGB 5EXMA 1TPAE 1P11E 2ALVA 4CRGA 3SU5A 1SLVB 3RXGA 2UUFB 1ZHRA 2I6QA 2FOFA 1W0YH 2VIWA 4X8SH 2C93B 3EYDA 1HAZB 4R8TB 2ANKH 1ZTLA 5ESTE 3TITA 3A82A 1GJ9B 2O9QA 2GKVE 3RXTA 1LQEA 4DOQA 1SVPA 1DWEH 3O8RA 3E91A 1PPEE 5T6DA 2W3IA 4IN1A 4BNRA 3TGJE 3LGVA 2A2QH 4YTAA 4AOQA 1SMFE 1D3TB 2ANWA 1AE5A 4CHAC 1TOCB 8KME2 4JZIA 4NA8A 3FVFB 1QJ7B 1V2WT 1W12U 3U1IB 1MMJN 1RD3B 2EA3A 4ABEA 1P04A 3NXPA 5EOKA 1SLXB 2FESH 4VGCC 1FXYA 1FY8E 2VINA 2WPKS 2CN0H 1WTHD 1IQLA 3SV8A 4JK5A 1GDUA 1OX1A 3K6YA 1GVLA 3NKKA 3MU4A 3MH5A 3ZZ3A 2BDHA 4SGBE 4B73A 1DY9A 6CHAB 1B0EA 1S6FA 2EC9H 2P59A 2WV4A 1CE5A 3TVJB 2CF8H 2ZFSA 1KTSB 1UJ1A 1YPEH 5A0AE 3KNXA 3A88A 1MZAA 1H8DH 1ELTA 3SOSA 1GMHF 1GCTB 1V2ST 3SO3A 4O97A 8GCHG 5EPYA 4IN2A 1BITA 1FDPA 1UVTH 3KGPA 3SV6A 1O2UA 1ZTKA 3H7TA 1AFEH 1GI3A 1KLJH 1TA6A 1A2CH 1KY9A 1VJAU 2BLWA 1GHBF 1BRUP 1IQFA 1HAXB 4K60A 1P9SA 4SGAE 4DIIH 1DPOA 1W11U 4LOYH 2QA9E 1RIWB 1SB1H 1AY6H 4K1EA 1F5RA 4WY3A 4HTCH 1SFQB 2OC8A 2HLCA 2P16A 3LJJA 2Z9KA 1MD8A 1TB6H 1NT1A 5ABWA 1GI4A 9LPRA 2ZQ2A 2A32A 1TNLA 3ZZ7A 1GJAB 3BSQA 1GJBB 5C5NA 3BTFE 1BJVA 1N6YA 2XBVA 3SUGA 1F0RA 4TPYA 3SU1A 3OSYA 1O2KA 4J2YB 2VB0A 3QTOH 3F9GA 1GHYH 4B1TA 2OXSA 1NY22 1LVYA 4I8KA 3E3TA 4FUIA 1UVPA 5AHGH 1T8MA 2EI7A 3TK5A 3A8BA 1DXPA 2A4OA 3KIDU 1SQTA 1O2LA 1O5EH 1ANDA 4MPVA 2BX4A 1CGIE 1GI0A 1YLCA 2FWWA 3QGJA 3UOUA 4OS1A 1P10A 1EOJA 4ZH8A 1O2SA 2FODA 1ZLRA 1HIAA 3SU3A 2BVXH 1UTPA 2NU3E 2GCTC 3LC3A 2VGCC 1HJ8A 2AFQB 1AFQC 1GL0E 1TPOA 3E90B 3SQHE 3PLKA 1NESE 4AGKA 5B6OA 1BIOA 1RXPA 2VU8E 3BTQE 3GDUA 4ZAEA 1SGNE 1HAGE 1C1OA 2YNAA 1NPMA 3SUFA 4H4FA 3U9AH 1PQ7A 3RXHA 1O3KA 2B0FA 5EXLA 1O2NA 1WQVH 5A09A 1P0SH 1C2KA 4I32A 3T5FH 1CT4E 1Q2WA 1AKSB 4CR9A 2ZP0H 3UR9A 1EATA 2PW8H 1EB2A 4B2BA 2J2UA 1A0LA 3MH7A 4HZHA 1V2KT 3P8OA 5DP7A 1FN8A 1P9UA 1WU1A 2J4IA 1MH0A 1PYTD 1S5SA 3WY8A 2ZHFH 3NZIA 3Q00A 1OWEA 3MNCA 3LH3A 5FX6A 2PHBA 1GJCB 2ZCKP 5GWZA 1ACBE 1GBDA 2NU1E 3KQDA 3M5MA 1OSSA 4FU9A 1P2MA 4IGDA 1TX7A 1ZSLA 3UQVA 4MNYA 3BG8A 2TBSA 4CRFA 3FP7E 3GY4A 7ESTE 1GMCG 4FVDA 1G30B 2W3KA 3S9CA 2H5CA 2RCEA 5AF9H 1ZJDA 1MU8B 4YLUA 2XBXA 3LGIA 4DVAU 1SQOA 2GTBA 2QXGA 1HRTH 1ELGA 4ISNA 1GBJA 1HIAB 2BVRH 6GCHG 4GHTA 2ILNA 3BIUH 3ZZCA 2KAIA 3QWCH 1EJMA 3RXVA 1OYQA 1SPJA 4NFFA 2GVFA 3GCTF 1KXBA 3C27B 3SJ9A 1QRZA 4NCYA 1GHZA 1BCUH 1VR1H 4WWYA 1HAVB 1GDQA 1O3OA 1K2I1 1MD7A 4X2WA 3M35A 2D8WA 2BD4A 2WPLS 5BRRE 3RLWH 2WPJS 1K1JA 2HVXA 3ATWA 4X6NA 5A0CA 1NFYA 2SNVA 4E7RG 5B6LA 4X2VA 1C5SA 3T26A 1YP9A 3GYMA 3HPTB 4GCHG 1GBFA 3SNBA 4K3JA 2FOMB 3RXPA 1EX3A 4X8TH 4MVNA 4K5ZA 1LCYA 2K1QA 4D9QA 1IHTH 1AI8H 5E8EH 5H4IB 3RXAA 1IQJA 1C5ZB 1GHXH 3P95A 1TX6A 2Z9JA 1A4WH 4B71A 3NK8A 1CA0C 1YLDA 1QB9A 4NWKA 5E2PA 3ZVFA 1SGQE 1SG8B 1EQ9A 1OWJA 1GBEA 2BZAA 3P17H 3C1KA 1Y3YA 1YF4A 4I8JA 3EA9A 5L6NH 3BG4C 4YO9A 3ZZ5A 1F2SE 2P3UB 1O35A 4UDWH 2BB4A 1TMTH 2DUCA 1QA7A 4X0WU 1F92A 2GX4A 3RU4T 3LH1A 1RS0A 2F9UA 1NFUA 3SGAE 1E35B 3QUMP 1XKBC 1ELDE 3GY8A 1Q3XA 3SU4A 1O3BA 4H42U 4X8VH 1BTZA 3OYPA 1JBUH 2O8WA 2Q6GA 1YCPH 4DT7B 1THSH 2OUAA 1FY1A 4A1TA 1VITF 4LZ4B 3OU0A 1AVGH 1E0FD 4NSVA 1DVAH 3PROA 3SN8A 1V2OT 2PKAB 3V3MA 4CHAB 3BEFB 1UK3A 2PGBB 1LPKB 1V2VT 2GMTC 1FY4A 1YCPM 3MWIU 1O2GH 5LPFA 4I8LA 2JH6D 8LPRA 1TPSA 3A8AA 2C4FH 3RC6A 4VGCB 1TBZH 3F68H 5FBIA 1IOEA 3VEQB 5T6FA 1YPHE 1DOJA 1AO5A 3FAOA 1O3HA 2WPIS 1OWKA 5DP9A 2A7CA 1GGDB 3U1JB 4MG3A 1GHAG 1ELVA 2GZ9A 1N1LA 3JZ1B 1XKAC 3S69A 3STIA 4MNVA 1U6QA 1UCYE 3MNBA 3GDSA 3QGNB 2OQUA 1N8OC 1OP0A 2PSYA 5GIBA 3U8RH 1DSTA 1E37B 1WXRA 5L2ZH 3URDA 1LVOA 2A4GA 5DG6A 3KF2A 1KSNA 1TNKA 4Y8XA 2GT7A 2YOLA 1W2KH 3SQEE 3RC4A 3M36A 1CHOF 4UFFH 2EI6A 1DM4B 4Y6DA 1UTJA 3A7TA 3DA9B 3DD2H 1SGPE 1C1TA 4JZEH 4AYVB 1EXFA 4OM9A 1W0ZU 1EZXC 2XW9A 1XXDA 3RDZA 1KXAA 2Q6DA 1EUFA 3U98H 4M9FA 3MMGA 4ZKRU 5EQRA 1X7AC 2FZZA 3V0XA 5K7RA 3VB7A 1GBLA 2ZPQA 4HGCA 2Z3DA 1CQQA 2NWNA 2J34A 4AB8A 4FUBA 1SOZA 2B8OH 5K0HA 3K65B 2ZEBA 3IG6B 3MI4A 2ASUB 1O0DH 4WF8A 1IQHA 5HM9A 5BPEA 2EEKA 4I7YH 1K1OA 1FY3A 2FOEA 3V13A 1TX8A 1TLDA 1BZXE 2ZECA 3UPEA 1EKBB 1S0QA 2O8TA 3SV2H 4I8GA 3ZVGA 3QZQA 4HFPB 5LGOA 2H9EH 3RXRA 3S7HB 2VIVA 2PV9B 1BJUA 3LOXA 2B9LA 4J1YA 2R3YA 1G3EA 2UWLA 2A0QB 2FOAA 5EG4A 4OGYA 1DS2E 1QJ1B 2FLRH 1Y5AT 1FONA 4ZKOU 3KQBA 5J4SA 4FU7A 4IMQA 3DT0H 1H4WA 1A1RA 4ABBA 1OXGA 1MTVA 2GCTB 1K1MA 3RXKA 2RDLA 2VGCB 1AFQB 2NU4E 1SFIA 1O2MA 4TWWA 1C1SA 2G00A 3A81A 5FCKA 2SGQE 3QO6A 1TIOA 1DY8A 2THFB 4FU8A 2PR3A 3UR6A 1GBCA 4GHQA 3ZZ8A 3A7YA 3K6ZA 4U01A 4A6LA 4ASHA 1FV9A 4ABJA 2VIQA 1UCYH 1QRXA 1OOKB 3MNSA 1HGTH 1KIGH 1C5UA 3ATMA 3RMOH 1M9UA 5JDUB 2A7JA 2ZGHA 2FS8A 1F5LA 1K1LA 1CGHA 2V3HH 3PM3A 2FI3E 1P2QA 1UO6A 3AAUA 