1EGOA

Nmr structure of oxidized escherichia coli glutaredoxin: comparison with reduced e. coli glutaredoxin and functionally related proteins
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
pubmed rcsb
molecule keywords GLUTAREDOXIN
molecule tags Electron transport
source organism Escherichia coli
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1egoA00
2C3NA 2R2JA 1USBA 5B7CA 2WJUA 3KGKA 2VUPA 4TR1B 1U3IA 2GSTA 4POBA 4K0NA 5F07A 1GNWA 20GSA 2P0GA 3C7MA 5HR0A 3APQA 2DJKA 3FYGA 1C72A 3C8EA 4D73A 3DVXA 4XRDA 2X8GA 2H0GA 5ECRB 2VLVA 1OYJA 3DD3A 1GSDA 1PKWA 2LNSA 4PNFA 2R37A 4TW5A 2NBSA 3TKSC 3F8UA 2B7KA 3ZRDA 1SK1A 1ZYEA 2VL2A 1AQXA 2CZ2A 2L59A 2AHEA 1TU8A 1O85A 1M7TA 2WFCA 4QL7A 4ZB9A 3ME8A 2L5LA 3H4KA 3RPNA 17GSA 2V41A 1DSBA 2MMOA 2CVBA 3IK7A 4DSQA 3FKFA 4TXOB 5L71A 4IW9A 5EVOA 3IAS2 5GSTA 3KMOA 1YEXA 5IM9A 4WF5A 3VFIA 2E7PA 1JZWA 4KDXA 4TKYA 1SL0B 5JWRB 5F06A 5HFKA 3VI7A 3EWLA 1TU7A 2H01A 5IQYA 2VLUA 4HQSA 4K1FA 4JEDA 3HY2A 1PN9A 5CYYA 3Q6OA 2FA8A 3CRUA 2PERA 1F37A 4V2LA 1YEPA 3E3EA 2CAIA 2O7KA 2O87A 5ECNB 4KSOA 4AGSA 1W4VA 3LXTA 2HYXA 2DIZA 2VD0A 1MDJA 1X0RA 1ERWA 1XVWA 2R4VA 3LYPA 1SK2A 1Q4JA 3IAM2 2H19A 3P8WA 4Q5FA 5D96A 1B9YC 2GLRA 4ZXGA 1MTCA 3KCMA 1K0OA 2IN3A 3VWWA 3MDKA 5IO0A 4FYBA 2FNOA 2LKUA 2JU5A 2F8AA 3HXSA 4BVYA 3F0IA 4YAVA 3FK8A 1F9MA 5G2ZA 5CREA 3EINA 3HVSA 2LRTA 3ED3A 5GSSA 1XCCA 1XWCA 6GSXA 1DE1A 2RM5A 1GSQA 3IK9A 1X5DA 22GSA 2VD1A 4HQZA 4XS4B 3P7XA 5CRHA 1O6JA 1T8EB 4RQRA 3IV4A 2ZUPA 4MZWA 2IWTA 1AUCA 3CMIA 3C1SA 2WB9A 3E9JB 3GYKA 4KSMA 1TRWA 2YCDA 4HS1A 2MMAA 5EL8A 3GKXA 2FA4A 1JHBA 4L0UA 3UBLA 1A2MA 2OE3A 4YQMA 1EP8A 1F3AA 2K9FA 5DVBA 4GTUA 2HT9A 4MF6A 5CP1A 2LEGA 3Q74A 2B1LA 1FHEA 1M9AA 4J2FA 2H1AA 2LSTA 3G7IA 1JLVA 2R3XA 5IOWA 1A8LA 1GTIA 3HZ4A 2V1MA 1M0UA 4HEA2 3GH6A 2B6MA 4TR4A 2CT6A 3FZ5A 2RUFA 3BCKA 2FWHA 1H4OA 4EXJA 3D0ZA 1YKCA 2IL3A 4NXIA 1SENA 4F82A 1MDKA 2JACA 4GSNA 1GNEA 3ZVJD 1TKDB 4MJBA 3GH9A 1EEMA 1TI1A 3TKRA 5F05A 4HU7A 3C73A 2OJLA 1PD21 2JADA 1OE8A 4PURA 1SJIA 4PX1A 3PINA 3FZAA 2LUSA 2XPDA 3QAGA 5CNWA 3RAZA 4EE0A 3FZ9A 5ID2A 3HDCA 2ES7A 4IP6A 1J08A 3HA9A 1GTBA 2FLSA 4PQHA 5ELGA 4KE3A 4BWQA 4N30A 4OFTA 4WETA 1GSFA 4P3YB 5LCZA 6GSVA 2FY6A 1EV9A 3DMLA 1Z7RA 3UAPA 3TJFA 2C80A 3WGEA 1YKAA 1T7PB 4K2DA 1BYEA 3U5RE 3KMNA 1XW9A 1ZZYA 3TGZA 1WWJA 2F51A 3TKSA 1TK5B 1F2EA 4IJ3A 3A5WA 2H71A 3FEUA 5D9WA 2K6VA 3QFBC 5H5QA 4JBBA 1KTEA 2L57A 2VL3A 4MDCA 1BX9A 4GSSA 3AY8A 2H70A 2EIOA 3GIXA 4HUAA 1E2YA 4ZB6A 2E2MA 2D2ZA 5J5NA 1FG4A 3FZ4A 4DSRA 5D93A 3ME7A 3LG6A 2DJJA 4TOPA 4O7HA 3TJJA 3S9FA 2HLSA 1DE2A 2FWFA 1SYRA 1XFLA 2FWEA 2V6OA 5IMAA 2P31A 2A2SA 4ZILA 1K0MA 2FD3A 4IS0A 2VAFA 4ECIA 7GSSA 1UA5A 3PH9A 3GN3A 1RW1A 1OC9B 4N11A 1TDIA 3TCOA 2GZYA 4IHUA 1X9WB 2AYTA 2WCIA 3IBHA 4MJAA 1M2DA 5CRDA 3QCPA 2GDRA 1ML6A 1THXA 1O8WA 2F9SA 5DJMA 4I5QA 5J41A 5B8BA 4ILFA 1XBSA 4IN0A 2VLTA 2HZFA 5IMVA 2KP2A 4L8EA 3IPZA 4HZ4A 4FIWA 4F0BA 3BJ5A 3A2XA 2KHPA 1TRUA 5KN1A 2H1DA 5D8IA 3QFAC 3GKKA 2XHFA 18GSA 2KP1A 3QAWA 1O73A 2C3TA 5FHIA 2DJ2A 4HU9A 3Q19A 2PN8A 1U88A 2H8LA 3F6FA 2B5XA 2IMIA 4MJCA 3KTLA 1HYUA 1QFNA 2YPMA 4KNDA 4MZCA 3TB2A 4CHSA 2YV9A 2KLXA 4DEJA 4PNGA 2I4AA 2WDUA 2VL9A 1OC3A 2H6XA 1O8XA 1WJKA 4OCEA 2OE0A 4AJ6A 5DQSA 4ZL7A 2A2RA 2TRXA 4F9ZA 2H74A 2X99A 2KOKA 3GSTA 5DALB 4FYUA 4KDYA 2HXKA 3IHQA 5IPGA 1Z5YE 2ON7A 2X8HA 5HR3A 1GLPA 3CXGA 3TJGA 5IO2A 1NW2A 1JFUA 1VF1A 4Z7XA 1WE0A 3CBUA 2AUVA 3TRXA 3Q18A 5DAKB 3PR8A 3UL3A 1Z6NA 4KAEA 3GKMA 1EOGA 3WYWA 4I2TA 3CTGA 5G1LA 2YANA 3IRAA 5JWQB 1R4WA 2HRFA 5IMDA 3VI5A 2CX4A 2GZPA 2DIYA 3GHAA 3ZL5A 2X8CA 4LL1B 1OC8A 5EPFA 1SU9A 2DMMA 2PPTA 4KA0A 1NM3A 2MZCA 4ISDA 1UC7A 1F6MC 5C04A 5CRGA 1T00A 2IJYA 1CQHA 4K8MA 4TVEA 2LV3A 5ECKB 5ECOB 1QK8A 4GLTA 1QUWA 1PMTA 1JZDA 3QPMA 4HJ2A 1PRXA 1X9MB 3M3MA 2YNXA 2B5EA 2CA8A 4POKA 4K6XA 1FW1A 4GSTA 4N10A 2JZTA 4ZIJA 2PBJA 4AJ8A 2FWGA 3GMFA 1A0RP 5FWGA 4V2MA 1VF3A 5AIVA 3LSZA 3ERGA 4HDEA 2VO4A 3P2AA 2B7JA 3VLNA 4BA7A 5IMCA 1XVQA 3O3TA 1EP7A 3HJOA 4O92A 2V32A 4MLYA 6GSUA 2R5GA 4GRFA 1IYHA 1Y25A 4PUAA 3RHCA 3TRPA 4MPGA 4KCAA 1FVJA 2NDOA 5DCHA 1I9DA 1OVNA 2CVKA 5HQPA 4AJ7A 4TR0A 4HOJA 1OKDA 1JLWA 1X9SB 5HR2A 4NMUA 1WP0A 4EDZA 1A2LA 1PSQA 2QGVA 1TRVA 2WULA 4PQIA 5KN2A 3GV1A 1Z6MA 2Z9SA 4GCIA 4WR5A 5KN0A 3P90A 1GTAA 3LEFA 3DKSA 1V40A 1GWCA 4K7NA 2DBCA 2WZ9A 3BCIA 5J4UA 4Q5RA 1R26A 1ERUA 2YOIA 4NV2A 1LJRA 2I3YA 3D5JA 1XOAA 1ON4A 3A2WA 1LU4A 4BWSA 3IC4A 2EIRA 2DJ0A 2DJ3A 2VIMA 2GSRA 4HI7A 1A8YA 4MF7A 1FOVA 1N8JA 3DEXA 1BEDA 1V2AA 1K0DA 1GLQA 2EIQA 4OFMA 4ZB8A 2LQQA 5ABRA 1OE7A 3ERWA 2DLXA 4DSSB 5D73A 3I69A 1HD2A 5DCGA 1ZYQB 4KW6A 3ZMKA 1CQGA 2VCXA 2GGTA 1ABAA 2IMKA 4TXVA 3F9UA 3QOUA 3KP9A 3LWAA 3GTUA 2J9HA 4XRAA 2LRNA 1Y6EA 4ECJA 4HJMA 2IFQB 4IGJA 4XS1A 5D9XA 2YV7A 4EKZA 2B5YA 3OR5A 3J7Yb 3J7Yk 4GQCA 4IKHA 4JR6A 1A23A 2CV4A 2DSAA 2E2GA 3RPPA 2RUEA 1PL1A 2C0DA 5EY6A 2LNTA 4NAXA 3WT1A 2TIRA 2HZEB 3VPTA 3I9V2 3G7JA 2VCWA 2GQKA 4X0XA 2IPAA 3TKPA 4MF5A 1SD9A 3ZYWA 1GSEA 2J23A 2YWOA 3W8JA 1HNAA 5B8AA 4LL4B 2BMXA 4MZBA 1AAZA 4JR4A 2OBKA 3D4TA 1E6BA 1ZL9A 4FYCA 4K0GA 4JE1A 1SJZA 3JCML 5KN3A 3R2QA 1TK0B 4OO5A 2H1GA 5DBQA 3NZNA 2AV4A 5IOXA 4TR1A 4V1Ag 2MBTA 2PU9C 4XHMA 3GL3A 4O32A 3TJKA 2C1YA 1ST9A 1XZOA 4KGIA 1GSUA 3BOAA 4ULXA 4IBPA 3GA4A 2V2GA 3IOSA 5GAPD 3ZZXA 1HNCA 2DMLA 1Q98A 2CQ9A 2RLIA 3W8SA 4GF0A 3FY7A 2H75A 3RHBA 4LMWA 2VM2A 2JSZA 1GUKA 2E0QA 4K9ZA 1EZKA 3LXZA 3HVVA 1SD8A 2VCZA 4FO5A 3LFLA 2H1BA 4BVXA 4NHWA 2IMDA 3KTBA 1BJXA 3LYKA 2KUCA 4D73B 4TXOA 1ZGNA 4PXOA 2ZCTA 1XWBA 5LD0A 3KZQA 4ZL9A 1B8XA 1G6WA 2WS2A 2OA7A 3F63A 1B4PA 2O8VB 3DYRA 1TXXA 5H5RA 1DBYA 4IVFA 5J9CA 5E59A 4WF4A 2GSSA 5B6NA 2YP6A 3M9KA 3VPQA 5HFGA 5DQYA 4IELA 4MH3A 1XW6A 1OKTA 5AISA 1K3OA 3G7YA 3DVWA 2GVPA 5COHA 4HZ2A 1LBKA 1GUMA 4GXZA 4OO4A 1B48A 3M9JA 2YN1A 3VWVA 3H1NA 1U6TA 2QKEA 2BTOT 2OE1A 1JZOA 1S3CA 1XIYA 5IMZA 1V58A 1M2BA 3FR9A 2ALBA 3NIVA 4PGTA 5KEJA 2C0FA 1DUGA 3NOFA 4K7OA 5CRWA 4PUFC 3VK9A 4CW9A 3LQ7A 5G5FA 3UVTA 4KUNA 1Z3EA 3L9VA 3DIEA 4F0CA 2N5AA 1TRSA 5CAXA 5DDLA 2IIYA 1EGRA 1K3LA 1PQNA 2NPBA 3HJMA 2GQLA 2I1UA 1MD3A 1G7OA 1YF0A 4WXTA 1S3AA 4G19A 2F8FA 5JCUA 1R5AA 1JZRA 1AXDA 3D6IA 5A4UA 2I9HA 1J0FA 3HJPA 4XS4A 2O85A 3UARA 1SK0A 2K18A 5FT3A 2FGXA 1AQVA 2MYGA 4KX4A 4I8BA 1EOHA 1TI3A 2C0EA 2PUKC 1TTZA 5D9TA 2HRNA 5JCWA 3HVXA 4V1Ap 1J9BA 1KEBA 2B1KA 1G0TA 1NHYA 2MMZA 4WR4A 2F3MA 3F4SA 4KB3A 3CSIA 3TUEA 2CX3A 3BD2A 2L4CA 1V9WA 2L6DA 5IMFA 3CSJA 4X1UA 3M8NA 3EE2A 1BQ7A 3ZITA 1YDKA 2L6CA 5JCGA 3GFKA 5G30A 5INYA 2HFDA 4H86A 1XWAA 3CYNA 1SYXA 2M46A 3GNJA 1KBNA 3UBKA 4CDOA 2JZSA 1Z9HA 4K7IA 3N5OA 3EMXA 3KIJA 3F3QA 3LORA 4N0VA 3EMPA 4ML6A 2JSYA 4I97A 2OADA 1O81A 2P5QA 3U6VA 1THOA 1XOBA 4EC0A 1EV4A 4MA9A 2QSIA 5AN1A 3EU3A 5ECLB 3VWXA 3EVIA 1WOUA 3APSA 3QMXA 1T4YA 3GX8A 4FH8A 3US3A 5H5SA 5ECSA 4I6XA 2DJ1A 4I2UA 1X5CA 2VM1A 4POMA 3FR3A 3KXOA 2FHEA 4ZBBA 1N2AA 4ID0A 2NVLA 3DRNA 2HNLA 5HFIA 2YJHA 2YZUA 2H72A 1GTUA 5F0GA 1FO5A 2PGTA 3ZVJA 3C1RA 4EO3A 2B3SA 2N5FA 4X43A 1EEJA 1SKRB 4EVMA 5LNKe 2YJ7A 2OKAA 1GSSA 3QDNA 1FB6A 3KEBA 3UEMA 1QXHA 2P5RA 3L0HA 2L5OA 5ID2B 1OAZA 4ACSA 3O76A 4MH2A 5A5KA 4TR3A 1WPIA 3I6AA 4ML1A 3ZMLA 2PVOC 3IDVA 5E4WA 1U87A 3DGQA 19GSA 3D21A 3ZIJA 1TOFA 3GL5A 3TKQA 2G0FA 5G31A 2H6YA 3O6TA 3HKRA 3TJBA 2CZ3A 3UMAA 1V98A 3GKNA 3TDGA 1V57A 1K0AA 2OBIA 3GURA 16GSA 1B9XC 4OCFA 3ERFA 2LQOA 1XPVA 1OC9A 2K8VA 1SL1B 4IP1A 3L9UA 5C00A 1KNGA 4WEYA 2GQMA 4LMVA 2O89A 4EDYA 3F4RA 3BBYA 5D9VA 2I81A 3WT2A 2GT6A 2ZNMA 3CSHA 1WRYA 1GL8A 2FUG2 2A4VA 4NV5A 2H0IA 2CAQA 2H76A 1XW5A 2LTKA 3ISOA 1VF4A 1NSWA 1HQOA 1PGTA 1GP1A 1XXUA 11GSA 4JZQA 2IMFA 3UIWA 4V2NA 1URMA 3FW2A 4EF0A 1ACVA 5A4VA 2VCTA 2PWJA 5AGYA 4TN8A 1YY7A 3GUSA 4KCEA 2HI7A 3EC3A 4JRRA 2ON5A 4EUYA 1F3BA 1UN2A 1R5PA 5AIXA 1PX7A 6GSSA 1PA3A 1M9BA 3EYTA 4OWYA 1T3BA 3KM6A 4BL7A 4E8HA 1W89A 3C71A 3TOUA 3ZTLA 3HHVA 4BPYA 9GSSA 3I43A 3FHKA 1HNBA 1QQ2A 5DALA 1ERTA 2FCHA 3IE3A 4OMVA 3LGCA 3ZLPA 2IMEA 1AW9A 2C3QA 2XPEA 1K3YA 1RK4A 3IXRA 2XBQA 4NHZA 2GTUA 4KH7A 1I5GA 3SWLA 5DAKA 2LS5A 2YWMA 3ZREA 5IIZA 3TOTA 4WKWA 4QL9A 1SJ6A 1SKWB 5DJLA 4G9HA 1ILOA 1G7EA 4WBJA 2XBIA 3IA1A 1QMVA 4NWYA 1MEKA 3DXBA 3DWVA 3N9JA 4Q5NA 3A3TA 4MCUA 3QR6A 2REMA 2HSYA 4GQFA 2MMNA 4N0ZA 4WBRD 1PKZA 1GULA 4MK3A 1TP9A 13GSA 2WGRA 1A24A 3WGDA 1YZXA 2X64A 4TRXA 1H75A 1M99A 4MJEA 1WMJA 3H93A 3GX0A 5GAND 2HSHA 3F4TA 3HD5A 3MSZA 1GUHA 4MMMA 4OFNA 2VL2C 1K0NA 3L4NA 4L0WA 4YQVA 1PL2A 4PQ1A 4RI6A 4J56E 1YJ6A 1A2JA 3APOA 1XWKA 3D4MA 1GH2A 1RQMA 2DC5A 1U3AA 2RIIA 2MBSA 2LJRA 3W6GA 3MWHA 4LLRA 5JWOB 4E8EA 5B6MA 2M80A 1AC1A 1VGLA 1IYIA 3TKSE 3RDWA 3KP8A 3E0UA 1O7UA 2GS3A 4IQ1A 1ZCPA 2NTOA 2C0GA 5A4WA 1AQWA 2K8SA 3WGXA 2YWIA 4ZBDA 1BG5A 4J57E 4IQAA 2GZZA 1QGVA 3IR4A 3UJ1A 1MDIA 2HE3A 2AB6A 2JL4A 1M2AA 2H66A 1SKSB 5ECHB 3L78A 1VF2A 3GSSA 1T1VA 3L9SA 3H8QA 2OACA 4AF2A 1B4QA 1R7HA 2GT5A 3RBTA 4G10A 5GZZB 1YQ1A 1YF1A 4F2IA 5IPHA 4MP4A 2C4JA 3GRXA 2L4QA 3M0FA 4DVCA 2CVDA 2G2QA 1XWGA 2C8UA 3CRTA 4G2EA 1SL2B 1TJDA 3UVHA 5CO3A 2VCQA 1GRXA 3UOMA 5ECQB 2VCVA 2H73A 3G9BA 4RUVA 4RI7A 4JU5A 3ZFLA 1BAYA 3EU4A 3CTFA 1TK8B 6GSWA 2AJQB 2TRCP 3EURA 10GSA 1FB0A 2BJXA 2N5BA 4XS6A 1FAAA 3ZFBA 1AIUA 1ZMAA 3M1GA 2H0HA 4DSSA 6GSYA 5F8BA 5ECMB 4KDUA 3WD6A 2H30A 1TW9A 2RM6A 4ZBAA 3LJRA 2PMTA 2JZRA 4POLA 14GSA 5HR1A 6GSTA 3MAKA 5ENUA 3PGTA 2LJAA 4F03A 3A2VA 1K0CA 1S3DA 4YH2A 3FR6A 4L5LA 2IFQA 3HCZA 3QAVA 1FVKA 2QC7A 2LRCA 4NPBA 1Z7PA 4ZL8A 3FRCA 1NHOA 1PX6A 8GSSA 3KH7A 2GSQA 2HZEA 5J3RA 4IJIA 4RQXA 4MABA 5G5EA 4XCSA 1G6YA 4O5RA 2V6KA 3GTUB 1UVZA 4LA1A 1WIKA 4XIHA 4ECBA 2R6KA 12GSA 4QQ7A 3H79A 2PVQA 5ECIB 1MD4A 2WRTA 3VWUA 2EC4A 5J9BA 3KD0A 3SBCA 4OD7A 4XTSA 3VURA 3HYPA 1ZOFA 1X5EA 2VOCA 4EL1A 1VRSD 3TRQA 5ELAA 3D22A 3KJYA 2LJKA 1ERVA 4YAPA 2M72A 3F6DA 1EWXA 1EGOA 3QD9A 3ZIVA 5G1KA 5ECPB 2YZHA 1K0BA 4MPFA 1GSYA 2AAWA 3K8NA 3MNGA 4Q5QA 3F3RA 3KH9A 1A0FA 4GWRA 4L5OA 3HZ8A 1T4ZA 4ECCA 2XC2A 4YQUA 3V1WA 2YWNA 2H6ZA
