1EGOA

Nmr structure of oxidized escherichia coli glutaredoxin: comparison with reduced e. coli glutaredoxin and functionally related proteins
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
85
structure length
85
Chain Sequence
b'MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title NMR structure of oxidized Escherichia coli glutaredoxin: comparison with reduced E. coli glutaredoxin and functionally related proteins.
pubmed rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 28
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1egoA00
5CAXA 2GT6A 1B9XC 4YH2A 3CRUA 3GHAA 1K3OA 2VLTA 1FW1A 1GL8A 3GKNA 4NAXA 3HHVA 4RUVA 1DUGA 2PVOC 2VCVA 2LJAA 1USBA 4XHMA 2DLXA 1LBKA 3VLNA 1K0NA 2I81A 5D9XA 4I97A 1OAZA 4DSSB 2JU5A 3GNJA 4TOPA 1NW2A 5HFGA 1EGRA 4WR5A 1F37A 1Q4JA 1XCCA 4ZL7A 3H93A 3DVWA 1IYIA 1O6JA 2R4VA 1MD4A 1YY7A 3TJFA 1EWXA 5KN0A 1GULA 4PGTA 1XW5A 3H4KA 4KAEA 2LJKA 3TRPA 1T00A 2HXKA 1A2LA 4N30A 2V1MA 3GUSA 1V58A 3PINA 2XPEA 2TRXA 3ZFBA 2GS3A 2GTUA 4GWRA 1SYRA 2LV3A 2BMXA 3ZFLA 1QMVA 2RLIA 1CQHA 2HNLA 4J57E 3M0FA 3DWVA 2C0FA 1YEXA 4V2NA 1Z9HA 1X9MB 3IOSA 2VCZA 4PXOA 3M8NA 2X99A 5G1KA 4ZB6A 3WD6A 1N8JA 1WRYA 2JACA 2X8HA 1J9BA 5IIZA 2OKAA 2LJRA 4HI7A 1GSYA 18GSA 2H6YA 1RW1A 3IE3A 4WBJA 3O76A 1T4ZA 3IAM2 3I43A 3I6AA 1B4QA 4JR4A 3FR9A 4EE0A 2FNOA 3M1GA 3C1SA 1TRVA 4MJBA 5F07A 3GH6A 1XPVA 3IA1A 3IPZA 1XW6A 5A4VA 3KJYA 4GQFA 2CT6A 1V57A 2JZTA 3GN3A 3DVXA 4LMWA 2VUPA 3QR6A 5HQPA 2CV4A 5HFKA 3EVIA 2FLSA 4QL9A 1ACVA 3D6IA 2JZSA 5DQYA 4HQZA 4AF2A 2PU9C 4ISDA 4WR4A 2H0HA 2QGVA 3GYKA 3HZ8A 3UVHA 1PMTA 2HYXA 3A3TA 3LJRA 4Q5RA 1G7EA 5F8BA 5DALB 2QSIA 1K3YA 4ZILA 2H75A 3J7Yb 4MZCA 1ERTA 1OC9A 3UARA 1X5CA 1JFUA 1M9BA 3GA4A 2P5RA 5B6NA 1SJZA 1TP9A 1GSDA 1M0UA 1TRUA 1GUHA 2CVBA 3F3RA 3GKMA 3WT1A 2BTOT 1GP1A 5COHA 3VI7A 3EURA 1LJRA 1YEPA 2P31A 3QAGA 4ECJA 2JZRA 2AHEA 1KEBA 3K8NA 1V9WA 3ZTLA 2MMNA 2OBIA 3D4TA 2FY6A 4L5OA 3F4RA 4MJEA 4OCFA 4LA1A 2FCHA 4EO3A 4GF0A 4Z7XA 2IFQB 4RI7A 1T7PB 4HU7A 4MABA 1PSQA 3A2XA 4AJ8A 4NXIA 4ACSA 2CAIA 3FYGA 2G0FA 2K6VA 5IO2A 2FA8A 2M72A 2K8SA 3GMFA 3HVXA 3I69A 3F6FA 4YAVA 2V6OA 2GSTA 3LEFA 3RAZA 3VWXA 6GSWA 3IK9A 3UBKA 3FHKA 3C71A 4PQ1A 1E6BA 3NOFA 1XWKA 5ECSA 4DSQA 2VLVA 2KOKA 4F0BA 1BYEA 2VLUA 4EL1A 3CSHA 2DJKA 4HS1A 4MF5A 2VL3A 1F3AA 2DJJA 1O85A 3D4MA 3ZMLA 4MZWA 1ZYEA 2I4AA 3FK8A 5LCZA 5B6MA 3HD5A 4AGSA 2EC4A 2CVDA 2H1AA 3MNGA 2D2ZA 3R2QA 2FGXA 3KXOA 3US3A 1X5EA 2GZPA 3W6GA 1PKZA 1SK2A 1XWAA 2YV9A 3UJ1A 4IHUA 2HSYA 3G7JA 2PN8A 2MMZA 1O73A 5JWOB 4FH8A 5INYA 4OFTA 2FA4A 4KE3A 3QPMA 3VK9A 1DE1A 2LQOA 1R5AA 1GNEA 4IJ3A 2KLXA 2FWEA 2GGTA 4GSSA 1G6YA 2IJYA 5A4UA 5C04A 2H19A 1Q98A 1ABAA 3M9JA 4XRAA 5L71A 3IXRA 2HE3A 4YQMA 1XZOA 2VOCA 3UMAA 5D9WA 3HJOA 4MPGA 2ZUPA 2B7JA 2B5EA 1M9AA 4ZL8A 2IMFA 5ELAA 1T8EB 3GH9A 2OA7A 4EDZA 2IIYA 4POBA 5ECLB 3QOUA 2PVQA 2OE3A 1PX7A 3EMPA 3IAS2 3A2WA 1WWJA 3FZ9A 3GIXA 4FIWA 4XS4A 4I5QA 4PQHA 3U5RE 2MZCA 4WETA 3CYNA 5J41A 4IP1A 5G31A 2YV7A 3GFKA 4EDYA 2CAQA 3ZVJA 3H8QA 4JE1A 2ON5A 1FVKA 2RUEA 1DBYA 2NDOA 2VIMA 2V41A 2YJHA 4ML6A 2WDUA 4TKYA 5JCGA 2H73A 5EY6A 1R4WA 1GNWA 1F6MC 4MMMA 2CQ9A 2RM6A 2O89A 3KZQA 3L9SA 2MYGA 1TW9A 3ZYWA 3FW2A 3DGQA 5KN2A 5ECIB 1PX6A 1I5GA 4K7OA 1OC9B 3IK7A 2OACA 2JSYA 4GXZA 1THOA 4O7HA 4NV5A 2WB9A 3TGZA 1B9YC 1K0OA 3LGCA 4TR0A 4KCAA 2H71A 2OE1A 2LUSA 3GL5A 1PN9A 1H4OA 3A2VA 2XBQA 3KM6A 4O5RA 3ERFA 4WBRD 5E4WA 3EMXA 1B8XA 2DJ1A 3M9KA 2RUFA 3RPNA 4HUAA 2E2MA 2IPAA 4K1FA 3GKXA 1SL2B 1ZZYA 1TU7A 3KGKA 4MCUA 5IMDA 2F9SA 5IMAA 1SYXA 3DRNA 1EGOA 5AIXA 4TRXA 1GLPA 22GSA 1QGVA 2O7KA 5G2ZA 5D9VA 5GSSA 3C1RA 4LL1B 2R5GA 3P90A 3TJBA 5H5RA 1T3BA 2GSQA 3QAVA 4GTUA 5A5KA 1G6WA 2PBJA 1W89A 3RHCA 1MDKA 1X5DA 3Q19A 1K0DA 3W8SA 2F8AA 4TXOA 5CYYA 2GVPA 4YQVA 4V1Ag 2KHPA 5ECOB 2H1DA 4TXVA 2PMTA 3IHQA 2WULA 2YWNA 1EP7A 4KH7A 2WRTA 3LG6A 1NM3A 3LQ7A 2P0GA 20GSA 2CX3A 5IPHA 4GCIA 5JCWA 3O6TA 6GSUA 2CX4A 3VURA 3GSSA 5ECQB 5IMFA 4BVYA 3RPPA 5DJMA 2F51A 1FHEA 3ME7A 12GSA 4ECBA 1C72A 1F9MA 4KDUA 5ENUA 2LEGA 1ERWA 3CBUA 1TXXA 4KDXA 3V1WA 1RQMA 3EINA 2DSAA 3G7IA 4FYBA 2O85A 5G5FA 5ECHB 4F0CA 4HZ2A 4MDCA 2YJ7A 1X0RA 1AQXA 3O3TA 2AYTA 4G2EA 1RK4A 1T1VA 2C4JA 4KNDA 5IOXA 2CZ3A 2CVKA 5J4UA 2KP2A 1MDIA 1PGTA 3HKRA 2VO4A 2XBIA 16GSA 2H66A 3DMLA 4MH3A 2H70A 10GSA 2VL9A 2F8FA 2OJLA 4PNFA 5EL8A 1JZDA 1GTIA 4OO4A 4TR4A 1TK8B 1WP0A 3IV4A 1A0RP 5GSTA 5HR3A 5CRWA 2V32A 2LNTA 1Z6MA 1B48A 1XIYA 4PQIA 3HY2A 2VCXA 5A4WA 1JHBA 4NHZA 3HVVA 3GTUA 4KW6A 3GRXA 4XS4B 3CXGA 3E3EA 2XPDA 2WCIA 1M7TA 4I2TA 2L4CA 5ECRB 6GSVA 1OKDA 1I9DA 4JBBA 2R37A 2QKEA 1ZCPA 4KB3A 1URMA 1SJIA 4I2UA 4KA0A 2GSRA 3L4NA 2HZEA 4MK3A 4WF4A 3HZ4A 3Q18A 5EVOA 2C3NA 3DEXA 3ZMKA 4J56E 3SBCA 1O8WA 5D9TA 4KGIA 3BCKA 5EPFA 5IMCA 5B7CA 3KP8A 5JCUA 4ID0A 3DYRA 3EE2A 4TVEA 4H86A 4K8MA 1EV4A 2MBTA 1GTBA 1THXA 2IMKA 2H74A 1QK8A 14GSA 4J2FA 3I9V2 2I9HA 3LFLA 3Q6OA 4ZL9A 3F8UA 2LRCA 1DSBA 3KMNA 1J08A 1TDIA 3BCIA 2JL4A 2L6CA 2I3YA 2FWGA 4PUAA 5KEJA 4K7NA 5DCHA 3ED3A 5HR0A 3IBHA 1ERVA 4L8EA 3HJMA 4K6XA 2K18A 5ECMB 3LORA 1PL1A 4E8EA 4IGJA 1GLQA 4GSTA 3VWUA 4MA9A 1S3CA 3ZITA 4P3YB 2VL2A 5H5QA 3UOMA 1UVZA 3FEUA 4GLTA 1GTAA 6GSYA 4IVFA 4OCEA 1XWGA 1UN2A 2GSSA 1YZXA 1ZL9A 2VCWA 2O87A 2L6DA 1O7UA 4MLYA 1XOBA 4ILFA 4MF6A 4TN8A 1PQNA 1A2MA 2AAWA 2EIOA 2X64A 1OYJA 4DEJA 4TXOB 2ZCTA 2WS2A 1SD9A 2DJ2A 2YZHA 1OC8A 2WJUA 3JCML 2VM1A 1VF1A 3KP9A 3QDNA 1BX9A 5F0GA 3OR5A 3VWVA 1FG4A 2H1BA 3TUEA 4K9ZA 2HRFA 1UA5A 3WGDA 9GSSA 1XXUA 3FKFA 5CO3A 2WFCA 2B1LA 1M2BA 2PPTA 1AC1A 2B6MA 1J0FA 2YCDA 3G9BA 2GDRA 5FT3A 4X43A 4F9ZA 2GZYA 3KTLA 3TKRA 1YF1A 4NV2A 1SK1A 1XWBA 3BJ5A 4OMVA 1PD21 5G5EA 4WXTA 3KTBA 5AGYA 2ON7A 4PX1A 4BVXA 5DJLA 4ZBBA 3CTGA 3FZAA 1TOFA 2AJQB 3KIJA 4CDOA 2PUKC 3L78A 1OKTA 3LSZA 1FOVA 4PNGA 2DIZA 2EIQA 3TKSC 3ZLPA 3ZL5A 2YZUA 4CW9A 1U87A 3D21A 4K0NA 1H75A 3LYKA 1HNAA 3UEMA 4L5LA 4EKZA 1U88A 1XOAA 1AIUA 5IMVA 3N5OA 4ECCA 1JZRA 1V98A 5FWGA 1ON4A 3PGTA 2GLRA 4MP4A 1Y25A 3WGEA 3FZ5A 3L9VA 5IQYA 2AUVA 3GX8A 2LS5A 3E0UA 2YOIA 3D0ZA 1BAYA 3GTUB 5J3RA 1GTUA 4IBPA 1JLVA 2VD0A 1AQVA 5DVBA 1DE2A 2OADA 3UVTA 3GV1A 2C0DA 4G19A 4BPYA 1TK0B 5AN1A 5DBQA 3GL3A 2FWHA 4QL7A 3A5WA 2L5OA 1R26A 1FB6A 1GH2A 1GSUA 2A2RA 2HZEB 2RIIA 2REMA 1HQOA 1A8YA 2NBSA 3QFBC 1EEJA 3TKQA 3ME8A 3EU3A 5IO0A 2PWJA 3TJJA 5D96A 3KD0A 3QMXA 1IYHA 3F6DA 4KSMA 3F9UA 3ZRDA 4HU9A 3ERWA 5HR1A 1Z7PA 4RQRA 1G0TA 4EVMA 4MH2A 3MDKA 3APQA 4IS0A 1VF2A 4RI6A 6GSSA 1GUKA 3HDCA 4KSOA 1V2AA 3NZNA 3HJPA 1QUWA 3QCPA 2N5BA 3RHBA 1TRWA 19GSA 1A24A 4V1Ap 2N5FA 2H30A 4Q5NA 3GSTA 3VI5A 4RQXA 5F05A 4HJMA 1U3IA 4FYCA 4ULXA 4N11A 5ELGA 1K0BA 3DIEA 2KUCA 3KH9A 2DIYA 4OWYA 1ZOFA 2IL3A 1HD2A 4IW9A 3F0IA 1Z5YE 1EZKA 4L0WA 3KH7A 4KX4A 3TCOA 2GZZA 1R5PA 1YQ1A 1YJ6A 2LNSA 5JWRB 1AW9A 4HOJA 1PL2A 1GUMA 2MMOA 3EWLA 4XRDA 5GAND 2AB6A 1M2DA 1U3AA 2J9HA 2H6ZA 2HI7A 4G9HA 2A4VA 3ERGA 4N0ZA 3QAWA 1JZOA 3MSZA 1TTZA 1AXDA 4G10A 1R7HA 4V2MA 4Q5QA 2E2GA 2H0GA 1S3AA 1O8XA 4EUYA 3TJGA 4GSNA 2C80A 3U6VA 4HQSA 3ZIJA 2AV4A 3GKKA 3UIWA 5B8AA 1BQ7A 4TW5A 2H72A 3C7MA 4OD7A 2HZFA 2JADA 5B8BA 3F4SA 3F3QA 4IQ1A 1TK5B 2YWOA 2OE0A 3QFAC 1HNBA 2WZ9A 2I1UA 2CA8A 3LXZA 4XS1A 3UAPA 2H76A 1MD3A 7GSSA 2ES7A 5LD0A 4OO5A 4O32A 5DQSA 4E8HA 1PA3A 2OBKA 4IJIA 1VRSD 2DJ3A 1W4VA 4JRRA 1ZMAA 4YAPA 4TR1A 1OE7A 4DVCA 2F3MA 4BL7A 5CRDA 3IC4A 1N2AA 3P8WA 1F2EA 2H1GA 1CQGA 4XTSA 5ABRA 5FHIA 2IN3A 1AQWA 1EEMA 2O8VB 1QFNA 2H6XA 2EIRA 1VGLA 3SWLA 3APOA 3TB2A 1YDKA 1TI1A 4N0VA 3ZZXA 2B1KA 3CRTA 3TRXA 3CMIA 2VM2A 3M3MA 2L57A 1XVWA 4XCSA 4ECIA 3NIVA 4ZIJA 3P7XA 5ECPB 2CZ2A 1ZYQB 2E7PA 1KBNA 2VCQA 3PH9A 4WKWA 4FO5A 2X8CA 4X1UA 1E2YA 2NVLA 3GX0A 2YP6A 1LU4A 1TKDB 3G7YA 4D73A 2GQLA 3FRCA 3APSA 1SKWB 1Z3EA 3HYPA 1K0AA 1MTCA 4NWYA 3IDVA 3WT2A 4F82A 5KN3A 4JEDA 11GSA 4IN0A 1A2JA 5IMZA 5ID2A 4HEA2 2HT9A 3D22A 2L4QA 1WIKA 3VFIA 2VL2C 1A0FA 2H8LA 3RDWA 1FVJA 4ZBAA 2LQQA 3DD3A 4DSRA 1KNGA 3EC3A 4NMUA 4GQCA 2L5LA 1M99A 4FYUA 4ZB8A 4MJAA 4O92A 2YWIA 4PUFC 1GRXA 1Z7RA 4K0GA 3KMOA 3FZ4A 3TJKA 4WEYA 3TRQA 4MF7A 3S9FA 2FHEA 2ALBA 4MPFA 4BA7A 1ST9A 2IWTA 3LYPA 2PGTA 6GSXA 5ECNB 5LNKe 3PR8A 1TU8A 5DAKA 2YPMA 5D8IA 2H01A 3EYTA 1XVQA 1EOGA 3ISOA 1QXHA 3HCZA 1XBSA 5CP1A 3HXSA 3RBTA 3F4TA 1ILOA 2FD3A 3KEBA 3AY8A 13GSA 2N5AA 1OE8A 2WGRA 2DBCA 3CTFA 4ML1A 2M46A 1YF0A 4JR6A 1ML6A 1U6TA 2C3TA 1V40A 4HJ2A 1ZGNA 2FUG2 2K8VA 1EP8A 1OC3A 4XS6A 4EXJA 1SU9A 4JU5A 2HLSA 4OFNA 2DC5A 1JLWA 4NHWA 3TOUA 3UL3A 2LRTA 3VPQA 4CHSA 1SL0B 2KP1A 1GSEA 3L0HA 5GZZB 3TKSE 4YQUA 2NPBA 1ERUA 3TOTA 1SKRB 1TRSA 3QD9A 5D73A 2LKUA 1FB0A 1XWCA 2GQMA 5KN1A 3UBLA 3VWWA 1GSFA 1A23A 2YANA 1HYUA 2J23A 2A2SA 2X8GA 4N10A 1PRXA 2VAFA 4Q5FA 4JZQA 5J5NA 4K7IA 5IM9A 1VF3A 4HDEA 4F03A 5G1LA 3ZREA 2TRCP 2MBSA 3GURA 4TR1B 4DSSA 1WJKA 1K0MA 2GQKA 1SK0A 4I8BA 4IP6A 2YWMA 5CRHA 2R3XA 4LMVA 2IMEA 5HFIA 1KTEA 2P5QA 4IQAA 1UC7A 2L59A 2IMIA 5IPGA 4XIHA 3DXBA 5DDLA 2V2GA 4V2LA 5J9CA 1S3DA 3N9JA 4LL4B 1K3LA 1QQ2A 2E0QA 4HZ4A 2RM5A 4PURA 2C0GA 3MAKA 2M80A 1Z6NA 5HR2A 3TKPA 6GSTA 2LSTA 2R2JA 5CREA 5IOWA 2C1YA 1NHOA 3H79A 4KDYA 2MMAA 1T4YA 2GT5A 1EOHA 2C3QA 5CRGA 2NTOA 4EC0A 2Z9SA 5G30A 2YNXA 3ZVJD 4L0UA 4D73B 1G7OA 3WGXA 2TIRA 3EU4A 2B5YA 2BJXA 2IMDA 3BD2A 1FO5A 3DKSA 4MJCA 2B3SA 2VD1A 3VPTA 2XC2A 1YKAA 2ZNMA 4EF0A 3IR4A 3IRAA 5C00A 5H5SA 4LLRA 1AUCA 3BOAA 2G2QA 2R6KA 1PKWA 3LXTA 3C73A 5E59A 3P2AA 3D5JA 5J9BA 3TKSA 1WE0A 2FWFA 1X9SB 4MZBA 1MEKA 3FR6A 5ID2B 2DMMA 4IKHA 2LTKA 1XW9A 2V6KA 1GSQA 1BJXA 1BG5A 1EV9A 4WF5A 5D93A 1WMJA 1FAAA 1AAZA 3KCMA 5CNWA 2QC7A 4NPBA 3WYWA 4AJ6A 1YKCA 2HFDA 4ZXGA 3CSIA 3E9JB 5AISA 4X0XA 3L9UA 4ZBDA 1A8LA 5GAPD 1F3BA 5DALA 3H1NA 4I6XA 1WOUA 2DJ0A 2LRNA 4ZB9A 1VF4A 4QQ7A 1SD8A 3J7Yk 3HVSA 4POKA 3F63A 4BWSA 1NHYA 5ECKB 3FR3A 3TDGA 1B4PA 1OVNA 4GRFA 1WPIA 4POLA 2YN1A 1BEDA 1Y6EA 5DCGA 4KUNA 5DAKB 3CSJA 2HSHA 1HNCA 2JSZA 1K0CA 1XFLA 4K2DA 1TJDA 3Q74A 1SL1B 2HRNA 2C0EA 2K9FA 5AIVA 5F06A 1SJ6A 2B5XA 1TI3A 4OFMA 2PERA 3LWAA 2XHFA 2DMLA 4AJ7A 1GWCA 4F2IA 2B7KA 4TR3A 3MWHA 2C8UA 3ZIVA 3FY7A 4KCEA 17GSA 3W8JA 1M2AA 1JZWA 1MDJA 8GSSA 2H0IA 4BWQA 1SENA 5JWQB 2IFQA 1SKSB 3HA9A 3C8EA 4POMA 1GSSA 1NSWA 3BBYA 4IELA 1O81A 2VCTA 1X9WB