1Z8IB 3MOCA 3SORA 3OY5U 3UIRA 1LHCH 2WV5A 3BV9B 3HK3B 4AG1A 2OBOA 4BAMB 3PMHB 1DDJA 1V2TT 1NRSH 2C8XB 2ZGCA 3ENSB 4KTUA 2A5AA 3ESTA 5HMAA 2ZGJA 3RMNH 1BHXF 3TH2H 1ABJH 3DHKH 2STBE 1B5GH 1ARBA 4ABHA 3VGCB 2BLVA 2AMDA 3OX7U 2Z7FE 4GVUA 1NFXA 1P2OA 1Z7KA 1ETTH 1BB0B 2G81E 2BTCE 1C5LH 2G8TA 2XTTB 1RTFB 2ZPSA 3U8TH 3SU6A 2QF3A 1BMNH 1ESAA 1DWCH 1O3DA 3V7TA 4MQAA 2BLQA 3SZNA 5AFZH 1TALA 4UFGH 4RSPA 5ETXA 3ZV9A 1C9PA 1EP5A 2BDBA 2M5TA 2R2MB 2FTLE 2VIPA 1UTKA 1Y3WA 3BTHE 1GMDG 4AB9A 4BAOB 2H2ZA 4TYDA 1HUTH 4BAHB 3GCHC 1AQ7A 1XX9A 1OWIA 2QXHA 4NG9H 1YPKH 4NWLA 2XBWA 2BVSH 4OGXA 2F9PA 5FXLA 2CF9H 2W5EA 3CENA 1SOTA 2ZWLH 2OK5A 1GI8B 1HDTH 1NFWA 1WSSH 5EW2H 4NSYA 3SNCA 1JXPA 1P01A 3RMLH 1A7SA 1ABIH 4B2CA 3KHVA 3PWBA 4F4OC 1BOQA 1CA0B 1MCVA 2P8OC 4Y7AA 4ZXYH 3SW2B 1NO9H 1O2RA 4I33A 1O3GA 2HOBA 1TQ0B 2YNBA 1TGSZ 1G2MA 4Q7YA 3PO1C 4XDEA 1ESBA 1TFXA 1NRNH 1PPBH 3PMAB 1GMCF 2DE8A 3PTNA 3TJUA 4AZ2B 3UWIA 1V2UT 1VCWA 1V2NT 3QLPH 1GGDC 3LONA 1OS8A 3BG4B 5JBCS 5GJ4B 2GV7A 1C2MA 2F9VA 1HXFH 5JBTA 1ETSH 1PPZA 3O8CA 3ZVAA 2FDAA 1QB1A 4Y7BA 4DCDA 5A8YA 5JB9S 3PLPA 1SGEE 2QC2A 4HI3A 4ISOA 4O3TA 1GBIA 1KXDA 2W7UA 3TPIZ 1GI5A 2ZHWH 1J8AA 2CHAC 1ELCA 1NZQH 2QY0B 4OS5A 5DK1A 3LGUA 1MBQA 1MKXH 2XRCA 5C20A 5IDKA 2WYJA 2R0KA 1XVMA 2Z6BD 1V2QT 2G55A 4JMYA 3ZZBA 3EA7A 4DG4A 3ZVBA 2Y82A 4ABDA 2F83A 1K1NA 2WUBA 5FHTA 2QV1A 1TNIA 1G3DA 1O2VA 3KQEA 1QJ6B 2ZTYA 1QL9A 2V6NA 1CBWC 3PMJA 3TJVA 3I29A 1TOMH 3GY6A 1L4ZA 1RGQA 1T8NA 2UWOA 2ZU5A 3AAVA 2VVCA 1YPMH 1AKSA 3GCOA 4OS4A 1DLEA 2GMTB 2RA3A 4UFDH 1AVWA 4X1NU 4BTUB 1BT7A 1QGFA 1Z1IA 1AE8H 1FAXA 7KMEH 1LQDB 2OC0A 5DP6A 3BF6H 4BANB 2BQ6B 3FFGA 3UTUH 5DO4H 1SGIB 4WH6A 2VBCA 4GSOA 2H9TH 2DE9A 3ITIA 1UCYK 3P8FA 2ANYA 2A45B 4GAWA 2PLXA 4IS5A 4DURA 1AMHA 3A7VA 1QTFA 4U2WA 5GPIB 1L2EA 2BZ6H 4MPUA 3R0FA 3UY9A 1N8OB 1W10U 3IITA 1QBNA 3E1XB 3I77A 4CH8B 2ZFRH 3DFJA 1SGRE 2ZC9H 1BTUA 2OQ5A 3PB1E 4Y0YE 3VB3A 3LT3A 1C5TA 5T1VA 1Y3VA 1DSUA 1D3DB 1QNJA 3B9FH 1C5VA 5FPYA 1O2JA 1MBMA 2GGVB 2GT8A 4IC5A 2ALPA 4Y0ZE 3ATKA 3ZVCA 3TGKE 3M5OA 4AFUA 4A1XA 2Y5HA 3LJOA 1HAVA 2IJD1 1A5GH 1GJ6A 3ZYEA 1MKWK 2A2XH 3A7ZA 4YLQH 2IN2A 4AFZA 2STAE 1BBRH 1O34A 1B0FA 1P3EA 2VWNA 3Q77A 2QN5T 1CT0E 1ZRBA 2Z9GA 4DW2U 3SHAH 1Z1JA 1TNGA 1WYKA 3TGIE 1G3BA 3E0NB 2VH6A 2H9HA 2VJ1A 3SI4H 3HGNA 1YPLH 1TNHA 3KEEA 3TNTA 5I46H 1EZUC 4FUGA 1P2JA 2C8YB 2C8ZB 2CJIA 3F9HA 1ZHPA 3TNSA 1S82A 2UUKB 1ELEE 1ZZZA 4JZFH 3UFAA 4XBBA 3HGPA 1O3NA 3LDXH 1FIZA 5AFYH 3A7XA 3RXLA 1BA8B 2FYRA 4YT6H 1O2WA 5E2OA 4K69A 3RXSA 3SV9A 1TA2A 2XYAA 3KQCA 3TJOA 1PPFE 3TLOA 4JZ1A 1Y3UA 1LVBA 3VGCC 1XUIA 2ZCLP 1UHBA 1AWHB 1FMGA 4O9VA 1O39A 4ZROA 4FVBA 5CE1A 2PTCE 1SR5C 1BTYA 4INLA 1EB1H 3PYHA 1KXEA 1NM6A 1EAXA 3ZZAA 3RMMH 4OS6A 3MH6A 3SGBE 1KLTA 5AVDA 1BMMH 1FNIA 2FLBH 1P02A 1E38B 2ZPRA 1HFDA 2Z9LA 1P09A 2ANMH 3SU2A 2WPHS 4H6SB 3PWCA 5DP4A 1EASA 7LPRA 2F9OA 1J15A 2CV3A 3N7OA 1H9IE 1PQAA 2ODYB 1F0TA 3ZZ9A 1V2MT 6LPRA 3QN7A 1C2HA 1E36B 2QAAA 5T3HA 3E8LA 2FOGA 5DPAA 4D8NA 3UWJH 1GMHG 2PKAA 1ARCA 1QIXB 2XBYA 3FANA 4XOJA 3ATIA 5FAHA 1AN1E 1DITH 1LHDH 1HLTH 1H8IH 1UTMA 1C1QA 1TWXB 2XC0A 4CH2B 2BOKA 4Q2KA 1GBAA 1GWAA 1O2PA 1FUJA 2AH4X 2GCHG 3L3TA 2BXUH 2BY9X 4Y8ZA 1MKXK 5HGGA 1GHBG 3LGYA 3QZRA 3A8DA 5JYIA 5L2YH 1O2TA 1H9HE 2QF0A 3SHCH 1HYLA 3UNQA 1GBKA 1O2OA 1DANH 1YPHC 1ZMNA 2XC4A 3A7WA 3BEIB 4GPGA 5GNDA 2FMJA 1UHBB 2FI5E 1TRNA 2ZU3A 3CP7A 4AFQA 2QIQA 4BAKB 1QB6A 2H6MA 3VXFH 2BY8X 5EW1H 5FBEA 2WINI 1O31A 1P2IA 2AIQA 2Q1JA 2FI4E 2V0BA 5F03A 5PTPA 4CRCA 1QR3E 2RA0A 1ZTJA 2XCNA 3RUOA 3T28A 3VPKA 4INHA 2IPHA 3O8DA 1XUGA 3F6UH 2BDIA 4X1PU 2BLOA 2OLGA 1O2HA 1ZPBA 2FTMA 1JMOH 4NA9H 1HB0B 4X2XA 3S0NA 2Y6TA 3S7KB 1NRQH 3NPSA 1C5PA 5HYOA 3SUEA 2P93A 3MO3A 2BM2A 3NWUA 4RN6A 3GCHB 3RXJA 4GLYA 4Q80A 1IQGA 3JZ2B 7GCHF 1YPJH 2ZU1A 3RXUA 3GYLB 5I25A 1TONA 1MQ6A 1NU7B 1AIXH 4NZQA 4YZUA 5CMXH 1S84A 1WQSA 3EE0B 1XM1A 4U32A 1O32A 2ZGXH 3VB4A 3A87A 1SHYA 1P05A 2ZG0H 3M5LA 4NIWA 2ZNKH 1THRH 2CGAA 1FLEE 2HNTF 1ETRH 4NIXA 4JYTA 1KTTB 2BDAA 1A5HA 1LHEH 1K9OE 1WCZA 2C8WB 2D26C 4AORA 4CR5A 2HNTE 1ANCA 2P8OB 1O33A 2Y80A 2HPPH 1ANBA 2EI8A 4TPIZ 1WAYB 4BTIB 1CT2E 1ZJKA 3PO1B 1QBOA 2LPRA 1RTLA 3W95A 1QQ4A 3LPRA 4AN7A 2HWLB 1C5RA 5EODA 2SGDE 1HV7A 3S9AA 2UUJB 2HGTH 4BXSA 1EP6A 1BUIA 1TGBA 2VNTA 1TMBH 1GI6A 2BXTH 1DE7H 2VWMA 2J95A 2QYIA 3H5CB 1F0UA 2ZDAH 2F9NA 2FOHA 1BQYA 2ZKSA 3QDZB 1KXCA 4ZMAH 1D3QB 2BOHB 4Y11E 2TGPZ 4K2YA 4X6PA 2CHAB 5F8ZA 1MTWA 3OTJE 3M61U 3RC5A 1AZZA 2OTVA 2TPIZ 3EA8A 4Q7XA 5C2ZA 1ZSJA 4FUFA 4DJZB 2R0LA 4FUDA 2R9PA 1ZHMA 1ELFA 4CREA 1DX5M 1O5DH 4I31A 2J94A 4WXIA 5GCHG 3SNDA 2WHXA 1ORFA 1HAYB 1LMWB 1MTSA 3U8OH 8ESTE 