chains in the Genus database with same CATH superfamily
2C3NA 2R2JA 1USBA 5B7CA 2WJUA 3KGKA 2VUPA 4TR1B 1U3IA 2GSTA 4POBA 4K0NA 5F07A 1GNWA 20GSA 2P0GA 3C7MA 5HR0A 3APQA 2DJKA 3FYGA 1C72A 3C8EA 4D73A 3DVXA 4XRDA 2X8GA 2H0GA 5ECRB 2VLVA 1OYJA 3DD3A 4O5UA 1GSDA 1PKWA 2LNSA 4PNFA 2R37A 4TW5A 2NBSA 3TKSC 3F8UA 2B7KA 3ZRDA 1SK1A 1ZYEA 2VL2A 1AQXA 2CZ2A 2L59A 4PTSA 2AHEA 1TU8A 1O85A 1M7TA 2WFCA 4QL7A 4ZB9A 3ME8A 2L5LA 3H4KA 3RPNA 4BVXB 17GSA 2V41A 1DSBA 2MMOA 2CVBA 3IK7A 4DSQA 3FKFA 4TXOB 5L71A 4IW9A 5EVOA 3IAS2 5GSTA 3KMOA 1YEXA 5IM9A 4WF5A 3VFIA 2E7PA 1JZWA 4KDXA 4TKYA 1SL0B 5JWRB 5F06A 5HFKA 3VI7A 3EWLA 1TU7A 2H01A 5IQYA 2VLUA 4HQSA 4K1FA 4JEDA 3HY2A 1PN9A 5CYYA 3IHGA 3Q6OA 2FA8A 3CRUA 2PERA 1F37A 4V2LA 1FOHA 1YEPA 3E3EA 2CAIA 2O7KA 2O87A 5ECNB 4KSOA 4AGSA 1W4VA 3LXTA 2HYXA 2DIZA 2VD0A 1MDJA 1X0RA 1ERWA 1XVWA 2R4VA 3LYPA 1SK2A 1Q4JA 3IAM2 2H19A 3P8WA 4Q5FA 5D96A 1B9YC 2GLRA 4ZXGA 1MTCA 3KCMA 1K0OA 2IN3A 3VWWA 3MDKA 5IO0A 2A2PA 4FYBA 2FNOA 4MNNA 2LKUA 2JU5A 2F8AA 3HXSA 4BVYA 3F0IA 4YAVA 3FK8A 1F9MA 5G2ZA 5CREA 3EINA 3HVSA 2LRTA 3ED3A 5GSSA 1XCCA 1XWCA 6GSXA 1DE1A 2RM5A 1GSQA 3IK9A 1X5DA 22GSA 2VD1A 4HQZA 4XS4B 3P7XA 5CRHA 1O6JA 1T8EB 4RQRA 3IV4A 2ZUPA 4MZWA 2IWTA 1AUCA 3CMIA 3C1SA 2WB9A 3E9JB 3GYKA 4KSMA 1TRWA 2YCDA 4HS1A 2MMAA 5EL8A 3GKXA 2FA4A 1JHBA 4L0UA 3UBLA 1A2MA 2OE3A 4YQMA 1EP8A 1F3AA 2K9FA 5DVBA 4GTUA 2HT9A 4MF6A 5CP1A 2LEGA 3Q74A 2B1LA 1FHEA 1M9AA 4J2FA 2H1AA 3MYDA 2LSTA 3G7IA 2R0CA 1JLVA 2R3XA 5IOWA 1A8LA 1GTIA 3HZ4A 2V1MA 1M0UA 4HEA2 3GH6A 2B6MA 4TR4A 2CT6A 3FZ5A 2RUFA 3BCKA 2FWHA 1H4OA 4EXJA 3D0ZA 1YKCA 2IL3A 4NXIA 1SENA 4F82A 1MDKA 2JACA 4GSNA 1GNEA 3ZVJD 1TKDB 4MJBA 3GH9A 1EEMA 1TI1A 3TKRA 5F05A 4HU7A 3C73A 2OJLA 1PD21 2JADA 1OE8A 4PURA 1SJIA 4PX1A 3PINA 3FZAA 2LUSA 2XPDA 3QAGA 5CNWA 3RAZA 4EE0A 3FZ9A 5ID2A 3HDCA 2ES7A 4IP6A 1J08A 3HA9A 1GTBA 2FLSA 4PQHA 5ELGA 4KE3A 4BWQA 4N30A 4OFTA 4WETA 1GSFA 4P3YB 5LCZA 6GSVA 2FY6A 1EV9A 3DMLA 1Z7RA 3UAPA 3TJFA 2C80A 3WGEA 3LW9A 1ZYPA 1YKAA 1T7PB 4K2DA 1BYEA 3U5RE 4CY6A 3KMNA 1XW9A 1ZZYA 3TGZA 1WWJA 5KOXA 2F51A 3TKSA 1TK5B 1F2EA 4IJ3A 3A5WA 2H71A 3FEUA 5D9WA 2K6VA 3QFBC 5H5QA 4JBBA 1KTEA 2L57A 2VL3A 4MDCA 1BX9A 4GSSA 3AY8A 2H70A 2EIOA 3GIXA 4HUAA 1E2YA 4ZB6A 4O5QA 2E2MA 1M3IA 2D2ZA 5J5NA 1FG4A 3FZ4A 4DSRA 5D93A 3ME7A 3LG6A 2DJJA 4TOPA 4O7HA 3TJJA 3S9FA 2HLSA 1DE2A 2FWFA 1SYRA 1XFLA 2FWEA 2V6OA 4K5SA 5IMAA 1PFOA 2R0PA 2P31A 2A2SA 4ZILA 1K0MA 2FD3A 4IS0A 2VAFA 4ECIA 7GSSA 1UA5A 3PH9A 3GN3A 1RW1A 1OC9B 4N11A 1TDIA 3TCOA 2GZYA 4IHUA 1X9WB 2AYTA 2WCIA 3IBHA 4G0LA 4MJAA 1M2DA 5CRDA 3QCPA 2GDRA 1ML6A 1THXA 1O8WA 2F9SA 5DJMA 4I5QA 5J41A 5B8BA 4ILFA 1XBSA 4IN0A 2VLTA 2HZFA 4Z2UA 2KP2A 5IMVA 4L8EA 3IPZA 4HZ4A 4FIWA 4F0BA 3BJ5A 2QA1A 3A2XA 2KHPA 1TRUA 5KN1A 2H1DA 5D8IA 3QFAC 3GKKA 2XHFA 18GSA 2KP1A 3QAWA 1O73A 2C3TA 5FHIA 2DJ2A 4HU9A 2HSMA 3Q19A 2PN8A 1U88A 2H8LA 3F6FA 2B5XA 2IMIA 4MJCA 4YKFA 3KTLA 1HYUA 1QFNA 4USSA 2YPMA 4KNDA 4MZCA 2X4AA 3TB2A 4CHSA 2YV9A 2KLXA 4DEJA 5BMUA 4PNGA 2I4AA 2WDUA 2VL9A 1OC3A 2H6XA 1O8XA 4BL7B 1WJKA 4OCEA 2OE0A 4AJ6A 5DQSA 4ZL7A 2A2RA 2TRXA 4F9ZA 2H74A 2X99A 2KOKA 3GSTA 5DALB 4FYUA 4KDYA 2HXKA 3IHQA 5IPGA 1Z5YE 2ON7A 2X8HA 5HR3A 1GLPA 3CXGA 3TJGA 5IO2A 1NW2A 4BIKA 1JFUA 1VF1A 4Z7XA 1WE0A 3CBUA 2AUVA 3TRXA 3Q18A 5DAKB 3PR8A 3UL3A 1Z6NA 4KAEA 3GKMA 1EOGA 3WYWA 4I2TA 3CTGA 5G1LA 2YANA 3IRAA 5JWQB 1R4WA 2HRFA 5IMDA 3VI5A 2CX4A 2GZPA 2DIYA 3GHAA 3ZL5A 2X8CA 4LL1B 1OC8A 5EPFA 1SU9A 2DMMA 2PPTA 4KA0A 1NM3A 2MZCA 2DKIA 4ISDA 1UC7A 1F6MC 5C04A 5CRGA 1T00A 2IJYA 1CQHA 4K8MA 4TVEA 2LV3A 5ECKB 5ECOB 1QK8A 4GLTA 1QUWA 1PMTA 1JZDA 3QPMA 4HJ2A 1PRXA 1X9MB 3M3MA 2YNXA 2B5EA 2CA8A 4POKA 4K6XA 1FW1A 4GSTA 4N10A 2JZTA 4ZIJA 2PBJA 4AJ8A 2FWGA 3GMFA 1A0RP 5FWGA 4V2MA 1VF3A 5AIVA 3LSZA 3ERGA 4HDEA 2VO4A 3P2AA 2B7JA 3VLNA 4BA7A 4FQUA 5IMCA 1S3RA 1XVQA 3O3TA 1EP7A 3HJOA 4O92A 2V32A 4MLYA 6GSUA 2R5GA 4GRFA 1IYHA 1Y25A 4PUAA 3RHCA 3TRPA 4MPGA 4KCAA 1FVJA 2NDOA 5DCHA 1I9DA 1OVNA 2CVKA 5HQPA 4AJ7A 4TR0A 3HVNA 4HOJA 1OKDA 1JLWA 1X9SB 5HR2A 4NMUA 1WP0A 4EDZA 1A2LA 1PSQA 2QGVA 2A4HA 1TRVA 2WULA 4PQIA 5KN2A 3GV1A 1Z6MA 2Z9SA 4GCIA 4WR5A 5KN0A 3P90A 1GTAA 3LEFA 3DKSA 1V40A 1GWCA 4K7NA 2DBCA 2WZ9A 3BCIA 5J4UA 4Q5RA 1R26A 1ERUA 2YOIA 4NV2A 1LJRA 2I3YA 3D5JA 1XOAA 1ON4A 3A2WA 1M3JA 1LU4A 4BWSA 3IC4A 2EIRA 2DJ0A 2DJ3A 2VIMA 2GSRA 4HI7A 1A8YA 4MF7A 1FOVA 1N8JA 3DEXA 1BEDA 1V2AA 1K0DA 1GLQA 2EIQA 4OFMA 4ZB8A 2LQQA 5ABRA 1OE7A 3ERWA 2DLXA 4DSSB 5D73A 3I69A 1HD2A 5DCGA 1ZYQB 4KW6A 3ZMKA 1CQGA 2VCXA 2GGTA 1ABAA 2IMKA 4TXVA 3F9UA 2HRKA 3QOUA 3KP9A 3A5IA 3LWAA 3GTUA 2J9HA 4XRAA 2LRNA 1Y6EA 1PN0A 4ECJA 4HJMA 2IFQB 4IGJA 4XS1A 5D9XA 2YV7A 4EKZA 2B5YA 3OR5A 3J7Yb 3J7Yk 4GQCA 4IKHA 4JR6A 1A23A 2CV4A 2DSAA 2E2GA 3RPPA 2RUEA 1PL1A 2C0DA 5EY6A 2LNTA 4NAXA 3WT1A 2TIRA 2HZEB 3VPTA 3I9V2 3G7JA 2VCWA 2GQKA 4X0XA 1XG8A 2IPAA 3TKPA 4MF5A 1SD9A 3ZYWA 1GSEA 2J23A 2YWOA 3W8JA 1HNAA 5B8AA 4LL4B 2BMXA 4MZBA 1AAZA 4JR4A 2OBKA 3D4TA 1E6BA 1ZL9A 4FYCA 4K0GA 4JE1A 1SJZA 3JCML 5KN3A 3R2QA 1TK0B 4OO5A 2H1GA 5DBQA 3NZNA 2AV4A 5IOXA 4TR1A 4V1Ag 2MBTA 2PU9C 4XHMA 3GL3A 4O32A 3TJKA 2C1YA 1ST9A 1XZOA 4KGIA 1GSUA 3BOAA 4ULXA 4K2XA 4IBPA 3GA4A 2V2GA 3IOSA 5GAPD 3ZZXA 1HNCA 2DMLA 1Q98A 2CQ9A 2RLIA 3W8SA 4GF0A 3FY7A 2H75A 3RHBA 4LMWA 2VM2A 2JSZA 1GUKA 2E0QA 4A5PA 4K9ZA 1EZKA 3LXZA 3HVVA 1SD8A 2VCZA 4FO5A 3LFLA 2H1BA 4BVXA 4NHWA 2IMDA 3KTBA 1BJXA 3LYKA 2KUCA 4D73B 4TXOA 1ZGNA 4PXOA 2ZCTA 1XWBA 5LD0A 3KZQA 4ZL9A 1B8XA 1G6WA 2WS2A 2OA7A 3F63A 1B4PA 2O8VB 3DYRA 1TXXA 5H5RA 1DBYA 4IVFA 5J9CA 5E59A 4WF4A 2GSSA 5B6NA 2YP6A 3M9KA 3VPQA 5HFGA 5DQYA 4IELA 4MH3A 1XW6A 1OKTA 5AISA 3CQFA 1K3OA 3G7YA 3DVWA 2GVPA 5COHA 4HZ2A 1LBKA 1GUMA 4GXZA 4OO4A 1B48A 3M9JA 2YN1A 3VWVA 3H1NA 1U6TA 2QKEA 2BTOT 2OE1A 3MIXA 1JZOA 1S3CA 1XIYA 5IMZA 1V58A 1M2BA 3FR9A 2ALBA 3NIVA 4PGTA 5KEJA 2C0FA 2UZ8A 1DUGA 3NOFA 4K7OA 5CRWA 4PUFC 3VK9A 4CW9A 3LQ7A 5G5FA 3UVTA 4KUNA 1Z3EA 3L9VA 3DIEA 4F0CA 2N5AA 1TRSA 5CAXA 5DDLA 2IIYA 1EGRA 1K3LA 1PQNA 2HRAA 2NPBA 3HJMA 2GQLA 2I1UA 1MD3A 3PPUA 1G7OA 1YF0A 4WXTA 1S3AA 4G19A 2F8FA 5JCUA 1R5AA 1JZRA 1AXDA 2R0GA 3D6IA 5A4UA 2I9HA 1J0FA 3HJPA 4XS4A 2O85A 3UARA 1SK0A 2K18A 5FT3A 2FGXA 1AQVA 2MYGA 4KX4A 4BVYB 4I8BA 1EOHA 1TI3A 2C0EA 2PUKC 1TTZA 5D9TA 2HRNA 5JCWA 3HVXA 4V1Ap 1J9BA 1KEBA 2B1KA 1G0TA 1NHYA 2MMZA 4WR4A 2F3MA 3F4SA 4KB3A 3CSIA 3TUEA 2CX3A 3BD2A 2L4CA 1V9WA 2L6DA 5IMFA 3CSJA 4EIQA 4X1UA 3M8NA 3EE2A 1BQ7A 3ZITA 1YDKA 2L6CA 5JCGA 3GFKA 5G30A 5INYA 2HFDA 4H86A 1XWAA 1ZYNA 3CYNA 1SYXA 2M46A 3GNJA 1KBNA 3UBKA 4CDOA 2JZSA 1Z9HA 4K7IA 3N5OA 3EMXA 3KIJA 3F3QA 3LORA 4N0VA 3EMPA 4ML6A 2JSYA 4I97A 2OADA 1O81A 2P5QA 3U6VA 1THOA 4K5RA 1XOBA 4EC0A 1EV4A 4MA9A 5BRTA 2QSIA 5AN1A 3EU3A 5ECLB 3VWXA 3EVIA 1WOUA 3APSA 3QMXA 1T4YA 3GX8A 4FH8A 3US3A 5H5SA 5ECSA 4I6XA 2DJ1A 4I2UA 1X5CA 2VM1A 4POMA 3FR3A 3KXOA 2FHEA 4ZBBA 1N2AA 4ID0A 2NVLA 3DRNA 2HNLA 5HFIA 2YJHA 2YZUA 2H72A 1GTUA 5F0GA 1FO5A 2PGTA 3ZVJA 3C1RA 4EO3A 2B3SA 2N5FA 4X43A 1EEJA 1SKRB 4EVMA 5LNKe 2YJ7A 2OKAA 1GSSA 3QDNA 1FB6A 3KEBA 3UEMA 1QXHA 2P5RA 3L0HA 2L5OA 5ID2B 1OAZA 4ACSA 3O76A 4MH2A 5A5KA 4TR3A 1WPIA 3I6AA 4ML1A 4G0KA 3ZMLA 2PVOC 3IDVA 5E4WA 1U87A 3DGQA 19GSA 3D21A 3ZIJA 1TOFA 3GL5A 3TKQA 2G0FA 5G31A 2H6YA 3O6TA 3HKRA 3TJBA 2CZ3A 3UMAA 1V98A 3GKNA 3TDGA 1V57A 1K0AA 2OBIA 4CY8A 3GURA 16GSA 1B9XC 4OCFA 3ERFA 2LQOA 1XPVA 1OC9A 2K8VA 1SL1B 4IP1A 3L9UA 2DKHA 5C00A 4G0IA 1KNGA 4WEYA 2GQMA 4LMVA 2O89A 4EDYA 3F4RA 3BBYA 5D9VA 2I81A 4Z2TA 3WT2A 2GT6A 2ZNMA 3CSHA 1WRYA 1GL8A 2FUG2 2A4VA 4NV5A 2H0IA 2CAQA 2H76A 1XW5A 2LTKA 3EPTA 3ISOA 1VF4A 1NSWA 1HQOA 1PGTA 4EIPA 1GP1A 1XXUA 11GSA 4JZQA 2IMFA 3UIWA 4V2NA 1URMA 3FW2A 4EF0A 1ACVA 5A4VA 2VCTA 2PWJA 5AGYA 4TN8A 1YY7A 3GUSA 4KCEA 2HI7A 3EC3A 4JRRA 2ON5A 4EUYA 1F3BA 1UN2A 1R5PA 5AIXA 1PX7A 6GSSA 1PA3A 1M9BA 3EYTA 4OWYA 1T3BA 3KM6A 4BL7A 4E8HA 1W89A 3C71A 3TOUA 3ZTLA 3HHVA 4BPYA 9GSSA 3I43A 3FHKA 1HNBA 1QQ2A 5DALA 1ERTA 2FCHA 3IE3A 4OMVA 3LGCA 3ZLPA 2IMEA 1AW9A 2C3QA 2XPEA 1K3YA 1RK4A 3IXRA 2XBQA 5KOWA 4NHZA 2GTUA 4KH7A 1I5GA 3SWLA 5DAKA 2LS5A 2YWMA 3ZREA 5IIZA 3TOTA 4WKWA 4QL9A 1SJ6A 1SKWB 5DJLA 4G9HA 1ILOA 1G7EA 4WBJA 2XBIA 3IA1A 1QMVA 4NWYA 1MEKA 3DXBA 3DWVA 3N9JA 4Q5NA 3A3TA 4MCUA 3QR6A 2REMA 2HSYA 4GQFA 2MMNA 4N0ZA 4WBRD 1PKZA 1GULA 4MK3A 1TP9A 13GSA 2WGRA 1A24A 3WGDA 1YZXA 2X64A 4TRXA 1H75A 1M99A 4MJEA 1WMJA 3H93A 3GX0A 5GAND 2HSHA 3F4TA 3HD5A 3MSZA 1GUHA 4MMMA 4OFNA 2VL2C 1K0NA 3L4NA 4HSCX 4L0WA 4YQVA 4Z2RA 1PL2A 4PQ1A 4RI6A 4J56E 1YJ6A 1A2JA 3APOA 1XWKA 3D4MA 1GH2A 1RQMA 2DC5A 1U3AA 2RIIA 2MBSA 2LJRA 3W6GA 3MWHA 4KF9A 4LLRA 5JWOB 4E8EA 5B6MA 2M80A 1AC1A 1VGLA 1IYIA 3TKSE 3RDWA 3KP8A 3E0UA 1O7UA 2GS3A 4IQ1A 1ZCPA 2NTOA 2C0GA 5A4WA 1AQWA 2K8SA 3WGXA 2YWIA 4ZBDA 1BG5A 4J57E 4IQAA 2GZZA 1QGVA 3IR4A 3UJ1A 1MDIA 2HE3A 2AB6A 4X4JA 2JL4A 1M2AA 2H66A 1SKSB 5ECHB 4ICYA 3L78A 1VF2A 3GSSA 1T1VA 3L9SA 3H8QA 2OACA 4AF2A 1B4QA 1R7HA 2GT5A 3RBTA 4G10A 5GZZB 1YQ1A 1YF1A 4F2IA 5IPHA 4MP4A 2C4JA 3GRXA 2L4QA 3M0FA 4DVCA 2CVDA 2G2QA 1XWGA 2C8UA 3CRTA 4G2EA 1SL2B 1TJDA 3UVHA 5CO3A 2VCQA 1GRXA 3UOMA 5ECQB 2VCVA 2H73A 3G9BA 4RUVA 4RI7A 4JU5A 3ZFLA 1BAYA 3EU4A 3CTFA 1TK8B 6GSWA 2AJQB 2TRCP 3EURA 10GSA 1FB0A 2BJXA 2N5BA 4XS6A 1FAAA 3ZFBA 1AIUA 1ZMAA 3M1GA 2H0HA 4DSSA 6GSYA 5F8BA 5ECMB 4KDUA 3WD6A 2H30A 1TW9A 2RM6A 4ZBAA 3LJRA 2PMTA 2JZRA 4POLA 14GSA 5HR1A 6GSTA 3MAKA 5ENUA 3R3EA 3PGTA 2LJAA 4F03A 3A2VA 1K0CA 1S3DA 4YH2A 3FR6A 4L5LA 2IFQA 3HCZA 3QAVA 1FVKA 2QC7A 2LRCA 4NPBA 1Z7PA 4ZL8A 3FRCA 1NHOA 1PX6A 8GSSA 3IC8A 3KH7A 2GSQA 2HZEA 5J3RA 4IJIA 4RQXA 4MABA 5G5EA 4XCSA 1G6YA 4O5RA 2V6KA 2QA2A 3GTUB 1UVZA 4LA1A 1WIKA 4XIHA 4ECBA 2R6KA 12GSA 4QQ7A 3H79A 2PVQA 5ECIB 1MD4A 2WRTA 3VWUA 2EC4A 5J9BA 3KD0A 3SBCA 4OD7A 4XTSA 3VURA 3HYPA 1ZOFA 1X5EA 2VOCA 4EL1A 1VRSD 3TRQA 5ELAA 3D22A 3KJYA 2LJKA 1ERVA 4YAPA 2M72A 3FMWA 3F6DA 1EWXA 1EGOA 3QD9A 3ZIVA 5G1KA 5ECPB 2YZHA 1K0BA 4MPFA 1GSYA 2AAWA 3K8NA 3MNGA 4Q5QA 3F3RA 2X49A 3KH9A 1A0FA 4GWRA 4L5OA 3HZ8A 1T4ZA 4ECCA 4YKGA 2XC2A 4YQUA 3V1WA 2YWNA 2H6ZA