chains in the Genus database with same CATH superfamily
5CAXA 2GT6A 1B9XC 4YH2A 3CRUA 3GHAA 1K3OA 2VLTA 1FW1A 1GL8A 3GKNA 4NAXA 3HHVA 4RUVA 1DUGA 2PVOC 2VCVA 2LJAA 1USBA 4XHMA 2DLXA 1LBKA 3VLNA 1K0NA 2I81A 5D9XA 4I97A 1OAZA 4DSSB 2JU5A 3GNJA 4TOPA 1NW2A 5HFGA 1EGRA 4WR5A 1F37A 1Q4JA 1XCCA 4ZL7A 3H93A 3DVWA 1IYIA 1O6JA 2R4VA 1MD4A 1YY7A 3TJFA 1EWXA 5KN0A 1GULA 4PGTA 1XW5A 3H4KA 4KAEA 2LJKA 3TRPA 1T00A 2HXKA 1A2LA 4N30A 2V1MA 4Z2RA 3GUSA 1V58A 3PINA 2XPEA 2TRXA 3ZFBA 2GS3A 2GTUA 4GWRA 1SYRA 2LV3A 2BMXA 3ZFLA 1QMVA 2RLIA 1CQHA 2HNLA 4J57E 3M0FA 3DWVA 2C0FA 1YEXA 4V2NA 1Z9HA 1X9MB 3IOSA 2VCZA 4PXOA 3M8NA 2X99A 5G1KA 4ZB6A 3WD6A 1N8JA 1WRYA 2JACA 2X8HA 1J9BA 5IIZA 2OKAA 2LJRA 4HI7A 1GSYA 18GSA 2H6YA 1RW1A 4HSCX 3IE3A 4WBJA 3O76A 1T4ZA 3IAM2 3I43A 3I6AA 1B4QA 4JR4A 3FR9A 4EE0A 2FNOA 3M1GA 3C1SA 1TRVA 4MJBA 5F07A 3GH6A 1XPVA 3IA1A 3IPZA 4BIKA 1XW6A 5A4VA 3KJYA 4GQFA 2CT6A 1V57A 2JZTA 3GN3A 3DVXA 4LMWA 2VUPA 3QR6A 5HQPA 2CV4A 5HFKA 3EVIA 2FLSA 4QL9A 1ACVA 3D6IA 2JZSA 5DQYA 4HQZA 4AF2A 2PU9C 4ISDA 4WR4A 2H0HA 2X4AA 2QGVA 3GYKA 3HZ8A 3UVHA 1PMTA 2HYXA 3A3TA 3LJRA 4Q5RA 1G7EA 5F8BA 2HRAA 5DALB 2QSIA 1K3YA 4ZILA 2H75A 3J7Yb 4MZCA 1ERTA 1OC9A 3UARA 1X5CA 1JFUA 1M9BA 3GA4A 2P5RA 5B6NA 1SJZA 1PFOA 1TP9A 1GSDA 1M0UA 1TRUA 1GUHA 2CVBA 3F3RA 3GKMA 3WT1A 2BTOT 1GP1A 5COHA 3VI7A 3EURA 1LJRA 1YEPA 2P31A 3QAGA 4ECJA 2JZRA 2AHEA 1KEBA 3K8NA 1V9WA 3ZTLA 2MMNA 2OBIA 3D4TA 2FY6A 4L5OA 3F4RA 4MJEA 4OCFA 4LA1A 2FCHA 4EO3A 4GF0A 4Z7XA 2IFQB 4RI7A 1T7PB 4HU7A 4MABA 1PSQA 3A2XA 4AJ8A 4NXIA 4ACSA 2CAIA 3FYGA 2G0FA 2K6VA 5IO2A 2FA8A 2M72A 2K8SA 3GMFA 3HVXA 3I69A 3F6FA 4YAVA 2V6OA 2GSTA 3LEFA 3RAZA 3VWXA 6GSWA 3IK9A 3UBKA 3FHKA 3C71A 4PQ1A 1E6BA 3NOFA 1XWKA 2R0CA 5ECSA 4DSQA 2VLVA 2KOKA 4F0BA 1BYEA 2VLUA 4EL1A 3CSHA 2DJKA 4HS1A 4MF5A 2VL3A 1F3AA 2DJJA 1O85A 2DKHA 3D4MA 3ZMLA 4MZWA 1ZYEA 2I4AA 3FK8A 5LCZA 5B6MA 3HD5A 1PN0A 4AGSA 2EC4A 2CVDA 2H1AA 3MNGA 2D2ZA 3R2QA 2FGXA 3KXOA 4O5QA 3US3A 1X5EA 2GZPA 3W6GA 1PKZA 1SK2A 1XWAA 2YV9A 3UJ1A 4IHUA 2HSYA 3G7JA 2PN8A 2MMZA 1O73A 5JWOB 4FH8A 5INYA 4OFTA 2FA4A 4KE3A 2HSMA 3QPMA 3VK9A 1DE1A 2LQOA 1R5AA 1GNEA 4Z2UA 4IJ3A 2HRKA 2KLXA 2FWEA 2GGTA 4GSSA 1G6YA 2IJYA 5A4UA 5C04A 2H19A 1Q98A 1ABAA 3M9JA 4XRAA 5L71A 3IXRA 2HE3A 4YQMA 1XZOA 2VOCA 3UMAA 5D9WA 3HJOA 4MPGA 2ZUPA 2B7JA 2B5EA 1M9AA 4ZL8A 2IMFA 5ELAA 1T8EB 3GH9A 2OA7A 4EDZA 2IIYA 4POBA 5ECLB 3QOUA 2PVQA 2OE3A 2UZ8A 1PX7A 3EMPA 3IAS2 3A2WA 1WWJA 3FZ9A 3GIXA 4FIWA 4XS4A 4I5QA 4PQHA 4ICYA 1ZYPA 3U5RE 2MZCA 4WETA 3CYNA 5J41A 4K5RA 4IP1A 5G31A 2YV7A 3GFKA 4EDYA 2CAQA 3ZVJA 3H8QA 4JE1A 2ON5A 1FVKA 2RUEA 1DBYA 2NDOA 2VIMA 2V41A 2YJHA 4ML6A 2WDUA 4TKYA 5JCGA 2H73A 5EY6A 1R4WA 1GNWA 1F6MC 4MMMA 2CQ9A 2RM6A 2O89A 3KZQA 3L9SA 2MYGA 1TW9A 3ZYWA 3IC8A 3FW2A 3DGQA 5KN2A 5ECIB 1PX6A 1I5GA 4K7OA 1OC9B 3IK7A 2OACA 2JSYA 4GXZA 1THOA 4O7HA 4NV5A 2WB9A 3TGZA 1B9YC 1K0OA 3LGCA 4TR0A 4KCAA 2H71A 2OE1A 2LUSA 3GL5A 1PN9A 1H4OA 3A2VA 2XBQA 3KM6A 4O5RA 3ERFA 4WBRD 5E4WA 3EMXA 1B8XA 1M3JA 2DJ1A 3M9KA 2RUFA 3RPNA 4HUAA 2E2MA 2IPAA 4K1FA 3GKXA 1SL2B 1ZZYA 1TU7A 3KGKA 4MCUA 5IMDA 2F9SA 4EIQA 5IMAA 1SYXA 3DRNA 4USSA 1EGOA 4K5SA 4TRXA 5AIXA 1GLPA 22GSA 1QGVA 2O7KA 5G2ZA 5D9VA 5GSSA 3C1RA 4LL1B 2R5GA 3P90A 3TJBA 5H5RA 1T3BA 2GSQA 3QAVA 4GTUA 5A5KA 1G6WA 2PBJA 1W89A 3RHCA 1MDKA 1X5DA 3Q19A 1K0DA 3W8SA 2F8AA 4TXOA 5CYYA 2GVPA 4YQVA 1S3RA 4V1Ag 2KHPA 5ECOB 2H1DA 4TXVA 2PMTA 3IHQA 3HVNA 2WULA 2YWNA 1EP7A 4KH7A 2WRTA 3LG6A 1NM3A 3LQ7A 2P0GA 20GSA 2CX3A 5IPHA 4GCIA 5JCWA 3O6TA 6GSUA 2CX4A 3VURA 3GSSA 5ECQB 5IMFA 4BVYA 3RPPA 5DJMA 4G0KA 2F51A 1FHEA 3ME7A 12GSA 4ECBA 1C72A 1F9MA 4KDUA 5ENUA 2LEGA 1ERWA 3CBUA 1TXXA 4KDXA 3V1WA 1RQMA 3EINA 2DSAA 3G7IA 4FYBA 2O85A 5G5FA 5ECHB 4F0CA 4HZ2A 4MDCA 2YJ7A 1X0RA 1AQXA 4K2XA 3O3TA 2AYTA 4G2EA 1RK4A 1T1VA 2C4JA 4KNDA 5IOXA 2CZ3A 2CVKA 5J4UA 2KP2A 1MDIA 1PGTA 3HKRA 2VO4A 2XBIA 16GSA 5BRTA 2H66A 3DMLA 4MH3A 5KOXA 2H70A 10GSA 2VL9A 2F8FA 2OJLA 4PNFA 5EL8A 1JZDA 1GTIA 2QA1A 4OO4A 4TR4A 1TK8B 1WP0A 3IV4A 1A0RP 5GSTA 5HR3A 5CRWA 2V32A 2LNTA 1Z6MA 1B48A 1XIYA 4PQIA 3HY2A 2VCXA 5A4WA 1JHBA 4NHZA 2QA2A 3HVVA 3GTUA 4KW6A 3GRXA 4XS4B 3CXGA 3E3EA 2XPDA 2WCIA 1M7TA 4I2TA 2L4CA 5ECRB 6GSVA 1OKDA 1I9DA 4JBBA 2R37A 2QKEA 1ZCPA 4KB3A 1URMA 1SJIA 4I2UA 4KA0A 2GSRA 3L4NA 2HZEA 4PTSA 4MK3A 4WF4A 3HZ4A 3Q18A 5EVOA 2C3NA 3DEXA 3ZMKA 4J56E 3SBCA 1O8WA 5D9TA 4KGIA 3BCKA 5EPFA 5IMCA 5B7CA 3KP8A 4G0IA 5JCUA 4ID0A 3DYRA 3EE2A 4TVEA 4H86A 4K8MA 1EV4A 2MBTA 1GTBA 1THXA 2IMKA 2H74A 1QK8A 14GSA 4J2FA 3I9V2 2I9HA 3LFLA 3Q6OA 4ZL9A 3F8UA 2LRCA 1DSBA 3KMNA 1J08A 1TDIA 3BCIA 2JL4A 2L6CA 2I3YA 2FWGA 4PUAA 5KEJA 4K7NA 5DCHA 3ED3A 5HR0A 3IBHA 1ERVA 4L8EA 3HJMA 4K6XA 2K18A 5ECMB 3MYDA 3LORA 1PL1A 4E8EA 4IGJA 1GLQA 4GSTA 3VWUA 4MA9A 1S3CA 3ZITA 4P3YB 2VL2A 5H5QA 3UOMA 1UVZA 3FEUA 4GLTA 1GTAA 6GSYA 3R3EA 4IVFA 4OCEA 1XWGA 1UN2A 2GSSA 1YZXA 1ZL9A 2VCWA 2O87A 2L6DA 1O7UA 4MLYA 1XOBA 4ILFA 4MF6A 4TN8A 1PQNA 1A2MA 2AAWA 2EIOA 2X64A 1OYJA 4DEJA 4TXOB 2ZCTA 2WS2A 1SD9A 2DJ2A 2YZHA 1OC8A 2WJUA 3JCML 4X4JA 2VM1A 1VF1A 3KP9A 3QDNA 1BX9A 5F0GA 3OR5A 3VWVA 1FG4A 2H1BA 3TUEA 4K9ZA 2HRFA 1UA5A 3WGDA 9GSSA 4BVYB 1XXUA 3FKFA 5CO3A 2WFCA 3CQFA 2B1LA 1M2BA 2PPTA 1AC1A 2B6MA 1J0FA 2YCDA 3G9BA 2GDRA 5FT3A 4X43A 4F9ZA 2GZYA 3KTLA 3TKRA 1YF1A 4Z2TA 4NV2A 1SK1A 1XWBA 3BJ5A 4OMVA 1PD21 5G5EA 4WXTA 3KTBA 5AGYA 2ON7A 4PX1A 4CY6A 3LW9A 4BVXA 5DJLA 4ZBBA 3CTGA 3FZAA 1TOFA 2AJQB 3KIJA 4CDOA 2PUKC 3L78A 1OKTA 3LSZA 1FOVA 4PNGA 2DIZA 2EIQA 3TKSC 3ZLPA 3ZL5A 4EIPA 2YZUA 4CW9A 1U87A 3D21A 4K0NA 1H75A 3LYKA 1HNAA 3UEMA 4L5LA 4EKZA 1U88A 1XOAA 1AIUA 5IMVA 3N5OA 4ECCA 1JZRA 1V98A 5FWGA 1ON4A 3PGTA 2GLRA 4MP4A 1Y25A 3WGEA 3FZ5A 3L9VA 5IQYA 2AUVA 2X49A 3GX8A 2LS5A 3E0UA 2YOIA 3D0ZA 1BAYA 3GTUB 5J3RA 1GTUA 4IBPA 1JLVA 2VD0A 1AQVA 5DVBA 1DE2A 2OADA 3UVTA 3GV1A 2C0DA 4G19A 4BPYA 1TK0B 5AN1A 5DBQA 3GL3A 2FWHA 4QL7A 3A5WA 2L5OA 1R26A 1FB6A 1GH2A 1GSUA 2A2RA 2HZEB 2RIIA 2REMA 1HQOA 1A8YA 2NBSA 3QFBC 1EEJA 3TKQA 3ME8A 3EU3A 5IO0A 2PWJA 3TJJA 5D96A 3KD0A 3QMXA 1IYHA 3F6DA 4KSMA 1ZYNA 3F9UA 3ZRDA 4HU9A 3ERWA 5HR1A 1Z7PA 4RQRA 1G0TA 1M3IA 4EVMA 4MH2A 3MDKA 3APQA 4IS0A 1VF2A 4RI6A 6GSSA 1GUKA 3HDCA 4KSOA 1V2AA 3NZNA 3HJPA 1QUWA 3QCPA 2N5BA 3RHBA 1TRWA 19GSA 1A24A 4V1Ap 2N5FA 2H30A 4Q5NA 3GSTA 3VI5A 4RQXA 5F05A 4HJMA 1U3IA 4FYCA 4ULXA 4N11A 5ELGA 1K0BA 3DIEA 2KUCA 3KH9A 2DIYA 4OWYA 1ZOFA 2IL3A 1HD2A 4IW9A 3F0IA 1Z5YE 1EZKA 4L0WA 3KH7A 4KX4A 3TCOA 2GZZA 1R5PA 1YQ1A 1YJ6A 2LNSA 5JWRB 1AW9A 4HOJA 1PL2A 1GUMA 2MMOA 3EWLA 4XRDA 5GAND 2AB6A 1M2DA 1U3AA 2J9HA 2H6ZA 2HI7A 4G9HA 2A4VA 3ERGA 4N0ZA 3QAWA 1JZOA 3MSZA 1TTZA 1AXDA 4G10A 1R7HA 4V2MA 4Q5QA 2E2GA 2H0GA 1S3AA 1O8XA 4EUYA 3TJGA 4GSNA 2C80A 3U6VA 4HQSA 3ZIJA 2AV4A 3GKKA 3UIWA 5B8AA 1BQ7A 4TW5A 2H72A 3C7MA 4OD7A 2HZFA 2JADA 5B8BA 3F4SA 3F3QA 4IQ1A 1TK5B 2YWOA 2OE0A 3QFAC 1HNBA 2WZ9A 2I1UA 2CA8A 3LXZA 4XS1A 3UAPA 2H76A 1MD3A 7GSSA 2ES7A 5LD0A 4OO5A 4O32A 5DQSA 4E8HA 1PA3A 4KF9A 2OBKA 2R0PA 4IJIA 1VRSD 2DJ3A 1W4VA 4JRRA 1ZMAA 4YAPA 4TR1A 1OE7A 4DVCA 2F3MA 4BL7A 5CRDA 3IC4A 3EPTA 1N2AA 3P8WA 4BVXB 1F2EA 2H1GA 1CQGA 4XTSA 4FQUA 5ABRA 5FHIA 2IN3A 1AQWA 1EEMA 2O8VB 1QFNA 2H6XA 2EIRA 1VGLA 3SWLA 3APOA 3TB2A 1YDKA 1TI1A 4N0VA 3ZZXA 2B1KA 3CRTA 3TRXA 3CMIA 2A4HA 2VM2A 3M3MA 2L57A 1XVWA 4XCSA 4ECIA 3NIVA 4ZIJA 3P7XA 5ECPB 2CZ2A 1ZYQB 2E7PA 1KBNA 2VCQA 3PH9A 4WKWA 4FO5A 2X8CA 4X1UA 1E2YA 2NVLA 3GX0A 2YP6A 1LU4A 1TKDB 3G7YA 4D73A 2GQLA 3FRCA 3APSA 4A5PA 1SKWB 1Z3EA 3HYPA 1K0AA 1MTCA 4NWYA 3IDVA 3WT2A 4F82A 5KN3A 4JEDA 4YKFA 11GSA 4IN0A 1A2JA 5IMZA 5ID2A 2DKIA 4HEA2 2HT9A 3D22A 2L4QA 1WIKA 3VFIA 2VL2C 3A5IA 1A0FA 2H8LA 3RDWA 1FVJA 4ZBAA 2LQQA 3DD3A 4DSRA 1KNGA 3EC3A 4NMUA 4GQCA 2L5LA 1M99A 4FYUA 4ZB8A 4MJAA 4O92A 2YWIA 4PUFC 1GRXA 1Z7RA 4K0GA 3KMOA 3FZ4A 3TJKA 4WEYA 3TRQA 4MF7A 3S9FA 2FHEA 2ALBA 4MPFA 4BA7A 1ST9A 2IWTA 3LYPA 2PGTA 6GSXA 5ECNB 5LNKe 5BMUA 3PR8A 1TU8A 5DAKA 2YPMA 5D8IA 2H01A 3EYTA 1XVQA 1EOGA 3ISOA 1QXHA 3HCZA 1XBSA 5CP1A 3HXSA 3RBTA 3F4TA 4O5UA 1ILOA 2FD3A 3KEBA 3AY8A 13GSA 2N5AA 1OE8A 2WGRA 2DBCA 3CTFA 4ML1A 2M46A 1YF0A 4JR6A 1ML6A 1U6TA 2C3TA 1V40A 4HJ2A 1ZGNA 2FUG2 2K8VA 1EP8A 1OC3A 4XS6A 4EXJA 1SU9A 4JU5A 2HLSA 4OFNA 4YKGA 2DC5A 1JLWA 4NHWA 3TOUA 3UL3A 2LRTA 3VPQA 4CHSA 1SL0B 2KP1A 1GSEA 3L0HA 5GZZB 3TKSE 4YQUA 2NPBA 3PPUA 1ERUA 3TOTA 1SKRB 1TRSA 3QD9A 5D73A 2LKUA 1FB0A 1XWCA 2GQMA 5KN1A 3FMWA 3UBLA 3VWWA 1GSFA 1A23A 2YANA 1HYUA 2J23A 2A2SA 2X8GA 4N10A 1PRXA 4CY8A 2VAFA 4Q5FA 4JZQA 5J5NA 4K7IA 