1WTGH 4XBCA 2HRVA 3MH4A 4A7IB 1IQIA 2P95A 4TY7A 1CBWB 2PTNA 1GI1A 5FX5A 2H1UA 5LH8A 2J38A 1ELAA 1ZR0A 3LGTA 4FUEA 1UVOA 3RXQA 2SNWA 1C5WB 3MHWU 1Z71A 2O8UA 2WV9A 1ZMLA 2CMYA 4MLFB 4AG2A 1EAWA 3GCTG 5EPNA 4Q7ZA 4E7NA 2LNCA 2A7HA 2Q6FA 4KTSA 3P8NA 1BMLA 4JCNA 4ABFA 3SNAA 2JH5D 2NU0E 1Z8JB 2VVUA 4D76A 2O8LA 4ZKNU 1Y8TA 2VVVA 3QTVH 2BD7A 5J4QA 3T62A 1DUEA 2TGAA 5DP3A 2UWPA 1H1BA 1YM0A 4JZDH 1O3IA 1O2YA 1C2EA 1O38A 1QL8A 5DKMA 5C1UA 1TQ7B 1B7XB 2FP7B 1AVXA 4KGAA 4IW4E 5L30H 1O5BB 4E06H 1O36A 8GCHF 1GI9B 3MTYA 2ZHEH 1GI2A 3ZZ6A 1ZPZA 2CXVA 3MU1A 3KN2A 3TK6A 1C1PA 3ODFA 4DIHH 3BTKE 4XSKU 1G37A 2PWXA 2W26A 5F8TA 4WMFA 2G52A 1Z6EA 3E16B 2BYAX 4X2YA 1MTNC 2ZQ1A 4ZKSU 1P57B 1GJ8B 5DP8A 2F91A 2ODPA 3RM0H 3MYWA 4MNWA 2OP9A 2A4QA 1KDQB 1P8VC 2ZDNA 1DXWA 1O5AB 1SGCA 1HJ9A 3RXEA 2G4UA 1AWFH 1QL7A 1IQNA 1NC6A 1SLUB 2BDCA 1SGTA 2AGIX 3PMBB 1YKTA 2JETC 1T8OA 1O3JA 4F49A 2SGFE 3P6ZB 2IJOB 3CS7A 1VITG 1YCPK 1P06A 1Y59T 2A1DB 4WMDA 1O5GH 1W3CA 1JIMA 1P2NA 3RLYH 3ATLA 1GBBA 2BMGB 1SBWA 1QBVH 1VCPA 3T27A 6ESTA 3RXIA 1PPHE 5HM2A 1BRBE 1IQKA 1UVUH 1GG6C 1EPTB 1FZZA 3M7UA 3LGWA 3F9EA 1BTWA 2Z3CA 3A84A 4THNH 3SU0A 1INCA 3KL6A 2PKSB 3G01A 2ZU2A 3SYJA 4YOJA 3A83A 3LU9B 1UMAH 1A61H 5EGMA 4YM9A 2ZFFH 4JYVH 1C1WH 2FO9A 1A0JA 1EZSC 2QGRA 1XUFA 4A5TS 5E0GA 2ZTZA 1TNJA 1VGCC 4ZHAA 1V2JT 1C5NH 1QY6A 2ZU4A 1HAPH 2P94A 1A46H 3M3SA 1S6HA 1UTNA 2GD4B 3ZV8A 5EQQA 3S9BA 3GY7A 4NFEA 1UTLM 4YT7H 1AUTC 1OYTH 2R3UA 2R2WU 1UVSH 3SI3H 1WV7H 3BTDE 3MO9A 1CHOG 1J9CH 1SHHB 1RFNA 2ZGBH 2F4LA 1W13U 3A85A 1Z8RA 1D9IA 2ZTXA 2ZHQH 1IAUA 1A3BH 1ZSKA 4UONA 1L1JA 1HPGA 5EQSA 1WUNH 1RTKA 2AMPA 4QT8C 1UTQA 2Y7XA 4WH8A 2G5VA 1DWDH 4DY7B 4TWYA 5C67A 3CS0A 1ZMJA 2FIRH 3SUDA 4D7GA 1O2XA 1JOUB 1XUKA 1A0HB 1V6DA 1BBRE 6GCHF 1OPHB 3K2UA 1LDTT 2PUQH 3GICB 4O03A 1OWDA 1A5IA 1FJSA 2HPQH 1Y3XA 1BTPA 1CSOE 1TAWA 3D49H 3M7TA 5T6GA 4ABIA 1E34B 3DUXH 2BY6X 1GJ7B 1K22H 5TJXA 3QX5H 1ID5H 3RXFA 1YPGH 1KXFA 2FM2A 3FZDA 1C2IA 3GY5A 2AGGX 1A3EH 1IHSH 4JK6A 4MDSA 4A92A 1ZRKA 3PV4A 2ZF0H 5JPMH 3HATH 1LPZB 4GCHF 2A5IA 4K1SA 4K8BA 1C1UH 3ZVEA 1CVWH 2C3SA 2FXRA 3EQ0H 1J16A 2O8MA 3Q76A 5EXNA 1NS3A 1IQEA 3TK9A 1GJDB 3MU8A 4NIVA 1T7CA 2G51A 3D23A 2GCHF 3AK5A 2TRMA 1QRWA 3PLBA 1TBQH 2BD8A 3ODDA 1D3PB 3U69H 5TCCA 1SQAA 1JRSA 4Y8YA 1UTOA 2XNIA 4CRAA 2GZ8A 4MTBA 2AEIH 1YC0A 3AASA 3E6PH 1L0ZA 4TY6A 5JBBS 5E0JA 3RXOA 3ZVDA 1MUEB 3VB5A 1ZYOA 1K1IA 2BHGA 2A31A 2SGPE 1DLKB 4ESTE 3RU4E 1O3CA 3UNRA 2FX6A 5FPSA 3UREA 4X1QU 1O5FH 1NRPH 1T8LA 1V2LT 3RXBA 1PPCE 3GY3A 3FP8E 5A2MH 1GVZA 4MPWA 4AX9H 4ZXXH 1PFXC 1BDAA 1Z8GA 4X6OA 1CO7E 1NROH 2TGDA 2Y7ZA 4AFSA 1SGYE 3EGKH 1TGCA 4B75A 4NZLA 2V35A 4ISIH 1N6XA 2B7DH 1YYY1 1XXFA 3SJ8A 1TABE 1ESTA 4KELA 1FPHH 1GBHA 1GCDA 2PSXA 3SV7A 4ZHLU 5CHAC 2XC5A 1GL1A 1GDNA 2UUYA 4UE7H 1C1NA 2HALA 2ODQA 3HK6B 2OC7A 1D6WA 1NN6A 3HKJB 4B74A 2D2DA 3RP2A 3M3TA 2ZIQH 1DUAA 3PV5A 3GY2A 4CBOA 1C5MD 1SSXA 1PJPA 2GP9B 4RKJB 3F1SB 1AU8A 2J92A 1MZDA 3A89A 1GI7B 4X8UH 1BMAA 1SC8U 1W7GH 1C5XB 4D7FA 1ZPCA 1L4DA 4AGJA 3D62A 5JBAS 1TGTA 2Y5FA 1SLWB 3ELAH 2VH0A 3BIVH 1P2KA 3L6PA 2Z9IA 1ANEA 3BTME 3M5NA 1GHAF 1AD8H 1ZGIA 1QURH 3FZZA 3P70B 1OKXA 2ZFPH 1G2LA 5ESBA 1WBGB 1EJNA 2AS9A 2ZCHP 1BHXB 2QXIA 2ULLA 1AB9B 3H7OA 2BQWB 3Q3YA 1LKBA 4CRDA 1EPTC 5HXFA 1FAKH 1K1PA 4YOIA 1EZQA 4NIYA 1AUJA 3T2NA 4K1TA 3GCNA 1V2PT 1FI8A 4AYYB 2PKSC 5F8XA 4GUXA 5LPEA 1HJAC
chains in the Genus database with same CATH superfamily
5GCHF 1G3CA 2HVYB 3N7DA 1K21H 1L1NA 1O30A 4K8YA 1PQ8A 3PTBA 1MTNB 3URCA 1LHFH 4BTTB 2J9NA 3RM2H 4NA7A 1C2GA 3KCGH 1BRAA 1VJ9U 4PROA 1C4V2 1TMUH 2TGTA 2YMSC 4WMEA 5GXPA 1SGDE 2ZHDA 2I6SA 4X6MA 1QA0A 1C5YB 1BRCE 1TRMA 1NTPA 2XXLA 2A4RA 3DFLA 3FO8D 5DN6D 1K0HA 3H09A 1GBTA 4BOHA 2JETB 1HNEE 1QHRB 1DICA 1TGNA 4ABAA 2AYWA 1NRRH 2HNTC 4DGJA 1P3CA 1DFPA 3LC5A 2K8IA 1TRYA 3OTPA 9ESTA 3T29A 3A86A 3OAAD 4FUHA 5TCAA 3F2FA 2XWBI 1S85A 5GDSH 1O3PB 3A8CA 3K9XB 3TH4H 1GHVH 2ZZUH 3KQ5A 1D4PB 4ABGA 2SGAA 1T4UH 2TIOA 2IOTA 1C2LA 2BD5A 1NBME 2Y81A 1Q31A 3M3VA 1GG6B 1W7XH 1GHWH 3D65E 1UK4A 2JKHA 1LTOA 3SBKA 4B2AA 1G32B 3BTTE 3ZZDA 2AGEX 1C4Y2 1YGCH 2OBQA 3NCLA 3BTWE 5C1YA 1RRKA 1QCPA 3RXMA 3SJKA 1G9IE 3I78A 2L6OA 3GS9A 1O37A 1W8BH 3EDXB 1ELBA 3OY6U 3EAJA 2AIPA 6CHAC 2FS9A 4FUJA 2W7SA 2QCYA 1D6RA 4RKOB 1Y5UT 3V12A 4Y71A 1VGCB 4XE4A 2ZDKA 3KYFA 2FEQH 2KAIB 2WPDD 4MPXA 2J97A 1XUJA 4KTCA 1GJ4H 1GCTC 4FUCA 2Z94A 1F5KU 3MNXA 4M7GA 3BN9A 3MO6A 4BXWA 4MNXA 4OS7A 1EJAA 4CRBA 2XWAA 2ZFQH 1O3LA 1MU6B 3RXCA 3VB6A 2ZDVH 1C4U2 1O3MA 3RU4D 2RG3A 2B5TB 3SJIA 5DJ7A 1MCTA 3AW1A 2V3OH 1CGJE 3GISB 3UNSA 5DP5A 4KP0A 1HAOH 2PUXB 1S0RA 3SZEA 1RIWC 2OCVB 1P12E 1JIRA 