chains in the Genus database with same CATH topology
2C3NA 2R2JA 1USBA 5B7CA 2WJUA 3KGKA 2VUPA 4TR1B 1U3IA 2GSTA 4POBA 4K0NA 5F07A 1GNWA 20GSA 2P0GA 3C7MA 5HR0A 3APQA 2DJKA 3FYGA 1C72A 3C8EA 4D73A 3DVXA 4XRDA 2X8GA 2H0GA 5ECRB 2VLVA 1OYJA 3DD3A 4O5UA 1GSDA 1PKWA 2LNSA 4PNFA 2R37A 4TW5A 2NBSA 3TKSC 3F8UA 2B7KA 3ZRDA 1SK1A 1ZYEA 2VL2A 1AQXA 2CZ2A 2L59A 4PTSA 2AHEA 1TU8A 1O85A 1M7TA 2WFCA 4QL7A 4ZB9A 3ME8A 2L5LA 3H4KA 3RPNA 4BVXB 17GSA 2V41A 1DSBA 2MMOA 2CVBA 3IK7A 4DSQA 3FKFA 4TXOB 5L71A 4IW9A 5EVOA 3IAS2 5GSTA 3KMOA 1YEXA 5IM9A 4WF5A 3VFIA 2E7PA 1JZWA 4KDXA 4TKYA 1SL0B 5JWRB 5F06A 5HFKA 3VI7A 3EWLA 1TU7A 2H01A 5IQYA 2VLUA 4HQSA 4K1FA 4JEDA 3HY2A 1PN9A 5CYYA 3IHGA 3Q6OA 2FA8A 3CRUA 2PERA 1F37A 4V2LA 1FOHA 1YEPA 3E3EA 2CAIA 2O7KA 2O87A 5ECNB 4KSOA 4AGSA 1W4VA 3LXTA 2HYXA 2DIZA 2VD0A 1MDJA 1X0RA 1ERWA 1XVWA 2R4VA 3LYPA 1SK2A 1Q4JA 3IAM2 2H19A 3P8WA 4Q5FA 5D96A 1B9YC 2GLRA 4ZXGA 1MTCA 3KCMA 1K0OA 2IN3A 3VWWA 3MDKA 5IO0A 2A2PA 4FYBA 2FNOA 4MNNA 2LKUA 2JU5A 2F8AA 3HXSA 4BVYA 3F0IA 4YAVA 3FK8A 1F9MA 5G2ZA 5CREA 3EINA 3HVSA 2LRTA 3ED3A 5GSSA 1XCCA 1XWCA 6GSXA 1DE1A 2RM5A 1GSQA 3IK9A 1X5DA 22GSA 2VD1A 4HQZA 4XS4B 3P7XA 5CRHA 1O6JA 1T8EB 4RQRA 3IV4A 2ZUPA 4MZWA 2IWTA 1AUCA 3CMIA 3C1SA 2WB9A 3E9JB 3GYKA 4KSMA 1TRWA 2YCDA 4HS1A 2MMAA 5EL8A 3GKXA 2FA4A 1JHBA 4L0UA 3UBLA 1A2MA 2OE3A 4YQMA 1EP8A 1F3AA 2K9FA 5DVBA 4GTUA 2HT9A 4MF6A 5CP1A 2LEGA 3Q74A 2B1LA 1FHEA 1M9AA 4J2FA 2H1AA 3MYDA 2LSTA 3G7IA 2R0CA 1JLVA 2R3XA 5IOWA 1A8LA 1GTIA 3HZ4A 2V1MA 1M0UA 4HEA2 3GH6A 2B6MA 4TR4A 2CT6A 3FZ5A 2RUFA 3BCKA 2FWHA 1H4OA 4EXJA 3D0ZA 1YKCA 2IL3A 4NXIA 1SENA 4F82A 1MDKA 2JACA 4GSNA 1GNEA 3ZVJD 1TKDB 4MJBA 3GH9A 1EEMA 1TI1A 3TKRA 5F05A 4HU7A 3C73A 2OJLA 1PD21 2JADA 1OE8A 4PURA 1SJIA 4PX1A 3PINA 3FZAA 2LUSA 2XPDA 3QAGA 5CNWA 3RAZA 4EE0A 3FZ9A 5ID2A 3HDCA 2ES7A 4IP6A 1J08A 3HA9A 1GTBA 2FLSA 4PQHA 5ELGA 4KE3A 4BWQA 4N30A 4OFTA 4WETA 1GSFA 4P3YB 5LCZA 6GSVA 2FY6A 1EV9A 3DMLA 1Z7RA 3UAPA 3TJFA 2C80A 3WGEA 3LW9A 1ZYPA 1YKAA 1T7PB 4K2DA 1BYEA 3U5RE 4CY6A 3KMNA 1XW9A 1ZZYA 3TGZA 1WWJA 5KOXA 2F51A 3TKSA 1TK5B 1F2EA 4IJ3A 3A5WA 2H71A 3FEUA 5D9WA 2K6VA 3QFBC 5H5QA 4JBBA 1KTEA 2L57A 2VL3A 4MDCA 1BX9A 4GSSA 3AY8A 2H70A 2EIOA 3GIXA 4HUAA 1E2YA 4ZB6A 4O5QA 2E2MA 2D2ZA 5J5NA 1FG4A 3FZ4A 4DSRA 5D93A 3ME7A 3LG6A 2DJJA 4TOPA 4O7HA 3TJJA 3S9FA 2HLSA 1DE2A 2FWFA 1SYRA 1XFLA 2FWEA 2V6OA 4K5SA 5IMAA 2R0PA 2P31A 2A2SA 4ZILA 1K0MA 2FD3A 4IS0A 2VAFA 4ECIA 7GSSA 1UA5A 3PH9A 3GN3A 1RW1A 1OC9B 4N11A 1TDIA 3TCOA 2GZYA 4IHUA 1X9WB 2AYTA 2WCIA 3IBHA 4G0LA 4MJAA 1M2DA 5CRDA 3QCPA 2GDRA 1ML6A 1THXA 1O8WA 2F9SA 5DJMA 4I5QA 5J41A 5B8BA 4ILFA 1XBSA 4IN0A 2VLTA 2HZFA 4Z2UA 2KP2A 5IMVA 4L8EA 3IPZA 4HZ4A 4FIWA 4F0BA 3BJ5A 2QA1A 3A2XA 2KHPA 1TRUA 5KN1A 2H1DA 5D8IA 3QFAC 3GKKA 2XHFA 18GSA 2KP1A 3QAWA 1O73A 2C3TA 5FHIA 2DJ2A 4HU9A 2HSMA 3Q19A 2PN8A 1U88A 2H8LA 3F6FA 2B5XA 2IMIA 4MJCA 4YKFA 3KTLA 1HYUA 1QFNA 4USSA 2YPMA 4KNDA 4MZCA 2X4AA 3TB2A 4CHSA 2YV9A 2KLXA 4DEJA 5BMUA 4PNGA 2I4AA 2WDUA 2VL9A 1OC3A 2H6XA 1O8XA 4BL7B 1WJKA 4OCEA 2OE0A 4AJ6A 5DQSA 4ZL7A 2A2RA 2TRXA 4F9ZA 2H74A 2X99A 2KOKA 3GSTA 5DALB 4FYUA 4KDYA 2HXKA 3IHQA 5IPGA 1Z5YE 2ON7A 2X8HA 5HR3A 1GLPA 3CXGA 3TJGA 5IO2A 1NW2A 1JFUA 1VF1A 4Z7XA 1WE0A 3CBUA 2AUVA 3TRXA 3Q18A 5DAKB 3PR8A 3UL3A 1Z6NA 4KAEA 3GKMA 1EOGA 3WYWA 4I2TA 3CTGA 5G1LA 2YANA 3IRAA 5JWQB 1R4WA 2HRFA 5IMDA 3VI5A 2CX4A 2GZPA 2DIYA 3GHAA 3ZL5A 2X8CA 4LL1B 1OC8A 5EPFA 1SU9A 2DMMA 2PPTA 4KA0A 1NM3A 2MZCA 2DKIA 4ISDA 1UC7A 1F6MC 5C04A 5CRGA 1T00A 2IJYA 1CQHA 4K8MA 4TVEA 2LV3A 5ECKB 5ECOB 1QK8A 4GLTA 1QUWA 1PMTA 1JZDA 3QPMA 4HJ2A 1PRXA 1X9MB 3M3MA 2YNXA 2B5EA 2CA8A 4POKA 4K6XA 1FW1A 4GSTA 4N10A 2JZTA 4ZIJA 2PBJA 4AJ8A 2FWGA 3GMFA 1A0RP 5FWGA 4V2MA 1VF3A 5AIVA 3LSZA 3ERGA 4HDEA 2VO4A 3P2AA 2B7JA 3VLNA 4BA7A 4FQUA 5IMCA 1XVQA 3O3TA 1EP7A 3HJOA 4O92A 2V32A 4MLYA 6GSUA 2R5GA 4GRFA 1IYHA 1Y25A 4PUAA 3RHCA 3TRPA 4MPGA 4KCAA 1FVJA 2NDOA 5DCHA 1I9DA 1OVNA 2CVKA 5HQPA 4AJ7A 4TR0A 4HOJA 1OKDA 1JLWA 1X9SB 5HR2A 4NMUA 1WP0A 4EDZA 1A2LA 1PSQA 2QGVA 2A4HA 1TRVA 2WULA 4PQIA 5KN2A 3GV1A 1Z6MA 2Z9SA 4GCIA 4WR5A 5KN0A 3P90A 1GTAA 3LEFA 3DKSA 1V40A 1GWCA 4K7NA 2DBCA 2WZ9A 3BCIA 5J4UA 4Q5RA 1R26A 1ERUA 2YOIA 4NV2A 1LJRA 2I3YA 3D5JA 1XOAA 1ON4A 3A2WA 1LU4A 4BWSA 3IC4A 2EIRA 2DJ0A 2DJ3A 2VIMA 2GSRA 4HI7A 1A8YA 4MF7A 1FOVA 1N8JA 3DEXA 1BEDA 1V2AA 1K0DA 1GLQA 2EIQA 4OFMA 4ZB8A 2LQQA 5ABRA 1OE7A 3ERWA 2DLXA 4DSSB 5D73A 3I69A 1HD2A 5DCGA 1ZYQB 4KW6A 3ZMKA 1CQGA 2VCXA 2GGTA 1ABAA 2IMKA 4TXVA 3F9UA 2HRKA 3QOUA 3KP9A 3A5IA 3LWAA 3GTUA 2J9HA 4XRAA 2LRNA 1Y6EA 1PN0A 4ECJA 4HJMA 2IFQB 4IGJA 4XS1A 5D9XA 2YV7A 4EKZA 2B5YA 3OR5A 3J7Yb 3J7Yk 4GQCA 4IKHA 4JR6A 1A23A 2CV4A 2DSAA 2E2GA 3RPPA 2RUEA 1PL1A 2C0DA 5EY6A 2LNTA 4NAXA 3WT1A 2TIRA 2HZEB 3VPTA 3I9V2 3G7JA 2VCWA 2GQKA 4X0XA 2IPAA 3TKPA 4MF5A 1SD9A 3ZYWA 1GSEA 2J23A 2YWOA 3W8JA 1HNAA 5B8AA 4LL4B 2BMXA 4MZBA 1AAZA 4JR4A 2OBKA 3D4TA 1E6BA 1ZL9A 4FYCA 4K0GA 4JE1A 1SJZA 3JCML 5KN3A 3R2QA 1TK0B 4OO5A 2H1GA 5DBQA 3NZNA 2AV4A 5IOXA 4TR1A 4V1Ag 2MBTA 2PU9C 4XHMA 3GL3A 4O32A 3TJKA 2C1YA 1ST9A 1XZOA 4KGIA 1GSUA 3BOAA 4ULXA 4K2XA 4IBPA 3GA4A 2V2GA 3IOSA 5GAPD 3ZZXA 1HNCA 2DMLA 1Q98A 2CQ9A 2RLIA 3W8SA 4GF0A 3FY7A 2H75A 3RHBA 4LMWA 2VM2A 2JSZA 1GUKA 2E0QA 4A5PA 4K9ZA 1EZKA 3LXZA 3HVVA 1SD8A 2VCZA 4FO5A 3LFLA 2H1BA 4BVXA 4NHWA 2IMDA 3KTBA 1BJXA 3LYKA 2KUCA 4D73B 4TXOA 1ZGNA 4PXOA 2ZCTA 1XWBA 5LD0A 3KZQA 4ZL9A 1B8XA 1G6WA 2WS2A 2OA7A 3F63A 1B4PA 2O8VB 3DYRA 1TXXA 5H5RA 1DBYA 4IVFA 5J9CA 5E59A 4WF4A 2GSSA 5B6NA 2YP6A 3M9KA 3VPQA 5HFGA 5DQYA 4IELA 4MH3A 1XW6A 1OKTA 5AISA 1K3OA 3G7YA 3DVWA 2GVPA 5COHA 4HZ2A 1LBKA 1GUMA 4GXZA 4OO4A 1B48A 3M9JA 2YN1A 3VWVA 3H1NA 1U6TA 2QKEA 2BTOT 2OE1A 3MIXA 1JZOA 1S3CA 1XIYA 5IMZA 1V58A 1M2BA 3FR9A 2ALBA 3NIVA 4PGTA 5KEJA 2C0FA 2UZ8A 1DUGA 3NOFA 4K7OA 5CRWA 4PUFC 3VK9A 4CW9A 3LQ7A 5G5FA 3UVTA 4KUNA 1Z3EA 3L9VA 3DIEA 4F0CA 2N5AA 1TRSA 5CAXA 5DDLA 2IIYA 1EGRA 1K3LA 1PQNA 2HRAA 2NPBA 3HJMA 2GQLA 2I1UA 1MD3A 3PPUA 1G7OA 1YF0A 4WXTA 1S3AA 4G19A 2F8FA 5JCUA 1R5AA 1JZRA 1AXDA 2R0GA 3D6IA 5A4UA 2I9HA 1J0FA 3HJPA 4XS4A 2O85A 3UARA 1SK0A 2K18A 5FT3A 2FGXA 1AQVA 2MYGA 4KX4A 4BVYB 4I8BA 1EOHA 1TI3A 2C0EA 2PUKC 1TTZA 5D9TA 2HRNA 5JCWA 3HVXA 4V1Ap 1J9BA 1KEBA 2B1KA 1G0TA 1NHYA 2MMZA 4WR4A 2F3MA 3F4SA 4KB3A 3CSIA 3TUEA 2CX3A 3BD2A 2L4CA 1V9WA 2L6DA 5IMFA 3CSJA 4EIQA 4X1UA 3M8NA 3EE2A 1BQ7A 3ZITA 1YDKA 2L6CA 5JCGA 3GFKA 5G30A 5INYA 2HFDA 4H86A 1XWAA 1ZYNA 3CYNA 1SYXA 2M46A 3GNJA 1KBNA 3UBKA 4CDOA 2JZSA 1Z9HA 4K7IA 3N5OA 3EMXA 3KIJA 3F3QA 3LORA 4N0VA 3EMPA 4ML6A 2JSYA 4I97A 2OADA 1O81A 2P5QA 3U6VA 1THOA 4K5RA 1XOBA 4EC0A 1EV4A 4MA9A 5BRTA 2QSIA 5AN1A 3EU3A 5ECLB 3VWXA 3EVIA 1WOUA 3APSA 3QMXA 1T4YA 3GX8A 4FH8A 3US3A 5H5SA 5ECSA 4I6XA 2DJ1A 4I2UA 1X5CA 2VM1A 4POMA 3FR3A 3KXOA 2FHEA 4ZBBA 1N2AA 4ID0A 2NVLA 3DRNA 2HNLA 5HFIA 2YJHA 2YZUA 2H72A 1GTUA 5F0GA 1FO5A 2PGTA 3ZVJA 3C1RA 4EO3A 2B3SA 2N5FA 4X43A 1EEJA 1SKRB 4EVMA 5LNKe 2YJ7A 2OKAA 1GSSA 3QDNA 1FB6A 3KEBA 3UEMA 1QXHA 2P5RA 3L0HA 2L5OA 5ID2B 1OAZA 4ACSA 3O76A 4MH2A 5A5KA 4TR3A 1WPIA 3I6AA 4ML1A 4G0KA 3ZMLA 2PVOC 3IDVA 5E4WA 1U87A 3DGQA 19GSA 3D21A 3ZIJA 1TOFA 3GL5A 3TKQA 2G0FA 5G31A 2H6YA 3O6TA 3HKRA 3TJBA 2CZ3A 3UMAA 1V98A 3GKNA 3TDGA 1V57A 1K0AA 2OBIA 4CY8A 3GURA 16GSA 1B9XC 4OCFA 3ERFA 2LQOA 1XPVA 1OC9A 2K8VA 1SL1B 4IP1A 3L9UA 2DKHA 5C00A 4G0IA 1KNGA 4WEYA 2GQMA 4LMVA 2O89A 4EDYA 3F4RA 3BBYA 5D9VA 2I81A 4Z2TA 3WT2A 2GT6A 2ZNMA 3CSHA 1WRYA 1GL8A 2FUG2 2A4VA 4NV5A 2H0IA 2CAQA 2H76A 1XW5A 2LTKA 3EPTA 3ISOA 1VF4A 1NSWA 1HQOA 1PGTA 4EIPA 1GP1A 1XXUA 11GSA 4JZQA 2IMFA 3UIWA 4V2NA 1URMA 3FW2A 4EF0A 1ACVA 5A4VA 2VCTA 2PWJA 5AGYA 4TN8A 1YY7A 3GUSA 4KCEA 2HI7A 3EC3A 4JRRA 2ON5A 4EUYA 1F3BA 1UN2A 1R5PA 5AIXA 1PX7A 6GSSA 1PA3A 1M9BA 3EYTA 4OWYA 1T3BA 3KM6A 4BL7A 4E8HA 1W89A 3C71A 3TOUA 3ZTLA 3HHVA 4BPYA 9GSSA 3I43A 3FHKA 1HNBA 1QQ2A 5DALA 1ERTA 2FCHA 3IE3A 4OMVA 