5IM9A 1VF3A 4HDEA 4F03A 5G1LA 3ZREA 2TRCP 2MBSA 3GURA 4TR1B 4DSSA 1WJKA 4BL7B 1K0MA 2GQKA 1SK0A 4I8BA 4IP6A 2YWMA 5CRHA 2R3XA 4LMVA 2IMEA 5HFIA 1KTEA 2P5QA 4IQAA 1UC7A 2L59A 2IMIA 5IPGA 4XIHA 3DXBA 5DDLA 2V2GA 4V2LA 5J9CA 1S3DA 3N9JA 4LL4B 1K3LA 1QQ2A 2E0QA 4HZ4A 2RM5A 4PURA 2C0GA 3MAKA 2M80A 1Z6NA 5HR2A 3TKPA 6GSTA 2LSTA 2R2JA 5CREA 5IOWA 4MNNA 2C1YA 1NHOA 3H79A 4KDYA 2MMAA 1T4YA 2GT5A 3MIXA 1EOHA 2C3QA 5CRGA 2NTOA 4EC0A 3IHGA 2Z9SA 5G30A 2YNXA 3ZVJD 4L0UA 4D73B 1G7OA 3WGXA 2TIRA 3EU4A 2B5YA 2BJXA 2IMDA 3BD2A 1FO5A 3DKSA 4G0LA 4MJCA 2B3SA 2VD1A 3VPTA 2XC2A 1YKAA 2ZNMA 4EF0A 3IR4A 3IRAA 5C00A 5H5SA 2A2PA 4LLRA 1AUCA 3BOAA 2G2QA 2R6KA 1PKWA 3LXTA 5KOWA 3C73A 5E59A 3P2AA 3D5JA 5J9BA 3TKSA 1WE0A 2FWFA 1X9SB 4MZBA 1MEKA 3FR6A 5ID2B 2DMMA 4IKHA 2LTKA 1XW9A 2V6KA 1GSQA 1BJXA 1BG5A 1EV9A 4WF5A 5D93A 1WMJA 1FAAA 1AAZA 3KCMA 5CNWA 2QC7A 4NPBA 3WYWA 4AJ6A 1YKCA 2HFDA 4ZXGA 3CSIA 3E9JB 5AISA 4X0XA 3L9UA 4ZBDA 1A8LA 5GAPD 1F3BA 5DALA 3H1NA 4I6XA 1WOUA 2DJ0A 2LRNA 4ZB9A 1VF4A 4QQ7A 1SD8A 3J7Yk 3HVSA 4POKA 3F63A 4BWSA 1NHYA 5ECKB 3FR3A 3TDGA 1B4PA 1OVNA 4GRFA 1WPIA 4POLA 2YN1A 1BEDA 1Y6EA 5DCGA 4KUNA 5DAKB 3CSJA 2HSHA 1HNCA 2JSZA 1K0CA 1XFLA 4K2DA 1TJDA 1FOHA 3Q74A 1SL1B 2HRNA 2C0EA 2K9FA 5AIVA 5F06A 1SJ6A 2B5XA 1TI3A 4OFMA 2PERA 3LWAA 2XHFA 2DMLA 4AJ7A 1GWCA 4F2IA 2B7KA 4TR3A 1XG8A 3MWHA 2C8UA 3ZIVA 3FY7A 4KCEA 17GSA 3W8JA 1M2AA 1JZWA 1MDJA 8GSSA 2H0IA 4BWQA 1SENA 5JWQB 2IFQA 1SKSB 3HA9A 3C8EA 4POMA 2R0GA 1GSSA 1NSWA 3BBYA 4IELA 1O81A 2VCTA 1X9WB
chains in the Genus database with same CATH topology
5CAXA 2GT6A 1B9XC 4YH2A 3CRUA 3GHAA 1K3OA 2VLTA 1FW1A 1GL8A 3GKNA 4NAXA 3HHVA 4RUVA 1DUGA 2PVOC 2VCVA 2LJAA 1USBA 4XHMA 2DLXA 1LBKA 3VLNA 1K0NA 2I81A 5D9XA 4I97A 1OAZA 4DSSB 2JU5A 3GNJA 4TOPA 1NW2A 5HFGA 1EGRA 4WR5A 1F37A 1Q4JA 1XCCA 4ZL7A 3H93A 3DVWA 1IYIA 1O6JA 2R4VA 1MD4A 1YY7A 3TJFA 1EWXA 5KN0A 1GULA 4PGTA 1XW5A 3H4KA 4KAEA 2LJKA 3TRPA 1T00A 2HXKA 1A2LA 4N30A 2V1MA 4Z2RA 3GUSA 1V58A 3PINA 2XPEA 2TRXA 3ZFBA 2GS3A 2GTUA 4GWRA 1SYRA 2LV3A 2BMXA 3ZFLA 1QMVA 2RLIA 1CQHA 2HNLA 4J57E 3M0FA 3DWVA 2C0FA 1YEXA 4V2NA 1Z9HA 1X9MB 3IOSA 2VCZA 4PXOA 3M8NA 2X99A 5G1KA 4ZB6A 3WD6A 1N8JA 1WRYA 2JACA 2X8HA 1J9BA 5IIZA 2OKAA 2LJRA 4HI7A 1GSYA 18GSA 2H6YA 1RW1A 3IE3A 4WBJA 3O76A 1T4ZA 3IAM2 3I43A 3I6AA 1B4QA 4JR4A 3FR9A 4EE0A 2FNOA 3M1GA 3C1SA 1TRVA 4MJBA 5F07A 3GH6A 1XPVA 3IA1A 3IPZA 1XW6A 5A4VA 3KJYA 4GQFA 2CT6A 1V57A 2JZTA 3GN3A 3DVXA 4LMWA 2VUPA 3QR6A 5HQPA 2CV4A 5HFKA 3EVIA 2FLSA 4QL9A 1ACVA 3D6IA 2JZSA 5DQYA 4HQZA 4AF2A 2PU9C 4ISDA 4WR4A 2H0HA 2X4AA 2QGVA 3GYKA 3HZ8A 3UVHA 1PMTA 2HYXA 3A3TA 3LJRA 4Q5RA 1G7EA 5F8BA 2HRAA 5DALB 2QSIA 1K3YA 4ZILA 2H75A 3J7Yb 4MZCA 1ERTA 1OC9A 3UARA 1X5CA 1JFUA 1M9BA 3GA4A 2P5RA 5B6NA 1SJZA 1TP9A 1GSDA 1M0UA 1TRUA 1GUHA 2CVBA 3F3RA 3GKMA 3WT1A 2BTOT 1GP1A 5COHA 3VI7A 3EURA 1LJRA 1YEPA 2P31A 3QAGA 4ECJA 2JZRA 2AHEA 1KEBA 3K8NA 1V9WA 3ZTLA 2MMNA 2OBIA 3D4TA 2FY6A 4L5OA 3F4RA 4MJEA 4OCFA 4LA1A 2FCHA 4EO3A 4GF0A 4Z7XA 2IFQB 4RI7A 1T7PB 4HU7A 4MABA 1PSQA 3A2XA 4AJ8A 4NXIA 4ACSA 2CAIA 3FYGA 2G0FA 2K6VA 5IO2A 2FA8A 2M72A 2K8SA 3GMFA 3HVXA 3I69A 3F6FA 4YAVA 2V6OA 2GSTA 3LEFA 3RAZA 3VWXA 6GSWA 3IK9A 3UBKA 3FHKA 3C71A 4PQ1A 1E6BA 3NOFA 1XWKA 2R0CA 5ECSA 4DSQA 2VLVA 2KOKA 4F0BA 1BYEA 2VLUA 4EL1A 3CSHA 2DJKA 4HS1A 4MF5A 2VL3A 1F3AA 2DJJA 1O85A 2DKHA 3D4MA 3ZMLA 4MZWA 1ZYEA 2I4AA 3FK8A 5LCZA 5B6MA 3HD5A 1PN0A 4AGSA 2EC4A 2CVDA 2H1AA 3MNGA 2D2ZA 3R2QA 2FGXA 3KXOA 4O5QA 3US3A 1X5EA 2GZPA 3W6GA 1PKZA 1SK2A 1XWAA 2YV9A 3UJ1A 4IHUA 2HSYA 3G7JA 2PN8A 2MMZA 1O73A 5JWOB 4FH8A 5INYA 4OFTA 2FA4A 4KE3A 2HSMA 3QPMA 3VK9A 1DE1A 2LQOA 1R5AA 1GNEA 4Z2UA 4IJ3A 2HRKA 2KLXA 2FWEA 2GGTA 4GSSA 1G6YA 2IJYA 5A4UA 5C04A 2H19A 1Q98A 1ABAA 3M9JA 4XRAA 5L71A 3IXRA 2HE3A 4YQMA 1XZOA 2VOCA 3UMAA 5D9WA 3HJOA 4MPGA 2ZUPA 2B7JA 2B5EA 1M9AA 4ZL8A 2IMFA 5ELAA 1T8EB 3GH9A 2OA7A 4EDZA 2IIYA 4POBA 5ECLB 3QOUA 2PVQA 2OE3A 2UZ8A 1PX7A 3EMPA 3IAS2 3A2WA 1WWJA 3FZ9A 3GIXA 4FIWA 4XS4A 4I5QA 4PQHA 4ICYA 1ZYPA 3U5RE 2MZCA 4WETA 3CYNA 5J41A 4K5RA 4IP1A 5G31A 2YV7A 3GFKA 4EDYA 2CAQA 3ZVJA 3H8QA 4JE1A 2ON5A 1FVKA 2RUEA 1DBYA 2NDOA 2VIMA 2V41A 2YJHA 4ML6A 2WDUA 4TKYA 5JCGA 2H73A 5EY6A 1R4WA 1GNWA 1F6MC 4MMMA 2CQ9A 2RM6A 2O89A 3KZQA 3L9SA 2MYGA 1TW9A 3ZYWA 3IC8A 3FW2A 3DGQA 5KN2A 5ECIB 1PX6A 1I5GA 4K7OA 1OC9B 3IK7A 2OACA 2JSYA 4GXZA 1THOA 4O7HA 4NV5A 2WB9A 3TGZA 1B9YC 1K0OA 3LGCA 4TR0A 4KCAA 2H71A 2OE1A 2LUSA 3GL5A 1PN9A 1H4OA 3A2VA 2XBQA 3KM6A 4O5RA 3ERFA 4WBRD 5E4WA 3EMXA 1B8XA 2DJ1A 3M9KA 2RUFA 3RPNA 4HUAA 2E2MA 2IPAA 4K1FA 3GKXA 1SL2B 1ZZYA 1TU7A 3KGKA 4MCUA 5IMDA 2F9SA 4EIQA 5IMAA 1SYXA 3DRNA 4USSA 1EGOA 4K5SA 4TRXA 5AIXA 1GLPA 22GSA 1QGVA 2O7KA 5G2ZA 5D9VA 5GSSA 3C1RA 4LL1B 2R5GA 3P90A 3TJBA 5H5RA 1T3BA 2GSQA 3QAVA 4GTUA 5A5KA 1G6WA 2PBJA 1W89A 3RHCA 1MDKA 1X5DA 3Q19A 1K0DA 3W8SA 2F8AA 4TXOA 5CYYA 2GVPA 4YQVA 4V1Ag 2KHPA 5ECOB 2H1DA 4TXVA 2PMTA 3IHQA 2WULA 2YWNA 1EP7A 4KH7A 2WRTA 3LG6A 1NM3A 3LQ7A 2P0GA 20GSA 2CX3A 5IPHA 4GCIA 5JCWA 3O6TA 6GSUA 2CX4A 3VURA 3GSSA 5ECQB 5IMFA 4BVYA 3RPPA 5DJMA 4G0KA 2F51A 1FHEA 3ME7A 12GSA 4ECBA 1C72A 1F9MA 4KDUA 5ENUA 2LEGA 1ERWA 3CBUA 1TXXA 4KDXA 3V1WA 1RQMA 3EINA 2DSAA 3G7IA 4FYBA 2O85A 5G5FA 5ECHB 4F0CA 4HZ2A 4MDCA 2YJ7A 1X0RA 1AQXA 4K2XA 3O3TA 2AYTA 4G2EA 1RK4A 1T1VA 2C4JA 4KNDA 5IOXA 2CZ3A 2CVKA 5J4UA 2KP2A 1MDIA 1PGTA 3HKRA 2VO4A 2XBIA 16GSA 5BRTA 2H66A 3DMLA 4MH3A 5KOXA 2H70A 10GSA 2VL9A 2F8FA 2OJLA 4PNFA 5EL8A 1JZDA 1GTIA 2QA1A 4OO4A 4TR4A 1TK8B 1WP0A 3IV4A 1A0RP 5GSTA 5HR3A 5CRWA 2V32A 2LNTA 1Z6MA 1B48A 1XIYA 4PQIA 3HY2A 2VCXA 5A4WA 1JHBA 4NHZA 2QA2A 3HVVA 3GTUA 4KW6A 3GRXA 4XS4B 3CXGA 3E3EA 2XPDA 2WCIA 1M7TA 4I2TA 2L4CA 5ECRB 6GSVA 1OKDA 1I9DA 4JBBA 2R37A 2QKEA 1ZCPA 4KB3A 1URMA 1SJIA 4I2UA 4KA0A 2GSRA 3L4NA 2HZEA 4PTSA 4MK3A 4WF4A 3HZ4A 3Q18A 5EVOA 2C3NA 3DEXA 3ZMKA 4J56E 3SBCA 1O8WA 5D9TA 4KGIA 3BCKA 5EPFA 5IMCA 5B7CA 3KP8A 4G0IA 5JCUA 4ID0A 3DYRA 3EE2A 4TVEA 4H86A 4K8MA 1EV4A 2MBTA 1GTBA 1THXA 2IMKA 2H74A 1QK8A 14GSA 4J2FA 3I9V2 2I9HA 3LFLA 3Q6OA 4ZL9A 3F8UA 2LRCA 1DSBA 3KMNA 1J08A 1TDIA 3BCIA 2JL4A 2L6CA 2I3YA 2FWGA 4PUAA 5KEJA 4K7NA 5DCHA 3ED3A 5HR0A 3IBHA 1ERVA 4L8EA 3HJMA 4K6XA 2K18A 5ECMB 3MYDA 3LORA 1PL1A 4E8EA 4IGJA 1GLQA 4GSTA 3VWUA 4MA9A 1S3CA 3ZITA 4P3YB 2VL2A 5H5QA 3UOMA 1UVZA 3FEUA 4GLTA 1GTAA 6GSYA 3R3EA 4IVFA 4OCEA 1XWGA 1UN2A 2GSSA 1YZXA 1ZL9A 2VCWA 2O87A 2L6DA 1O7UA 4MLYA 1XOBA 4ILFA 4MF6A 4TN8A 1PQNA 1A2MA 2AAWA 2EIOA 2X64A 1OYJA 4DEJA 4TXOB 2ZCTA 2WS2A 1SD9A 2DJ2A 2YZHA 1OC8A 2WJUA 3JCML 4X4JA 2VM1A 1VF1A 3KP9A 3QDNA 1BX9A 5F0GA 3OR5A 3VWVA 1FG4A 2H1BA 3TUEA 4K9ZA 2HRFA 1UA5A 3WGDA 9GSSA 4BVYB 1XXUA 3FKFA 5CO3A 2WFCA 2B1LA 1M2BA 2PPTA 1AC1A 2B6MA 1J0FA 2YCDA 3G9BA 2GDRA 5FT3A 4X43A 4F9ZA 2GZYA 3KTLA 3TKRA 1YF1A 4Z2TA 4NV2A 1SK1A 1XWBA 3BJ5A 4OMVA 1PD21 5G5EA 4WXTA 3KTBA 5AGYA 2ON7A 4PX1A 4CY6A 3LW9A 4BVXA 5DJLA 4ZBBA 3CTGA 3FZAA 1TOFA 2AJQB 3KIJA 4CDOA 2PUKC 3L78A 1OKTA 3LSZA 1FOVA 4PNGA 2DIZA 2EIQA 3TKSC 3ZLPA 3ZL5A 4EIPA 2YZUA 4CW9A 1U87A 3D21A 4K0NA 1H75A 3LYKA 1HNAA 3UEMA 4L5LA 4EKZA 1U88A 1XOAA 1AIUA 5IMVA 3N5OA 4ECCA 1JZRA 1V98A 5FWGA 1ON4A 3PGTA 2GLRA 4MP4A 1Y25A 3WGEA 3FZ5A 3L9VA 5IQYA 2AUVA 2X49A 3GX8A 2LS5A 3E0UA 2YOIA 3D0ZA 1BAYA 3GTUB 5J3RA 1GTUA 4IBPA 1JLVA 2VD0A 1AQVA 5DVBA 1DE2A 2OADA 3UVTA 3GV1A 2C0DA 4G19A 4BPYA 1TK0B 5AN1A 5DBQA 3GL3A 2FWHA 4QL7A 3A5WA 2L5OA 1R26A 1FB6A 1GH2A 1GSUA 2A2RA 2HZEB 2RIIA 2REMA 1HQOA 1A8YA 2NBSA 3QFBC 1EEJA 3TKQA 3ME8A 3EU3A 5IO0A 2PWJA 3TJJA 5D96A 3KD0A 3QMXA 1IYHA 3F6DA 4KSMA 1ZYNA 3F9UA 3ZRDA 4HU9A 3ERWA 5HR1A 1Z7PA 4RQRA 1G0TA 4EVMA 4MH2A 3MDKA 3APQA 4IS0A 1VF2A 4RI6A 6GSSA 1GUKA 3HDCA 4KSOA 1V2AA 3NZNA 3HJPA 1QUWA 3QCPA 2N5BA 3RHBA 1TRWA 19GSA 1A24A 4V1Ap 2N5FA 2H30A 4Q5NA 3GSTA 3VI5A 4RQXA 5F05A 4HJMA 1U3IA 4FYCA 4ULXA 4N11A 5ELGA 1K0BA 3DIEA 2KUCA 3KH9A 2DIYA 4OWYA 1ZOFA 2IL3A 1HD2A 4IW9A 3F0IA 1Z5YE 1EZKA 4L0WA 3KH7A 4KX4A 3TCOA 2GZZA 1R5PA 1YQ1A 1YJ6A 2LNSA 5JWRB 1AW9A 4HOJA 1PL2A 1GUMA 2MMOA 3EWLA 4XRDA 5GAND 2AB6A 1M2DA 1U3AA 2J9HA 2H6ZA 2HI7A 4G9HA 2A4VA 3ERGA 4N0ZA 3QAWA 1JZOA 3MSZA 1TTZA 1AXDA 4G10A 1R7HA 4V2MA 4Q5QA 2E2GA 2H0GA 1S3AA 1O8XA 4EUYA 3TJGA 4GSNA 2C80A 3U6VA 4HQSA 3ZIJA 2AV4A 3GKKA 3UIWA 5B8AA 1BQ7A 4TW5A 2H72A 3C7MA 4OD7A 2HZFA 2JADA 5B8BA 3F4SA 3F3QA 4IQ1A 1TK5B 2YWOA 2OE0A 3QFAC 1HNBA 2WZ9A 2I1UA 2CA8A 3LXZA 4XS1A 3UAPA 2H76A 1MD3A 7GSSA 2ES7A 5LD0A 4OO5A 4O32A 5DQSA 4E8HA 1PA3A 4KF9A 2OBKA 2R0PA 4IJIA 1VRSD 2DJ3A 1W4VA 4JRRA 1ZMAA 4YAPA 4TR1A 1OE7A 4DVCA 2F3MA 4BL7A 5CRDA 3IC4A 3EPTA 1N2AA 3P8WA 4BVXB 1F2EA 2H1GA 1CQGA 4XTSA 4FQUA 5ABRA 5FHIA 2IN3A 1AQWA 1EEMA 2O8VB 1QFNA 2H6XA 2EIRA 1VGLA 3SWLA 3APOA 3TB2A 1YDKA 1TI1A 4N0VA 3ZZXA 2B1KA 3CRTA 3TRXA 3CMIA 2A4HA 2VM2A 3M3MA 2L57A 1XVWA 4XCSA 4ECIA 3NIVA 4ZIJA 3P7XA 5ECPB 2CZ2A 1ZYQB 2E7PA 1KBNA 2VCQA 3PH9A 4WKWA 4FO5A 2X8CA 4X1UA 1E2YA 2NVLA 3GX0A 2YP6A 1LU4A 1TKDB 3G7YA 4D73A 2GQLA 3FRCA 3APSA 4A5PA 1SKWB 1Z3EA 3HYPA 1K0AA 1MTCA 4NWYA 3IDVA 3WT2A 4F82A 5KN3A 4JEDA 4YKFA 11GSA 4IN0A 1A2JA 5IMZA 5ID2A 2DKIA 4HEA2 2HT9A 3D22A 2L4QA 1WIKA 3VFIA 2VL2C 3A5IA 1A0FA 2H8LA 3RDWA 1FVJA 4ZBAA 2LQQA 3DD3A 4DSRA 1KNGA 3EC3A 4NMUA 4GQCA 2L5LA 1M99A 4FYUA 4ZB8A 4MJAA 4O92A 2YWIA 4PUFC 1GRXA 1Z7RA 4K0GA 3KMOA 3FZ4A 3TJKA 4WEYA 3TRQA 4MF7A 3S9FA 2FHEA 