1KLIH 1THPB 3P92A 1S81A 1GPZA 4IMZA 2BDGA 3P8GA 5EU8A 1EAIA 2FX4A 3HKIB 4UEHH 3VFEA 1BBRK 3SGQE 5E0HA 1BTXA 1P03A 3VXEH 4XFQA 1PQ5A 4A1VA 2WPMS 1JRTA 1O3AA 4LK4A 1AHTH 3AW0A 4Y10E 4NGAH 5FPTA 4RI0A 4UD9H 1JWTA 1S6LA 1XMNB 2OINA 1XUHA 1CA8B 1SGFA 2VWLA 4YOGA 4B76A 2PFEA 1TE0A 2D1JA 2WZQA 4R0IA 1GMDF 1HAIH 1K28D 1O2ZA 4X1RU 2P3TB 1O2IA 1C1MA 3AVZA 2PGQB 3UUZA 3LIWA 1MAXA 1HAHH 1C9TA 1NU9A 5SGAE 1SGFG 1Z6JH 2QXJA 3A80A 3SNEA 3WW7A 2BD9A 5HIYA 5C3NA 4OS2A 4INKA 1C5OH 1O2QA 1HCGA 4O3UA 4Z0KA 4ISLA 1H9LB 4BAQB 1KDQA 1LVMA 5KECA 3IWMA 4ISHH 2BY7X 1G36A 3B23B 3BTEE 2SFAA 5JB8S 1C1RA 3F9FA 5IYTA 5C5OA 3LKWA 1SI5H 5F6MA 3MQKC 1CU1A 4U30A 2ESTE 1TYNA 1AGJA 1SL3A 3W94A 4LXBH 3MFJA 3QK1A 2BD3A 1LO6A 1V2RT 3Q3KA 1DWBH 1PPGE 1CHGA 1T4VH 2BX3A 2ZFTA 4Z6AH 2H5DA 2WYGA 3STJA 1VCQA 5KEDA 1FPCH 5FCRA 4WVPE 1VZQH 1TPPA 3M7QA 4B6EA 1OWHA 1AZ8A 1GBMA 3SJOA 4IC6A 3UQOA 1RJXB 1AB9C 1S83A 3TU7H 1EPTA 3ZYDA 4XBDA 1T31A 1FIWA 2ZO3H 4WJG2 5A0BA 3TH3H 1WOFA 2OD3B 4LZ1H 2BDYA 4ZUHA 1EOLA 1VITH 4KKDA 3PV2A 1C5QA 4WXVA 1O5CB 2GV6A 1PYTC 1L1GA 2GDDA 5CHAB 2OC1A 4H6TA 1W14U 3B8JA 2AMQA 2F43B 1HXEH 3M37A 1MQ5A 1QFKH 3TJNA 1OP2A 2VWOA 1C2FA 1C2JA 5G4BA 3GDVA 3RXDA 3O8BA 4ZHMU 3FKSD 1LHGH 1J14A 4YESB 5DGJA 3R3GB 2GJGA 2JH0D 4JYUH 2F9BH 1GVKB 3F0OA 2FYQA 2VIDA 2KZ4A 1T32A 1NBMD 2NU2E 4Y76A 2XCFA 3T25A 1IQMA 7GCHG 3DSPA 3Q3XA 2ZI2H 3FP6E 4E05H 4TT3D 2BY5X 1EAUA 1ZGVA 2FPZA 5A8ZA 1C1VH 1TBRH 2F3CE 2LP6A 5LPRA 1F7ZA 4X1SU 1J17T 1LKAA 1O3EA 2GZ7A 1V3XA 1FN6A 5C17A 3BEUA 1FQ3A 2FOCA 1BTHH 1FY5A 4I8HA 5C1XA 1F0SA 3MU0A 3UOPA 4IBLH 1FX0B 4FXGH 2G4TA 3GOVB 2BQ7B 3EE7A 3NUMA 1COWD 2VIOA 1XVOA 1DT2A 2Z3EA 2G5NA 2SGEE 3OE7D 3W1EA 1HBTH 1HJAB 1MKWH 2FOBA 2BD2A 1MTUA 4CBNA 1QQUA 2A5KA 3TIUA 1GJ5H 1ZOMA 4D9RA 3MU5A 3ZZ4A 4B6FA 1OP8A 1KYNA 2ZDLA 2Y5GA 1MAYA 1UK2A 1Y5BT 4Y79A 1YBWA 3L33A 5A8XA 4UFEH 1C2DA 2P3FH 2C90B 2ZDMA 2ZA5A 3BTGE 1O3FA 3E0PB 2EY4C 2WUCA 2GDEH 2AERH 1LPGB 5EXMA 1TPAE 2YMSB 1P11E 2AHME 2ALVA 3F0PA 4CRGA 3SU5A 1SLVB 3RXGA 2UUFB 1ZHRA 4ACAA 2I6QA 2FOFA 1W0YH 2VIWA 4X8SH 2C93B 3EYDA 1HAZB 4R8TB 2ANKH 1ZTLA 5ESTE 3TITA 3A82A 1GJ9B 2O9QA 2GKVE 3RXTA 1LQEA 4DOQA 1SVPA 1DWEH 3O8RA 3E91A 1PPEE 5T6DA 2W3IA 5EJZA 4IN1A 4BNRA 3TGJE 3LGVA 2A2QH 4YTAA 4AOQA 1SMFE 1D3TB 2ANWA 1AE5A 4CHAC 1TOCB 8KME2 4JZIA 4NA8A 2KM0A 1QJ7B 3FVFB 1V2WT 1W12U 3U1IB 1MMJN 1RD3B 2EA3A 4ABEA 5C0TA 1P04A 3NXPA 5EOKA 1SLXB 2FESH 4VGCC 1FXYA 1FY8E 2VINA 2WPKS 2CN0H 1WTHD 1IQLA 3SV8A 4JK5A 1GDUA 1OX1A 3K6YA 1GVLA 3NKKA 3MU4A 1VKYA 3MH5A 3ZZ3A 2BDHA 4SGBE 4B73A 1DY9A 6CHAB 1B0EA 1S6FA 2EC9H 2P59A 2WV4A 1CE5A 3TVJB 2CF8H 2ZFSA 1KTSB 1UJ1A 1YPEH 5A0AE 3KNXA 3A88A 1MZAA 1H8DH 1ELTA 3SOSA 1GMHF 1GCTB 1V2ST 3SO3A 4O97A 8GCHG 5EPYA 4IN2A 1BITA 1FDPA 1UVTH 3KGPA 3DSGA 3SV6A 1O2UA 1ZTKA 3H7TA 1AFEH 1GI3A 1KLJH 1TA6A 1A2CH 1KY9A 1VJAU 2BLWA 1GHBF 1BRUP 1IQFA 1HAXB 4K60A 1P9SA 4SGAE 4DIIH 1DPOA 1W11U 4LOYH 2QA9E 1RIWB 1SB1H 1AY6H 4K1EA 1F5RA 4WY3A 4HTCH 1SFQB 2OC8A 2HLCA 2P16A 3LJJA 2Z9KA 1MD8A 1TB6H 1NT1A 5ABWA 1GI4A 9LPRA 2ZQ2A 2A32A 1TNLA 3ZZ7A 1GJAB 3BSQA 1GJBB 5C5NA 3BTFE 1BJVA 1N6YA 2XBVA 3SUGA 1F0RA 4TPYA 3SU1A 3OSYA 1O2KA 4J2YB 2VB0A 3QTOH 3F9GA 1GHYH 4B1TA 2OXSA 1NY22 1LVYA 4I8KA 3E3TA 4FUIA 1UVPA 5AHGH 2KX4A 1T8MA 2EI7A 3TK5A 3A8BA 1DXPA 2A4OA 3KIDU 1SQTA 1O2LA 1O5EH 1ANDA 4MPVA 2BX4A 1CGIE 1GI0A 1YLCA 2FWWA 3QGJA 3UOUA 4OS1A 1P10A 1EOJA 4ZH8A 1O2SA 2FODA 1ZLRA 1HIAA 3SU3A 2BVXH 1UTPA 2NU3E 2GCTC 3LC3A 2VGCC 1HJ8A 2AFQB 1AFQC 1GL0E 1TPOA 3E90B 1E1QD 3SQHE 3PLKA 1NESE 4AGKA 5B6OA 1BIOA 1UW7A 1RXPA 2VU8E 3BTQE 3GDUA 4ZAEA 1SGNE 1HAGE 1C1OA 2YNAA 1NPMA 3SUFA 4H4FA 3U9AH 1PQ7A 3RXHA 1O3KA 2B0FA 5EXLA 1O2NA 1WQVH 5A09A 1P0SH 1C2KA 4I32A 3T5FH 1CT4E 1Q2WA 1AKSB 4CR9A 2ZP0H 3UR9A 1EATA 2PW8H 1EB2A 4B2BA 2J2UA 1A0LA 3MH7A 4HZHA 1V2KT 3P8OA 1H8HD 5DP7A 1FN8A 1P9UA 1WU1A 2J4IA 5DSFA 1MH0A 1PYTD 1S5SA 3WY8A 1YWUA 2ZHFH 3NZIA 3Q00A 1OWEA 3MNCA 3LH3A 5FX6A 2PHBA 1GJCB 2ZCKP 5GWZA 1ACBE 1GBDA 2NU1E 3KQDA 3M5MA 1OSSA 4FU9A 1P2MA 4IGDA 1TX7A 1ZSLA 3F3BA 4MNYA 3UQVA 3BG8A 2TBSA 4CRFA 3FP7E 3GY4A 7ESTE 1GMCG 4FVDA 1G30B 2W3KA 3S9CA 2RFKC 1E79D 2H5CA 2RCEA 5AF9H 1ZJDA 1MU8B 4YLUA 2XBXA 3LGIA 4DVAU 1SQOA 2GTBA 2QXGA 1HRTH 1ELGA 4ISNA 1GBJA 1HIAB 2BVRH 6GCHG 4GHTA 2ILNA 3BIUH 3ZZCA 2KAIA 3QWCH 1EJMA 3RXVA 1OYQA 1SPJA 4NFFA 2GVFA 3GCTF 1KXBA 3C27B 3SJ9A 1QRZA 4NCYA 1GHZA 1BCUH 1VR1H 4WWYA 1HAVB 1GDQA 1O3OA 1K2I1 2HLDD 1MD7A 4X2WA 3M35A 2D8WA 2BD4A 2WPLS 5BRRE 3RLWH 2WPJS 1K1JA 2HVXA 2W6JD 3ATWA 4X6NA 5A0CA 1NFYA 2SNVA 4E7RG 3DSOA 5B6LA 4X2VA 1C5SA 3T26A 1YP9A 3GYMA 3HPTB 5EJLA 4GCHG 1GBFA 3SNBA 4K3JA 2FOMB 3RXPA 1EX3A 4X8TH 