3LGCA 3ZLPA 2IMEA 1AW9A 2C3QA 2XPEA 1K3YA 1RK4A 3IXRA 2XBQA 5KOWA 4NHZA 2GTUA 4KH7A 1I5GA 3SWLA 5DAKA 2LS5A 2YWMA 3ZREA 5IIZA 3TOTA 4WKWA 4QL9A 1SJ6A 1SKWB 5DJLA 4G9HA 1ILOA 1G7EA 4WBJA 2XBIA 3IA1A 1QMVA 4NWYA 1MEKA 3DXBA 3DWVA 3N9JA 4Q5NA 3A3TA 4MCUA 3QR6A 2REMA 2HSYA 4GQFA 2MMNA 4N0ZA 4WBRD 1PKZA 1GULA 4MK3A 1TP9A 13GSA 2WGRA 1A24A 3WGDA 1YZXA 2X64A 4TRXA 1H75A 1M99A 4MJEA 1WMJA 3H93A 3GX0A 5GAND 2HSHA 3F4TA 3HD5A 3MSZA 1GUHA 4MMMA 4OFNA 2VL2C 1K0NA 3L4NA 4L0WA 4YQVA 4Z2RA 1PL2A 4PQ1A 4RI6A 4J56E 1YJ6A 1A2JA 3APOA 1XWKA 3D4MA 1GH2A 1RQMA 2DC5A 1U3AA 2RIIA 2MBSA 2LJRA 3W6GA 3MWHA 4KF9A 4LLRA 5JWOB 4E8EA 5B6MA 2M80A 1AC1A 1VGLA 1IYIA 3TKSE 3RDWA 3KP8A 3E0UA 1O7UA 2GS3A 4IQ1A 1ZCPA 2NTOA 2C0GA 5A4WA 1AQWA 2K8SA 3WGXA 2YWIA 4ZBDA 1BG5A 4J57E 4IQAA 2GZZA 1QGVA 3IR4A 3UJ1A 1MDIA 2HE3A 2AB6A 4X4JA 2JL4A 1M2AA 2H66A 1SKSB 5ECHB 4ICYA 3L78A 1VF2A 3GSSA 1T1VA 3L9SA 3H8QA 2OACA 4AF2A 1B4QA 1R7HA 2GT5A 3RBTA 4G10A 5GZZB 1YQ1A 1YF1A 4F2IA 5IPHA 4MP4A 2C4JA 3GRXA 2L4QA 3M0FA 4DVCA 2CVDA 2G2QA 1XWGA 2C8UA 3CRTA 4G2EA 1SL2B 1TJDA 3UVHA 5CO3A 2VCQA 1GRXA 3UOMA 5ECQB 2VCVA 2H73A 3G9BA 4RUVA 4RI7A 4JU5A 3ZFLA 1BAYA 3EU4A 3CTFA 1TK8B 6GSWA 2AJQB 2TRCP 3EURA 10GSA 1FB0A 2BJXA 2N5BA 4XS6A 1FAAA 3ZFBA 1AIUA 1ZMAA 3M1GA 2H0HA 4DSSA 6GSYA 5F8BA 5ECMB 4KDUA 3WD6A 2H30A 1TW9A 2RM6A 4ZBAA 3LJRA 2PMTA 2JZRA 4POLA 14GSA 5HR1A 6GSTA 3MAKA 5ENUA 3R3EA 3PGTA 2LJAA 4F03A 3A2VA 1K0CA 1S3DA 4YH2A 3FR6A 4L5LA 2IFQA 3HCZA 3QAVA 1FVKA 2QC7A 2LRCA 4NPBA 1Z7PA 4ZL8A 3FRCA 1NHOA 1PX6A 8GSSA 3IC8A 3KH7A 2GSQA 2HZEA 5J3RA 4IJIA 4RQXA 4MABA 5G5EA 4XCSA 1G6YA 4O5RA 2V6KA 2QA2A 3GTUB 1UVZA 4LA1A 1WIKA 4XIHA 4ECBA 2R6KA 12GSA 4QQ7A 3H79A 2PVQA 5ECIB 1MD4A 2WRTA 3VWUA 2EC4A 5J9BA 3KD0A 3SBCA 4OD7A 4XTSA 3VURA 3HYPA 1ZOFA 1X5EA 2VOCA 4EL1A 1VRSD 3TRQA 5ELAA 3D22A 3KJYA 2LJKA 1ERVA 4YAPA 2M72A 3FMWA 3F6DA 1EWXA 1EGOA 3QD9A 3ZIVA 5G1KA 5ECPB 2YZHA 1K0BA 4MPFA 1GSYA 2AAWA 3K8NA 3MNGA 4Q5QA 3F3RA 2X49A 3KH9A 1A0FA 4GWRA 4L5OA 3HZ8A 1T4ZA 4ECCA 4YKGA 2XC2A 4YQUA 3V1WA 2YWNA 2H6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C3N A;  2R2J A;  1USB A;  5B7C A;  2WJU A;  3KGK A;  2VUP A;  4TR1 B;  1U3I A;  2GST A;  4POB A;  4K0N A;  5F07 A;  1GNW A;  20GS A;  2P0G A;  3C7M A;  5HR0 A;  3APQ A;  2DJK A;  3FYG A;  1C72 A;  3C8E A;  4D73 A;  3DVX A;  4XRD A;  2X8G A;  2H0G A;  5ECR B;  2VLV A;  1OYJ A;  3DD3 A;  1GSD A;  1PKW A;  2LNS A;  4PNF A;  2R37 A;  4TW5 A;  2NBS A;  3TKS C;  3F8U A;  2B7K A;  3ZRD A;  1SK1 A;  1ZYE A;  2VL2 A;  1AQX A;  2CZ2 A;  2L59 A;  2AHE A;  1TU8 A;  1O85 A;  1M7T A;  2WFC A;  4QL7 A;  4ZB9 A;  3ME8 A;  2L5L A;  3H4K A;  3RPN A;  17GS A;  2V41 A;  1DSB A;  2MMO A;  2CVB A;  3IK7 A;  4DSQ A;  3FKF A;  4TXO B;  5L71 A;  4IW9 A;  5EVO A;  3IAS 2;  5GST A;  3KMO A;  1YEX A;  5IM9 A;  4WF5 A;  3VFI A;  2E7P A;  1JZW A;  4KDX A;  4TKY A;  1SL0 B;  5JWR B;  5F06 A;  5HFK A;  3VI7 A;  3EWL A;  1TU7 A;  2H01 A;  5IQY A;  2VLU A;  4HQS A;  4K1F A;  4JED A;  3HY2 A;  1PN9 A;  5CYY A;  3Q6O A;  2FA8 A;  3CRU A;  2PER A;  1F37 A;  4V2L A;  1YEP A;  3E3E A;  2CAI A;  2O7K A;  2O87 A;  5ECN B;  4KSO A;  4AGS A;  1W4V A;  3LXT A;  2HYX A;  2DIZ A;  2VD0 A;  1MDJ A;  1X0R A;  1ERW A;  1XVW A;  2R4V A;  3LYP A;  1SK2 A;  1Q4J A;  3IAM 2;  2H19 A;  3P8W A;  4Q5F A;  5D96 A;  1B9Y C;  2GLR A;  4ZXG A;  1MTC A;  3KCM A;  1K0O A;  2IN3 A;  3VWW A;  3MDK A;  5IO0 A;  4FYB A;  2FNO A;  2LKU A;  2JU5 A;  2F8A A;  3HXS A;  4BVY A;  3F0I A;  4YAV A;  3FK8 A;  1F9M A;  5G2Z A;  5CRE A;  3EIN A;  3HVS A;  2LRT A;  3ED3 A;  5GSS A;  1XCC A;  1XWC A;  6GSX A;  1DE1 A;  2RM5 A;  1GSQ A;  3IK9 A;  1X5D A;  22GS A;  2VD1 A;  4HQZ A;  4XS4 B;  3P7X A;  5CRH A;  1O6J A;  1T8E B;  4RQR A;  3IV4 A;  2ZUP A;  4MZW A;  2IWT A;  1AUC A;  3CMI A;  3C1S A;  2WB9 A;  3E9J B;  3GYK A;  4KSM A;  1TRW A;  2YCD A;  4HS1 A;  2MMA A;  5EL8 A;  3GKX A;  2FA4 A;  1JHB A;  4L0U A;  3UBL A;  1A2M A;  2OE3 A;  4YQM A;  1EP8 A;  1F3A A;  2K9F A;  5DVB A;  4GTU A;  2HT9 A;  4MF6 A;  5CP1 A;  2LEG A;  3Q74 A;  2B1L A;  1FHE A;  1M9A A;  4J2F A;  2H1A A;  2LST A;  3G7I A;  1JLV A;  2R3X A;  5IOW A;  1A8L A;  1GTI A;  3HZ4 A;  2V1M A;  1M0U A;  4HEA 2;  3GH6 A;  2B6M A;  4TR4 A;  2CT6 A;  3FZ5 A;  2RUF A;  3BCK A;  2FWH A;  1H4O A;  4EXJ A;  3D0Z A;  1YKC A;  2IL3 A;  4NXI A;  1SEN A;  4F82 A;  1MDK A;  2JAC A;  4GSN A;  1GNE A;  3ZVJ D;  1TKD B;  4MJB A;  3GH9 A;  1EEM A;  1TI1 A;  3TKR A;  5F05 A;  4HU7 A;  3C73 A;  2OJL A;  1PD2 1;  2JAD A;  1OE8 A;  4PUR A;  1SJI A;  4PX1 A;  3PIN A;  3FZA A;  2LUS A;  2XPD A;  3QAG A;  5CNW A;  3RAZ A;  4EE0 A;  3FZ9 A;  5ID2 A;  3HDC A;  2ES7 A;  4IP6 A;  1J08 A;  3HA9 A;  1GTB A;  2FLS A;  4PQH A;  5ELG A;  4KE3 A;  4BWQ A;  4N30 A;  4OFT A;  4WET A;  1GSF A;  4P3Y B;  5LCZ A;  6GSV A;  2FY6 A;  1EV9 A;  3DML A;  1Z7R A;  3UAP A;  3TJF A;  2C80 A;  3WGE A;  1YKA A;  1T7P B;  4K2D A;  1BYE A;  3U5R E;  3KMN A;  1XW9 A;  1ZZY A;  3TGZ A;  1WWJ A;  2F51 A;  3TKS A;  1TK5 B;  1F2E A;  4IJ3 A;  3A5W A;  2H71 A;  3FEU A;  5D9W A;  2K6V A;  3QFB C;  5H5Q A;  4JBB A;  1KTE A;  2L57 A;  2VL3 A;  4MDC A;  1BX9 A;  4GSS A;  3AY8 A;  2H70 A;  2EIO A;  3GIX A;  4HUA A;  1E2Y A;  4ZB6 A;  2E2M A;  2D2Z A;  5J5N A;  1FG4 A;  3FZ4 A;  4DSR A;  5D93 A;  3ME7 A;  3LG6 A;  2DJJ A;  4TOP A;  4O7H A;  3TJJ A;  3S9F A;  2HLS A;  1DE2 A;  2FWF A;  1SYR A;  1XFL A;  2FWE A;  2V6O A;  5IMA A;  2P31 A;  2A2S A;  4ZIL A;  1K0M A;  2FD3 A;  4IS0 A;  2VAF A;  4ECI A;  7GSS A;  1UA5 A;  3PH9 A;  3GN3 A;  1RW1 A;  1OC9 B;  4N11 A;  1TDI A;  3TCO A;  2GZY A;  4IHU A;  1X9W B;  2AYT A;  2WCI A;  3IBH A;  4MJA A;  1M2D A;  5CRD A;  3QCP A;  2GDR A;  1ML6 A;  1THX A;  1O8W A;  2F9S A;  5DJM A;  4I5Q A;  5J41 A;  5B8B A;  4ILF A;  1XBS A;  4IN0 A;  2VLT A;  2HZF A;  5IMV A;  2KP2 A;  4L8E A;  3IPZ A;  4HZ4 A;  4FIW A;  4F0B A;  3BJ5 A;  3A2X A;  2KHP A;  1TRU A;  5KN1 A;  2H1D A;  5D8I A;  3QFA C;  3GKK A;  2XHF A;  18GS A;  2KP1 A;  3QAW A;  1O73 A;  2C3T A;  5FHI A;  2DJ2 A;  4HU9 A;  3Q19 A;  2PN8 A;  1U88 A;  2H8L A;  3F6F A;  2B5X A;  2IMI A;  4MJC A;  3KTL A;  1HYU A;  1QFN A;  2YPM A;  4KND A;  4MZC A;  3TB2 A;  4CHS A;  2YV9 A;  2KLX A;  4DEJ A;  4PNG A;  2I4A A;  2WDU A;  2VL9 A;  1OC3 A;  2H6X A;  1O8X A;  1WJK A;  4OCE A;  2OE0 A;  4AJ6 A;  5DQS A;  4ZL7 A;  2A2R A;  2TRX A;  4F9Z A;  2H74 A;  2X99 A;  2KOK A;  3GST A;  5DAL B;  4FYU A;  4KDY A;  2HXK A;  3IHQ A;  5IPG A;  1Z5Y E;  2ON7 A;  2X8H A;  5HR3 A;  1GLP A;  3CXG A;  3TJG A;  5IO2 A;  1NW2 A;  1JFU A;  1VF1 A;  4Z7X A;  1WE0 A;  3CBU A;  2AUV A;  3TRX A;  3Q18 A;  5DAK B;  3PR8 A;  3UL3 A;  1Z6N A;  4KAE A;  3GKM A;  1EOG A;  3WYW A;  4I2T A;  3CTG A;  5G1L A;  2YAN A;  3IRA A;  5JWQ B;  1R4W A;  2HRF A;  5IMD A;  3VI5 A;  2CX4 A;  2GZP A;  2DIY A;  3GHA A;  3ZL5 A;  2X8C A;  4LL1 B;  1OC8 A;  5EPF A;  1SU9 A;  2DMM A;  2PPT A;  4KA0 A;  1NM3 A;  2MZC A;  4ISD A;  1UC7 A;  1F6M C;  5C04 A;  5CRG A;  1T00 A;  2IJY A;  1CQH A;  4K8M A;  4TVE A;  2LV3 A;  5ECK B;  5ECO B;  1QK8 A;  4GLT A;  1QUW A;  1PMT A;  1JZD A;  3QPM A;  4HJ2 A;  1PRX A;  1X9M B;  3M3M A;  2YNX A;  2B5E A;  2CA8 A;  4POK A;  4K6X A;  1FW1 A;  4GST A;  4N10 A;  2JZT A;  4ZIJ A;  2PBJ A;  4AJ8 A;  2FWG A;  3GMF A;  1A0R P;  5FWG A;  4V2M A;  1VF3 A;  5AIV A;  3LSZ A;  3ERG A;  4HDE A;  2VO4 A;  3P2A A;  2B7J A;  3VLN A;  4BA7 A;  5IMC A;  1XVQ A;  3O3T A;  1EP7 A;  3HJO A;  4O92 A;  2V32 A;  4MLY A;  6GSU A;  2R5G A;  4GRF A;  1IYH A;  1Y25 A;  4PUA A;  3RHC A;  3TRP A;  4MPG A;  4KCA A;  1FVJ A;  2NDO A;  5DCH A;  1I9D A;  1OVN A;  2CVK A;  5HQP A;  4AJ7 A;  4TR0 A;  4HOJ A;  1OKD A;  1JLW A;  1X9S B;  5HR2 A;  4NMU A;  1WP0 A;  4EDZ A;  1A2L A;  1PSQ A;  2QGV A;  1TRV A;  2WUL A;  4PQI A;  5KN2 A;  3GV1 A;  1Z6M A;  2Z9S A;  4GCI A;  4WR5 A;  5KN0 A;  3P90 A;  1GTA A;  3LEF A;  3DKS A;  1V40 A;  1GWC A;  4K7N A;  2DBC A;  2WZ9 A;  3BCI A;  5J4U A;  4Q5R A;  1R26 A;  1ERU A;  2YOI A;  4NV2 A;  1LJR A;  2I3Y A;  3D5J A;  1XOA A;  1ON4 A;  3A2W A;  1LU4 A;  4BWS A;  3IC4 A;  2EIR A;  2DJ0 A;  2DJ3 A;  2VIM A;  2GSR A;  4HI7 A;  1A8Y A;  4MF7 A;  1FOV A;  1N8J A;  3DEX A;  1BED A;  1V2A A;  1K0D A;  1GLQ A;  2EIQ A;  4OFM A;  4ZB8 A;  2LQQ A;  5ABR A;  1OE7 A;  3ERW A;  2DLX A;  4DSS B;  5D73 A;  3I69 A;  1HD2 A;  5DCG A;  1ZYQ B;  4KW6 A;  3ZMK A;  1CQG A;  2VCX A;  2GGT A;  1ABA A;  2IMK A;  4TXV A;  3F9U A;  3QOU A;  3KP9 A;  3LWA A;  3GTU A;  2J9H A;  4XRA A;  2LRN A;  1Y6E A;  4ECJ A;  4HJM A;  2IFQ B;  4IGJ A;  4XS1 A;  5D9X A;  2YV7 A;  4EKZ A;  2B5Y A;  3OR5 A;  3J7Y b;  3J7Y k;  4GQC A;  4IKH A;  4JR6 A;  1A23 A;  2CV4 A;  2DSA A;  2E2G A;  3RPP A;  2RUE A;  1PL1 A;  2C0D A;  5EY6 A;  2LNT A;  4NAX A;  3WT1 A;  2TIR A;  2HZE B;  3VPT A;  3I9V 2;  3G7J A;  2VCW A;  2GQK A;  4X0X A;  2IPA A;  3TKP A;  4MF5 A;  1SD9 A;  3ZYW A;  1GSE A;  2J23 A;  2YWO A;  3W8J A;  1HNA A;  5B8A A;  4LL4 B;  2BMX A;  4MZB A;  1AAZ A;  4JR4 A;  2OBK A;  3D4T A;  1E6B A;  1ZL9 A;  4FYC A;  4K0G A;  4JE1 A;  1SJZ A;  3JCM L;  5KN3 A;  3R2Q A;  1TK0 B;  4OO5 A;  2H1G A;  5DBQ A;  3NZN A;  2AV4 A;  5IOX