2ALBA 4MPFA 4BA7A 1ST9A 2IWTA 3LYPA 2PGTA 6GSXA 5ECNB 5LNKe 5BMUA 3PR8A 1TU8A 5DAKA 2YPMA 5D8IA 2H01A 3EYTA 1XVQA 1EOGA 3ISOA 1QXHA 3HCZA 1XBSA 5CP1A 3HXSA 3RBTA 3F4TA 4O5UA 1ILOA 2FD3A 3KEBA 3AY8A 13GSA 2N5AA 1OE8A 2WGRA 2DBCA 3CTFA 4ML1A 2M46A 1YF0A 4JR6A 1ML6A 1U6TA 2C3TA 1V40A 4HJ2A 1ZGNA 2FUG2 2K8VA 1EP8A 1OC3A 4XS6A 4EXJA 1SU9A 4JU5A 2HLSA 4OFNA 4YKGA 2DC5A 1JLWA 4NHWA 3TOUA 3UL3A 2LRTA 3VPQA 4CHSA 1SL0B 2KP1A 1GSEA 3L0HA 5GZZB 3TKSE 4YQUA 2NPBA 3PPUA 1ERUA 3TOTA 1SKRB 1TRSA 3QD9A 5D73A 2LKUA 1FB0A 1XWCA 2GQMA 5KN1A 3FMWA 3UBLA 3VWWA 1GSFA 1A23A 2YANA 1HYUA 2J23A 2A2SA 2X8GA 4N10A 1PRXA 4CY8A 2VAFA 4Q5FA 4JZQA 5J5NA 4K7IA 5IM9A 1VF3A 4HDEA 4F03A 5G1LA 3ZREA 2TRCP 2MBSA 3GURA 4TR1B 4DSSA 1WJKA 4BL7B 1K0MA 2GQKA 1SK0A 4I8BA 4IP6A 2YWMA 5CRHA 2R3XA 4LMVA 2IMEA 5HFIA 1KTEA 2P5QA 4IQAA 1UC7A 2L59A 2IMIA 5IPGA 4XIHA 3DXBA 5DDLA 2V2GA 4V2LA 5J9CA 1S3DA 3N9JA 4LL4B 1K3LA 1QQ2A 2E0QA 4HZ4A 2RM5A 4PURA 2C0GA 3MAKA 2M80A 1Z6NA 5HR2A 3TKPA 6GSTA 2LSTA 2R2JA 5CREA 5IOWA 4MNNA 2C1YA 1NHOA 3H79A 4KDYA 2MMAA 1T4YA 2GT5A 3MIXA 1EOHA 2C3QA 5CRGA 2NTOA 4EC0A 3IHGA 2Z9SA 5G30A 2YNXA 3ZVJD 4L0UA 4D73B 1G7OA 3WGXA 2TIRA 3EU4A 2B5YA 2BJXA 2IMDA 3BD2A 1FO5A 3DKSA 4G0LA 4MJCA 2B3SA 2VD1A 3VPTA 2XC2A 1YKAA 2ZNMA 4EF0A 3IR4A 3IRAA 5C00A 5H5SA 2A2PA 4LLRA 1AUCA 3BOAA 2G2QA 2R6KA 1PKWA 3LXTA 5KOWA 3C73A 5E59A 3P2AA 3D5JA 5J9BA 3TKSA 1WE0A 2FWFA 1X9SB 4MZBA 1MEKA 3FR6A 5ID2B 2DMMA 4IKHA 2LTKA 1XW9A 2V6KA 1GSQA 1BJXA 1BG5A 1EV9A 4WF5A 5D93A 1WMJA 1FAAA 1AAZA 3KCMA 5CNWA 2QC7A 4NPBA 3WYWA 4AJ6A 1YKCA 2HFDA 4ZXGA 3CSIA 3E9JB 5AISA 4X0XA 3L9UA 4ZBDA 1A8LA 5GAPD 1F3BA 5DALA 3H1NA 4I6XA 1WOUA 2DJ0A 2LRNA 4ZB9A 1VF4A 4QQ7A 1SD8A 3J7Yk 3HVSA 4POKA 3F63A 4BWSA 1NHYA 5ECKB 3FR3A 3TDGA 1B4PA 1OVNA 4GRFA 1WPIA 4POLA 2YN1A 1BEDA 1Y6EA 5DCGA 4KUNA 5DAKB 3CSJA 2HSHA 1HNCA 2JSZA 1K0CA 1XFLA 4K2DA 1TJDA 1FOHA 3Q74A 1SL1B 2HRNA 2C0EA 2K9FA 5AIVA 5F06A 1SJ6A 2B5XA 1TI3A 4OFMA 2PERA 3LWAA 2XHFA 2DMLA 4AJ7A 1GWCA 4F2IA 2B7KA 4TR3A 3MWHA 2C8UA 3ZIVA 3FY7A 4KCEA 17GSA 3W8JA 1M2AA 1JZWA 1MDJA 8GSSA 2H0IA 4BWQA 1SENA 5JWQB 2IFQA 1SKSB 3HA9A 3C8EA 4POMA 2R0GA 1GSSA 1NSWA 3BBYA 4IELA 1O81A 2VCTA 1X9WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAX A;  2GT6 A;  1B9X C;  4YH2 A;  3CRU A;  3GHA A;  1K3O A;  2VLT A;  1FW1 A;  1GL8 A;  3GKN A;  4NAX A;  3HHV A;  4RUV A;  1DUG A;  2PVO C;  2VCV A;  2LJA A;  1USB A;  4XHM A;  2DLX A;  1LBK A;  3VLN A;  1K0N A;  2I81 A;  5D9X A;  4I97 A;  1OAZ A;  4DSS B;  2JU5 A;  3GNJ A;  4TOP A;  1NW2 A;  5HFG A;  1EGR A;  4WR5 A;  1F37 A;  1Q4J A;  1XCC A;  4ZL7 A;  3H93 A;  3DVW A;  1IYI A;  1O6J A;  2R4V A;  1MD4 A;  1YY7 A;  3TJF A;  1EWX A;  5KN0 A;  1GUL A;  4PGT A;  1XW5 A;  3H4K A;  4KAE A;  2LJK A;  3TRP A;  1T00 A;  2HXK A;  1A2L A;  4N30 A;  2V1M A;  3GUS A;  1V58 A;  3PIN A;  2XPE A;  2TRX A;  3ZFB A;  2GS3 A;  2GTU A;  4GWR A;  1SYR A;  2LV3 A;  2BMX A;  3ZFL A;  1QMV A;  2RLI A;  1CQH A;  2HNL A;  4J57 E;  3M0F A;  3DWV A;  2C0F A;  1YEX A;  4V2N A;  1Z9H A;  1X9M B;  3IOS A;  2VCZ A;  4PXO A;  3M8N A;  2X99 A;  5G1K A;  4ZB6 A;  3WD6 A;  1N8J A;  1WRY A;  2JAC A;  2X8H A;  1J9B A;  5IIZ A;  2OKA A;  2LJR A;  4HI7 A;  1GSY A;  18GS A;  2H6Y A;  1RW1 A;  3IE3 A;  4WBJ A;  3O76 A;  1T4Z A;  3IAM 2;  3I43 A;  3I6A A;  1B4Q A;  4JR4 A;  3FR9 A;  4EE0 A;  2FNO A;  3M1G A;  3C1S A;  1TRV A;  4MJB A;  5F07 A;  3GH6 A;  1XPV A;  3IA1 A;  3IPZ A;  1XW6 A;  5A4V A;  3KJY A;  4GQF A;  2CT6 A;  1V57 A;  2JZT A;  3GN3 A;  3DVX A;  4LMW A;  2VUP A;  3QR6 A;  5HQP A;  2CV4 A;  5HFK A;  3EVI A;  2FLS A;  4QL9 A;  1ACV A;  3D6I A;  2JZS A;  5DQY A;  4HQZ A;  4AF2 A;  2PU9 C;  4ISD A;  4WR4 A;  2H0H A;  2QGV A;  3GYK A;  3HZ8 A;  3UVH A;  1PMT A;  2HYX A;  3A3T A;  3LJR A;  4Q5R A;  1G7E A;  5F8B A;  5DAL B;  2QSI A;  1K3Y A;  4ZIL A;  2H75 A;  3J7Y b;  4MZC A;  1ERT A;  1OC9 A;  3UAR A;  1X5C A;  1JFU A;  1M9B A;  3GA4 A;  2P5R A;  5B6N A;  1SJZ A;  1TP9 A;  1GSD A;  1M0U A;  1TRU A;  1GUH A;  2CVB A;  3F3R A;  3GKM A;  3WT1 A;  2BTO T;  1GP1 A;  5COH A;  3VI7 A;  3EUR A;  1LJR A;  1YEP A;  2P31 A;  3QAG A;  4ECJ A;  2JZR A;  2AHE A;  1KEB A;  3K8N A;  1V9W A;  3ZTL A;  2MMN A;  2OBI A;  3D4T A;  2FY6 A;  4L5O A;  3F4R A;  4MJE A;  4OCF A;  4LA1 A;  2FCH A;  4EO3 A;  4GF0 A;  4Z7X A;  2IFQ B;  4RI7 A;  1T7P B;  4HU7 A;  4MAB A;  1PSQ A;  3A2X A;  4AJ8 A;  4NXI A;  4ACS A;  2CAI A;  3FYG A;  2G0F A;  2K6V A;  5IO2 A;  2FA8 A;  2M72 A;  2K8S A;  3GMF A;  3HVX A;  3I69 A;  3F6F A;  4YAV A;  2V6O A;  2GST A;  3LEF A;  3RAZ A;  3VWX A;  6GSW A;  3IK9 A;  3UBK A;  3FHK A;  3C71 A;  4PQ1 A;  1E6B A;  3NOF A;  1XWK A;  5ECS A;  4DSQ A;  2VLV A;  2KOK A;  4F0B A;  1BYE A;  2VLU A;  4EL1 A;  3CSH A;  2DJK A;  4HS1 A;  4MF5 A;  2VL3 A;  1F3A A;  2DJJ A;  1O85 A;  3D4M A;  3ZML A;  4MZW A;  1ZYE A;  2I4A A;  3FK8 A;  5LCZ A;  5B6M A;  3HD5 A;  4AGS A;  2EC4 A;  2CVD A;  2H1A A;  3MNG A;  2D2Z A;  3R2Q A;  2FGX A;  3KXO A;  3US3 A;  1X5E A;  2GZP A;  3W6G A;  1PKZ A;  1SK2 A;  1XWA A;  2YV9 A;  3UJ1 A;  4IHU A;  2HSY A;  3G7J A;  2PN8 A;  2MMZ A;  1O73 A;  5JWO B;  4FH8 A;  5INY A;  4OFT A;  2FA4 A;  4KE3 A;  3QPM A;  3VK9 A;  1DE1 A;  2LQO A;  1R5A A;  1GNE A;  4IJ3 A;  2KLX A;  2FWE A;  2GGT A;  4GSS A;  1G6Y A;  2IJY A;  5A4U A;  5C04 A;  2H19 A;  1Q98 A;  1ABA A;  3M9J A;  4XRA A;  5L71 A;  3IXR A;  2HE3 A;  4YQM A;  1XZO A;  2VOC A;  3UMA A;  5D9W A;  3HJO A;  4MPG A;  2ZUP A;  2B7J A;  2B5E A;  1M9A A;  4ZL8 A;  2IMF A;  5ELA A;  1T8E B;  3GH9 A;  2OA7 A;  4EDZ A;  2IIY A;  4POB A;  5ECL B;  3QOU A;  2PVQ A;  2OE3 A;  1PX7 A;  3EMP A;  3IAS 2;  3A2W A;  1WWJ A;  3FZ9 A;  3GIX A;  4FIW A;  4XS4 A;  4I5Q A;  4PQH A;  3U5R E;  2MZC A;  4WET A;  3CYN A;  5J41 A;  4IP1 A;  5G31 A;  2YV7 A;  3GFK A;  4EDY A;  2CAQ A;  3ZVJ A;  3H8Q A;  4JE1 A;  2ON5 A;  1FVK A;  2RUE A;  1DBY A;  2NDO A;  2VIM A;  2V41 A;  2YJH A;  4ML6 A;  2WDU A;  4TKY A;  5JCG A;  2H73 A;  5EY6 A;  1R4W A;  1GNW A;  1F6M C;  4MMM A;  2CQ9 A;  2RM6 A;  2O89 A;  3KZQ A;  3L9S A;  2MYG A;  1TW9 A;  3ZYW A;  3FW2 A;  3DGQ A;  5KN2 A;  5ECI B;  1PX6 A;  1I5G A;  4K7O A;  1OC9 B;  3IK7 A;  2OAC A;  2JSY A;  4GXZ A;  1THO A;  4O7H A;  4NV5 A;  2WB9 A;  3TGZ A;  1B9Y C;  1K0O A;  3LGC A;  4TR0 A;  4KCA A;  2H71 A;  2OE1 A;  2LUS A;  3GL5 A;  1PN9 A;  1H4O A;  3A2V A;  2XBQ A;  3KM6 A;  4O5R A;  3ERF A;  4WBR D;  5E4W A;  3EMX A;  1B8X A;  2DJ1 A;  3M9K A;  2RUF A;  3RPN A;  4HUA A;  2E2M A;  2IPA A;  4K1F A;  3GKX A;  1SL2 B;  1ZZY A;  1TU7 A;  3KGK A;  4MCU A;  5IMD A;  2F9S A;  5IMA A;  1SYX A;  3DRN A;  1EGO A;  5AIX A;  4TRX A;  1GLP A;  22GS A;  1QGV A;  2O7K A;  5G2Z A;  5D9V A;  5GSS A;  3C1R A;  4LL1 B;  2R5G A;  3P90 A;  3TJB A;  5H5R A;  1T3B A;  2GSQ A;  3QAV A;  4GTU A;  5A5K A;  1G6W A;  2PBJ A;  1W89 A;  3RHC A;  1MDK A;  1X5D A;  3Q19 A;  1K0D A;  3W8S A;  2F8A A;  4TXO A;  5CYY A;  2GVP A;  4YQV A;  4V1A g;  2KHP A;  5ECO B;  2H1D A;  4TXV A;  2PMT A;  3IHQ A;  2WUL A;  2YWN A;  1EP7 A;  4KH7 A;  2WRT A;  3LG6 A;  1NM3 A;  3LQ7 A;  2P0G A;  20GS A;  2CX3 A;  5IPH A;  4GCI A;  5JCW A;  3O6T A;  6GSU A;  2CX4 A;  3VUR A;  3GSS A;  5ECQ B;  5IMF A;  4BVY A;  3RPP A;  5DJM A;  2F51 A;  1FHE A;  3ME7 A;  12GS A;  4ECB A;  1C72 A;  1F9M A;  4KDU A;  5ENU A;  2LEG A;  1ERW A;  3CBU A;  1TXX A;  4KDX A;  3V1W A;  1RQM A;  3EIN A;  2DSA A;  3G7I A;  4FYB A;  2O85 A;  5G5F A;  5ECH B;  4F0C A;  4HZ2 A;  4MDC A;  2YJ7 A;  1X0R A;  1AQX A;  3O3T A;  2AYT A;  4G2E A;  1RK4 A;  1T1V A;  2C4J A;  4KND A;  5IOX A;  2CZ3 A;  2CVK A;  5J4U A;  2KP2 A;  1MDI A;  1PGT A;  3HKR A;  2VO4 A;  2XBI A;  16GS A;  2H66 A;  3DML A;  4MH3 A;  2H70 A;  10GS A;  2VL9 A;  2F8F A;  2OJL A;  4PNF A;  5EL8 A;  1JZD A;  1GTI A;  4OO4 A;  4TR4 A;  1TK8 B;  1WP0 A;  3IV4 A;  1A0R P;  5GST A;  5HR3 A;  5CRW A;  2V32 A;  2LNT A;  1Z6M A;  1B48 A;  1XIY A;  4PQI A;  3HY2 A;  2VCX A;  5A4W A;  1JHB A;  4NHZ A;  3HVV A;  3GTU A;  4KW6 A;  3GRX A;  4XS4 B;  3CXG A;  3E3E A;  2XPD A;  2WCI A;  1M7T A;  4I2T A;  2L4C A;  5ECR B;  6GSV A;  1OKD A;  1I9D A;  4JBB A;  2R37 A;  2QKE A;  1ZCP A;  4KB3 A;  1URM A;  1SJI A;  4I2U A;  4KA0 A;  2GSR A;  3L4N A;  2HZE A;  4MK3 A;  4WF4 A;  3HZ4 A;  3Q18 A;  5EVO A;  2C3N A;  3DEX A;  3ZMK A;  4J56 E;  3SBC A;  1O8W A;  5D9T A;  4KGI A;  3BCK A;  5EPF A;  5IMC A;  5B7C A;  3KP8 A;  5JCU A;  4ID0 A;  3DYR A;  3EE2 A;  4TVE A;  4H86 A;  4K8M A;  1EV4 A;  2MBT A;  1GTB A;  1THX A;  2IMK A;  2H74 A;  1QK8 A;  14GS A;  4J2F A;  3I9V 2;  2I9H A;  3LFL A;  3Q6O A;  4ZL9 A;  3F8U A;  2LRC A;  1DSB A;  3KMN A;  1J08 A;  1TDI A;  3BCI A;  2JL4 A;  2L6C A;  2I3Y A;  2FWG A;  4PUA A;  5KEJ A;  4K7N A;  5DCH A;  3ED3 A;  5HR0 A;  3IBH A;  1ERV A;  4L8E A;  3HJM A;  4K6X A;  2K18 A;  5ECM B;  3LOR A;  1PL1 A;  4E8E A;  4IGJ A;  1GLQ A;  4GST A;  3VWU A;  4MA9 A;  1S3C A;  3ZIT A;  4P3Y B;  2VL2 A;  5H5Q A;  3UOM A;  1UVZ A;  3FEU A;  4GLT A;  1GTA A;  6GSY A;  4IVF A;  4OCE A;  1XWG A;  1UN2 A;  2GSS A;  1YZX A;  1ZL9 A;  2VCW A;  2O87 A;  2L6D A;  1O7U A;  4MLY A;  1XOB A;  4ILF A;  4MF6 A;  4TN8 A;  1PQN A;  1A2M A;  2AAW A;  2EIO A;  2X64 A;  