4Z1MD 4MVNA 4K5ZA 4F48B 1LCYA 2K1QA 4D9QA 1IHTH 1AI8H 1SKYE 5E8EH 5H4IB 3RXAA 1IQJA 1C5ZB 1GHXH 3P95A 1TX6A 2KCOA 1A4WH 2Z9JA 4B71A 3NK8A 1CA0C 1YLDA 1QB9A 4HG6A 4NWKA 5E2PA 1EFRD 3ZVFA 1SGQE 1SG8B 1EQ9A 1OWJA 1GBEA 2BZAA 3P17H 3C1KA 1Y3YA 1YF4A 4I8JA 3EA9A 5L6NH 3BG4C 4YO9A 3ZZ5A 1F2SE 2P3UB 1O35A 4UDWH 2BB4A 1TMTH 2DUCA 1QA7A 4X0WU 1F92A 2GX4A 3RU4T 3LH1A 1RS0A 2F9UA 1NFUA 3SGAE 1E35B 3QUMP 1XKBC 1ELDE 3GY8A 1Q3XA 3SU4A 1O3BA 1YLNA 4H42U 4X8VH 1BTZA 3OYPA 1JBUH 2O8WA 2Q6GA 1YCPH 4DT7B 1THSH 2OUAA 1FY1A 4A1TA 1VITF 4LZ4B 3OU0A 1AVGH 1E0FD 3U28C 4NSVA 1DVAH 3PROA 3SN8A 1V2OT 2PKAB 3V3MA 4CHAB 3BEFB 1UK3A 2PGBB 1LPKB 1V2VT 1E1RD 2GMTC 1FY4A 1W0KD 1YCPM 3MWIU 1O2GH 3VG8A 5LPFA 4XD7D 4I8LA 2JH6D 8LPRA 1TPSA 3A8AA 2C4FH 3RC6A 4VGCB 1TBZH 3F68H 5FBIA 1IOEA 3VEQB 5T6FA 1YPHE 1DOJA 1AO5A 3FAOA 3OEHD 1O3HA 2WPIS 1OWKA 5DP9A 2A7CA 1GGDB 3U1JB 4MG3A 1GHAG 1ELVA 2GZ9A 1N1LA 3JZ1B 1XKAC 3S69A 3STIA 4MNVA 1U6QA 1UCYE 3MNBA 3GDSA 3QGNB 2OQUA 1N8OC 1OP0A 2PSYA 5GIBA 3U8RH 1DSTA 1E37B 1WXRA 5L2ZH 3URDA 1LVOA 3ZIAD 2A4GA 5DG6A 3KF2A 1KSNA 1TNKA 4Y8XA 2GT7A 2YOLA 1W2KH 5IK2D 3SQEE 3RC4A 3M36A 1CHOF 2M2AA 4UFFH 2EI6A 1DM4B 4Y6DA 1UTJA 3A7TA 3DA9B 3DD2H 1SGPE 1C1TA 4JZEH 4AYVB 1EXFA 4OM9A 1W0ZU 1EZXC 2XW9A 1XXDA 3RDZA 1KXAA 2Q6DA 1EUFA 3U98H 4M9FA 3MMGA 4ZKRU 5EQRA 1X7AC 2FZZA 3V0XA 4TSFD 5K7RA 3VB7A 1GBLA 2ZPQA 4HGCA 2Z3DA 1CQQA 2NWNA 2J34A 4AB8A 4YXWD 4FUBA 1SOZA 2B8OH 2EQNA 5K0HA 3K65B 2ZEBA 3IG6B 3MI4A 2ASUB 1O0DH 4WF8A 1IQHA 5HM9A 5BPEA 2EEKA 4I7YH 1K1OA 1FY3A 2FOEA 3V13A 1TX8A 1TLDA 1BZXE 2ZECA 3UPEA 1EKBB 1S0QA 2O8TA 3SV2H 4I8GA 3ZVGA 3QZQA 4HFPB 5LGOA 2H9EH 3RXRA 3S7HB 2VIVA 2PV9B 1BJUA 3LOXA 2B9LA 4J1YA 2R3YA 1G3EA 2UWLA 2A0QB 2FOAA 5EG4A 4OGYA 1DS2E 1QJ1B 2FLRH 1Y5AT 1FONA 4ZKOU 3KQBA 5J4SA 4FU7A 4IMQA 3DT0H 1H4WA 1A1RA 4ABBA 1OXGA 1MTVA 2GCTB 1K1MA 3RXKA 2RDLA 2VGCB 1AFQB 2NU4E 4P02A 1SFIA 3KYGA 1O2MA 4TWWA 1C1SA 2G00A 3A81A 5FCKA 2SGQE 3QO6A 1TIOA 1DY8A 2THFB 2PP6A 4FU8A 2PR3A 3UR6A 1GBCA 4GHQA 3ZZ8A 3A7YA 3K6ZA 4U01A 4A6LA 4ASHA 1FV9A 4ABJA 2VIQA 1UCYH 1QRXA 1OOKB 2QF5A 3MNSA 1HGTH 1KIGH 1C5UA 3ATMA 3RMOH 1M9UA 5JDUB 2A7JA 2ZGHA 2FS8A 1F5LA 1K1LA 1CGHA 2V3HH 3PM3A 2FI3E 1P2QA 1UO6A 3AAUA 1Z8IB 3MOCA 3SORA 3OY5U 3UIRA 1LHCH 2XNDD 2WV5A 3BV9B 3HK3B 4AG1A 2OBOA 4BAMB 3PMHB 1DDJA 1V2TT 1NRSH 2C8XB 2ZGCA 3ENSB 4KTUA 2A5AA 3ESTA 5HMAA 2ZGJA 3RMNH 1BHXF 2JIZD 3TH2H 1ABJH 3DHKH 2STBE 1B5GH 1ARBA 4ABHA 2XOKD 3VGCB 2BLVA 2AMDA 3OX7U 2Z7FE 4GVUA 1NFXA 1YY3A 1P2OA 1Z7KA 1ETTH 1BB0B 2G81E 2BTCE 1C5LH 2G8TA 4AC9A 2XTTB 1RTFB 2ZPSA 3U8TH 3SU6A 2QF3A 1BMNH 1ESAA 1DWCH 1O3DA 2J98B 3V7TA 4MQAA 2BLQA 3SZNA 5AFZH 1TALA 4UFGH 4RSPA 5ETXA 3ZV9A 1C9PA 1EP5A 2BDBA 2M5TA 2R2MB 2FTLE 2VIPA 1UTKA 1Y3WA 3BTHE 1GMDG 4AB9A 4BAOB 2H2ZA 4TYDA 1HUTH 4BAHB 3GCHC 1AQ7A 1XX9A 1OWIA 2QXHA 3OEED 4NG9H 1YPKH 4NWLA 4ZCNA 2XBWA 2BVSH 4OGXA 3F2GA 2F9PA 5FXLA 2CF9H 2W5EA 3CENA 1SOTA 2ZWLH 2OK5A 1GI8B 1HDTH 1NFWA 1WSSH 1H8ED 5EW2H 4NSYA 3SNCA 1JXPA 1P01A 3RMLH 1A7SA 1ABIH 4B2CA 3KHVA 3PWBA 4F4OC 1BOQA 1CA0B 1MCVA 2P8OC 4Y7AA 4ZXYH 3SW2B 1NO9H 1O2RA 4I33A 1O3GA 2HOBA 1TQ0B 2YNBA 1TGSZ 1G2MA 4Q7YA 3PO1C 4XDEA 1ESBA 1TFXA 1NRNH 1PPBH 3PMAB 1GMCF 2DE8A 3PTNA 3TJUA 4AZ2B 3UWIA 3N99A 1V2UT 1VCWA 1V2NT 3QLPH 1GGDC 3LONA 1OS8A 3BG4B 5JBCS 5GJ4B 2GV7A 1C2MA 2F9VA 1HXFH 5JBTA 1ETSH 1PPZA 3O8CA 3ZVAA 2FDAA 1QB1A 4Y7BA 4DCDA 5A8YA 5JB9S 3PLPA 1SGEE 1OHHD 2QC2A 4HI3A 4ISOA 4O3TA 1GBIA 3WWFA 1KXDA 2W7UA 3TPIZ 1GI5A 2ZHWH 1J8AA 2CHAC 1ELCA 1NZQH 2QY0B 4OS5A 5DK1A 3LGUA 1MBQA 1MKXH 2XRCA 5C20A 5IDKA 2WYJA 2R0KA 3NRLA 1XVMA 2Z6BD 1V2QT 2G55A 4JMYA 3ZZBA 3EA7A 4DG4A 3ZVBA 2Y82A 4ABDA 2F83A 1K1NA 2WUBA 5FHTA 2QV1A 1TNIA 1G3DA 1O2VA 3KQEA 1QJ6B 2ZTYA 1QL9A 5EIYA 2V6NA 1CBWC 3PMJA 3TJVA 3I29A 1TOMH 3GY6A 1L4ZA 1RGQA 1T8NA 2UWOA 2ZU5A 3AAVA 1SQRA 2VVCA 1YPMH 1AKSA 3GCOA 4OS4A 1DLEA 2GMTB 2RA3A 4UFDH 1AVWA 4X1NU 4BTUB 1BT7A 1QGFA 1Z1IA 2W6ID 1AE8H 1FAXA 7KMEH 4Q4LA 1LQDB 2OC0A 5DP6A 3BF6H 4BANB 2BQ6B 3FFGA 3F2HA 3UTUH 5DO4H 1SGIB 4WH6A 2VBCA 4GSOA 2H9TH 2DE9A 3ITIA 4RT0A 1UCYK 2KFWA 2ANYA 3P8FA 2A45B 4GAWA 2PLXA 4IS5A 4DURA 1AMHA 3A7VA 1QTFA 2KR7A 4U2WA 5GPIB 1L2EA 2BZ6H 4MPUA 3R0FA 3UY9A 1N8OB 1W10U 3IITA 1QBNA 3E1XB 3I77A 4CH8B 2ZFRH 3DFJA 1SGRE 5CHBA 2ZC9H 1BTUA 2OQ5A 3PB1E 4Y0YE 3VB3A 3LT3A 1C5TA 5T1VA 1Y3VA 1DSUA 1D3DB 1QNJA 3B9FH 1C5VA 5FPYA 1O2JA 1MBMA 2GGVB 2GT8A 4IC5A 2ALPA 4Y0ZE 3ATKA 3ZVCA 3TGKE 3M5OA 4AFUA 4A1XA 2Y5HA 2LELA 3LJOA 1HAVA 2IJD1 1A5GH 1GJ6A 3ZYEA 1MKWK 2A2XH 4Q63A 3A7ZA 4YLQH 2IN2A 4AFZA 2STAE 1BBRH 1O34A 1B0FA 1P3EA 2VWNA 3Q77A 2QN5T 5FL7D 1CT0E 1ZRBA 2Z9GA 4DW2U 3SHAH 1Z1JA 