A;  4TR1 A;  4V1A g;  2MBT A;  2PU9 C;  4XHM A;  3GL3 A;  4O32 A;  3TJK A;  2C1Y A;  1ST9 A;  1XZO A;  4KGI A;  1GSU A;  3BOA A;  4ULX A;  4IBP A;  3GA4 A;  2V2G A;  3IOS A;  5GAP D;  3ZZX A;  1HNC A;  2DML A;  1Q98 A;  2CQ9 A;  2RLI A;  3W8S A;  4GF0 A;  3FY7 A;  2H75 A;  3RHB A;  4LMW A;  2VM2 A;  2JSZ A;  1GUK A;  2E0Q A;  4K9Z A;  1EZK A;  3LXZ A;  3HVV A;  1SD8 A;  2VCZ A;  4FO5 A;  3LFL A;  2H1B A;  4BVX A;  4NHW A;  2IMD A;  3KTB A;  1BJX A;  3LYK A;  2KUC A;  4D73 B;  4TXO A;  1ZGN A;  4PXO A;  2ZCT A;  1XWB A;  5LD0 A;  3KZQ A;  4ZL9 A;  1B8X A;  1G6W A;  2WS2 A;  2OA7 A;  3F63 A;  1B4P A;  2O8V B;  3DYR A;  1TXX A;  5H5R A;  1DBY A;  4IVF A;  5J9C A;  5E59 A;  4WF4 A;  2GSS A;  5B6N A;  2YP6 A;  3M9K A;  3VPQ A;  5HFG A;  5DQY A;  4IEL A;  4MH3 A;  1XW6 A;  1OKT A;  5AIS A;  1K3O A;  3G7Y A;  3DVW A;  2GVP A;  5COH A;  4HZ2 A;  1LBK A;  1GUM A;  4GXZ A;  4OO4 A;  1B48 A;  3M9J A;  2YN1 A;  3VWV A;  3H1N A;  1U6T A;  2QKE A;  2BTO T;  2OE1 A;  1JZO A;  1S3C A;  1XIY A;  5IMZ A;  1V58 A;  1M2B A;  3FR9 A;  2ALB A;  3NIV A;  4PGT A;  5KEJ A;  2C0F A;  1DUG A;  3NOF A;  4K7O A;  5CRW A;  4PUF C;  3VK9 A;  4CW9 A;  3LQ7 A;  5G5F A;  3UVT A;  4KUN A;  1Z3E A;  3L9V A;  3DIE A;  4F0C A;  2N5A A;  1TRS A;  5CAX A;  5DDL A;  2IIY A;  1EGR A;  1K3L A;  1PQN A;  2NPB A;  3HJM A;  2GQL A;  2I1U A;  1MD3 A;  1G7O A;  1YF0 A;  4WXT A;  1S3A A;  4G19 A;  2F8F A;  5JCU A;  1R5A A;  1JZR A;  1AXD A;  3D6I A;  5A4U A;  2I9H A;  1J0F A;  3HJP A;  4XS4 A;  2O85 A;  3UAR A;  1SK0 A;  2K18 A;  5FT3 A;  2FGX A;  1AQV A;  2MYG A;  4KX4 A;  4I8B A;  1EOH A;  1TI3 A;  2C0E A;  2PUK C;  1TTZ A;  5D9T A;  2HRN A;  5JCW A;  3HVX A;  4V1A p;  1J9B A;  1KEB A;  2B1K A;  1G0T A;  1NHY A;  2MMZ A;  4WR4 A;  2F3M A;  3F4S A;  4KB3 A;  3CSI A;  3TUE A;  2CX3 A;  3BD2 A;  2L4C A;  1V9W A;  2L6D A;  5IMF A;  3CSJ A;  4X1U A;  3M8N A;  3EE2 A;  1BQ7 A;  3ZIT A;  1YDK A;  2L6C A;  5JCG A;  3GFK A;  5G30 A;  5INY A;  2HFD A;  4H86 A;  1XWA A;  3CYN A;  1SYX A;  2M46 A;  3GNJ A;  1KBN A;  3UBK A;  4CDO A;  2JZS A;  1Z9H A;  4K7I A;  3N5O A;  3EMX A;  3KIJ A;  3F3Q A;  3LOR A;  4N0V A;  3EMP A;  4ML6 A;  2JSY A;  4I97 A;  2OAD A;  1O81 A;  2P5Q A;  3U6V A;  1THO A;  1XOB A;  4EC0 A;  1EV4 A;  4MA9 A;  2QSI A;  5AN1 A;  3EU3 A;  5ECL B;  3VWX A;  3EVI A;  1WOU A;  3APS A;  3QMX A;  1T4Y A;  3GX8 A;  4FH8 A;  3US3 A;  5H5S A;  5ECS A;  4I6X A;  2DJ1 A;  4I2U A;  1X5C A;  2VM1 A;  4POM A;  3FR3 A;  3KXO A;  2FHE A;  4ZBB A;  1N2A A;  4ID0 A;  2NVL A;  3DRN A;  2HNL A;  5HFI A;  2YJH A;  2YZU A;  2H72 A;  1GTU A;  5F0G A;  1FO5 A;  2PGT A;  3ZVJ A;  3C1R A;  4EO3 A;  2B3S A;  2N5F A;  4X43 A;  1EEJ A;  1SKR B;  4EVM A;  5LNK e;  2YJ7 A;  2OKA A;  1GSS A;  3QDN A;  1FB6 A;  3KEB A;  3UEM A;  1QXH A;  2P5R A;  3L0H A;  2L5O A;  5ID2 B;  1OAZ A;  4ACS A;  3O76 A;  4MH2 A;  5A5K A;  4TR3 A;  1WPI A;  3I6A A;  4ML1 A;  3ZML A;  2PVO C;  3IDV A;  5E4W A;  1U87 A;  3DGQ A;  19GS A;  3D21 A;  3ZIJ A;  1TOF A;  3GL5 A;  3TKQ A;  2G0F A;  5G31 A;  2H6Y A;  3O6T A;  3HKR A;  3TJB A;  2CZ3 A;  3UMA A;  1V98 A;  3GKN A;  3TDG A;  1V57 A;  1K0A A;  2OBI A;  3GUR A;  16GS A;  1B9X C;  4OCF A;  3ERF A;  2LQO A;  1XPV A;  1OC9 A;  2K8V A;  1SL1 B;  4IP1 A;  3L9U A;  5C00 A;  1KNG A;  4WEY A;  2GQM A;  4LMV A;  2O89 A;  4EDY A;  3F4R A;  3BBY A;  5D9V A;  2I81 A;  3WT2 A;  2GT6 A;  2ZNM A;  3CSH A;  1WRY A;  1GL8 A;  2FUG 2;  2A4V A;  4NV5 A;  2H0I A;  2CAQ A;  2H76 A;  1XW5 A;  2LTK A;  3ISO A;  1VF4 A;  1NSW A;  1HQO A;  1PGT A;  1GP1 A;  1XXU A;  11GS A;  4JZQ A;  2IMF A;  3UIW A;  4V2N A;  1URM A;  3FW2 A;  4EF0 A;  1ACV A;  5A4V A;  2VCT A;  2PWJ A;  5AGY A;  4TN8 A;  1YY7 A;  3GUS A;  4KCE A;  2HI7 A;  3EC3 A;  4JRR A;  2ON5 A;  4EUY A;  1F3B A;  1UN2 A;  1R5P A;  5AIX A;  1PX7 A;  6GSS A;  1PA3 A;  1M9B A;  3EYT A;  4OWY A;  1T3B A;  3KM6 A;  4BL7 A;  4E8H A;  1W89 A;  3C71 A;  3TOU A;  3ZTL A;  3HHV A;  4BPY A;  9GSS A;  3I43 A;  3FHK A;  1HNB A;  1QQ2 A;  5DAL A;  1ERT A;  2FCH A;  3IE3 A;  4OMV A;  3LGC A;  3ZLP A;  2IME A;  1AW9 A;  2C3Q A;  2XPE A;  1K3Y A;  1RK4 A;  3IXR A;  2XBQ A;  4NHZ A;  2GTU A;  4KH7 A;  1I5G A;  3SWL A;  5DAK A;  2LS5 A;  2YWM A;  3ZRE A;  5IIZ A;  3TOT A;  4WKW A;  4QL9 A;  1SJ6 A;  1SKW B;  5DJL A;  4G9H A;  1ILO A;  1G7E A;  4WBJ A;  2XBI A;  3IA1 A;  1QMV A;  4NWY A;  1MEK A;  3DXB A;  3DWV A;  3N9J A;  4Q5N A;  3A3T A;  4MCU A;  3QR6 A;  2REM A;  2HSY A;  4GQF A;  2MMN A;  4N0Z A;  4WBR D;  1PKZ A;  1GUL A;  4MK3 A;  1TP9 A;  13GS A;  2WGR A;  1A24 A;  3WGD A;  1YZX A;  2X64 A;  4TRX A;  1H75 A;  1M99 A;  4MJE A;  1WMJ A;  3H93 A;  3GX0 A;  5GAN D;  2HSH A;  3F4T A;  3HD5 A;  3MSZ A;  1GUH A;  4MMM A;  4OFN A;  2VL2 C;  1K0N A;  3L4N A;  4L0W A;  4YQV A;  1PL2 A;  4PQ1 A;  4RI6 A;  4J56 E;  1YJ6 A;  1A2J A;  3APO A;  1XWK A;  3D4M A;  1GH2 A;  1RQM A;  2DC5 A;  1U3A A;  2RII A;  2MBS A;  2LJR A;  3W6G A;  3MWH A;  4LLR A;  5JWO B;  4E8E A;  5B6M A;  2M80 A;  1AC1 A;  1VGL A;  1IYI A;  3TKS E;  3RDW A;  3KP8 A;  3E0U A;  1O7U A;  2GS3 A;  4IQ1 A;  1ZCP A;  2NTO A;  2C0G A;  5A4W A;  1AQW A;  2K8S A;  3WGX A;  2YWI A;  4ZBD A;  1BG5 A;  4J57 E;  4IQA A;  2GZZ A;  1QGV A;  3IR4 A;  3UJ1 A;  1MDI A;  2HE3 A;  2AB6 A;  2JL4 A;  1M2A A;  2H66 A;  1SKS B;  5ECH B;  3L78 A;  1VF2 A;  3GSS A;  1T1V A;  3L9S A;  3H8Q A;  2OAC A;  4AF2 A;  1B4Q A;  1R7H A;  2GT5 A;  3RBT A;  4G10 A;  5GZZ B;  1YQ1 A;  1YF1 A;  4F2I A;  5IPH A;  4MP4 A;  2C4J A;  3GRX A;  2L4Q A;  3M0F A;  4DVC A;  2CVD A;  2G2Q A;  1XWG A;  2C8U A;  3CRT A;  4G2E A;  1SL2 B;  1TJD A;  3UVH A;  5CO3 A;  2VCQ A;  1GRX A;  3UOM A;  5ECQ B;  2VCV A;  2H73 A;  3G9B A;  4RUV A;  4RI7 A;  4JU5 A;  3ZFL A;  1BAY A;  3EU4 A;  3CTF A;  1TK8 B;  6GSW A;  2AJQ B;  2TRC P;  3EUR A;  10GS A;  1FB0 A;  2BJX A;  2N5B A;  4XS6 A;  1FAA A;  3ZFB A;  1AIU A;  1ZMA A;  3M1G A;  2H0H A;  4DSS A;  6GSY A;  5F8B A;  5ECM B;  4KDU A;  3WD6 A;  2H30 A;  1TW9 A;  2RM6 A;  4ZBA A;  3LJR A;  2PMT A;  2JZR A;  4POL A;  14GS A;  5HR1 A;  6GST A;  3MAK A;  5ENU A;  3PGT A;  2LJA A;  4F03 A;  3A2V A;  1K0C A;  1S3D A;  4YH2 A;  3FR6 A;  4L5L A;  2IFQ A;  3HCZ A;  3QAV A;  1FVK A;  2QC7 A;  2LRC A;  4NPB A;  1Z7P A;  4ZL8 A;  3FRC A;  1NHO A;  1PX6 A;  8GSS A;  3KH7 A;  2GSQ A;  2HZE A;  5J3R A;  4IJI A;  4RQX A;  4MAB A;  5G5E A;  4XCS A;  1G6Y A;  4O5R A;  2V6K A;  3GTU B;  1UVZ A;  4LA1 A;  1WIK A;  4XIH A;  4ECB A;  2R6K A;  12GS A;  4QQ7 A;  3H79 A;  2PVQ A;  5ECI B;  1MD4 A;  2WRT A;  3VWU A;  2EC4 A;  5J9B A;  3KD0 A;  3SBC A;  4OD7 A;  4XTS A;  3VUR A;  3HYP A;  1ZOF A;  1X5E A;  2VOC A;  4EL1 A;  1VRS D;  3TRQ A;  5ELA A;  3D22 A;  3KJY A;  2LJK A;  1ERV A;  4YAP A;  2M72 A;  3F6D A;  1EWX A;  1EGO A;  3QD9 A;  3ZIV A;  5G1K A;  5ECP B;  2YZH A;  1K0B A;  4MPF A;  1GSY A;  2AAW A;  3K8N A;  3MNG A;  4Q5Q A;  3F3R A;  3KH9 A;  1A0F A;  4GWR A;  4L5O A;  3HZ8 A;  1T4Z A;  4ECC A;  2XC2 A;  4YQU A;  3V1W A;  2YWN A;  2H6Z A; 
#chains in the Genus database with same CATH topology
 2C3N A;  2R2J A;  1USB A;  5B7C A;  2WJU A;  3KGK A;  2VUP A;  4TR1 B;  1U3I A;  2GST A;  4POB A;  4K0N A;  5F07 A;  1GNW A;  20GS A;  2P0G A;  3C7M A;  5HR0 A;  3APQ A;  2DJK A;  3FYG A;  1C72 A;  3C8E A;  4D73 A;  3DVX A;  4XRD A;  2X8G A;  2H0G A;  5ECR B;  2VLV A;  1OYJ A;  3DD3 A;  4O5U A;  1GSD A;  1PKW A;  2LNS A;  4PNF A;  2R37 A;  4TW5 A;  2NBS A;  3TKS C;  3F8U A;  2B7K A;  3ZRD A;  1SK1 A;  1ZYE A;  2VL2 A;  1AQX A;  2CZ2 A;  2L59 A;  4PTS A;  2AHE A;  1TU8 A;  1O85 A;  1M7T A;  2WFC A;  4QL7 A;  4ZB9 A;  3ME8 A;  2L5L A;  3H4K A;  3RPN A;  4BVX B;  17GS A;  2V41 A;  1DSB A;  2MMO A;  2CVB A;  3IK7 A;  4DSQ A;  3FKF A;  4TXO B;  5L71 A;  4IW9 A;  5EVO A;  3IAS 2;  5GST A;  3KMO A;  1YEX A;  5IM9 A;  4WF5 A;  3VFI A;  2E7P A;  1JZW A;  4KDX A;  4TKY A;  1SL0 B;  5JWR B;  5F06 A;  5HFK A;  3VI7 A;  3EWL A;  1TU7 A;  2H01 A;  5IQY A;  2VLU A;  4HQS A;  4K1F A;  4JED A;  3HY2 A;  1PN9 A;  5CYY A;  3IHG A;  3Q6O A;  2FA8 A;  3CRU A;  2PER A;  1F37 A;  4V2L A;  1FOH A;  1YEP A;  3E3E A;  2CAI A;  2O7K A;  2O87 A;  5ECN B;  4KSO A;  4AGS A;  1W4V A;  3LXT A;  2HYX A;  2DIZ A;  2VD0 A;  1MDJ A;  1X0R A;  1ERW A;  1XVW A;  2R4V A;  3LYP A;  1SK2 A;  1Q4J A;  3IAM 2;  2H19 A;  3P8W A;  4Q5F A;  5D96 A;  1B9Y C;  2GLR A;  4ZXG A;  1MTC A;  3KCM A;  1K0O A;  2IN3 A;  3VWW A;  3MDK A;  5IO0 A;  2A2P A;  4FYB A;  2FNO A;  4MNN A;  2LKU A;  2JU5 A;  2F8A A;  3HXS A;  4BVY A;  3F0I A;  4YAV A;  3FK8 A;  1F9M A;  5G2Z A;  5CRE A;  3EIN A;  3HVS A;  2LRT A;  3ED3 A;  5GSS A;  1XCC A;  1XWC A;  6GSX A;  1DE1 A;  2RM5 A;  1GSQ A;  3IK9 A;  1X5D A;  22GS A;  2VD1 A;  4HQZ A;  4XS4 B;  3P7X A;  5CRH A;  1O6J A;  1T8E B;  4RQR A;  3IV4 A;  2ZUP A;  4MZW A;  2IWT A;  1AUC A;  3CMI A;  3C1S A;  2WB9 A;  3E9J B;  3GYK A;  4KSM A;  1TRW A;  2YCD A;  4HS1 A;  2MMA A;  5EL8 A;  3GKX A;  2FA4 A;  1JHB A;  4L0U A;  3UBL A;  1A2M A;  2OE3 A;  4YQM A;  1EP8 A;  1F3A A;  2K9F A;  5DVB A;  4GTU A;  2HT9 A;  4MF6 A;  5CP1 A;  2LEG A;  3Q74 A;  2B1L A;  1FHE A;  1M9A A;  4J2F