1OYJ A;  4DEJ A;  4TXO B;  2ZCT A;  2WS2 A;  1SD9 A;  2DJ2 A;  2YZH A;  1OC8 A;  2WJU A;  3JCM L;  2VM1 A;  1VF1 A;  3KP9 A;  3QDN A;  1BX9 A;  5F0G A;  3OR5 A;  3VWV A;  1FG4 A;  2H1B A;  3TUE A;  4K9Z A;  2HRF A;  1UA5 A;  3WGD A;  9GSS A;  1XXU A;  3FKF A;  5CO3 A;  2WFC A;  2B1L A;  1M2B A;  2PPT A;  1AC1 A;  2B6M A;  1J0F A;  2YCD A;  3G9B A;  2GDR A;  5FT3 A;  4X43 A;  4F9Z A;  2GZY A;  3KTL A;  3TKR A;  1YF1 A;  4NV2 A;  1SK1 A;  1XWB A;  3BJ5 A;  4OMV A;  1PD2 1;  5G5E A;  4WXT A;  3KTB A;  5AGY A;  2ON7 A;  4PX1 A;  4BVX A;  5DJL A;  4ZBB A;  3CTG A;  3FZA A;  1TOF A;  2AJQ B;  3KIJ A;  4CDO A;  2PUK C;  3L78 A;  1OKT A;  3LSZ A;  1FOV A;  4PNG A;  2DIZ A;  2EIQ A;  3TKS C;  3ZLP A;  3ZL5 A;  2YZU A;  4CW9 A;  1U87 A;  3D21 A;  4K0N A;  1H75 A;  3LYK A;  1HNA A;  3UEM A;  4L5L A;  4EKZ A;  1U88 A;  1XOA A;  1AIU A;  5IMV A;  3N5O A;  4ECC A;  1JZR A;  1V98 A;  5FWG A;  1ON4 A;  3PGT A;  2GLR A;  4MP4 A;  1Y25 A;  3WGE A;  3FZ5 A;  3L9V A;  5IQY A;  2AUV A;  3GX8 A;  2LS5 A;  3E0U A;  2YOI A;  3D0Z A;  1BAY A;  3GTU B;  5J3R A;  1GTU A;  4IBP A;  1JLV A;  2VD0 A;  1AQV A;  5DVB A;  1DE2 A;  2OAD A;  3UVT A;  3GV1 A;  2C0D A;  4G19 A;  4BPY A;  1TK0 B;  5AN1 A;  5DBQ A;  3GL3 A;  2FWH A;  4QL7 A;  3A5W A;  2L5O A;  1R26 A;  1FB6 A;  1GH2 A;  1GSU A;  2A2R A;  2HZE B;  2RII A;  2REM A;  1HQO A;  1A8Y A;  2NBS A;  3QFB C;  1EEJ A;  3TKQ A;  3ME8 A;  3EU3 A;  5IO0 A;  2PWJ A;  3TJJ A;  5D96 A;  3KD0 A;  3QMX A;  1IYH A;  3F6D A;  4KSM A;  3F9U A;  3ZRD A;  4HU9 A;  3ERW A;  5HR1 A;  1Z7P A;  4RQR A;  1G0T A;  4EVM A;  4MH2 A;  3MDK A;  3APQ A;  4IS0 A;  1VF2 A;  4RI6 A;  6GSS A;  1GUK A;  3HDC A;  4KSO A;  1V2A A;  3NZN A;  3HJP A;  1QUW A;  3QCP A;  2N5B A;  3RHB A;  1TRW A;  19GS A;  1A24 A;  4V1A p;  2N5F A;  2H30 A;  4Q5N A;  3GST A;  3VI5 A;  4RQX A;  5F05 A;  4HJM A;  1U3I A;  4FYC A;  4ULX A;  4N11 A;  5ELG A;  1K0B A;  3DIE A;  2KUC A;  3KH9 A;  2DIY A;  4OWY A;  1ZOF A;  2IL3 A;  1HD2 A;  4IW9 A;  3F0I A;  1Z5Y E;  1EZK A;  4L0W A;  3KH7 A;  4KX4 A;  3TCO A;  2GZZ A;  1R5P A;  1YQ1 A;  1YJ6 A;  2LNS A;  5JWR B;  1AW9 A;  4HOJ A;  1PL2 A;  1GUM A;  2MMO A;  3EWL A;  4XRD A;  5GAN D;  2AB6 A;  1M2D A;  1U3A A;  2J9H A;  2H6Z A;  2HI7 A;  4G9H A;  2A4V A;  3ERG A;  4N0Z A;  3QAW A;  1JZO A;  3MSZ A;  1TTZ A;  1AXD A;  4G10 A;  1R7H A;  4V2M A;  4Q5Q A;  2E2G A;  2H0G A;  1S3A A;  1O8X A;  4EUY A;  3TJG A;  4GSN A;  2C80 A;  3U6V A;  4HQS A;  3ZIJ A;  2AV4 A;  3GKK A;  3UIW A;  5B8A A;  1BQ7 A;  4TW5 A;  2H72 A;  3C7M A;  4OD7 A;  2HZF A;  2JAD A;  5B8B A;  3F4S A;  3F3Q A;  4IQ1 A;  1TK5 B;  2YWO A;  2OE0 A;  3QFA C;  1HNB A;  2WZ9 A;  2I1U A;  2CA8 A;  3LXZ A;  4XS1 A;  3UAP A;  2H76 A;  1MD3 A;  7GSS A;  2ES7 A;  5LD0 A;  4OO5 A;  4O32 A;  5DQS A;  4E8H A;  1PA3 A;  2OBK A;  4IJI A;  1VRS D;  2DJ3 A;  1W4V A;  4JRR A;  1ZMA A;  4YAP A;  4TR1 A;  1OE7 A;  4DVC A;  2F3M A;  4BL7 A;  5CRD A;  3IC4 A;  1N2A A;  3P8W A;  1F2E A;  2H1G A;  1CQG A;  4XTS A;  5ABR A;  5FHI A;  2IN3 A;  1AQW A;  1EEM A;  2O8V B;  1QFN A;  2H6X A;  2EIR A;  1VGL A;  3SWL A;  3APO A;  3TB2 A;  1YDK A;  1TI1 A;  4N0V A;  3ZZX A;  2B1K A;  3CRT A;  3TRX A;  3CMI A;  2VM2 A;  3M3M A;  2L57 A;  1XVW A;  4XCS A;  4ECI A;  3NIV A;  4ZIJ A;  3P7X A;  5ECP B;  2CZ2 A;  1ZYQ B;  2E7P A;  1KBN A;  2VCQ A;  3PH9 A;  4WKW A;  4FO5 A;  2X8C A;  4X1U A;  1E2Y A;  2NVL A;  3GX0 A;  2YP6 A;  1LU4 A;  1TKD B;  3G7Y A;  4D73 A;  2GQL A;  3FRC A;  3APS A;  1SKW B;  1Z3E A;  3HYP A;  1K0A A;  1MTC A;  4NWY A;  3IDV A;  3WT2 A;  4F82 A;  5KN3 A;  4JED A;  11GS A;  4IN0 A;  1A2J A;  5IMZ A;  5ID2 A;  4HEA 2;  2HT9 A;  3D22 A;  2L4Q A;  1WIK A;  3VFI A;  2VL2 C;  1A0F A;  2H8L A;  3RDW A;  1FVJ A;  4ZBA A;  2LQQ A;  3DD3 A;  4DSR A;  1KNG A;  3EC3 A;  4NMU A;  4GQC A;  2L5L A;  1M99 A;  4FYU A;  4ZB8 A;  4MJA A;  4O92 A;  2YWI A;  4PUF C;  1GRX A;  1Z7R A;  4K0G A;  3KMO A;  3FZ4 A;  3TJK A;  4WEY A;  3TRQ A;  4MF7 A;  3S9F A;  2FHE A;  2ALB A;  4MPF A;  4BA7 A;  1ST9 A;  2IWT A;  3LYP A;  2PGT A;  6GSX A;  5ECN B;  5LNK e;  3PR8 A;  1TU8 A;  5DAK A;  2YPM A;  5D8I A;  2H01 A;  3EYT A;  1XVQ A;  1EOG A;  3ISO A;  1QXH A;  3HCZ A;  1XBS A;  5CP1 A;  3HXS A;  3RBT A;  3F4T A;  1ILO A;  2FD3 A;  3KEB A;  3AY8 A;  13GS A;  2N5A A;  1OE8 A;  2WGR A;  2DBC A;  3CTF A;  4ML1 A;  2M46 A;  1YF0 A;  4JR6 A;  1ML6 A;  1U6T A;  2C3T A;  1V40 A;  4HJ2 A;  1ZGN A;  2FUG 2;  2K8V A;  1EP8 A;  1OC3 A;  4XS6 A;  4EXJ A;  1SU9 A;  4JU5 A;  2HLS A;  4OFN A;  2DC5 A;  1JLW A;  4NHW A;  3TOU A;  3UL3 A;  2LRT A;  3VPQ A;  4CHS A;  1SL0 B;  2KP1 A;  1GSE A;  3L0H A;  5GZZ B;  3TKS E;  4YQU A;  2NPB A;  1ERU A;  3TOT A;  1SKR B;  1TRS A;  3QD9 A;  5D73 A;  2LKU A;  1FB0 A;  1XWC A;  2GQM A;  5KN1 A;  3UBL A;  3VWW A;  1GSF A;  1A23 A;  2YAN A;  1HYU A;  2J23 A;  2A2S A;  2X8G A;  4N10 A;  1PRX A;  2VAF A;  4Q5F A;  4JZQ A;  5J5N A;  4K7I A;  5IM9 A;  1VF3 A;  4HDE A;  4F03 A;  5G1L A;  3ZRE A;  2TRC P;  2MBS A;  3GUR A;  4TR1 B;  4DSS A;  1WJK A;  1K0M A;  2GQK A;  1SK0 A;  4I8B A;  4IP6 A;  2YWM A;  5CRH A;  2R3X A;  4LMV A;  2IME A;  5HFI A;  1KTE A;  2P5Q A;  4IQA A;  1UC7 A;  2L59 A;  2IMI A;  5IPG A;  4XIH A;  3DXB A;  5DDL A;  2V2G A;  4V2L A;  5J9C A;  1S3D A;  3N9J A;  4LL4 B;  1K3L A;  1QQ2 A;  2E0Q A;  4HZ4 A;  2RM5 A;  4PUR A;  2C0G A;  3MAK A;  2M80 A;  1Z6N A;  5HR2 A;  3TKP A;  6GST A;  2LST A;  2R2J A;  5CRE A;  5IOW A;  2C1Y A;  1NHO A;  3H79 A;  4KDY A;  2MMA A;  1T4Y A;  2GT5 A;  1EOH A;  2C3Q A;  5CRG A;  2NTO A;  4EC0 A;  2Z9S A;  5G30 A;  2YNX A;  3ZVJ D;  4L0U A;  4D73 B;  1G7O A;  3WGX A;  2TIR A;  3EU4 A;  2B5Y A;  2BJX A;  2IMD A;  3BD2 A;  1FO5 A;  3DKS A;  4MJC A;  2B3S A;  2VD1 A;  3VPT A;  2XC2 A;  1YKA A;  2ZNM A;  4EF0 A;  3IR4 A;  3IRA A;  5C00 A;  5H5S A;  4LLR A;  1AUC A;  3BOA A;  2G2Q A;  2R6K A;  1PKW A;  3LXT A;  3C73 A;  5E59 A;  3P2A A;  3D5J A;  5J9B A;  3TKS A;  1WE0 A;  2FWF A;  1X9S B;  4MZB A;  1MEK A;  3FR6 A;  5ID2 B;  2DMM A;  4IKH A;  2LTK A;  1XW9 A;  2V6K A;  1GSQ A;  1BJX A;  1BG5 A;  1EV9 A;  4WF5 A;  5D93 A;  1WMJ A;  1FAA A;  1AAZ A;  3KCM A;  5CNW A;  2QC7 A;  4NPB A;  3WYW A;  4AJ6 A;  1YKC A;  2HFD A;  4ZXG A;  3CSI A;  3E9J B;  5AIS A;  4X0X A;  3L9U A;  4ZBD A;  1A8L A;  5GAP D;  1F3B A;  5DAL A;  3H1N A;  4I6X A;  1WOU A;  2DJ0 A;  2LRN A;  4ZB9 A;  1VF4 A;  4QQ7 A;  1SD8 A;  3J7Y k;  3HVS A;  4POK A;  3F63 A;  4BWS A;  1NHY A;  5ECK B;  3FR3 A;  3TDG A;  1B4P A;  1OVN A;  4GRF A;  1WPI A;  4POL A;  2YN1 A;  1BED A;  1Y6E A;  5DCG A;  4KUN A;  5DAK B;  3CSJ A;  2HSH A;  1HNC A;  2JSZ A;  1K0C A;  1XFL A;  4K2D A;  1TJD A;  3Q74 A;  1SL1 B;  2HRN A;  2C0E A;  2K9F A;  5AIV A;  5F06 A;  1SJ6 A;  2B5X A;  1TI3 A;  4OFM A;  2PER A;  3LWA A;  2XHF A;  2DML A;  4AJ7 A;  1GWC A;  4F2I A;  2B7K A;  4TR3 A;  3MWH A;  2C8U A;  3ZIV A;  3FY7 A;  4KCE A;  17GS A;  3W8J A;  1M2A A;  1JZW A;  1MDJ A;  8GSS A;  2H0I A;  4BWQ A;  1SEN A;  5JWQ B;  2IFQ A;  1SKS B;  3HA9 A;  3C8E A;  4POM A;  1GSS A;  1NSW A;  3BBY A;  4IEL A;  1O81 A;  2VCT A;  1X9W B; 
#chains in the Genus database with same CATH topology
 5CAX A;  2GT6 A;  1B9X C;  4YH2 A;  3CRU A;  3GHA A;  1K3O A;  2VLT A;  1FW1 A;  1GL8 A;  3GKN A;  4NAX A;  3HHV A;  4RUV A;  1DUG A;  2PVO C;  2VCV A;  2LJA A;  1USB A;  4XHM A;  2DLX A;  1LBK A;  3VLN A;  1K0N A;  2I81 A;  5D9X A;  4I97 A;  1OAZ A;  4DSS B;  2JU5 A;  3GNJ A;  4TOP A;  1NW2 A;  5HFG A;  1EGR A;  4WR5 A;  1F37 A;  1Q4J A;  1XCC A;  4ZL7 A;  3H93 A;  3DVW A;  1IYI A;  1O6J A;  2R4V A;  1MD4 A;  1YY7 A;  3TJF A;  1EWX A;  5KN0 A;  1GUL A;  4PGT A;  1XW5 A;  3H4K A;  4KAE A;  2LJK A;  3TRP A;  1T00 A;  2HXK A;  1A2L A;  4N30 A;  2V1M A;  4Z2R A;  3GUS A;  1V58 A;  3PIN A;  2XPE A;  2TRX A;  3ZFB A;  2GS3 A;  2GTU A;  4GWR A;  1SYR A;  2LV3 A;  2BMX A;  3ZFL A;  1QMV A;  2RLI A;  1CQH A;  2HNL A;  4J57 E;  3M0F A;  3DWV A;  2C0F A;  1YEX A;  4V2N A;  1Z9H A;  1X9M B;  3IOS A;  2VCZ A;  4PXO A;  3M8N A;  2X99 A;  5G1K A;  4ZB6 A;  3WD6 A;  1N8J A;  1WRY A;  2JAC A;  2X8H A;  1J9B A;  5IIZ A;  2OKA A;  2LJR A;  4HI7 A;  1GSY A;  18GS A;  2H6Y A;  1RW1 A;  4HSC X;  3IE3 A;  4WBJ A;  3O76 A;  1T4Z A;  3IAM 2;  3I43 A;  3I6A A;  1B4Q A;  4JR4 A;  3FR9 A;  4EE0 A;  2FNO A;  3M1G A;  3C1S A;  1TRV A;  4MJB A;  5F07 A;  3GH6 A;  1XPV A;  3IA1 A;  3IPZ A;  4BIK A;  1XW6 A;  5A4V A;  3KJY A;  4GQF A;  2CT6 A;  1V57 A;  2JZT A;  3GN3 A;  3DVX A;  4LMW A;  2VUP A;  3QR6 A;  5HQP A;  2CV4 A;  5HFK A;  3EVI A;  2FLS A;  4QL9 A;  1ACV A;  3D6I A;  2JZS A;  5DQY A;  4HQZ A;  4AF2 A;  2PU9 C;  4ISD A;  4WR4 A;  2H0H A;  2X4A A;  2QGV A;  3GYK A;  3HZ8 A;  3UVH A;  1PMT A;  2HYX A;  3A3T A;  3LJR A;  4Q5R A;  1G7E A;  5F8B A;  2HRA A;  5DAL B;  2QSI A;  1K3Y A;  4ZIL A;  2H75 A;  3J7Y b;  4MZC A;  1ERT A;  1OC9 A;  3UAR A;  1X5C A;  1JFU A;  1M9B A;  3GA4 A;  2P5R A;  5B6N A;  1SJZ A;  1PFO A;  1TP9 A;  1GSD A;  1M0U A;  1TRU A;  1GUH A;  2CVB A;  3F3R A;  3GKM A;  3WT1 A;  2BTO T;  1GP1 A;  5COH A;  3VI7 A;  3EUR A;  1LJR A;  1YEP A;  2P31 A;  3QAG A;  4ECJ A;  2JZR A;  2AHE A;  1KEB