1TNGA 1WYKA 3TGIE 1G3BA 3E0NB 2VH6A 2H9HA 2VJ1A 3SI4H 3HGNA 1YPLH 1TNHA 3KEEA 3TNTA 5I46H 1EZUC 4FUGA 1P2JA 2C8YB 2C8ZB 2CJIA 3F9HA 1ZHPA 5C94A 3TNSA 1S82A 2UUKB 1ELEE 1ZZZA 4JZFH 3UFAA 4XBBA 3HGPA 1O3NA 3LDXH 1FIZA 5AFYH 3A7XA 3RXLA 1BA8B 2K0QA 2FYRA 4YT6H 1O2WA 5E2OA 3FOAA 4K69A 3RXSA 3SV9A 1TA2A 2XYAA 3KQCA 3TJOA 1PPFE 3TLOA 4JZ1A 1Y3UA 1LVBA 3VGCC 1XUIA 2ZCLP 1UHBA 1AWHB 1FMGA 4O9VA 1O39A 4ZROA 4FVBA 5CE1A 2PTCE 1SR5C 1BTYA 4INLA 1EB1H 3PYHA 1KXEA 1NM6A 1EAXA 3ZZAA 3RMMH 4OS6A 3MH6A 3SGBE 1KLTA 5AVDA 1BMMH 1FNIA 2FLBH 1P02A 1E38B 2ZPRA 1HFDA 2Z9LA 4DT4A 1P09A 5CDFE 2ANMH 3SU2A 2WPHS 4H6SB 3PWCA 5DP4A 1EASA 2CK3D 7LPRA 2F9OA 1J15A 2CV3A 3N7OA 1H9IE 1PQAA 2ODYB 1F0TA 3ZZ9A 1V2MT 6LPRA 3QN7A 1C2HA 1E36B 5F53A 2QAAA 5T3HA 3E8LA 1W0JD 2FOGA 5DPAA 4D8NA 3UWJH 1GMHG 1ARCA 1QIXB 2PKAA 2XBYA 3FANA 4XOJA 3ATIA 5FAHA 1AN1E 1DITH 1LHDH 4RT1A 1HLTH 1H8IH 1UTMA 1C1QA 1TWXB 2XC0A 4CH2B 2BOKA 4Q2KA 1GBAA 1GWAA 1O2PA 1FUJA 2AH4X 2GCHG 3L3TA 2BXUH 2BY9X 4Y8ZA 1MKXK 5HGGA 3WWBA 1GHBG 3LGYA 3QZRA 3A8DA 5JYIA 5L2YH 1O2TA 1H9HE 2QF0A 3SHCH 1HYLA 3UNQA 1GBKA 1O2OA 1DANH 1YPHC 1ZMNA 2XC4A 3A7WA 3BEIB 4GPGA 5GNDA 2FMJA 1UHBB 2FI5E 1TRNA 2ZU3A 3CP7A 4AFQA 2QIQA 4BAKB 1QB6A 2H6MA 3VXFH 2BY8X 5EW1H 5FBEA 2WINI 3CNRA 1O31A 1P2IA 3DCLA 2AIQA 2Q1JA 2FI4E 2V0BA 5F03A 5PTPA 4CRCA 1QR3E 2RA0A 1ZTJA 2XCNA 3RUOA 3T28A 3VPKA 4INHA 2IPHA 2V3MA 3O8DA 2QF4A 1XUGA 3F6UH 2BDIA 4X1PU 2BLOA 2OLGA 2L74A 1O2HA 1ZPBA 2FTMA 1JMOH 4NA9H 1HB0B 4X2XA 3S0NA 2Y6TA 3S7KB 1BMFD 1NRQH 3NPSA 1C5PA 5HYOA 3SUEA 2P93A 3MO3A 2BM2A 3NWUA 4RN6A 3GCHB 3RXJA 4GLYA 4Q80A 1IQGA 3JZ2B 7GCHF 1MABB 1YPJH 2ZU1A 3RXUA 3GYLB 4ASUD 5I25A 1TONA 1MQ6A 1NU7B 1AIXH 4NZQA 4YZUA 5CMXH 1S84A 1WQSA 3EE0B 1XM1A 4U32A 1O32A 2ZGXH 3VB4A 3A87A 1SHYA 1P05A 2ZG0H 3M5LA 4NIWA 2ZNKH 1THRH 2CGAA 1FLEE 2HNTF 4P00A 1ETRH 4NIXA 4JYTA 1KTTB 2BDAA 1A5HA 1LHEH 1K9OE 1WCZA 2C8WB 2D26C 4AORA 4CR5A 2HNTE 1ANCA 2P8OB 1O33A 2Y80A 2HPPH 1ANBA 2EI8A 4TPIZ 1WAYB 4BTIB 5HKKD 1CT2E 1ZJKA 3PO1B 1QBOA 2LPRA 1RTLA 3W95A 1QQ4A 3LPRA 2KCYA 4AN7A 2HWLB 1C5RA 5EODA 2SGDE 1HV7A 3S9AA 5C0UA 2UUJB 2HGTH 4BXSA 1EP6A 1BUIA 1TGBA 2VNTA 1TMBH 1GI6A 2BXTH 1DE7H 2VWMA 2J95A 2QYIA 3H5CB 1F0UA 2ZDAH 2F9NA 2FOHA 1BQYA 2ZKSA 2WSSD 3QDZB 1KXCA 4ZMAH 1D3QB 2BOHB 4Y11E 2TGPZ 4K2YA 4X6PA 2CHAB 5F8ZA 1MTWA 3OTJE 3M61U 3RC5A 1AZZA 2OTVA 2TPIZ 3EA8A 4Q7XA 5C2ZA 1ZSJA 4FUFA 4DJZB 2R0LA 4FUDA 2R9PA 1ZHMA 1ELFA 4CREA 1DX5M 1O5DH 4I31A 2J94A 4WXIA 5GCHG 3SNDA 2WHXA 1ORFA 1HAYB 1LMWB 1MTSA 3U8OH 8ESTE 1WTGH 4XBCA 2HRVA 3MH4A 3UAIC 4A7IB 1IQIA 2P95A 4TY7A 1CBWB 2PTNA 1GI1A 5FX5A 2H1UA 5LH8A 2J38A 1ELAA 1ZR0A 3LGTA 4FUEA 1UVOA 3RXQA 2SNWA 1C5WB 3MHWU 1Z71A 2O8UA 2WV9A 2RDEA 1ZMLA 2CMYA 4MLFB 4AG2A 1EAWA 3GCTG 5EPNA 4Q7ZA 4E7NA 2LNCA 2A7HA 2Q6FA 4KTSA 3P8NA 1BMLA 4JCNA 4ABFA 3SNAA 2JH5D 2NU0E 1Z8JB 2VVUA 4D76A 2O8LA 4ZKNU 1Y8TA 2VVVA 3QTVH 2BD7A 5J4QA 3T62A 1DUEA 2TGAA 5DP3A 2UWPA 1H1BA 1YM0A 4JZDH 1O3IA 1O2YA 1C2EA 1O38A 1QL8A 5DKMA 5C1UA 1TQ7B 1B7XB 2FP7B 1AVXA 4KGAA 4IW4E 5L30H 1O5BB 4E06H 1O36A 8GCHF 1GI9B 3MTYA 2ZHEH 1GI2A 3ZZ6A 1ZPZA 2CXVA 3MU1A 3KN2A 3TK6A 2J98A 1C1PA 3ODFA 3N7EA 4DIHH 3BTKE 4XSKU 1G37A 2PWXA 2W26A 5F8TA 4WMFA 2G52A 1Z6EA 3E16B 2BYAX 4X2YA 1MTNC 2ZQ1A 4ZKSU 1P57B 1GJ8B 5DP8A 5EJ1A 2F91A 2QE7D 2ODPA 3RM0H 3MYWA 4MNWA 2OP9A 1WDIA 2A4QA 1KDQB 1P8VC 2ZDNA 1DXWA 1O5AB 1SGCA 1HJ9A 3RXEA 2G4UA 1AWFH 1QL7A 1IQNA 1NC6A 1SLUB 2BDCA 1SGTA 2AGIX 4ACBA 3PMBB 1YKTA 2JETC 1T8OA 1O3JA 4F49A 2SGFE 3P6ZB 2IJOB 4FETA 3CS7A 1VITG 1YCPK 1P06A 1Y59T 2A1DB 4WMDA 1O5GH 1W3CA 1JIMA 1P2NA 3RLYH 3ATLA 1GBBA 2BMGB 1SBWA 1QBVH 1VCPA 3T27A 6ESTA 3RXIA 1PPHE 5HM2A 1BRBE 1IQKA 1UVUH 1GG6C 1EPTB 1FZZA 3M7UA 2IPQX 3LGWA 3F9EA 1BTWA 2Z3CA 3A84A 4THNH 3SU0A 1INCA 3KL6A 2PKSB 3G01A 2ZU2A 3SYJA 2YMSD 4YOJA 3A83A 3LU9B 1UMAH 1A61H 5EGMA 4YM9A 2ZFFH 4JYVH 4I86A 1C1WH 2FO9A 1A0JA 1EZSC 2QGRA 1XUFA 4A5TS 5E0GA 2ZTZA 1TNJA 1VGCC 4ZHAA 1V2JT 1C5NH 1QY6A 2JDID 2ZU4A 1HAPH 4FOUC 2P94A 1A46H 3M3SA 1S6HA 1UTNA 2GD4B 3ZV8A 5EQQA 3S9BA 3GY7A 4NFEA 1UTLM 4YT7H 1AUTC 1OYTH 2R3UA 2R2WU 1UVSH 3SI3H 1WV7H 3BTDE 3MO9A 1CHOG 1J9CH 1SHHB 1RFNA 2ZGBH 2F4LA 1W13U 3A85A 1Z8RA 1D9IA 2ZTXA 2ZHQH 1IAUA 1A3BH 1ZSKA 4UONA 1L1JA 1HPGA 5EQSA 1WUNH 3PRDA 1RTKA 2AMPA 4QT8C 1UTQA 2Y7XA 3OFND 1KMHB 4WH8A 2G5VA 1DWDH 4DY7B 4TWYA 4F55A 5C67A 3CS0A 1ZMJA 2FIRH 3SUDA 4D7GA 1O2XA 1JOUB 1XUKA 1A0HB 1V6DA 1BBRE 6GCHF 1OPHB 3K2UA 1LDTT 2PUQH 3GICB 4O03A 1OWDA 1A5IA 1FJSA 2HPQH 1Y3XA 1BTPA 1CSOE 1TAWA 3D49H 3M7TA 5T6GA 4ABIA 2KCAA 1E34B 3DUXH 2BY6X 1GJ7B 4XRNA 1K22H 5TJXA 3QX5H 2J5UA 3FN8A 1ID5H 3RXFA 1YPGH 1KXFA 3PRBA 