A;  2H1A A;  3MYD A;  2LST A;  3G7I A;  2R0C A;  1JLV A;  2R3X A;  5IOW A;  1A8L A;  1GTI A;  3HZ4 A;  2V1M A;  1M0U A;  4HEA 2;  3GH6 A;  2B6M A;  4TR4 A;  2CT6 A;  3FZ5 A;  2RUF A;  3BCK A;  2FWH A;  1H4O A;  4EXJ A;  3D0Z A;  1YKC A;  2IL3 A;  4NXI A;  1SEN A;  4F82 A;  1MDK A;  2JAC A;  4GSN A;  1GNE A;  3ZVJ D;  1TKD B;  4MJB A;  3GH9 A;  1EEM A;  1TI1 A;  3TKR A;  5F05 A;  4HU7 A;  3C73 A;  2OJL A;  1PD2 1;  2JAD A;  1OE8 A;  4PUR A;  1SJI A;  4PX1 A;  3PIN A;  3FZA A;  2LUS A;  2XPD A;  3QAG A;  5CNW A;  3RAZ A;  4EE0 A;  3FZ9 A;  5ID2 A;  3HDC A;  2ES7 A;  4IP6 A;  1J08 A;  3HA9 A;  1GTB A;  2FLS A;  4PQH A;  5ELG A;  4KE3 A;  4BWQ A;  4N30 A;  4OFT A;  4WET A;  1GSF A;  4P3Y B;  5LCZ A;  6GSV A;  2FY6 A;  1EV9 A;  3DML A;  1Z7R A;  3UAP A;  3TJF A;  2C80 A;  3WGE A;  3LW9 A;  1ZYP A;  1YKA A;  1T7P B;  4K2D A;  1BYE A;  3U5R E;  4CY6 A;  3KMN A;  1XW9 A;  1ZZY A;  3TGZ A;  1WWJ A;  5KOX A;  2F51 A;  3TKS A;  1TK5 B;  1F2E A;  4IJ3 A;  3A5W A;  2H71 A;  3FEU A;  5D9W A;  2K6V A;  3QFB C;  5H5Q A;  4JBB A;  1KTE A;  2L57 A;  2VL3 A;  4MDC A;  1BX9 A;  4GSS A;  3AY8 A;  2H70 A;  2EIO A;  3GIX A;  4HUA A;  1E2Y A;  4ZB6 A;  4O5Q A;  2E2M A;  1M3I A;  2D2Z A;  5J5N A;  1FG4 A;  3FZ4 A;  4DSR A;  5D93 A;  3ME7 A;  3LG6 A;  2DJJ A;  4TOP A;  4O7H A;  3TJJ A;  3S9F A;  2HLS A;  1DE2 A;  2FWF A;  1SYR A;  1XFL A;  2FWE A;  2V6O A;  4K5S A;  5IMA A;  1PFO A;  2R0P A;  2P31 A;  2A2S A;  4ZIL A;  1K0M A;  2FD3 A;  4IS0 A;  2VAF A;  4ECI A;  7GSS A;  1UA5 A;  3PH9 A;  3GN3 A;  1RW1 A;  1OC9 B;  4N11 A;  1TDI A;  3TCO A;  2GZY A;  4IHU A;  1X9W B;  2AYT A;  2WCI A;  3IBH A;  4G0L A;  4MJA A;  1M2D A;  5CRD A;  3QCP A;  2GDR A;  1ML6 A;  1THX A;  1O8W A;  2F9S A;  5DJM A;  4I5Q A;  5J41 A;  5B8B A;  4ILF A;  1XBS A;  4IN0 A;  2VLT A;  2HZF A;  4Z2U A;  2KP2 A;  5IMV A;  4L8E A;  3IPZ A;  4HZ4 A;  4FIW A;  4F0B A;  3BJ5 A;  2QA1 A;  3A2X A;  2KHP A;  1TRU A;  5KN1 A;  2H1D A;  5D8I A;  3QFA C;  3GKK A;  2XHF A;  18GS A;  2KP1 A;  3QAW A;  1O73 A;  2C3T A;  5FHI A;  2DJ2 A;  4HU9 A;  2HSM A;  3Q19 A;  2PN8 A;  1U88 A;  2H8L A;  3F6F A;  2B5X A;  2IMI A;  4MJC A;  4YKF A;  3KTL A;  1HYU A;  1QFN A;  4USS A;  2YPM A;  4KND A;  4MZC A;  2X4A A;  3TB2 A;  4CHS A;  2YV9 A;  2KLX A;  4DEJ A;  5BMU A;  4PNG A;  2I4A A;  2WDU A;  2VL9 A;  1OC3 A;  2H6X A;  1O8X A;  4BL7 B;  1WJK A;  4OCE A;  2OE0 A;  4AJ6 A;  5DQS A;  4ZL7 A;  2A2R A;  2TRX A;  4F9Z A;  2H74 A;  2X99 A;  2KOK A;  3GST A;  5DAL B;  4FYU A;  4KDY A;  2HXK A;  3IHQ A;  5IPG A;  1Z5Y E;  2ON7 A;  2X8H A;  5HR3 A;  1GLP A;  3CXG A;  3TJG A;  5IO2 A;  1NW2 A;  4BIK A;  1JFU A;  1VF1 A;  4Z7X A;  1WE0 A;  3CBU A;  2AUV A;  3TRX A;  3Q18 A;  5DAK B;  3PR8 A;  3UL3 A;  1Z6N A;  4KAE A;  3GKM A;  1EOG A;  3WYW A;  4I2T A;  3CTG A;  5G1L A;  2YAN A;  3IRA A;  5JWQ B;  1R4W A;  2HRF A;  5IMD A;  3VI5 A;  2CX4 A;  2GZP A;  2DIY A;  3GHA A;  3ZL5 A;  2X8C A;  4LL1 B;  1OC8 A;  5EPF A;  1SU9 A;  2DMM A;  2PPT A;  4KA0 A;  1NM3 A;  2MZC A;  2DKI A;  4ISD A;  1UC7 A;  1F6M C;  5C04 A;  5CRG A;  1T00 A;  2IJY A;  1CQH A;  4K8M A;  4TVE A;  2LV3 A;  5ECK B;  5ECO B;  1QK8 A;  4GLT A;  1QUW A;  1PMT A;  1JZD A;  3QPM A;  4HJ2 A;  1PRX A;  1X9M B;  3M3M A;  2YNX A;  2B5E A;  2CA8 A;  4POK A;  4K6X A;  1FW1 A;  4GST A;  4N10 A;  2JZT A;  4ZIJ A;  2PBJ A;  4AJ8 A;  2FWG A;  3GMF A;  1A0R P;  5FWG A;  4V2M A;  1VF3 A;  5AIV A;  3LSZ A;  3ERG A;  4HDE A;  2VO4 A;  3P2A A;  2B7J A;  3VLN A;  4BA7 A;  4FQU A;  5IMC A;  1S3R A;  1XVQ A;  3O3T A;  1EP7 A;  3HJO A;  4O92 A;  2V32 A;  4MLY A;  6GSU A;  2R5G A;  4GRF A;  1IYH A;  1Y25 A;  4PUA A;  3RHC A;  3TRP A;  4MPG A;  4KCA A;  1FVJ A;  2NDO A;  5DCH A;  1I9D A;  1OVN A;  2CVK A;  5HQP A;  4AJ7 A;  4TR0 A;  3HVN A;  4HOJ A;  1OKD A;  1JLW A;  1X9S B;  5HR2 A;  4NMU A;  1WP0 A;  4EDZ A;  1A2L A;  1PSQ A;  2QGV A;  2A4H A;  1TRV A;  2WUL A;  4PQI A;  5KN2 A;  3GV1 A;  1Z6M A;  2Z9S A;  4GCI A;  4WR5 A;  5KN0 A;  3P90 A;  1GTA A;  3LEF A;  3DKS A;  1V40 A;  1GWC A;  4K7N A;  2DBC A;  2WZ9 A;  3BCI A;  5J4U A;  4Q5R A;  1R26 A;  1ERU A;  2YOI A;  4NV2 A;  1LJR A;  2I3Y A;  3D5J A;  1XOA A;  1ON4 A;  3A2W A;  1M3J A;  1LU4 A;  4BWS A;  3IC4 A;  2EIR A;  2DJ0 A;  2DJ3 A;  2VIM A;  2GSR A;  4HI7 A;  1A8Y A;  4MF7 A;  1FOV A;  1N8J A;  3DEX A;  1BED A;  1V2A A;  1K0D A;  1GLQ A;  2EIQ A;  4OFM A;  4ZB8 A;  2LQQ A;  5ABR A;  1OE7 A;  3ERW A;  2DLX A;  4DSS B;  5D73 A;  3I69 A;  1HD2 A;  5DCG A;  1ZYQ B;  4KW6 A;  3ZMK A;  1CQG A;  2VCX A;  2GGT A;  1ABA A;  2IMK A;  4TXV A;  3F9U A;  2HRK A;  3QOU A;  3KP9 A;  3A5I A;  3LWA A;  3GTU A;  2J9H A;  4XRA A;  2LRN A;  1Y6E A;  1PN0 A;  4ECJ A;  4HJM A;  2IFQ B;  4IGJ A;  4XS1 A;  5D9X A;  2YV7 A;  4EKZ A;  2B5Y A;  3OR5 A;  3J7Y b;  3J7Y k;  4GQC A;  4IKH A;  4JR6 A;  1A23 A;  2CV4 A;  2DSA A;  2E2G A;  3RPP A;  2RUE A;  1PL1 A;  2C0D A;  5EY6 A;  2LNT A;  4NAX A;  3WT1 A;  2TIR A;  2HZE B;  3VPT A;  3I9V 2;  3G7J A;  2VCW A;  2GQK A;  4X0X A;  1XG8 A;  2IPA A;  3TKP A;  4MF5 A;  1SD9 A;  3ZYW A;  1GSE A;  2J23 A;  2YWO A;  3W8J A;  1HNA A;  5B8A A;  4LL4 B;  2BMX A;  4MZB A;  1AAZ A;  4JR4 A;  2OBK A;  3D4T A;  1E6B A;  1ZL9 A;  4FYC A;  4K0G A;  4JE1 A;  1SJZ A;  3JCM L;  5KN3 A;  3R2Q A;  1TK0 B;  4OO5 A;  2H1G A;  5DBQ A;  3NZN A;  2AV4 A;  5IOX A;  4TR1 A;  4V1A g;  2MBT A;  2PU9 C;  4XHM A;  3GL3 A;  4O32 A;  3TJK A;  2C1Y A;  1ST9 A;  1XZO A;  4KGI A;  1GSU A;  3BOA A;  4ULX A;  4K2X A;  4IBP A;  3GA4 A;  2V2G A;  3IOS A;  5GAP D;  3ZZX A;  1HNC A;  2DML A;  1Q98 A;  2CQ9 A;  2RLI A;  3W8S A;  4GF0 A;  3FY7 A;  2H75 A;  3RHB A;  4LMW A;  2VM2 A;  2JSZ A;  1GUK A;  2E0Q A;  4A5P A;  4K9Z A;  1EZK A;  3LXZ A;  3HVV A;  1SD8 A;  2VCZ A;  4FO5 A;  3LFL A;  2H1B A;  4BVX A;  4NHW A;  2IMD A;  3KTB A;  1BJX A;  3LYK A;  2KUC A;  4D73 B;  4TXO A;  1ZGN A;  4PXO A;  2ZCT A;  1XWB A;  5LD0 A;  3KZQ A;  4ZL9 A;  1B8X A;  1G6W A;  2WS2 A;  2OA7 A;  3F63 A;  1B4P A;  2O8V B;  3DYR A;  1TXX A;  5H5R A;  1DBY A;  4IVF A;  5J9C A;  5E59 A;  4WF4 A;  2GSS A;  5B6N A;  2YP6 A;  3M9K A;  3VPQ A;  5HFG A;  5DQY A;  4IEL A;  4MH3 A;  1XW6 A;  1OKT A;  5AIS A;  3CQF A;  1K3O A;  3G7Y A;  3DVW A;  2GVP A;  5COH A;  4HZ2 A;  1LBK A;  1GUM A;  4GXZ A;  4OO4 A;  1B48 A;  3M9J A;  2YN1 A;  3VWV A;  3H1N A;  1U6T A;  2QKE A;  2BTO T;  2OE1 A;  3MIX A;  1JZO A;  1S3C A;  1XIY A;  5IMZ A;  1V58 A;  1M2B A;  3FR9 A;  2ALB A;  3NIV A;  4PGT A;  5KEJ A;  2C0F A;  2UZ8 A;  1DUG A;  3NOF A;  4K7O A;  5CRW A;  4PUF C;  3VK9 A;  4CW9 A;  3LQ7 A;  5G5F A;  3UVT A;  4KUN A;  1Z3E A;  3L9V A;  3DIE A;  4F0C A;  2N5A A;  1TRS A;  5CAX A;  5DDL A;  2IIY A;  1EGR A;  1K3L A;  1PQN A;  2HRA A;  2NPB A;  3HJM A;  2GQL A;  2I1U A;  1MD3 A;  3PPU A;  1G7O A;  1YF0 A;  4WXT A;  1S3A A;  4G19 A;  2F8F A;  5JCU A;  1R5A A;  1JZR A;  1AXD A;  2R0G A;  3D6I A;  5A4U A;  2I9H A;  1J0F A;  3HJP A;  4XS4 A;  2O85 A;  3UAR A;  1SK0 A;  2K18 A;  5FT3 A;  2FGX A;  1AQV A;  2MYG A;  4KX4 A;  4BVY B;  4I8B A;  1EOH A;  1TI3 A;  2C0E A;  2PUK C;  1TTZ A;  5D9T A;  2HRN A;  5JCW A;  3HVX A;  4V1A p;  1J9B A;  1KEB A;  2B1K A;  1G0T A;  1NHY A;  2MMZ A;  4WR4 A;  2F3M A;  3F4S A;  4KB3 A;  3CSI A;  3TUE A;  2CX3 A;  3BD2 A;  2L4C A;  1V9W A;  2L6D A;  5IMF A;  3CSJ A;  4EIQ A;  4X1U A;  3M8N A;  3EE2 A;  1BQ7 A;  3ZIT A;  1YDK A;  2L6C A;  5JCG A;  3GFK A;  5G30 A;  5INY A;  2HFD A;  4H86 A;  1XWA A;  1ZYN A;  3CYN A;  1SYX A;  2M46 A;  3GNJ A;  1KBN A;  3UBK A;  4CDO A;  2JZS A;  1Z9H A;  4K7I A;  3N5O A;  3EMX A;  3KIJ A;  3F3Q A;  3LOR A;  4N0V A;  3EMP A;  4ML6 A;  2JSY A;  4I97 A;  2OAD A;  1O81 A;  2P5Q A;  3U6V A;  1THO A;  4K5R A;  1XOB A;  4EC0 A;  1EV4 A;  4MA9 A;  5BRT A;  2QSI A;  5AN1 A;  3EU3 A;  5ECL B;  3VWX A;  3EVI A;  1WOU A;  3APS A;  3QMX A;  1T4Y A;  3GX8 A;  4FH8 A;  3US3 A;  5H5S A;  5ECS A;  4I6X A;  2DJ1 A;  4I2U A;  1X5C A;  2VM1 A;  4POM A;  3FR3 A;  3KXO A;  2FHE A;  4ZBB A;  1N2A A;  4ID0 A;  2NVL A;  3DRN A;  2HNL A;  5HFI A;  2YJH A;  2YZU A;  2H72 A;  1GTU A;  5F0G A;  1FO5 A;  2PGT A;  3ZVJ A;  3C1R A;  4EO3 A;  2B3S A;  2N5F A;  4X43 A;  1EEJ A;  1SKR B;  4EVM A;  5LNK e;  2YJ7 A;  2OKA A;  1GSS A;  3QDN A;  1FB6 A;  3KEB A;  3UEM A;  1QXH A;  2P5R A;  3L0H A;  2L5O A;  5ID2 B;  1OAZ A;  4ACS A;  3O76 A;  4MH2 A;  5A5K A;  4TR3 A;  1WPI A;  3I6A A;  4ML1 A;  4G0K A;  3ZML A;  2PVO C;  3IDV A;  5E4W A;  1U87 A;  3DGQ A;  19GS A;  3D21 A;  3ZIJ A;  1TOF A;  3GL5 A;  3TKQ A;  2G0F A;  5G31 A;  2H6Y A;  3O6T A;  3HKR A;  3TJB A;  2CZ3 A;  3UMA A;  1V98 A;  3GKN A;  3TDG A;  1V57 A;  1K0A A;  2OBI A;  4CY8 A;  3GUR A;  16GS A;  1B9X C;  4OCF A;  3ERF A;  2LQO A;  1XPV A;  1OC9 A;  2K8V A;  1SL1 B;  4IP1 A;  3L9U A;  2DKH A;  5C00 A;  4G0I A;  1KNG A;  4WEY A;  2GQM A;  4LMV A;  2O89 A;  4EDY A;  3F4R A;  3BBY A;  5D9V A;  2I81 A;  4Z2T A;  3WT2 A;  2GT6 A;  2ZNM A;  3CSH A;  1WRY A;  1GL8 A;  2FUG 2;  2A4V A;  4NV5 A;  2H0I A;  2CAQ A;  2H76 A;  1XW5 A;  2LTK A;  3EPT A;  3ISO A;  1VF4 A;  1NSW A;  1HQO A;  1PGT A;  4EIP A;  1GP1 A;  1XXU A;  11GS A;  4JZQ A;  