A;  3K8N A;  1V9W A;  3ZTL A;  2MMN A;  2OBI A;  3D4T A;  2FY6 A;  4L5O A;  3F4R A;  4MJE A;  4OCF A;  4LA1 A;  2FCH A;  4EO3 A;  4GF0 A;  4Z7X A;  2IFQ B;  4RI7 A;  1T7P B;  4HU7 A;  4MAB A;  1PSQ A;  3A2X A;  4AJ8 A;  4NXI A;  4ACS A;  2CAI A;  3FYG A;  2G0F A;  2K6V A;  5IO2 A;  2FA8 A;  2M72 A;  2K8S A;  3GMF A;  3HVX A;  3I69 A;  3F6F A;  4YAV A;  2V6O A;  2GST A;  3LEF A;  3RAZ A;  3VWX A;  6GSW A;  3IK9 A;  3UBK A;  3FHK A;  3C71 A;  4PQ1 A;  1E6B A;  3NOF A;  1XWK A;  2R0C A;  5ECS A;  4DSQ A;  2VLV A;  2KOK A;  4F0B A;  1BYE A;  2VLU A;  4EL1 A;  3CSH A;  2DJK A;  4HS1 A;  4MF5 A;  2VL3 A;  1F3A A;  2DJJ A;  1O85 A;  2DKH A;  3D4M A;  3ZML A;  4MZW A;  1ZYE A;  2I4A A;  3FK8 A;  5LCZ A;  5B6M A;  3HD5 A;  1PN0 A;  4AGS A;  2EC4 A;  2CVD A;  2H1A A;  3MNG A;  2D2Z A;  3R2Q A;  2FGX A;  3KXO A;  4O5Q A;  3US3 A;  1X5E A;  2GZP A;  3W6G A;  1PKZ A;  1SK2 A;  1XWA A;  2YV9 A;  3UJ1 A;  4IHU A;  2HSY A;  3G7J A;  2PN8 A;  2MMZ A;  1O73 A;  5JWO B;  4FH8 A;  5INY A;  4OFT A;  2FA4 A;  4KE3 A;  2HSM A;  3QPM A;  3VK9 A;  1DE1 A;  2LQO A;  1R5A A;  1GNE A;  4Z2U A;  4IJ3 A;  2HRK A;  2KLX A;  2FWE A;  2GGT A;  4GSS A;  1G6Y A;  2IJY A;  5A4U A;  5C04 A;  2H19 A;  1Q98 A;  1ABA A;  3M9J A;  4XRA A;  5L71 A;  3IXR A;  2HE3 A;  4YQM A;  1XZO A;  2VOC A;  3UMA A;  5D9W A;  3HJO A;  4MPG A;  2ZUP A;  2B7J A;  2B5E A;  1M9A A;  4ZL8 A;  2IMF A;  5ELA A;  1T8E B;  3GH9 A;  2OA7 A;  4EDZ A;  2IIY A;  4POB A;  5ECL B;  3QOU A;  2PVQ A;  2OE3 A;  2UZ8 A;  1PX7 A;  3EMP A;  3IAS 2;  3A2W A;  1WWJ A;  3FZ9 A;  3GIX A;  4FIW A;  4XS4 A;  4I5Q A;  4PQH A;  4ICY A;  1ZYP A;  3U5R E;  2MZC A;  4WET A;  3CYN A;  5J41 A;  4K5R A;  4IP1 A;  5G31 A;  2YV7 A;  3GFK A;  4EDY A;  2CAQ A;  3ZVJ A;  3H8Q A;  4JE1 A;  2ON5 A;  1FVK A;  2RUE A;  1DBY A;  2NDO A;  2VIM A;  2V41 A;  2YJH A;  4ML6 A;  2WDU A;  4TKY A;  5JCG A;  2H73 A;  5EY6 A;  1R4W A;  1GNW A;  1F6M C;  4MMM A;  2CQ9 A;  2RM6 A;  2O89 A;  3KZQ A;  3L9S A;  2MYG A;  1TW9 A;  3ZYW A;  3IC8 A;  3FW2 A;  3DGQ A;  5KN2 A;  5ECI B;  1PX6 A;  1I5G A;  4K7O A;  1OC9 B;  3IK7 A;  2OAC A;  2JSY A;  4GXZ A;  1THO A;  4O7H A;  4NV5 A;  2WB9 A;  3TGZ A;  1B9Y C;  1K0O A;  3LGC A;  4TR0 A;  4KCA A;  2H71 A;  2OE1 A;  2LUS A;  3GL5 A;  1PN9 A;  1H4O A;  3A2V A;  2XBQ A;  3KM6 A;  4O5R A;  3ERF A;  4WBR D;  5E4W A;  3EMX A;  1B8X A;  1M3J A;  2DJ1 A;  3M9K A;  2RUF A;  3RPN A;  4HUA A;  2E2M A;  2IPA A;  4K1F A;  3GKX A;  1SL2 B;  1ZZY A;  1TU7 A;  3KGK A;  4MCU A;  5IMD A;  2F9S A;  4EIQ A;  5IMA A;  1SYX A;  3DRN A;  4USS A;  1EGO A;  4K5S A;  4TRX A;  5AIX A;  1GLP A;  22GS A;  1QGV A;  2O7K A;  5G2Z A;  5D9V A;  5GSS A;  3C1R A;  4LL1 B;  2R5G A;  3P90 A;  3TJB A;  5H5R A;  1T3B A;  2GSQ A;  3QAV A;  4GTU A;  5A5K A;  1G6W A;  2PBJ A;  1W89 A;  3RHC A;  1MDK A;  1X5D A;  3Q19 A;  1K0D A;  3W8S A;  2F8A A;  4TXO A;  5CYY A;  2GVP A;  4YQV A;  1S3R A;  4V1A g;  2KHP A;  5ECO B;  2H1D A;  4TXV A;  2PMT A;  3IHQ A;  3HVN A;  2WUL A;  2YWN A;  1EP7 A;  4KH7 A;  2WRT A;  3LG6 A;  1NM3 A;  3LQ7 A;  2P0G A;  20GS A;  2CX3 A;  5IPH A;  4GCI A;  5JCW A;  3O6T A;  6GSU A;  2CX4 A;  3VUR A;  3GSS A;  5ECQ B;  5IMF A;  4BVY A;  3RPP A;  5DJM A;  4G0K A;  2F51 A;  1FHE A;  3ME7 A;  12GS A;  4ECB A;  1C72 A;  1F9M A;  4KDU A;  5ENU A;  2LEG A;  1ERW A;  3CBU A;  1TXX A;  4KDX A;  3V1W A;  1RQM A;  3EIN A;  2DSA A;  3G7I A;  4FYB A;  2O85 A;  5G5F A;  5ECH B;  4F0C A;  4HZ2 A;  4MDC A;  2YJ7 A;  1X0R A;  1AQX A;  4K2X A;  3O3T A;  2AYT A;  4G2E A;  1RK4 A;  1T1V A;  2C4J A;  4KND A;  5IOX A;  2CZ3 A;  2CVK A;  5J4U A;  2KP2 A;  1MDI A;  1PGT A;  3HKR A;  2VO4 A;  2XBI A;  16GS A;  5BRT A;  2H66 A;  3DML A;  4MH3 A;  5KOX A;  2H70 A;  10GS A;  2VL9 A;  2F8F A;  2OJL A;  4PNF A;  5EL8 A;  1JZD A;  1GTI A;  2QA1 A;  4OO4 A;  4TR4 A;  1TK8 B;  1WP0 A;  3IV4 A;  1A0R P;  5GST A;  5HR3 A;  5CRW A;  2V32 A;  2LNT A;  1Z6M A;  1B48 A;  1XIY A;  4PQI A;  3HY2 A;  2VCX A;  5A4W A;  1JHB A;  4NHZ A;  2QA2 A;  3HVV A;  3GTU A;  4KW6 A;  3GRX A;  4XS4 B;  3CXG A;  3E3E A;  2XPD A;  2WCI A;  1M7T A;  4I2T A;  2L4C A;  5ECR B;  6GSV A;  1OKD A;  1I9D A;  4JBB A;  2R37 A;  2QKE A;  1ZCP A;  4KB3 A;  1URM A;  1SJI A;  4I2U A;  4KA0 A;  2GSR A;  3L4N A;  2HZE A;  4PTS A;  4MK3 A;  4WF4 A;  3HZ4 A;  3Q18 A;  5EVO A;  2C3N A;  3DEX A;  3ZMK A;  4J56 E;  3SBC A;  1O8W A;  5D9T A;  4KGI A;  3BCK A;  5EPF A;  5IMC A;  5B7C A;  3KP8 A;  4G0I A;  5JCU A;  4ID0 A;  3DYR A;  3EE2 A;  4TVE A;  4H86 A;  4K8M A;  1EV4 A;  2MBT A;  1GTB A;  1THX A;  2IMK A;  2H74 A;  1QK8 A;  14GS A;  4J2F A;  3I9V 2;  2I9H A;  3LFL A;  3Q6O A;  4ZL9 A;  3F8U A;  2LRC A;  1DSB A;  3KMN A;  1J08 A;  1TDI A;  3BCI A;  2JL4 A;  2L6C A;  2I3Y A;  2FWG A;  4PUA A;  5KEJ A;  4K7N A;  5DCH A;  3ED3 A;  5HR0 A;  3IBH A;  1ERV A;  4L8E A;  3HJM A;  4K6X A;  2K18 A;  5ECM B;  3MYD A;  3LOR A;  1PL1 A;  4E8E A;  4IGJ A;  1GLQ A;  4GST A;  3VWU A;  4MA9 A;  1S3C A;  3ZIT A;  4P3Y B;  2VL2 A;  5H5Q A;  3UOM A;  1UVZ A;  3FEU A;  4GLT A;  1GTA A;  6GSY A;  3R3E A;  4IVF A;  4OCE A;  1XWG A;  1UN2 A;  2GSS A;  1YZX A;  1ZL9 A;  2VCW A;  2O87 A;  2L6D A;  1O7U A;  4MLY A;  1XOB A;  4ILF A;  4MF6 A;  4TN8 A;  1PQN A;  1A2M A;  2AAW A;  2EIO A;  2X64 A;  1OYJ A;  4DEJ A;  4TXO B;  2ZCT A;  2WS2 A;  1SD9 A;  2DJ2 A;  2YZH A;  1OC8 A;  2WJU A;  3JCM L;  4X4J A;  2VM1 A;  1VF1 A;  3KP9 A;  3QDN A;  1BX9 A;  5F0G A;  3OR5 A;  3VWV A;  1FG4 A;  2H1B A;  3TUE A;  4K9Z A;  2HRF A;  1UA5 A;  3WGD A;  9GSS A;  4BVY B;  1XXU A;  3FKF A;  5CO3 A;  2WFC A;  3CQF A;  2B1L A;  1M2B A;  2PPT A;  1AC1 A;  2B6M A;  1J0F A;  2YCD A;  3G9B A;  2GDR A;  5FT3 A;  4X43 A;  4F9Z A;  2GZY A;  3KTL A;  3TKR A;  1YF1 A;  4Z2T A;  4NV2 A;  1SK1 A;  1XWB A;  3BJ5 A;  4OMV A;  1PD2 1;  5G5E A;  4WXT A;  3KTB A;  5AGY A;  2ON7 A;  4PX1 A;  4CY6 A;  3LW9 A;  4BVX A;  5DJL A;  4ZBB A;  3CTG A;  3FZA A;  1TOF A;  2AJQ B;  3KIJ A;  4CDO A;  2PUK C;  3L78 A;  1OKT A;  3LSZ A;  1FOV A;  4PNG A;  2DIZ A;  2EIQ A;  3TKS C;  3ZLP A;  3ZL5 A;  4EIP A;  2YZU A;  4CW9 A;  1U87 A;  3D21 A;  4K0N A;  1H75 A;  3LYK A;  1HNA A;  3UEM A;  4L5L A;  4EKZ A;  1U88 A;  1XOA A;  1AIU A;  5IMV A;  3N5O A;  4ECC A;  1JZR A;  1V98 A;  5FWG A;  1ON4 A;  3PGT A;  2GLR A;  4MP4 A;  1Y25 A;  3WGE A;  3FZ5 A;  3L9V A;  5IQY A;  2AUV A;  2X49 A;  3GX8 A;  2LS5 A;  3E0U A;  2YOI A;  3D0Z A;  1BAY A;  3GTU B;  5J3R A;  1GTU A;  4IBP A;  1JLV A;  2VD0 A;  1AQV A;  5DVB A;  1DE2 A;  2OAD A;  3UVT A;  3GV1 A;  2C0D A;  4G19 A;  4BPY A;  1TK0 B;  5AN1 A;  5DBQ A;  3GL3 A;  2FWH A;  4QL7 A;  3A5W A;  2L5O A;  1R26 A;  1FB6 A;  1GH2 A;  1GSU A;  2A2R A;  2HZE B;  2RII A;  2REM A;  1HQO A;  1A8Y A;  2NBS A;  3QFB C;  1EEJ A;  3TKQ A;  3ME8 A;  3EU3 A;  5IO0 A;  2PWJ A;  3TJJ A;  5D96 A;  3KD0 A;  3QMX A;  1IYH A;  3F6D A;  4KSM A;  1ZYN A;  3F9U A;  3ZRD A;  4HU9 A;  3ERW A;  5HR1 A;  1Z7P A;  4RQR A;  1G0T A;  1M3I A;  4EVM A;  4MH2 A;  3MDK A;  3APQ A;  4IS0 A;  1VF2 A;  4RI6 A;  6GSS A;  1GUK A;  3HDC A;  4KSO A;  1V2A A;  3NZN A;  3HJP A;  1QUW A;  3QCP A;  2N5B A;  3RHB A;  1TRW A;  19GS A;  1A24 A;  4V1A p;  2N5F A;  2H30 A;  4Q5N A;  3GST A;  3VI5 A;  4RQX A;  5F05 A;  4HJM A;  1U3I A;  4FYC A;  4ULX A;  4N11 A;  5ELG A;  1K0B A;  3DIE A;  2KUC A;  3KH9 A;  2DIY A;  4OWY A;  1ZOF A;  2IL3 A;  1HD2 A;  4IW9 A;  3F0I A;  1Z5Y E;  1EZK A;  4L0W A;  3KH7 A;  4KX4 A;  3TCO A;  2GZZ A;  1R5P A;  1YQ1 A;  1YJ6 A;  2LNS A;  5JWR B;  1AW9 A;  4HOJ A;  1PL2 A;  1GUM A;  2MMO A;  3EWL A;  4XRD A;  5GAN D;  2AB6 A;  1M2D A;  1U3A A;  2J9H A;  2H6Z A;  2HI7 A;  4G9H A;  2A4V A;  3ERG A;  4N0Z A;  3QAW A;  1JZO A;  3MSZ A;  1TTZ A;  1AXD A;  4G10 A;  1R7H A;  4V2M A;  4Q5Q A;  2E2G A;  2H0G A;  1S3A A;  1O8X A;  4EUY A;  3TJG A;  4GSN A;  2C80 A;  3U6V A;  4HQS A;  3ZIJ A;  2AV4 A;  3GKK A;  3UIW A;  5B8A A;  1BQ7 A;  4TW5 A;  2H72 A;  3C7M A;  4OD7 A;  2HZF A;  2JAD A;  5B8B A;  3F4S A;  3F3Q A;  4IQ1 A;  1TK5 B;  2YWO A;  2OE0 A;  3QFA C;  1HNB A;  2WZ9 A;  2I1U A;  2CA8 A;  3LXZ A;  4XS1 A;  3UAP A;  2H76 A;  1MD3 A;  7GSS A;  2ES7 A;  5LD0 A;  4OO5 A;  4O32 A;  5DQS A;  4E8H A;  1PA3 A;  4KF9 A;  2OBK A;  2R0P A;  4IJI A;  1VRS D;  2DJ3 A;  1W4V A;  4JRR A;  1ZMA A;  4YAP A;  4TR1 A;  1OE7 A;  4DVC A;  2F3M A;  4BL7 A;  5CRD A;  3IC4 A;  3EPT A;  1N2A A;  3P8W A;  4BVX B;  1F2E A;  2H1G A;  1CQG A;  4XTS A;  4FQU A;  5ABR A;  5FHI A;  2IN3 A;  1AQW A;  1EEM A;  2O8V B;  1QFN A;  2H6X A;  2EIR A;  1VGL A;  3SWL A;  3APO A;  3TB2 A;  1YDK A;  1TI1 A;  4N0V A;  3ZZX A;  2B1K A;  3CRT A;  3TRX A;  3CMI A;  2A4H A;  2VM2 A;  3M3M A;  2L57 A;  1XVW A;  4XCS A;  4ECI A;  3NIV A;  4ZIJ A;  3P7X A;  5ECP B;  2CZ2 A;  1ZYQ B;  2E7P A;  1KBN A;  2VCQ A;  3PH9 A;  4WKW A;  4FO5 A;  2X8C A;  4X1U A;  1E2Y A;  2NVL A;  3GX0 A;  2YP6 A;  1LU4 A;  1TKD B;  3G7Y A;  4D73 A;  2GQL A;  3FRC A;  3APS A;  4A5P A;  1SKW B;  1Z3E A;  3HYP A;  1K0A A;  1MTC A;  4NWY A;  3IDV A;  3WT2 A;  4F82 A;  5KN3 A;  4JED A;  4YKF A;  11GS A;  4IN0 A;  1A2J A;  5IMZ A;  5ID2 A;  2DKI A;  4HEA 2;  2HT9 A;  3D22 A;  2L4Q A;  1WIK