2FM2A 3FZDA 1C2IA 2V7QD 3GY5A 2AGGX 1A3EH 1IHSH 4JK6A 4MDSA 4A92A 1ZRKA 3PV4A 2ZF0H 5JPMH 3HATH 1LPZB 4GCHF 2A5IA 4K1SA 4K8BA 1C1UH 3ZVEA 1CVWH 2C3SA 2FXRA 3EQ0H 1J16A 2O8MA 3Q76A 5EXNA 1NS3A 1IQEA 3TK9A 1GJDB 3MU8A 4NIVA 1T7CA 2G51A 3D23A 2GCHF 3AK5A 2TRMA 1QRWA 3PLBA 1TBQH 2BD8A 3ODDA 1D3PB 3U69H 5TCCA 1SQAA 1JRSA 4Y8YA 1UTOA 2XNIA 4CRAA 2GZ8A 4MTBA 2AEIH 1YC0A 3AASA 3E6PH 1L0ZA 4TY6A 5JBBS 5E0JA 3RXOA 3ZVDA 1MUEB 3VB5A 1ZYOA 1K1IA 2BHGA 2A31A 2SGPE 1DLKB 4ESTE 3RU4E 1O3CA 3UNRA 2FX6A 5FPSA 3UREA 4X1QU 1O5FH 1NRPH 1T8LA 1V2LT 3RXBA 1PPCE 3GY3A 3FP8E 5A2MH 1GVZA 4MPWA 4AX9H 4ZXXH 1PFXC 1BDAA 1Z8GA 4X6OA 1CO7E 1NROH 2TGDA 2Y7ZA 4AFSA 1SGYE 3EGKH 1TGCA 4B75A 4NZLA 2V35A 4ISIH 1N6XA 2B7DH 2KCPA 1YYY1 1XXFA 3SJ8A 1TABE 1ESTA 4KELA 1FPHH 1GBHA 3UB0A 1GCDA 2PSXA 3SV7A 4ZHLU 5CHAC 2XC5A 1GL1A 1GDNA 2UUYA 2JJ1D 4UE7H 1C1NA 2HALA 2ODQA 3HK6B 2OC7A 1D6WA 1NN6A 3HKJB 4B74A 2D2DA 3RP2A 3M3TA 2ZIQH 1DUAA 3PV5A 3GY2A 4CBOA 1C5MD 1SSXA 1PJPA 5HIZA 2GP9B 4RKJB 3F1SB 1AU8A 2J92A 1MZDA 3A89A 1GI7B 4X8UH 1BMAA 1SC8U 1W7GH 1C5XB 4D7FA 1ZPCA 1L4DA 4AGJA 3D62A 5JBAS 1TGTA 2Y5FA 1SLWB 3ELAH 2VH0A 3BIVH 1P2KA 3L6PA 2Z9IA 1ANEA 3BTME 3M5NA 5KGOA 1GHAF 1AD8H 1ZGIA 1QURH 3FZZA 3P70B 1OKXA 2ZFPH 1G2LA 5ESBA 1WBGB 1EJNA 2AS9A 2ZCHP 1BHXB 2QXIA 2ULLA 1AB9B 1QZ8A 3H7OA 2BQWB 3Q3YA 1LKBA 4CRDA 1EPTC 5HXFA 1FAKH 1K1PA 4YOIA 1EZQA 4NIYA 1AUJA 3T2NA 4K1TA 3GCNA 1V2PT 1FI8A 4AYYB 2PKSC 5F8XA 4GUXA 5LPEA 1HJAC 2JJ2D
chains in the Genus database with same CATH topology
5GCHF 1G3CA 3N7DA 1K21H 1L1NA 1O30A 4K8YA 1PQ8A 3PTBA 1MTNB 3URCA 1LHFH 4BTTB 2J9NA 3RM2H 4NA7A 1C2GA 3KCGH 1BRAA 1VJ9U 4PROA 1C4V2 1TMUH 2TGTA 4WMEA 2YMSC 5GXPA 1SGDE 2ZHDA 2I6SA 4X6MA 1QA0A 1C5YB 1BRCE 1TRMA 1NTPA 2XXLA 2A4RA 3DFLA 3FO8D 5DN6D 3H09A 1GBTA 4BOHA 2JETB 1HNEE 1QHRB 1DICA 1TGNA 4ABAA 2AYWA 1NRRH 2HNTC 4DGJA 1P3CA 1DFPA 3LC5A 2K8IA 1TRYA 3OTPA 9ESTA 3T29A 3A86A 3OAAD 4FUHA 5TCAA 3F2FA 2XWBI 1S85A 5GDSH 1O3PB 3A8CA 3K9XB 3TH4H 1GHVH 2ZZUH 1D4PB 4ABGA 2SGAA 1T4UH 2TIOA 2IOTA 1C2LA 2BD5A 2Y81A 3M3VA 1Q31A 1NBME 1GG6B 1W7XH 1GHWH 3D65E 1UK4A 2JKHA 1LTOA 3SBKA 4B2AA 1G32B 3BTTE 3ZZDA 2AGEX 1C4Y2 1YGCH 2OBQA 3NCLA 3BTWE 5C1YA 1RRKA 1QCPA 3RXMA 3SJKA 1G9IE 3I78A 2L6OA 3GS9A 1O37A 1W8BH 3EDXB 1ELBA 3OY6U 3EAJA 2AIPA 6CHAC 2FS9A 4FUJA 2W7SA 2QCYA 1D6RA 4RKOB 1Y5UT 3V12A 4Y71A 1VGCB 4XE4A 2ZDKA 2FEQH 2KAIB 2WPDD 4MPXA 4KTCA 1XUJA 1GJ4H 1GCTC 4FUCA 2Z94A 1F5KU 3MNXA 4M7GA 3BN9A 3MO6A 4BXWA 4MNXA 4OS7A 1EJAA 4CRBA 2XWAA 2ZFQH 1O3LA 1MU6B 3RXCA 3VB6A 2ZDVH 1C4U2 1O3MA 3RU4D 2RG3A 2B5TB 3SJIA 5DJ7A 1MCTA 3AW1A 2V3OH 1CGJE 3GISB 3UNSA 5DP5A 4KP0A 1HAOH 2PUXB 1S0RA 3SZEA 1RIWC 2OCVB 1P12E 1JIRA 1KLIH 1THPB 3P92A 1S81A 1GPZA 4IMZA 2BDGA 3P8GA 5EU8A 1EAIA 2FX4A 3HKIB 4UEHH 3VFEA 1BBRK 3SGQE 5E0HA 1BTXA 1P03A 3VXEH 4XFQA 1PQ5A 4A1VA 2WPMS 1JRTA 1O3AA 4LK4A 1AHTH 3AW0A 4Y10E 4NGAH 5FPTA 4RI0A 4UD9H 1JWTA 1S6LA 1XMNB 2OINA 1XUHA 1CA8B 1SGFA 2VWLA 4YOGA 4B76A 2PFEA 1TE0A 2D1JA 4R0IA 2WZQA 1GMDF 1HAIH 1K28D 1O2ZA 4X1RU 2P3TB 1O2IA 1C1MA 3AVZA 2PGQB 3UUZA 3LIWA 1MAXA 1HAHH 1C9TA 1NU9A 5SGAE 1SGFG 1Z6JH 2QXJA 3A80A 3SNEA 3WW7A 2BD9A 5C3NA 4OS2A 4INKA 1C5OH 1O2QA 1HCGA 4O3UA 4Z0KA 4ISLA 1H9LB 4BAQB 1KDQA 1LVMA 3IWMA 4ISHH 2BY7X 1G36A 3B23B 3BTEE 2SFAA 5JB8S 1C1RA 3F9FA 5IYTA 5C5OA 3LKWA 1SI5H 5F6MA 1CU1A 4U30A 2ESTE 1TYNA 1AGJA 1SL3A 3W94A 4LXBH 3MFJA 3QK1A 2BD3A 1LO6A 1V2RT 3Q3KA 1DWBH 1PPGE 1CHGA 1T4VH 2BX3A 2ZFTA 4Z6AH 2H5DA 2WYGA 3STJA 1VCQA 1FPCH 5FCRA 4WVPE 1VZQH 1TPPA 3M7QA 4B6EA 1OWHA 1AZ8A 1GBMA 3SJOA 4IC6A 3UQOA 1RJXB 1AB9C 1S83A 3TU7H 1EPTA 3ZYDA 4XBDA 1T31A 1FIWA 2ZO3H 4WJG2 5A0BA 3TH3H 1WOFA 2OD3B 4LZ1H 2BDYA 4ZUHA 1EOLA 1VITH 4KKDA 3PV2A 1C5QA 4WXVA 1O5CB 2GV6A 1PYTC 1L1GA 2GDDA 5CHAB 2OC1A 4H6TA 1W14U 3B8JA 2AMQA 2F43B 1HXEH 3M37A 1MQ5A 1QFKH 3TJNA 1OP2A 2VWOA 1C2FA 1C2JA 5G4BA 3GDVA 3RXDA 3O8BA 4ZHMU 3FKSD 1LHGH 1J14A 4YESB 5DGJA 3R3GB 2JH0D 4JYUH 2F9BH 1GVKB 3F0OA 2FYQA 2VIDA 2KZ4A 1T32A 2NU2E 4Y76A 1NBMD 2XCFA 3T25A 1IQMA 7GCHG 3DSPA 3Q3XA 2ZI2H 3FP6E 4E05H 4TT3D 2BY5X 1EAUA 1ZGVA 2FPZA 5A8ZA 1C1VH 1TBRH 2F3CE 5LPRA 1F7ZA 4X1SU 1J17T 1LKAA 1O3EA 2GZ7A 1V3XA 1FN6A 5C17A 3BEUA 1FQ3A 2FOCA 1BTHH 1FY5A 4I8HA 5C1XA 1F0SA 3MU0A 3UOPA 4IBLH 1FX0B 4FXGH 2G4TA 3GOVB 2BQ7B 3NUMA 1COWD 2VIOA 1XVOA 1DT2A 2Z3EA 2G5NA 2SGEE 3OE7D 3W1EA 1HBTH 1HJAB 1MKWH 2FOBA 2BD2A 1MTUA 4CBNA 1QQUA 2A5KA 3TIUA 1GJ5H 1ZOMA 4D9RA 3MU5A 3ZZ4A 4B6FA 1OP8A 1KYNA 2ZDLA 2Y5GA 1MAYA 1UK2A 1Y5BT 4Y79A 1YBWA 3L33A 5A8XA 4UFEH 1C2DA 2P3FH 2C90B 2ZDMA 2ZA5A 3BTGE 1O3FA 3E0PB 2WUCA 2GDEH 2AERH 1LPGB 5EXMA 1TPAE 2YMSB 1P11E 2ALVA 2AHME 