2IMF A;  3UIW A;  4V2N A;  1URM A;  3FW2 A;  4EF0 A;  1ACV A;  5A4V A;  2VCT A;  2PWJ A;  5AGY A;  4TN8 A;  1YY7 A;  3GUS A;  4KCE A;  2HI7 A;  3EC3 A;  4JRR A;  2ON5 A;  4EUY A;  1F3B A;  1UN2 A;  1R5P A;  5AIX A;  1PX7 A;  6GSS A;  1PA3 A;  1M9B A;  3EYT A;  4OWY A;  1T3B A;  3KM6 A;  4BL7 A;  4E8H A;  1W89 A;  3C71 A;  3TOU A;  3ZTL A;  3HHV A;  4BPY A;  9GSS A;  3I43 A;  3FHK A;  1HNB A;  1QQ2 A;  5DAL A;  1ERT A;  2FCH A;  3IE3 A;  4OMV A;  3LGC A;  3ZLP A;  2IME A;  1AW9 A;  2C3Q A;  2XPE A;  1K3Y A;  1RK4 A;  3IXR A;  2XBQ A;  5KOW A;  4NHZ A;  2GTU A;  4KH7 A;  1I5G A;  3SWL A;  5DAK A;  2LS5 A;  2YWM A;  3ZRE A;  5IIZ A;  3TOT A;  4WKW A;  4QL9 A;  1SJ6 A;  1SKW B;  5DJL A;  4G9H A;  1ILO A;  1G7E A;  4WBJ A;  2XBI A;  3IA1 A;  1QMV A;  4NWY A;  1MEK A;  3DXB A;  3DWV A;  3N9J A;  4Q5N A;  3A3T A;  4MCU A;  3QR6 A;  2REM A;  2HSY A;  4GQF A;  2MMN A;  4N0Z A;  4WBR D;  1PKZ A;  1GUL A;  4MK3 A;  1TP9 A;  13GS A;  2WGR A;  1A24 A;  3WGD A;  1YZX A;  2X64 A;  4TRX A;  1H75 A;  1M99 A;  4MJE A;  1WMJ A;  3H93 A;  3GX0 A;  5GAN D;  2HSH A;  3F4T A;  3HD5 A;  3MSZ A;  1GUH A;  4MMM A;  4OFN A;  2VL2 C;  1K0N A;  3L4N A;  4HSC X;  4L0W A;  4YQV A;  4Z2R A;  1PL2 A;  4PQ1 A;  4RI6 A;  4J56 E;  1YJ6 A;  1A2J A;  3APO A;  1XWK A;  3D4M A;  1GH2 A;  1RQM A;  2DC5 A;  1U3A A;  2RII A;  2MBS A;  2LJR A;  3W6G A;  3MWH A;  4KF9 A;  4LLR A;  5JWO B;  4E8E A;  5B6M A;  2M80 A;  1AC1 A;  1VGL A;  1IYI A;  3TKS E;  3RDW A;  3KP8 A;  3E0U A;  1O7U A;  2GS3 A;  4IQ1 A;  1ZCP A;  2NTO A;  2C0G A;  5A4W A;  1AQW A;  2K8S A;  3WGX A;  2YWI A;  4ZBD A;  1BG5 A;  4J57 E;  4IQA A;  2GZZ A;  1QGV A;  3IR4 A;  3UJ1 A;  1MDI A;  2HE3 A;  2AB6 A;  4X4J A;  2JL4 A;  1M2A A;  2H66 A;  1SKS B;  5ECH B;  4ICY A;  3L78 A;  1VF2 A;  3GSS A;  1T1V A;  3L9S A;  3H8Q A;  2OAC A;  4AF2 A;  1B4Q A;  1R7H A;  2GT5 A;  3RBT A;  4G10 A;  5GZZ B;  1YQ1 A;  1YF1 A;  4F2I A;  5IPH A;  4MP4 A;  2C4J A;  3GRX A;  2L4Q A;  3M0F A;  4DVC A;  2CVD A;  2G2Q A;  1XWG A;  2C8U A;  3CRT A;  4G2E A;  1SL2 B;  1TJD A;  3UVH A;  5CO3 A;  2VCQ A;  1GRX A;  3UOM A;  5ECQ B;  2VCV A;  2H73 A;  3G9B A;  4RUV A;  4RI7 A;  4JU5 A;  3ZFL A;  1BAY A;  3EU4 A;  3CTF A;  1TK8 B;  6GSW A;  2AJQ B;  2TRC P;  3EUR A;  10GS A;  1FB0 A;  2BJX A;  2N5B A;  4XS6 A;  1FAA A;  3ZFB A;  1AIU A;  1ZMA A;  3M1G A;  2H0H A;  4DSS A;  6GSY A;  5F8B A;  5ECM B;  4KDU A;  3WD6 A;  2H30 A;  1TW9 A;  2RM6 A;  4ZBA A;  3LJR A;  2PMT A;  2JZR A;  4POL A;  14GS A;  5HR1 A;  6GST A;  3MAK A;  5ENU A;  3R3E A;  3PGT A;  2LJA A;  4F03 A;  3A2V A;  1K0C A;  1S3D A;  4YH2 A;  3FR6 A;  4L5L A;  2IFQ A;  3HCZ A;  3QAV A;  1FVK A;  2QC7 A;  2LRC A;  4NPB A;  1Z7P A;  4ZL8 A;  3FRC A;  1NHO A;  1PX6 A;  8GSS A;  3IC8 A;  3KH7 A;  2GSQ A;  2HZE A;  5J3R A;  4IJI A;  4RQX A;  4MAB A;  5G5E A;  4XCS A;  1G6Y A;  4O5R A;  2V6K A;  2QA2 A;  3GTU B;  1UVZ A;  4LA1 A;  1WIK A;  4XIH A;  4ECB A;  2R6K A;  12GS A;  4QQ7 A;  3H79 A;  2PVQ A;  5ECI B;  1MD4 A;  2WRT A;  3VWU A;  2EC4 A;  5J9B A;  3KD0 A;  3SBC A;  4OD7 A;  4XTS A;  3VUR A;  3HYP A;  1ZOF A;  1X5E A;  2VOC A;  4EL1 A;  1VRS D;  3TRQ A;  5ELA A;  3D22 A;  3KJY A;  2LJK A;  1ERV A;  4YAP A;  2M72 A;  3FMW A;  3F6D A;  1EWX A;  1EGO A;  3QD9 A;  3ZIV A;  5G1K A;  5ECP B;  2YZH A;  1K0B A;  4MPF A;  1GSY A;  2AAW A;  3K8N A;  3MNG A;  4Q5Q A;  3F3R A;  2X49 A;  3KH9 A;  1A0F A;  4GWR A;  4L5O A;  3HZ8 A;  1T4Z A;  4ECC A;  4YKG A;  2XC2 A;  4YQU A;  3V1W A;  2YWN A;  2H6Z A; 
#chains in the Genus database with same CATH homology
 2C3N A;  2R2J A;  1USB A;  5B7C A;  2WJU A;  3KGK A;  2VUP A;  4TR1 B;  1U3I A;  2GST A;  4POB A;  4K0N A;  5F07 A;  1GNW A;  20GS A;  2P0G A;  3C7M A;  5HR0 A;  3APQ A;  2DJK A;  3FYG A;  1C72 A;  3C8E A;  4D73 A;  3DVX A;  4XRD A;  2X8G A;  2H0G A;  5ECR B;  2VLV A;  1OYJ A;  3DD3 A;  4O5U A;  1GSD A;  1PKW A;  2LNS A;  4PNF A;  2R37 A;  4TW5 A;  2NBS A;  3TKS C;  3F8U A;  2B7K A;  3ZRD A;  1SK1 A;  1ZYE A;  2VL2 A;  1AQX A;  2CZ2 A;  2L59 A;  4PTS A;  2AHE A;  1TU8 A;  1O85 A;  1M7T A;  2WFC A;  4QL7 A;  4ZB9 A;  3ME8 A;  2L5L A;  3H4K A;  3RPN A;  4BVX B;  17GS A;  2V41 A;  1DSB A;  2MMO A;  2CVB A;  3IK7 A;  4DSQ A;  3FKF A;  4TXO B;  5L71 A;  4IW9 A;  5EVO A;  3IAS 2;  5GST A;  3KMO A;  1YEX A;  5IM9 A;  4WF5 A;  3VFI A;  2E7P A;  1JZW A;  4KDX A;  4TKY A;  1SL0 B;  5JWR B;  5F06 A;  5HFK A;  3VI7 A;  3EWL A;  1TU7 A;  2H01 A;  5IQY A;  2VLU A;  4HQS A;  4K1F A;  4JED A;  3HY2 A;  1PN9 A;  5CYY A;  3IHG A;  3Q6O A;  2FA8 A;  3CRU A;  2PER A;  1F37 A;  4V2L A;  1FOH A;  1YEP A;  3E3E A;  2CAI A;  2O7K A;  2O87 A;  5ECN B;  4KSO A;  4AGS A;  1W4V A;  3LXT A;  2HYX A;  2DIZ A;  2VD0 A;  1MDJ A;  1X0R A;  1ERW A;  1XVW A;  2R4V A;  3LYP A;  1SK2 A;  1Q4J A;  3IAM 2;  2H19 A;  3P8W A;  4Q5F A;  5D96 A;  1B9Y C;  2GLR A;  4ZXG A;  1MTC A;  3KCM A;  1K0O A;  2IN3 A;  3VWW A;  3MDK A;  5IO0 A;  2A2P A;  4FYB A;  2FNO A;  4MNN A;  2LKU A;  2JU5 A;  2F8A A;  3HXS A;  4BVY A;  3F0I A;  4YAV A;  3FK8 A;  1F9M A;  5G2Z A;  5CRE A;  3EIN A;  3HVS A;  2LRT A;  3ED3 A;  5GSS A;  1XCC A;  1XWC A;  6GSX A;  1DE1 A;  2RM5 A;  1GSQ A;  3IK9 A;  1X5D A;  22GS A;  2VD1 A;  4HQZ A;  4XS4 B;  3P7X A;  5CRH A;  1O6J A;  1T8E B;  4RQR A;  3IV4 A;  2ZUP A;  4MZW A;  2IWT A;  1AUC A;  3CMI A;  3C1S A;  2WB9 A;  3E9J B;  3GYK A;  4KSM A;  1TRW A;  2YCD A;  4HS1 A;  2MMA A;  5EL8 A;  3GKX A;  2FA4 A;  1JHB A;  4L0U A;  3UBL A;  1A2M A;  2OE3 A;  4YQM A;  1EP8 A;  1F3A A;  2K9F A;  5DVB A;  4GTU A;  2HT9 A;  4MF6 A;  5CP1 A;  2LEG A;  3Q74 A;  2B1L A;  1FHE A;  1M9A A;  4J2F A;  2H1A A;  3MYD A;  2LST A;  3G7I A;  2R0C A;  1JLV A;  2R3X A;  5IOW A;  1A8L A;  1GTI A;  3HZ4 A;  2V1M A;  1M0U A;  4HEA 2;  3GH6 A;  2B6M A;  4TR4 A;  2CT6 A;  3FZ5 A;  2RUF A;  3BCK A;  2FWH A;  1H4O A;  4EXJ A;  3D0Z A;  1YKC A;  2IL3 A;  4NXI A;  1SEN A;  4F82 A;  1MDK A;  2JAC A;  4GSN A;  1GNE A;  3ZVJ D;  1TKD B;  4MJB A;  3GH9 A;  1EEM A;  1TI1 A;  3TKR A;  5F05 A;  4HU7 A;  3C73 A;  2OJL A;  1PD2 1;  2JAD A;  1OE8 A;  4PUR A;  1SJI A;  4PX1 A;  3PIN A;  3FZA A;  2LUS A;  2XPD A;  3QAG A;  5CNW A;  3RAZ A;  4EE0 A;  3FZ9 A;  5ID2 A;  3HDC A;  2ES7 A;  4IP6 A;  1J08 A;  3HA9 A;  1GTB A;  2FLS A;  4PQH A;  5ELG A;  4KE3 A;  4BWQ A;  4N30 A;  4OFT A;  4WET A;  1GSF A;  4P3Y B;  5LCZ A;  6GSV A;  2FY6 A;  1EV9 A;  3DML A;  1Z7R A;  3UAP A;  3TJF A;  2C80 A;  3WGE A;  3LW9 A;  1ZYP A;  1YKA A;  1T7P B;  4K2D A;  1BYE A;  3U5R E;  4CY6 A;  3KMN A;  1XW9 A;  1ZZY A;  3TGZ A;  1WWJ A;  5KOX A;  2F51 A;  3TKS A;  1TK5 B;  1F2E A;  4IJ3 A;  3A5W A;  2H71 A;  3FEU A;  5D9W A;  2K6V A;  3QFB C;  5H5Q A;  4JBB A;  1KTE A;  2L57 A;  2VL3 A;  4MDC A;  1BX9 A;  4GSS A;  3AY8 A;  2H70 A;  2EIO A;  3GIX A;  4HUA A;  1E2Y A;  4ZB6 A;  4O5Q A;  2E2M A;  2D2Z A;  5J5N A;  1FG4 A;  3FZ4 A;  4DSR A;  5D93 A;  3ME7 A;  3LG6 A;  2DJJ A;  4TOP A;  4O7H A;  3TJJ A;  3S9F A;  2HLS A;  1DE2 A;  2FWF A;  1SYR A;  1XFL A;  2FWE A;  2V6O A;  4K5S A;  5IMA A;  2R0P A;  2P31 A;  2A2S A;  4ZIL A;  1K0M A;  2FD3 A;  4IS0 A;  2VAF A;  4ECI A;  7GSS A;  1UA5 A;  3PH9 A;  3GN3 A;  1RW1 A;  1OC9 B;  4N11 A;  1TDI A;  3TCO A;  2GZY A;  4IHU A;  1X9W B;  2AYT A;  2WCI A;  3IBH A;  4G0L A;  4MJA A;  1M2D A;  5CRD A;  3QCP A;  2GDR A;  1ML6 A;  1THX A;  1O8W A;  2F9S A;  5DJM A;  4I5Q A;  5J41 A;  5B8B A;  4ILF A;  1XBS A;  4IN0 A;  2VLT A;  2HZF A;  4Z2U A;  2KP2 A;  5IMV A;  4L8E A;  3IPZ A;  4HZ4 A;  4FIW A;  4F0B A;  3BJ5 A;  2QA1 A;  3A2X A;  2KHP A;  1TRU A;  5KN1 A;  2H1D A;  5D8I A;  3QFA C;  3GKK A;  2XHF A;  18GS A;  2KP1 A;  3QAW A;  1O73 A;  2C3T A;  5FHI A;  2DJ2 A;  4HU9 A;  2HSM A;  3Q19 A;  2PN8 A;  1U88 A;  2H8L A;  3F6F A;  2B5X A;  2IMI A;  4MJC A;  4YKF A;  3KTL A;  1HYU A;  1QFN A;  4USS A;  2YPM A;  4KND A;  4MZC A;  2X4A A;  3TB2 A;  4CHS A;  2YV9 A;  2KLX A;  4DEJ A;  5BMU A;  4PNG A;  2I4A A;  2WDU A;  2VL9 A;  1OC3 A;  2H6X A;  1O8X A;  4BL7 B;  1WJK A;  4OCE A;  2OE0 A;  4AJ6 A;  5DQS A;  4ZL7 A;  2A2R A;  2TRX A;  4F9Z A;  2H74 A;  2X99 A;  2KOK A;  3GST A;  5DAL B;  4FYU A;  4KDY A;  2HXK A;  3IHQ A;  5IPG A;  1Z5Y E;  2ON7 A;  2X8H A;  5HR3 A;  1GLP A;  3CXG A;  3TJG A;  5IO2 A;  1NW2 A;  1JFU A;  1VF1 A;  4Z7X A;  1WE0 A;  3CBU A;  2AUV A;  3TRX A;  3Q18 A;  5DAK B;  3PR8 A;  3UL3 A;  1Z6N A;  4KAE A;  3GKM A;  1EOG A;  3WYW A;  4I2T A;  3CTG A;  5G1L A;  2YAN A;  3IRA A;  5JWQ B;  1R4W A;  2HRF A;  5IMD A;  3VI5 A;  2CX4 A;  2GZP A;  2DIY A;  3GHA A;  3ZL5 A;  2X8C A;  4LL1 B;  1OC8 A;  5EPF A;  1SU9 A;  2DMM A;  2PPT A;  4KA0 A;  1NM3 A;  2MZC A;  2DKI A;  4ISD A;  1UC7 A;  1F6M C;  5C04 A;  5CRG A;  1T00 A;  2IJY A;  1CQH A;  4K8M A;  4TVE A;  2LV3 A;  5ECK B;  5ECO B;  1QK8 A;  4GLT A;  1QUW A;  1PMT A;  1JZD A;  3QPM A;  4HJ2 A;  1PRX A;  1X9M B;  3M3M A;  2YNX A;  2B5E A;  2CA8 A;  4POK A;  4K6X A;  1FW1 A;  4GST A;  4N10 A;  2JZT A;  4ZIJ A;  2PBJ A;  4AJ8 A;  2FWG A;  3GMF A;  1A0R P;  5FWG A;  4V2M A;  1VF3 A;  5AIV A;  3LSZ A;  3ERG A;  4HDE A;  2VO4 A;  3P2A A;  2B7J A;  3VLN A;  4BA7 A;  4FQU A;  