A;  3VFI A;  2VL2 C;  3A5I A;  1A0F A;  2H8L A;  3RDW A;  1FVJ A;  4ZBA A;  2LQQ A;  3DD3 A;  4DSR A;  1KNG A;  3EC3 A;  4NMU A;  4GQC A;  2L5L A;  1M99 A;  4FYU A;  4ZB8 A;  4MJA A;  4O92 A;  2YWI A;  4PUF C;  1GRX A;  1Z7R A;  4K0G A;  3KMO A;  3FZ4 A;  3TJK A;  4WEY A;  3TRQ A;  4MF7 A;  3S9F A;  2FHE A;  2ALB A;  4MPF A;  4BA7 A;  1ST9 A;  2IWT A;  3LYP A;  2PGT A;  6GSX A;  5ECN B;  5LNK e;  5BMU A;  3PR8 A;  1TU8 A;  5DAK A;  2YPM A;  5D8I A;  2H01 A;  3EYT A;  1XVQ A;  1EOG A;  3ISO A;  1QXH A;  3HCZ A;  1XBS A;  5CP1 A;  3HXS A;  3RBT A;  3F4T A;  4O5U A;  1ILO A;  2FD3 A;  3KEB A;  3AY8 A;  13GS A;  2N5A A;  1OE8 A;  2WGR A;  2DBC A;  3CTF A;  4ML1 A;  2M46 A;  1YF0 A;  4JR6 A;  1ML6 A;  1U6T A;  2C3T A;  1V40 A;  4HJ2 A;  1ZGN A;  2FUG 2;  2K8V A;  1EP8 A;  1OC3 A;  4XS6 A;  4EXJ A;  1SU9 A;  4JU5 A;  2HLS A;  4OFN A;  4YKG A;  2DC5 A;  1JLW A;  4NHW A;  3TOU A;  3UL3 A;  2LRT A;  3VPQ A;  4CHS A;  1SL0 B;  2KP1 A;  1GSE A;  3L0H A;  5GZZ B;  3TKS E;  4YQU A;  2NPB A;  3PPU A;  1ERU A;  3TOT A;  1SKR B;  1TRS A;  3QD9 A;  5D73 A;  2LKU A;  1FB0 A;  1XWC A;  2GQM A;  5KN1 A;  3FMW A;  3UBL A;  3VWW A;  1GSF A;  1A23 A;  2YAN A;  1HYU A;  2J23 A;  2A2S A;  2X8G A;  4N10 A;  1PRX A;  4CY8 A;  2VAF A;  4Q5F A;  4JZQ A;  5J5N A;  4K7I A;  5IM9 A;  1VF3 A;  4HDE A;  4F03 A;  5G1L A;  3ZRE A;  2TRC P;  2MBS A;  3GUR A;  4TR1 B;  4DSS A;  1WJK A;  4BL7 B;  1K0M A;  2GQK A;  1SK0 A;  4I8B A;  4IP6 A;  2YWM A;  5CRH A;  2R3X A;  4LMV A;  2IME A;  5HFI A;  1KTE A;  2P5Q A;  4IQA A;  1UC7 A;  2L59 A;  2IMI A;  5IPG A;  4XIH A;  3DXB A;  5DDL A;  2V2G A;  4V2L A;  5J9C A;  1S3D A;  3N9J A;  4LL4 B;  1K3L A;  1QQ2 A;  2E0Q A;  4HZ4 A;  2RM5 A;  4PUR A;  2C0G A;  3MAK A;  2M80 A;  1Z6N A;  5HR2 A;  3TKP A;  6GST A;  2LST A;  2R2J A;  5CRE A;  5IOW A;  4MNN A;  2C1Y A;  1NHO A;  3H79 A;  4KDY A;  2MMA A;  1T4Y A;  2GT5 A;  3MIX A;  1EOH A;  2C3Q A;  5CRG A;  2NTO A;  4EC0 A;  3IHG A;  2Z9S A;  5G30 A;  2YNX A;  3ZVJ D;  4L0U A;  4D73 B;  1G7O A;  3WGX A;  2TIR A;  3EU4 A;  2B5Y A;  2BJX A;  2IMD A;  3BD2 A;  1FO5 A;  3DKS A;  4G0L A;  4MJC A;  2B3S A;  2VD1 A;  3VPT A;  2XC2 A;  1YKA A;  2ZNM A;  4EF0 A;  3IR4 A;  3IRA A;  5C00 A;  5H5S A;  2A2P A;  4LLR A;  1AUC A;  3BOA A;  2G2Q A;  2R6K A;  1PKW A;  3LXT A;  5KOW A;  3C73 A;  5E59 A;  3P2A A;  3D5J A;  5J9B A;  3TKS A;  1WE0 A;  2FWF A;  1X9S B;  4MZB A;  1MEK A;  3FR6 A;  5ID2 B;  2DMM A;  4IKH A;  2LTK A;  1XW9 A;  2V6K A;  1GSQ A;  1BJX A;  1BG5 A;  1EV9 A;  4WF5 A;  5D93 A;  1WMJ A;  1FAA A;  1AAZ A;  3KCM A;  5CNW A;  2QC7 A;  4NPB A;  3WYW A;  4AJ6 A;  1YKC A;  2HFD A;  4ZXG A;  3CSI A;  3E9J B;  5AIS A;  4X0X A;  3L9U A;  4ZBD A;  1A8L A;  5GAP D;  1F3B A;  5DAL A;  3H1N A;  4I6X A;  1WOU A;  2DJ0 A;  2LRN A;  4ZB9 A;  1VF4 A;  4QQ7 A;  1SD8 A;  3J7Y k;  3HVS A;  4POK A;  3F63 A;  4BWS A;  1NHY A;  5ECK B;  3FR3 A;  3TDG A;  1B4P A;  1OVN A;  4GRF A;  1WPI A;  4POL A;  2YN1 A;  1BED A;  1Y6E A;  5DCG A;  4KUN A;  5DAK B;  3CSJ A;  2HSH A;  1HNC A;  2JSZ A;  1K0C A;  1XFL A;  4K2D A;  1TJD A;  1FOH A;  3Q74 A;  1SL1 B;  2HRN A;  2C0E A;  2K9F A;  5AIV A;  5F06 A;  1SJ6 A;  2B5X A;  1TI3 A;  4OFM A;  2PER A;  3LWA A;  2XHF A;  2DML A;  4AJ7 A;  1GWC A;  4F2I A;  2B7K A;  4TR3 A;  1XG8 A;  3MWH A;  2C8U A;  3ZIV A;  3FY7 A;  4KCE A;  17GS A;  3W8J A;  1M2A A;  1JZW A;  1MDJ A;  8GSS A;  2H0I A;  4BWQ A;  1SEN A;  5JWQ B;  2IFQ A;  1SKS B;  3HA9 A;  3C8E A;  4POM A;  2R0G A;  1GSS A;  1NSW A;  3BBY A;  4IEL A;  1O81 A;  2VCT A;  1X9W B; 
#chains in the Genus database with same CATH homology
 5CAX A;  2GT6 A;  1B9X C;  4YH2 A;  3CRU A;  3GHA A;  1K3O A;  2VLT A;  1FW1 A;  1GL8 A;  3GKN A;  4NAX A;  3HHV A;  4RUV A;  1DUG A;  2PVO C;  2VCV A;  2LJA A;  1USB A;  4XHM A;  2DLX A;  1LBK A;  3VLN A;  1K0N A;  2I81 A;  5D9X A;  4I97 A;  1OAZ A;  4DSS B;  2JU5 A;  3GNJ A;  4TOP A;  1NW2 A;  5HFG A;  1EGR A;  4WR5 A;  1F37 A;  1Q4J A;  1XCC A;  4ZL7 A;  3H93 A;  3DVW A;  1IYI A;  1O6J A;  2R4V A;  1MD4 A;  1YY7 A;  3TJF A;  1EWX A;  5KN0 A;  1GUL A;  4PGT A;  1XW5 A;  3H4K A;  4KAE A;  2LJK A;  3TRP A;  1T00 A;  2HXK A;  1A2L A;  4N30 A;  2V1M A;  4Z2R A;  3GUS A;  1V58 A;  3PIN A;  2XPE A;  2TRX A;  3ZFB A;  2GS3 A;  2GTU A;  4GWR A;  1SYR A;  2LV3 A;  2BMX A;  3ZFL A;  1QMV A;  2RLI A;  1CQH A;  2HNL A;  4J57 E;  3M0F A;  3DWV A;  2C0F A;  1YEX A;  4V2N A;  1Z9H A;  1X9M B;  3IOS A;  2VCZ A;  4PXO A;  3M8N A;  2X99 A;  5G1K A;  4ZB6 A;  3WD6 A;  1N8J A;  1WRY A;  2JAC A;  2X8H A;  1J9B A;  5IIZ A;  2OKA A;  2LJR A;  4HI7 A;  1GSY A;  18GS A;  2H6Y A;  1RW1 A;  3IE3 A;  4WBJ A;  3O76 A;  1T4Z A;  3IAM 2;  3I43 A;  3I6A A;  1B4Q A;  4JR4 A;  3FR9 A;  4EE0 A;  2FNO A;  3M1G A;  3C1S A;  1TRV A;  4MJB A;  5F07 A;  3GH6 A;  1XPV A;  3IA1 A;  3IPZ A;  1XW6 A;  5A4V A;  3KJY A;  4GQF A;  2CT6 A;  1V57 A;  2JZT A;  3GN3 A;  3DVX A;  4LMW A;  2VUP A;  3QR6 A;  5HQP A;  2CV4 A;  5HFK A;  3EVI A;  2FLS A;  4QL9 A;  1ACV A;  3D6I A;  2JZS A;  5DQY A;  4HQZ A;  4AF2 A;  2PU9 C;  4ISD A;  4WR4 A;  2H0H A;  2X4A A;  2QGV A;  3GYK A;  3HZ8 A;  3UVH A;  1PMT A;  2HYX A;  3A3T A;  3LJR A;  4Q5R A;  1G7E A;  5F8B A;  2HRA A;  5DAL B;  2QSI A;  1K3Y A;  4ZIL A;  2H75 A;  3J7Y b;  4MZC A;  1ERT A;  1OC9 A;  3UAR A;  1X5C A;  1JFU A;  1M9B A;  3GA4 A;  2P5R A;  5B6N A;  1SJZ A;  1TP9 A;  1GSD A;  1M0U A;  1TRU A;  1GUH A;  2CVB A;  3F3R A;  3GKM A;  3WT1 A;  2BTO T;  1GP1 A;  5COH A;  3VI7 A;  3EUR A;  1LJR A;  1YEP A;  2P31 A;  3QAG A;  4ECJ A;  2JZR A;  2AHE A;  1KEB A;  3K8N A;  1V9W A;  3ZTL A;  2MMN A;  2OBI A;  3D4T A;  2FY6 A;  4L5O A;  3F4R A;  4MJE A;  4OCF A;  4LA1 A;  2FCH A;  4EO3 A;  4GF0 A;  4Z7X A;  2IFQ B;  4RI7 A;  1T7P B;  4HU7 A;  4MAB A;  1PSQ A;  3A2X A;  4AJ8 A;  4NXI A;  4ACS A;  2CAI A;  3FYG A;  2G0F A;  2K6V A;  5IO2 A;  2FA8 A;  2M72 A;  2K8S A;  3GMF A;  3HVX A;  3I69 A;  3F6F A;  4YAV A;  2V6O A;  2GST A;  3LEF A;  3RAZ A;  3VWX A;  6GSW A;  3IK9 A;  3UBK A;  3FHK A;  3C71 A;  4PQ1 A;  1E6B A;  3NOF A;  1XWK A;  2R0C A;  5ECS A;  4DSQ A;  2VLV A;  2KOK A;  4F0B A;  1BYE A;  2VLU A;  4EL1 A;  3CSH A;  2DJK A;  4HS1 A;  4MF5 A;  2VL3 A;  1F3A A;  2DJJ A;  1O85 A;  2DKH A;  3D4M A;  3ZML A;  4MZW A;  1ZYE A;  2I4A A;  3FK8 A;  5LCZ A;  5B6M A;  3HD5 A;  1PN0 A;  4AGS A;  2EC4 A;  2CVD A;  2H1A A;  3MNG A;  2D2Z A;  3R2Q A;  2FGX A;  3KXO A;  4O5Q A;  3US3 A;  1X5E A;  2GZP A;  3W6G A;  1PKZ A;  1SK2 A;  1XWA A;  2YV9 A;  3UJ1 A;  4IHU A;  2HSY A;  3G7J A;  2PN8 A;  2MMZ A;  1O73 A;  5JWO B;  4FH8 A;  5INY A;  4OFT A;  2FA4 A;  4KE3 A;  2HSM A;  3QPM A;  3VK9 A;  1DE1 A;  2LQO A;  1R5A A;  1GNE A;  4Z2U A;  4IJ3 A;  2HRK A;  2KLX A;  2FWE A;  2GGT A;  4GSS A;  1G6Y A;  2IJY A;  5A4U A;  5C04 A;  2H19 A;  1Q98 A;  1ABA A;  3M9J A;  4XRA A;  5L71 A;  3IXR A;  2HE3 A;  4YQM A;  1XZO A;  2VOC A;  3UMA A;  5D9W A;  3HJO A;  4MPG A;  2ZUP A;  2B7J A;  2B5E A;  1M9A A;  4ZL8 A;  2IMF A;  5ELA A;  1T8E B;  3GH9 A;  2OA7 A;  4EDZ A;  2IIY A;  4POB A;  5ECL B;  3QOU A;  2PVQ A;  2OE3 A;  2UZ8 A;  1PX7 A;  3EMP A;  3IAS 2;  3A2W A;  1WWJ A;  3FZ9 A;  3GIX A;  4FIW A;  4XS4 A;  4I5Q A;  4PQH A;  4ICY A;  1ZYP A;  3U5R E;  2MZC A;  4WET A;  3CYN A;  5J41 A;  4K5R A;  4IP1 A;  5G31 A;  2YV7 A;  3GFK A;  4EDY A;  2CAQ A;  3ZVJ A;  3H8Q A;  4JE1 A;  2ON5 A;  1FVK A;  2RUE A;  1DBY A;  2NDO A;  2VIM A;  2V41 A;  2YJH A;  4ML6 A;  2WDU A;  4TKY A;  5JCG A;  2H73 A;  5EY6 A;  1R4W A;  1GNW A;  1F6M C;  4MMM A;  2CQ9 A;  2RM6 A;  2O89 A;  3KZQ A;  3L9S A;  2MYG A;  1TW9 A;  3ZYW A;  3IC8 A;  3FW2 A;  3DGQ A;  5KN2 A;  5ECI B;  1PX6 A;  1I5G A;  4K7O A;  1OC9 B;  3IK7 A;  2OAC A;  2JSY A;  4GXZ A;  1THO A;  4O7H A;  4NV5 A;  2WB9 A;  3TGZ A;  1B9Y C;  1K0O A;  3LGC A;  4TR0 A;  4KCA A;  2H71 A;  2OE1 A;  2LUS A;  3GL5 A;  1PN9 A;  1H4O A;  3A2V A;  2XBQ A;  3KM6 A;  4O5R A;  3ERF A;  4WBR D;  5E4W A;  3EMX A;  1B8X A;  2DJ1 A;  3M9K A;  2RUF A;  3RPN A;  4HUA A;  2E2M A;  2IPA A;  4K1F A;  3GKX A;  1SL2 B;  1ZZY A;  1TU7 A;  3KGK A;  4MCU A;  5IMD A;  2F9S A;  4EIQ A;  5IMA A;  1SYX A;  3DRN A;  4USS A;  1EGO A;  4K5S A;  4TRX A;  5AIX A;  1GLP A;  22GS A;  1QGV A;  2O7K A;  5G2Z A;  5D9V A;  5GSS A;  3C1R A;  4LL1 B;  2R5G A;  3P90 A;  3TJB A;  5H5R A;  1T3B A;  2GSQ A;  3QAV A;  4GTU A;  5A5K A;  1G6W A;  2PBJ A;  1W89 A;  3RHC A;  1MDK A;  1X5D A;  3Q19 A;  1K0D A;  3W8S A;  2F8A A;  4TXO A;  5CYY A;  2GVP A;  4YQV A;  4V1A g;  2KHP A;  5ECO B;  2H1D A;  4TXV A;  2PMT A;  3IHQ A;  2WUL A;  2YWN A;  1EP7 A;  4KH7 A;  2WRT A;  3LG6 A;  1NM3 A;  3LQ7 A;  2P0G A;  20GS A;  2CX3 A;  5IPH A;  4GCI A;  5JCW A;  3O6T A;  6GSU A;  2CX4 A;  3VUR A;  3GSS A;  5ECQ B;  5IMF A;  4BVY A;  3RPP A;  5DJM A;  4G0K A;  2F51 A;  1FHE A;  3ME7 A;  12GS A;  4ECB A;  1C72 A;  1F9M A;  4KDU A;  5ENU A;  2LEG A;  1ERW A;  3CBU A;  1TXX A;  4KDX A;  3V1W A;  1RQM A;  3EIN A;  2DSA A;  3G7I A;  4FYB A;  2O85 A;  5G5F A;  5ECH B;  4F0C A;  4HZ2 A;  4MDC A;  2YJ7 A;  1X0R A;  1AQX A;  4K2X A;  3O3T A;  2AYT A;  4G2E A;  1RK4 A;  1T1V A;  2C4J A;  4KND A;  5IOX A;  2CZ3 