3F0PA 4CRGA 3SU5A 1SLVB 3RXGA 2UUFB 1ZHRA 2I6QA 2FOFA 1W0YH 2VIWA 4X8SH 2C93B 3EYDA 1HAZB 4R8TB 2ANKH 1ZTLA 5ESTE 3TITA 3A82A 1GJ9B 2O9QA 2GKVE 3RXTA 1LQEA 4DOQA 1SVPA 1DWEH 3O8RA 3E91A 1PPEE 5T6DA 2W3IA 4IN1A 4BNRA 3TGJE 3LGVA 2A2QH 4YTAA 4AOQA 1SMFE 1D3TB 2ANWA 1AE5A 4CHAC 1TOCB 8KME2 4JZIA 4NA8A 3FVFB 1QJ7B 2KM0A 1V2WT 1W12U 3U1IB 1MMJN 1RD3B 2EA3A 4ABEA 5C0TA 1P04A 3NXPA 5EOKA 1SLXB 2FESH 4VGCC 1FXYA 1FY8E 2VINA 2WPKS 2CN0H 1WTHD 1IQLA 3SV8A 4JK5A 1GDUA 1OX1A 3K6YA 1GVLA 3NKKA 3MU4A 3MH5A 3ZZ3A 2BDHA 4SGBE 4B73A 1DY9A 6CHAB 1B0EA 1S6FA 2EC9H 2P59A 2WV4A 1CE5A 3TVJB 2CF8H 2ZFSA 1KTSB 1UJ1A 1YPEH 5A0AE 3KNXA 3A88A 1MZAA 1H8DH 1ELTA 3SOSA 1GMHF 1GCTB 1V2ST 3SO3A 4O97A 8GCHG 5EPYA 4IN2A 1BITA 1FDPA 1UVTH 3KGPA 3SV6A 1O2UA 1ZTKA 3H7TA 1AFEH 1GI3A 1KLJH 1TA6A 1A2CH 1KY9A 1VJAU 2BLWA 1GHBF 1BRUP 1IQFA 1HAXB 4K60A 1P9SA 4SGAE 4DIIH 1DPOA 1W11U 4LOYH 2QA9E 1RIWB 1SB1H 1AY6H 4K1EA 1F5RA 4WY3A 4HTCH 1SFQB 2OC8A 2HLCA 2P16A 3LJJA 2Z9KA 1MD8A 1TB6H 1NT1A 5ABWA 1GI4A 9LPRA 2ZQ2A 2A32A 1TNLA 3ZZ7A 1GJAB 3BSQA 1GJBB 5C5NA 3BTFE 1BJVA 1N6YA 2XBVA 3SUGA 1F0RA 4TPYA 3SU1A 3OSYA 1O2KA 4J2YB 2VB0A 3QTOH 3F9GA 1GHYH 4B1TA 2OXSA 1NY22 1LVYA 4I8KA 3E3TA 4FUIA 1UVPA 5AHGH 1T8MA 2EI7A 3TK5A 3A8BA 1DXPA 2A4OA 3KIDU 1SQTA 1O2LA 1O5EH 1ANDA 4MPVA 2BX4A 1CGIE 1GI0A 1YLCA 2FWWA 3QGJA 3UOUA 4OS1A 1P10A 1EOJA 4ZH8A 1O2SA 2FODA 1ZLRA 1HIAA 3SU3A 2BVXH 1UTPA 2NU3E 2GCTC 3LC3A 2VGCC 1HJ8A 2AFQB 1AFQC 1GL0E 1TPOA 3E90B 1E1QD 3SQHE 3PLKA 1NESE 4AGKA 5B6OA 1BIOA 1RXPA 2VU8E 3BTQE 3GDUA 4ZAEA 1SGNE 1HAGE 1C1OA 2YNAA 1NPMA 3SUFA 4H4FA 3U9AH 1PQ7A 3RXHA 1O3KA 2B0FA 5EXLA 1O2NA 1WQVH 5A09A 1P0SH 1C2KA 4I32A 3T5FH 1CT4E 1Q2WA 1AKSB 4CR9A 2ZP0H 3UR9A 1EATA 2PW8H 1EB2A 4B2BA 2J2UA 1A0LA 3MH7A 4HZHA 1V2KT 3P8OA 5DP7A 1H8HD 1FN8A 1P9UA 1WU1A 2J4IA 5DSFA 1MH0A 1PYTD 1S5SA 3WY8A 2ZHFH 3NZIA 3Q00A 1OWEA 3MNCA 3LH3A 5FX6A 2PHBA 1GJCB 2ZCKP 5GWZA 1ACBE 1GBDA 2NU1E 3KQDA 3M5MA 1OSSA 4FU9A 1P2MA 4IGDA 1TX7A 1ZSLA 3UQVA 4MNYA 3F3BA 3BG8A 2TBSA 4CRFA 3FP7E 3GY4A 7ESTE 1GMCG 4FVDA 1G30B 2W3KA 3S9CA 1E79D 2H5CA 2RCEA 5AF9H 1ZJDA 1MU8B 4YLUA 2XBXA 3LGIA 4DVAU 1SQOA 2GTBA 2QXGA 1HRTH 1ELGA 4ISNA 1GBJA 1HIAB 2BVRH 6GCHG 4GHTA 2ILNA 3BIUH 3ZZCA 2KAIA 3QWCH 1EJMA 3RXVA 1OYQA 1SPJA 4NFFA 2GVFA 3GCTF 1KXBA 3C27B 3SJ9A 1QRZA 4NCYA 1GHZA 1BCUH 1VR1H 4WWYA 1HAVB 1GDQA 1O3OA 1K2I1 2HLDD 1MD7A 4X2WA 3M35A 2D8WA 2BD4A 2WPLS 5BRRE 3RLWH 2WPJS 1K1JA 2HVXA 2W6JD 3ATWA 4X6NA 5A0CA 1NFYA 2SNVA 4E7RG 3DSOA 5B6LA 4X2VA 1C5SA 3T26A 1YP9A 3GYMA 3HPTB 4GCHG 1GBFA 3SNBA 4K3JA 2FOMB 3RXPA 1EX3A 4X8TH 4Z1MD 4MVNA 4K5ZA 1LCYA 2K1QA 4D9QA 1IHTH 1AI8H 1SKYE 5E8EH 5H4IB 3RXAA 1IQJA 1C5ZB 1GHXH 3P95A 1TX6A 2Z9JA 1A4WH 2KCOA 4B71A 3NK8A 1CA0C 1YLDA 1QB9A 4NWKA 5E2PA 1EFRD 3ZVFA 1SGQE 1SG8B 1EQ9A 1OWJA 1GBEA 2BZAA 3P17H 3C1KA 1Y3YA 1YF4A 4I8JA 3EA9A 5L6NH 3BG4C 4YO9A 3ZZ5A 1F2SE 2P3UB 1O35A 4UDWH 2BB4A 1TMTH 2DUCA 1QA7A 4X0WU 1F92A 2GX4A 3RU4T 3LH1A 1RS0A 2F9UA 1NFUA 3SGAE 1E35B 3QUMP 1XKBC 1ELDE 3GY8A 1Q3XA 3SU4A 1O3BA 4H42U 4X8VH 1BTZA 3OYPA 1JBUH 2O8WA 2Q6GA 1YCPH 4DT7B 1THSH 2OUAA 1FY1A 4A1TA 1VITF 4LZ4B 3OU0A 1AVGH 1E0FD 4NSVA 1DVAH 3PROA 3SN8A 1V2OT 2PKAB 3V3MA 4CHAB 3BEFB 1UK3A 2PGBB 1LPKB 1V2VT 1E1RD 2GMTC 1FY4A 1W0KD 1YCPM 3MWIU 1O2GH 3VG8A 5LPFA 4XD7D 4I8LA 2JH6D 8LPRA 1TPSA 3A8AA 2C4FH 3RC6A 4VGCB 1TBZH 3F68H 5FBIA 1IOEA 3VEQB 5T6FA 1YPHE 1DOJA 1AO5A 3FAOA 3OEHD 1O3HA 2WPIS 1OWKA 5DP9A 2A7CA 1GGDB 3U1JB 4MG3A 1GHAG 1ELVA 2GZ9A 1N1LA 3JZ1B 1XKAC 3S69A 3STIA 4MNVA 1U6QA 1UCYE 3MNBA 3GDSA 3QGNB 2OQUA 1N8OC 1OP0A 2PSYA 5GIBA 3U8RH 1DSTA 1E37B 1WXRA 5L2ZH 3URDA 1LVOA 3ZIAD 2A4GA 5DG6A 3KF2A 1KSNA 1TNKA 4Y8XA 2GT7A 2YOLA 1W2KH 5IK2D 3SQEE 3RC4A 3M36A 1CHOF 4UFFH 2M2AA 2EI6A 1DM4B 4Y6DA 1UTJA 3A7TA 3DA9B 3DD2H 1SGPE 1C1TA 4JZEH 4AYVB 1EXFA 4OM9A 1W0ZU 1EZXC 2XW9A 1XXDA 3RDZA 1KXAA 2Q6DA 1EUFA 3U98H 4M9FA 3MMGA 4ZKRU 5EQRA 1X7AC 2FZZA 3V0XA 5K7RA 4TSFD 3VB7A 1GBLA 2ZPQA 4HGCA 2Z3DA 1CQQA 2NWNA 2J34A 4AB8A 4YXWD 4FUBA 1SOZA 2B8OH 5K0HA 3K65B 2ZEBA 3IG6B 3MI4A 2ASUB 1O0DH 4WF8A 1IQHA 5HM9A 5BPEA 2EEKA 4I7YH 1K1OA 1FY3A 2FOEA 3V13A 1TX8A 1TLDA 1BZXE 2ZECA 3UPEA 1EKBB 1S0QA 2O8TA 3SV2H 4I8GA 3ZVGA 3QZQA 4HFPB 5LGOA 2H9EH 3RXRA 3S7HB 2VIVA 2PV9B 1BJUA 3LOXA 2B9LA 4J1YA 2R3YA 1G3EA 2UWLA 2A0QB 2FOAA 5EG4A 4OGYA 1DS2E 1QJ1B 2FLRH 1Y5AT 1FONA 4ZKOU 3KQBA 5J4SA 4FU7A 4IMQA 3DT0H 1H4WA 1A1RA 4ABBA 1OXGA 1MTVA 2GCTB 1K1MA 3RXKA 2RDLA 2VGCB 1AFQB 2NU4E 1SFIA 1O2MA 4TWWA 1C1SA 2G00A 3A81A 5FCKA 2SGQE 3QO6A 1TIOA 1DY8A 2THFB 4FU8A 2PR3A 3UR6A 1GBCA 4GHQA 3ZZ8A 3A7YA 3K6ZA 4U01A 4A6LA 4ASHA 1FV9A 4ABJA 2VIQA 1UCYH 1QRXA 1OOKB