5IMC A;  1XVQ A;  3O3T A;  1EP7 A;  3HJO A;  4O92 A;  2V32 A;  4MLY A;  6GSU A;  2R5G A;  4GRF A;  1IYH A;  1Y25 A;  4PUA A;  3RHC A;  3TRP A;  4MPG A;  4KCA A;  1FVJ A;  2NDO A;  5DCH A;  1I9D A;  1OVN A;  2CVK A;  5HQP A;  4AJ7 A;  4TR0 A;  4HOJ A;  1OKD A;  1JLW A;  1X9S B;  5HR2 A;  4NMU A;  1WP0 A;  4EDZ A;  1A2L A;  1PSQ A;  2QGV A;  2A4H A;  1TRV A;  2WUL A;  4PQI A;  5KN2 A;  3GV1 A;  1Z6M A;  2Z9S A;  4GCI A;  4WR5 A;  5KN0 A;  3P90 A;  1GTA A;  3LEF A;  3DKS A;  1V40 A;  1GWC A;  4K7N A;  2DBC A;  2WZ9 A;  3BCI A;  5J4U A;  4Q5R A;  1R26 A;  1ERU A;  2YOI A;  4NV2 A;  1LJR A;  2I3Y A;  3D5J A;  1XOA A;  1ON4 A;  3A2W A;  1LU4 A;  4BWS A;  3IC4 A;  2EIR A;  2DJ0 A;  2DJ3 A;  2VIM A;  2GSR A;  4HI7 A;  1A8Y A;  4MF7 A;  1FOV A;  1N8J A;  3DEX A;  1BED A;  1V2A A;  1K0D A;  1GLQ A;  2EIQ A;  4OFM A;  4ZB8 A;  2LQQ A;  5ABR A;  1OE7 A;  3ERW A;  2DLX A;  4DSS B;  5D73 A;  3I69 A;  1HD2 A;  5DCG A;  1ZYQ B;  4KW6 A;  3ZMK A;  1CQG A;  2VCX A;  2GGT A;  1ABA A;  2IMK A;  4TXV A;  3F9U A;  2HRK A;  3QOU A;  3KP9 A;  3A5I A;  3LWA A;  3GTU A;  2J9H A;  4XRA A;  2LRN A;  1Y6E A;  1PN0 A;  4ECJ A;  4HJM A;  2IFQ B;  4IGJ A;  4XS1 A;  5D9X A;  2YV7 A;  4EKZ A;  2B5Y A;  3OR5 A;  3J7Y b;  3J7Y k;  4GQC A;  4IKH A;  4JR6 A;  1A23 A;  2CV4 A;  2DSA A;  2E2G A;  3RPP A;  2RUE A;  1PL1 A;  2C0D A;  5EY6 A;  2LNT A;  4NAX A;  3WT1 A;  2TIR A;  2HZE B;  3VPT A;  3I9V 2;  3G7J A;  2VCW A;  2GQK A;  4X0X A;  2IPA A;  3TKP A;  4MF5 A;  1SD9 A;  3ZYW A;  1GSE A;  2J23 A;  2YWO A;  3W8J A;  1HNA A;  5B8A A;  4LL4 B;  2BMX A;  4MZB A;  1AAZ A;  4JR4 A;  2OBK A;  3D4T A;  1E6B A;  1ZL9 A;  4FYC A;  4K0G A;  4JE1 A;  1SJZ A;  3JCM L;  5KN3 A;  3R2Q A;  1TK0 B;  4OO5 A;  2H1G A;  5DBQ A;  3NZN A;  2AV4 A;  5IOX A;  4TR1 A;  4V1A g;  2MBT A;  2PU9 C;  4XHM A;  3GL3 A;  4O32 A;  3TJK A;  2C1Y A;  1ST9 A;  1XZO A;  4KGI A;  1GSU A;  3BOA A;  4ULX A;  4K2X A;  4IBP A;  3GA4 A;  2V2G A;  3IOS A;  5GAP D;  3ZZX A;  1HNC A;  2DML A;  1Q98 A;  2CQ9 A;  2RLI A;  3W8S A;  4GF0 A;  3FY7 A;  2H75 A;  3RHB A;  4LMW A;  2VM2 A;  2JSZ A;  1GUK A;  2E0Q A;  4A5P A;  4K9Z A;  1EZK A;  3LXZ A;  3HVV A;  1SD8 A;  2VCZ A;  4FO5 A;  3LFL A;  2H1B A;  4BVX A;  4NHW A;  2IMD A;  3KTB A;  1BJX A;  3LYK A;  2KUC A;  4D73 B;  4TXO A;  1ZGN A;  4PXO A;  2ZCT A;  1XWB A;  5LD0 A;  3KZQ A;  4ZL9 A;  1B8X A;  1G6W A;  2WS2 A;  2OA7 A;  3F63 A;  1B4P A;  2O8V B;  3DYR A;  1TXX A;  5H5R A;  1DBY A;  4IVF A;  5J9C A;  5E59 A;  4WF4 A;  2GSS A;  5B6N A;  2YP6 A;  3M9K A;  3VPQ A;  5HFG A;  5DQY A;  4IEL A;  4MH3 A;  1XW6 A;  1OKT A;  5AIS A;  1K3O A;  3G7Y A;  3DVW A;  2GVP A;  5COH A;  4HZ2 A;  1LBK A;  1GUM A;  4GXZ A;  4OO4 A;  1B48 A;  3M9J A;  2YN1 A;  3VWV A;  3H1N A;  1U6T A;  2QKE A;  2BTO T;  2OE1 A;  3MIX A;  1JZO A;  1S3C A;  1XIY A;  5IMZ A;  1V58 A;  1M2B A;  3FR9 A;  2ALB A;  3NIV A;  4PGT A;  5KEJ A;  2C0F A;  2UZ8 A;  1DUG A;  3NOF A;  4K7O A;  5CRW A;  4PUF C;  3VK9 A;  4CW9 A;  3LQ7 A;  5G5F A;  3UVT A;  4KUN A;  1Z3E A;  3L9V A;  3DIE A;  4F0C A;  2N5A A;  1TRS A;  5CAX A;  5DDL A;  2IIY A;  1EGR A;  1K3L A;  1PQN A;  2HRA A;  2NPB A;  3HJM A;  2GQL A;  2I1U A;  1MD3 A;  3PPU A;  1G7O A;  1YF0 A;  4WXT A;  1S3A A;  4G19 A;  2F8F A;  5JCU A;  1R5A A;  1JZR A;  1AXD A;  2R0G A;  3D6I A;  5A4U A;  2I9H A;  1J0F A;  3HJP A;  4XS4 A;  2O85 A;  3UAR A;  1SK0 A;  2K18 A;  5FT3 A;  2FGX A;  1AQV A;  2MYG A;  4KX4 A;  4BVY B;  4I8B A;  1EOH A;  1TI3 A;  2C0E A;  2PUK C;  1TTZ A;  5D9T A;  2HRN A;  5JCW A;  3HVX A;  4V1A p;  1J9B A;  1KEB A;  2B1K A;  1G0T A;  1NHY A;  2MMZ A;  4WR4 A;  2F3M A;  3F4S A;  4KB3 A;  3CSI A;  3TUE A;  2CX3 A;  3BD2 A;  2L4C A;  1V9W A;  2L6D A;  5IMF A;  3CSJ A;  4EIQ A;  4X1U A;  3M8N A;  3EE2 A;  1BQ7 A;  3ZIT A;  1YDK A;  2L6C A;  5JCG A;  3GFK A;  5G30 A;  5INY A;  2HFD A;  4H86 A;  1XWA A;  1ZYN A;  3CYN A;  1SYX A;  2M46 A;  3GNJ A;  1KBN A;  3UBK A;  4CDO A;  2JZS A;  1Z9H A;  4K7I A;  3N5O A;  3EMX A;  3KIJ A;  3F3Q A;  3LOR A;  4N0V A;  3EMP A;  4ML6 A;  2JSY A;  4I97 A;  2OAD A;  1O81 A;  2P5Q A;  3U6V A;  1THO A;  4K5R A;  1XOB A;  4EC0 A;  1EV4 A;  4MA9 A;  5BRT A;  2QSI A;  5AN1 A;  3EU3 A;  5ECL B;  3VWX A;  3EVI A;  1WOU A;  3APS A;  3QMX A;  1T4Y A;  3GX8 A;  4FH8 A;  3US3 A;  5H5S A;  5ECS A;  4I6X A;  2DJ1 A;  4I2U A;  1X5C A;  2VM1 A;  4POM A;  3FR3 A;  3KXO A;  2FHE A;  4ZBB A;  1N2A A;  4ID0 A;  2NVL A;  3DRN A;  2HNL A;  5HFI A;  2YJH A;  2YZU A;  2H72 A;  1GTU A;  5F0G A;  1FO5 A;  2PGT A;  3ZVJ A;  3C1R A;  4EO3 A;  2B3S A;  2N5F A;  4X43 A;  1EEJ A;  1SKR B;  4EVM A;  5LNK e;  2YJ7 A;  2OKA A;  1GSS A;  3QDN A;  1FB6 A;  3KEB A;  3UEM A;  1QXH A;  2P5R A;  3L0H A;  2L5O A;  5ID2 B;  1OAZ A;  4ACS A;  3O76 A;  4MH2 A;  5A5K A;  4TR3 A;  1WPI A;  3I6A A;  4ML1 A;  4G0K A;  3ZML A;  2PVO C;  3IDV A;  5E4W A;  1U87 A;  3DGQ A;  19GS A;  3D21 A;  3ZIJ A;  1TOF A;  3GL5 A;  3TKQ A;  2G0F A;  5G31 A;  2H6Y A;  3O6T A;  3HKR A;  3TJB A;  2CZ3 A;  3UMA A;  1V98 A;  3GKN A;  3TDG A;  1V57 A;  1K0A A;  2OBI A;  4CY8 A;  3GUR A;  16GS A;  1B9X C;  4OCF A;  3ERF A;  2LQO A;  1XPV A;  1OC9 A;  2K8V A;  1SL1 B;  4IP1 A;  3L9U A;  2DKH A;  5C00 A;  4G0I A;  1KNG A;  4WEY A;  2GQM A;  4LMV A;  2O89 A;  4EDY A;  3F4R A;  3BBY A;  5D9V A;  2I81 A;  4Z2T A;  3WT2 A;  2GT6 A;  2ZNM A;  3CSH A;  1WRY A;  1GL8 A;  2FUG 2;  2A4V A;  4NV5 A;  2H0I A;  2CAQ A;  2H76 A;  1XW5 A;  2LTK A;  3EPT A;  3ISO A;  1VF4 A;  1NSW A;  1HQO A;  1PGT A;  4EIP A;  1GP1 A;  1XXU A;  11GS A;  4JZQ A;  2IMF A;  3UIW A;  4V2N A;  1URM A;  3FW2 A;  4EF0 A;  1ACV A;  5A4V A;  2VCT A;  2PWJ A;  5AGY A;  4TN8 A;  1YY7 A;  3GUS A;  4KCE A;  2HI7 A;  3EC3 A;  4JRR A;  2ON5 A;  4EUY A;  1F3B A;  1UN2 A;  1R5P A;  5AIX A;  1PX7 A;  6GSS A;  1PA3 A;  1M9B A;  3EYT A;  4OWY A;  1T3B A;  3KM6 A;  4BL7 A;  4E8H A;  1W89 A;  3C71 A;  3TOU A;  3ZTL A;  3HHV A;  4BPY A;  9GSS A;  3I43 A;  3FHK A;  1HNB A;  1QQ2 A;  5DAL A;  1ERT A;  2FCH A;  3IE3 A;  4OMV A;  3LGC A;  3ZLP A;  2IME A;  1AW9 A;  2C3Q A;  2XPE A;  1K3Y A;  1RK4 A;  3IXR A;  2XBQ A;  5KOW A;  4NHZ A;  2GTU A;  4KH7 A;  1I5G A;  3SWL A;  5DAK A;  2LS5 A;  2YWM A;  3ZRE A;  5IIZ A;  3TOT A;  4WKW A;  4QL9 A;  1SJ6 A;  1SKW B;  5DJL A;  4G9H A;  1ILO A;  1G7E A;  4WBJ A;  2XBI A;  3IA1 A;  1QMV A;  4NWY A;  1MEK A;  3DXB A;  3DWV A;  3N9J A;  4Q5N A;  3A3T A;  4MCU A;  3QR6 A;  2REM A;  2HSY A;  4GQF A;  2MMN A;  4N0Z A;  4WBR D;  1PKZ A;  1GUL A;  4MK3 A;  1TP9 A;  13GS A;  2WGR A;  1A24 A;  3WGD A;  1YZX A;  2X64 A;  4TRX A;  1H75 A;  1M99 A;  4MJE A;  1WMJ A;  3H93 A;  3GX0 A;  5GAN D;  2HSH A;  3F4T A;  3HD5 A;  3MSZ A;  1GUH A;  4MMM A;  4OFN A;  2VL2 C;  1K0N A;  3L4N A;  4L0W A;  4YQV A;  4Z2R A;  1PL2 A;  4PQ1 A;  4RI6 A;  4J56 E;  1YJ6 A;  1A2J A;  3APO A;  1XWK A;  3D4M A;  1GH2 A;  1RQM A;  2DC5 A;  1U3A A;  2RII A;  2MBS A;  2LJR A;  3W6G A;  3MWH A;  4KF9 A;  4LLR A;  5JWO B;  4E8E A;  5B6M A;  2M80 A;  1AC1 A;  1VGL A;  1IYI A;  3TKS E;  3RDW A;  3KP8 A;  3E0U A;  1O7U A;  2GS3 A;  4IQ1 A;  1ZCP A;  2NTO A;  2C0G A;  5A4W A;  1AQW A;  2K8S A;  3WGX A;  2YWI A;  4ZBD A;  1BG5 A;  4J57 E;  4IQA A;  2GZZ A;  1QGV A;  3IR4 A;  3UJ1 A;  1MDI A;  2HE3 A;  2AB6 A;  4X4J A;  2JL4 A;  1M2A A;  2H66 A;  1SKS B;  5ECH B;  4ICY A;  3L78 A;  1VF2 A;  3GSS A;  1T1V A;  3L9S A;  3H8Q A;  2OAC A;  4AF2 A;  1B4Q A;  1R7H A;  2GT5 A;  3RBT A;  4G10 A;  5GZZ B;  1YQ1 A;  1YF1 A;  4F2I A;  5IPH A;  4MP4 A;  2C4J A;  3GRX A;  2L4Q A;  3M0F A;  4DVC A;  2CVD A;  2G2Q A;  1XWG A;  2C8U A;  3CRT A;  4G2E A;  1SL2 B;  1TJD A;  3UVH A;  5CO3 A;  2VCQ A;  1GRX A;  3UOM A;  5ECQ B;  2VCV A;  2H73 A;  3G9B A;  4RUV A;  4RI7 A;  4JU5 A;  3ZFL A;  1BAY A;  3EU4 A;  3CTF A;  1TK8 B;  6GSW A;  2AJQ B;  2TRC P;  3EUR A;  10GS A;  1FB0 A;  2BJX A;  2N5B A;  4XS6 A;  1FAA A;  3ZFB A;  1AIU A;  1ZMA A;  3M1G A;  2H0H A;  4DSS A;  6GSY A;  5F8B A;  5ECM B;  4KDU A;  3WD6 A;  2H30 A;  1TW9 A;  2RM6 A;  4ZBA A;  3LJR A;  2PMT A;  2JZR A;  4POL A;  14GS A;  5HR1 A;  6GST A;  3MAK A;  5ENU A;  3R3E A;  3PGT A;  2LJA A;  4F03 A;  3A2V A;  1K0C A;  1S3D A;  4YH2 A;  3FR6 A;  4L5L A;  2IFQ A;  3HCZ A;  3QAV A;  1FVK A;  2QC7 A;  2LRC A;  4NPB A;  1Z7P A;  4ZL8 A;  3FRC A;  1NHO A;  1PX6 A;  8GSS A;  3IC8 A;  3KH7 A;  2GSQ A;  2HZE A;  5J3R A;  4IJI A;  4RQX A;  4MAB A;  5G5E A;  4XCS A;  1G6Y A;  4O5R A;  2V6K A;  2QA2 A;  3GTU B;  1UVZ A;  4LA1 A;  1WIK A;  4XIH A;  4ECB A;  2R6K A;  12GS A;  4QQ7 A;  3H79 A;  2PVQ A;  5ECI B;  1MD4 A;  2WRT A;  3VWU A;  2EC4 A;  5J9B A;  3KD0 A;  3SBC A;  4OD7 A;  4XTS A;  3VUR A;  3HYP A;  1ZOF A;  1X5E A;  2VOC A;  4EL1 A;  1VRS D;  3TRQ A;  5ELA A;  3D22 A;  3KJY A;  2LJK A;  1ERV A;  4YAP A;  2M72 A;  3FMW A;  3F6D A;  1EWX A;  1EGO A;  3QD9 A;  3ZIV A;  5G1K A;  5ECP B;  2YZH A;  1K0B A;  4MPF A;  1GSY A;  2AAW A;  3K8N A;  3MNG A;  4Q5Q A;  3F3R A;  2X49 A;  3KH9 A;  1A0F A;  4GWR A;  4L5O A;  3HZ8 A;  1T4Z A;  4ECC A;  4YKG A;  2XC2 A;  4YQU A;  3V1W A;  2YWN A;  2H6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...