A;  2CVK A;  5J4U A;  2KP2 A;  1MDI A;  1PGT A;  3HKR A;  2VO4 A;  2XBI A;  16GS A;  5BRT A;  2H66 A;  3DML A;  4MH3 A;  5KOX A;  2H70 A;  10GS A;  2VL9 A;  2F8F A;  2OJL A;  4PNF A;  5EL8 A;  1JZD A;  1GTI A;  2QA1 A;  4OO4 A;  4TR4 A;  1TK8 B;  1WP0 A;  3IV4 A;  1A0R P;  5GST A;  5HR3 A;  5CRW A;  2V32 A;  2LNT A;  1Z6M A;  1B48 A;  1XIY A;  4PQI A;  3HY2 A;  2VCX A;  5A4W A;  1JHB A;  4NHZ A;  2QA2 A;  3HVV A;  3GTU A;  4KW6 A;  3GRX A;  4XS4 B;  3CXG A;  3E3E A;  2XPD A;  2WCI A;  1M7T A;  4I2T A;  2L4C A;  5ECR B;  6GSV A;  1OKD A;  1I9D A;  4JBB A;  2R37 A;  2QKE A;  1ZCP A;  4KB3 A;  1URM A;  1SJI A;  4I2U A;  4KA0 A;  2GSR A;  3L4N A;  2HZE A;  4PTS A;  4MK3 A;  4WF4 A;  3HZ4 A;  3Q18 A;  5EVO A;  2C3N A;  3DEX A;  3ZMK A;  4J56 E;  3SBC A;  1O8W A;  5D9T A;  4KGI A;  3BCK A;  5EPF A;  5IMC A;  5B7C A;  3KP8 A;  4G0I A;  5JCU A;  4ID0 A;  3DYR A;  3EE2 A;  4TVE A;  4H86 A;  4K8M A;  1EV4 A;  2MBT A;  1GTB A;  1THX A;  2IMK A;  2H74 A;  1QK8 A;  14GS A;  4J2F A;  3I9V 2;  2I9H A;  3LFL A;  3Q6O A;  4ZL9 A;  3F8U A;  2LRC A;  1DSB A;  3KMN A;  1J08 A;  1TDI A;  3BCI A;  2JL4 A;  2L6C A;  2I3Y A;  2FWG A;  4PUA A;  5KEJ A;  4K7N A;  5DCH A;  3ED3 A;  5HR0 A;  3IBH A;  1ERV A;  4L8E A;  3HJM A;  4K6X A;  2K18 A;  5ECM B;  3MYD A;  3LOR A;  1PL1 A;  4E8E A;  4IGJ A;  1GLQ A;  4GST A;  3VWU A;  4MA9 A;  1S3C A;  3ZIT A;  4P3Y B;  2VL2 A;  5H5Q A;  3UOM A;  1UVZ A;  3FEU A;  4GLT A;  1GTA A;  6GSY A;  3R3E A;  4IVF A;  4OCE A;  1XWG A;  1UN2 A;  2GSS A;  1YZX A;  1ZL9 A;  2VCW A;  2O87 A;  2L6D A;  1O7U A;  4MLY A;  1XOB A;  4ILF A;  4MF6 A;  4TN8 A;  1PQN A;  1A2M A;  2AAW A;  2EIO A;  2X64 A;  1OYJ A;  4DEJ A;  4TXO B;  2ZCT A;  2WS2 A;  1SD9 A;  2DJ2 A;  2YZH A;  1OC8 A;  2WJU A;  3JCM L;  4X4J A;  2VM1 A;  1VF1 A;  3KP9 A;  3QDN A;  1BX9 A;  5F0G A;  3OR5 A;  3VWV A;  1FG4 A;  2H1B A;  3TUE A;  4K9Z A;  2HRF A;  1UA5 A;  3WGD A;  9GSS A;  4BVY B;  1XXU A;  3FKF A;  5CO3 A;  2WFC A;  2B1L A;  1M2B A;  2PPT A;  1AC1 A;  2B6M A;  1J0F A;  2YCD A;  3G9B A;  2GDR A;  5FT3 A;  4X43 A;  4F9Z A;  2GZY A;  3KTL A;  3TKR A;  1YF1 A;  4Z2T A;  4NV2 A;  1SK1 A;  1XWB A;  3BJ5 A;  4OMV A;  1PD2 1;  5G5E A;  4WXT A;  3KTB A;  5AGY A;  2ON7 A;  4PX1 A;  4CY6 A;  3LW9 A;  4BVX A;  5DJL A;  4ZBB A;  3CTG A;  3FZA A;  1TOF A;  2AJQ B;  3KIJ A;  4CDO A;  2PUK C;  3L78 A;  1OKT A;  3LSZ A;  1FOV A;  4PNG A;  2DIZ A;  2EIQ A;  3TKS C;  3ZLP A;  3ZL5 A;  4EIP A;  2YZU A;  4CW9 A;  1U87 A;  3D21 A;  4K0N A;  1H75 A;  3LYK A;  1HNA A;  3UEM A;  4L5L A;  4EKZ A;  1U88 A;  1XOA A;  1AIU A;  5IMV A;  3N5O A;  4ECC A;  1JZR A;  1V98 A;  5FWG A;  1ON4 A;  3PGT A;  2GLR A;  4MP4 A;  1Y25 A;  3WGE A;  3FZ5 A;  3L9V A;  5IQY A;  2AUV A;  2X49 A;  3GX8 A;  2LS5 A;  3E0U A;  2YOI A;  3D0Z A;  1BAY A;  3GTU B;  5J3R A;  1GTU A;  4IBP A;  1JLV A;  2VD0 A;  1AQV A;  5DVB A;  1DE2 A;  2OAD A;  3UVT A;  3GV1 A;  2C0D A;  4G19 A;  4BPY A;  1TK0 B;  5AN1 A;  5DBQ A;  3GL3 A;  2FWH A;  4QL7 A;  3A5W A;  2L5O A;  1R26 A;  1FB6 A;  1GH2 A;  1GSU A;  2A2R A;  2HZE B;  2RII A;  2REM A;  1HQO A;  1A8Y A;  2NBS A;  3QFB C;  1EEJ A;  3TKQ A;  3ME8 A;  3EU3 A;  5IO0 A;  2PWJ A;  3TJJ A;  5D96 A;  3KD0 A;  3QMX A;  1IYH A;  3F6D A;  4KSM A;  1ZYN A;  3F9U A;  3ZRD A;  4HU9 A;  3ERW A;  5HR1 A;  1Z7P A;  4RQR A;  1G0T A;  4EVM A;  4MH2 A;  3MDK A;  3APQ A;  4IS0 A;  1VF2 A;  4RI6 A;  6GSS A;  1GUK A;  3HDC A;  4KSO A;  1V2A A;  3NZN A;  3HJP A;  1QUW A;  3QCP A;  2N5B A;  3RHB A;  1TRW A;  19GS A;  1A24 A;  4V1A p;  2N5F A;  2H30 A;  4Q5N A;  3GST A;  3VI5 A;  4RQX A;  5F05 A;  4HJM A;  1U3I A;  4FYC A;  4ULX A;  4N11 A;  5ELG A;  1K0B A;  3DIE A;  2KUC A;  3KH9 A;  2DIY A;  4OWY A;  1ZOF A;  2IL3 A;  1HD2 A;  4IW9 A;  3F0I A;  1Z5Y E;  1EZK A;  4L0W A;  3KH7 A;  4KX4 A;  3TCO A;  2GZZ A;  1R5P A;  1YQ1 A;  1YJ6 A;  2LNS A;  5JWR B;  1AW9 A;  4HOJ A;  1PL2 A;  1GUM A;  2MMO A;  3EWL A;  4XRD A;  5GAN D;  2AB6 A;  1M2D A;  1U3A A;  2J9H A;  2H6Z A;  2HI7 A;  4G9H A;  2A4V A;  3ERG A;  4N0Z A;  3QAW A;  1JZO A;  3MSZ A;  1TTZ A;  1AXD A;  4G10 A;  1R7H A;  4V2M A;  4Q5Q A;  2E2G A;  2H0G A;  1S3A A;  1O8X A;  4EUY A;  3TJG A;  4GSN A;  2C80 A;  3U6V A;  4HQS A;  3ZIJ A;  2AV4 A;  3GKK A;  3UIW A;  5B8A A;  1BQ7 A;  4TW5 A;  2H72 A;  3C7M A;  4OD7 A;  2HZF A;  2JAD A;  5B8B A;  3F4S A;  3F3Q A;  4IQ1 A;  1TK5 B;  2YWO A;  2OE0 A;  3QFA C;  1HNB A;  2WZ9 A;  2I1U A;  2CA8 A;  3LXZ A;  4XS1 A;  3UAP A;  2H76 A;  1MD3 A;  7GSS A;  2ES7 A;  5LD0 A;  4OO5 A;  4O32 A;  5DQS A;  4E8H A;  1PA3 A;  4KF9 A;  2OBK A;  2R0P A;  4IJI A;  1VRS D;  2DJ3 A;  1W4V A;  4JRR A;  1ZMA A;  4YAP A;  4TR1 A;  1OE7 A;  4DVC A;  2F3M A;  4BL7 A;  5CRD A;  3IC4 A;  3EPT A;  1N2A A;  3P8W A;  4BVX B;  1F2E A;  2H1G A;  1CQG A;  4XTS A;  4FQU A;  5ABR A;  5FHI A;  2IN3 A;  1AQW A;  1EEM A;  2O8V B;  1QFN A;  2H6X A;  2EIR A;  1VGL A;  3SWL A;  3APO A;  3TB2 A;  1YDK A;  1TI1 A;  4N0V A;  3ZZX A;  2B1K A;  3CRT A;  3TRX A;  3CMI A;  2A4H A;  2VM2 A;  3M3M A;  2L57 A;  1XVW A;  4XCS A;  4ECI A;  3NIV A;  4ZIJ A;  3P7X A;  5ECP B;  2CZ2 A;  1ZYQ B;  2E7P A;  1KBN A;  2VCQ A;  3PH9 A;  4WKW A;  4FO5 A;  2X8C A;  4X1U A;  1E2Y A;  2NVL A;  3GX0 A;  2YP6 A;  1LU4 A;  1TKD B;  3G7Y A;  4D73 A;  2GQL A;  3FRC A;  3APS A;  4A5P A;  1SKW B;  1Z3E A;  3HYP A;  1K0A A;  1MTC A;  4NWY A;  3IDV A;  3WT2 A;  4F82 A;  5KN3 A;  4JED A;  4YKF A;  11GS A;  4IN0 A;  1A2J A;  5IMZ A;  5ID2 A;  2DKI A;  4HEA 2;  2HT9 A;  3D22 A;  2L4Q A;  1WIK A;  3VFI A;  2VL2 C;  3A5I A;  1A0F A;  2H8L A;  3RDW A;  1FVJ A;  4ZBA A;  2LQQ A;  3DD3 A;  4DSR A;  1KNG A;  3EC3 A;  4NMU A;  4GQC A;  2L5L A;  1M99 A;  4FYU A;  4ZB8 A;  4MJA A;  4O92 A;  2YWI A;  4PUF C;  1GRX A;  1Z7R A;  4K0G A;  3KMO A;  3FZ4 A;  3TJK A;  4WEY A;  3TRQ A;  4MF7 A;  3S9F A;  2FHE A;  2ALB A;  4MPF A;  4BA7 A;  1ST9 A;  2IWT A;  3LYP A;  2PGT A;  6GSX A;  5ECN B;  5LNK e;  5BMU A;  3PR8 A;  1TU8 A;  5DAK A;  2YPM A;  5D8I A;  2H01 A;  3EYT A;  1XVQ A;  1EOG A;  3ISO A;  1QXH A;  3HCZ A;  1XBS A;  5CP1 A;  3HXS A;  3RBT A;  3F4T A;  4O5U A;  1ILO A;  2FD3 A;  3KEB A;  3AY8 A;  13GS A;  2N5A A;  1OE8 A;  2WGR A;  2DBC A;  3CTF A;  4ML1 A;  2M46 A;  1YF0 A;  4JR6 A;  1ML6 A;  1U6T A;  2C3T A;  1V40 A;  4HJ2 A;  1ZGN A;  2FUG 2;  2K8V A;  1EP8 A;  1OC3 A;  4XS6 A;  4EXJ A;  1SU9 A;  4JU5 A;  2HLS A;  4OFN A;  4YKG A;  2DC5 A;  1JLW A;  4NHW A;  3TOU A;  3UL3 A;  2LRT A;  3VPQ A;  4CHS A;  1SL0 B;  2KP1 A;  1GSE A;  3L0H A;  5GZZ B;  3TKS E;  4YQU A;  2NPB A;  3PPU A;  1ERU A;  3TOT A;  1SKR B;  1TRS A;  3QD9 A;  5D73 A;  2LKU A;  1FB0 A;  1XWC A;  2GQM A;  5KN1 A;  3FMW A;  3UBL A;  3VWW A;  1GSF A;  1A23 A;  2YAN A;  1HYU A;  2J23 A;  2A2S A;  2X8G A;  4N10 A;  1PRX A;  4CY8 A;  2VAF A;  4Q5F A;  4JZQ A;  5J5N A;  4K7I A;  5IM9 A;  1VF3 A;  4HDE A;  4F03 A;  5G1L A;  3ZRE A;  2TRC P;  2MBS A;  3GUR A;  4TR1 B;  4DSS A;  1WJK A;  4BL7 B;  1K0M A;  2GQK A;  1SK0 A;  4I8B A;  4IP6 A;  2YWM A;  5CRH A;  2R3X A;  4LMV A;  2IME A;  5HFI A;  1KTE A;  2P5Q A;  4IQA A;  1UC7 A;  2L59 A;  2IMI A;  5IPG A;  4XIH A;  3DXB A;  5DDL A;  2V2G A;  4V2L A;  5J9C A;  1S3D A;  3N9J A;  4LL4 B;  1K3L A;  1QQ2 A;  2E0Q A;  4HZ4 A;  2RM5 A;  4PUR A;  2C0G A;  3MAK A;  2M80 A;  1Z6N A;  5HR2 A;  3TKP A;  6GST A;  2LST A;  2R2J A;  5CRE A;  5IOW A;  4MNN A;  2C1Y A;  1NHO A;  3H79 A;  4KDY A;  2MMA A;  1T4Y A;  2GT5 A;  3MIX A;  1EOH A;  2C3Q A;  5CRG A;  2NTO A;  4EC0 A;  3IHG A;  2Z9S A;  5G30 A;  2YNX A;  3ZVJ D;  4L0U A;  4D73 B;  1G7O A;  3WGX A;  2TIR A;  3EU4 A;  2B5Y A;  2BJX A;  2IMD A;  3BD2 A;  1FO5 A;  3DKS A;  4G0L A;  4MJC A;  2B3S A;  2VD1 A;  3VPT A;  2XC2 A;  1YKA A;  2ZNM A;  4EF0 A;  3IR4 A;  3IRA A;  5C00 A;  5H5S A;  2A2P A;  4LLR A;  1AUC A;  3BOA A;  2G2Q A;  2R6K A;  1PKW A;  3LXT A;  5KOW A;  3C73 A;  5E59 A;  3P2A A;  3D5J A;  5J9B A;  3TKS A;  1WE0 A;  2FWF A;  1X9S B;  4MZB A;  1MEK A;  3FR6 A;  5ID2 B;  2DMM A;  4IKH A;  2LTK A;  1XW9 A;  2V6K A;  1GSQ A;  1BJX A;  1BG5 A;  1EV9 A;  4WF5 A;  5D93 A;  1WMJ A;  1FAA A;  1AAZ A;  3KCM A;  5CNW A;  2QC7 A;  4NPB A;  3WYW A;  4AJ6 A;  1YKC A;  2HFD A;  4ZXG A;  3CSI A;  3E9J B;  5AIS A;  4X0X A;  3L9U A;  4ZBD A;  1A8L A;  5GAP D;  1F3B A;  5DAL A;  3H1N A;  4I6X A;  1WOU A;  2DJ0 A;  2LRN A;  4ZB9 A;  1VF4 A;  4QQ7 A;  1SD8 A;  3J7Y k;  3HVS A;  4POK A;  3F63 A;  4BWS A;  1NHY A;  5ECK B;  3FR3 A;  3TDG A;  1B4P A;  1OVN A;  4GRF A;  1WPI A;  4POL A;  2YN1 A;  1BED A;  1Y6E A;  5DCG A;  4KUN A;  5DAK B;  3CSJ A;  2HSH A;  1HNC A;  2JSZ A;  1K0C A;  1XFL A;  4K2D A;  1TJD A;  1FOH A;  3Q74 A;  1SL1 B;  2HRN A;  2C0E A;  2K9F A;  5AIV A;  5F06 A;  1SJ6 A;  2B5X A;  1TI3 A;  4OFM A;  2PER A;  3LWA A;  2XHF A;  2DML A;  4AJ7 A;  1GWC A;  4F2I A;  2B7K A;  4TR3 A;  3MWH A;  2C8U A;  3ZIV A;  3FY7 A;  4KCE A;  17GS A;  3W8J A;  1M2A A;  1JZW A;  1MDJ A;  8GSS A;  2H0I A;  4BWQ A;  1SEN A;  5JWQ B;  2IFQ A;  1SKS B;  3HA9 A;  3C8E A;  4POM A;  2R0G A;  1GSS A;  1NSW A;  3BBY A;  4IEL A;  1O81 A;  2VCT A;  1X9W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...