1EGRA

Sequence-specific 1h n.m.r. assignments and determination of the three-dimensional structure of reduced escherichia coli glutaredoxin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-specific 1H n.m.r. assignments and determination of the three-dimensional structure of reduced Escherichia coli glutaredoxin.
pubmed doi rcsb
molecule keywords GLUTAREDOXIN
molecule tags Electron transport
source organism Escherichia coli
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1991-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1egrA00
2GT5A 3IK9A 4FIWA 2Z9SA 2RIIA 5AIVA 3LORA 4BVXA 1JZRA 1TI3A 4IQ1A 5JCWA 2DLXA 4K0GA 2GSSA 4ZBBA 2GQKA 3O6TA 5J9CA 1ZYQB 2GZZA 5GSTA 4ECJA 2I3YA 1S3CA 3F8UA 4TXOA 5DAKB 1M2BA 1NW2A 3LGCA 1XVWA 1Z6MA 1E6BA 5F07A 1ST9A 3VPQA 3ZTLA 5FWGA 3LSZA 2H1GA 5A4WA 4BL7A 4HS1A 3F4TA 1QGVA 4N11A 3IHQA 1PL2A 1WIKA 22GSA 2GVPA 2H70A 3GFKA 1OE7A 3UAPA 2V1MA 19GSA 3EE2A 4XS1A 2C0GA 2PPTA 3D22A 1SJ6A 4KUNA 1AQWA 1THXA 4IJ3A 1PA3A 2DMMA 4XS4B 4DSSB 1FOVA 1QXHA 1GSUA 4HEA2 5EL8A 5DQSA 2MBSA 1JFUA 3I6AA 2H1BA 1ZMAA 1ILOA 2XPDA 4OCEA 2KP2A 4MCUA 1XFLA 5HFKA 2P5RA 2FD3A 2L59A 4H86A 1SU9A 2M46A 4BVYA 4HQSA 2JZSA 1OE8A 6GSYA 4ZB9A 2GLRA 2HZEB 2H1DA 4AGSA 1CQHA 1USBA 4GRFA 4FYCA 3AY8A 3VFIA 4KDXA 4LA1A 2O7KA 3HCZA 4CW9A 1A0FA 1U3AA 3QPMA 1K3LA 3SWLA 3QAGA 2GSTA 1G7EA 2FUG2 1XW6A 1GSYA 1PN9A 4NMUA 2LEGA 3IOSA 2RM5A 1R5PA 5G30A 1GTBA 1R4WA 1SYRA 1B4QA 3L0HA 1K0MA 2O89A 1ZGNA 4BA7A 2JADA 4J2FA 1TU7A 3QAVA 2C8UA 1A2MA 3QD9A 1OKDA 2R6KA 5ELAA 1A8YA 1E2YA 4OCFA 4QQ7A 3VWXA 1BEDA 1R26A 3ZIJA 9GSSA 3KP9A 1X0RA 1YQ1A 3W8JA 2HE3A 5COHA 4NXIA 2VLUA 1Q4JA 2BTOT 3HJMA 4GQCA 3UBLA 1ZOFA 3QDNA 3UEMA 1ABAA 3LJRA 1RQMA 8GSSA 4L8EA 4GSTA 5AIXA 3CXGA 3KCMA 1VRSD 2FGXA 3CTGA 4F0CA 5IPHA 1GRXA 5DCGA 4NV2A 1VF4A 3VI5A 1T4YA 3HXSA 2NVLA 4CHSA 1SD8A 5B6MA 1J0FA 5GZZB 6GSUA 2CQ9A 2YWMA 5CYYA 5IMCA 4AJ7A 1EOGA 2OADA 2PGTA 2H30A 1VF1A 5IMFA 1XWGA 3KJYA 3RAZA 3L9VA 1UA5A 3P2AA 1MDIA 4GQFA 2LTKA 2ON5A 4V2MA 3P7XA 1X5CA 3ERWA 1GLQA 1SL0B 2K9FA 1F6MC 4ZL9A 3WGEA 4EO3A 3CSIA 3A5WA 1GTAA 5ENUA 1WJKA 3IC4A 1Y6EA 2F9SA 4TRXA 4E8HA 1EV4A 1TK8B 4WF4A 1BX9A 3IAM2 5G5EA 3GKKA 3TUEA 5CREA 1XPVA 2OE0A 5D8IA 3L9SA 4PNFA 2CVBA 3LXZA 3O3TA 3VWWA 1A2LA 4K7NA 1MEKA 5CNWA 4EXJA 1YF1A 3F63A 4QL9A 2FLSA 4ZILA 4DEJA 4KDYA 2IWTA 3ERFA 1EOHA 4POBA 3RDWA 2M80A 3HDCA 4X1UA 1FB0A 2PUKC 3KZQA 4IQAA 2CT6A 4MP4A 4MJEA 3LFLA 5IM9A 4YQVA 1B9YC 2JZTA 1A8LA 1GNEA 3GIXA 3IPZA 2HT9A 4HZ2A 3IK7A 3GMFA 4K0NA 3L9UA 4NHZA 2MMNA 1IYHA 3ZITA 1BYEA 4Q5FA 4ZBDA 1JZDA 2J23A 3IR4A 3A2VA 5J3RA 1TI1A 3F6DA 4KGIA 3W8SA 1PKZA 1TTZA 3GX0A 1GUMA 1X5EA 5DDLA 3HVSA 4XIHA 17GSA 1J9BA 1DE1A 2IMIA 1EWXA 3WD6A 3HHVA 1GTUA 2LNTA 3F4SA 3HYPA 3UL3A 3G9BA 4EE0A 4V1Ap 3DMLA 3FR6A 1WMJA 2VLTA 4YAVA 2F51A 5A4UA 3TRXA 3EINA 5IOWA 3TKQA 1WRYA 2LRCA 13GSA 1F9MA 2R3XA 5J4UA 4RI7A 5IMDA 1TK5B 1LJRA 3GNJA 4RQRA 1EGOA 3TOUA 3ZZXA 4IVFA 3GURA 2XPEA 1K0CA 2L5OA 3FR9A 2GZPA 5CRHA 2AAWA 4IBPA 2DSAA 3F6FA 4JEDA 1G6WA 2DJ1A 1XVQA 1AUCA 2MBTA 3UOMA 3KTLA 1XW5A 4G2EA 4TXOB 5A4VA 1MDJA 3LG6A 2AYTA 1PX6A 5FT3A 4LMWA 1MTCA 1VF2A 4LL1B 3E9JB 3VI7A 2K8VA 3KM6A 1GUHA 1OAZA 3VLNA 4GTUA 5ECPB 4TVEA 1XIYA 5F05A 3S9FA 1B9XC 5H5SA 4IJIA 2H0IA 1A23A 4G10A 5IO2A 1K0DA 1ML6A 3G7JA 4PX1A 3RPNA 2DJKA 5IMZA 2AB6A 5CRWA 3RHBA 3EU4A 4HU7A 3CSJA 1M2AA 3PINA 1GUKA 4EL1A 1Z5YE 2H75A 3CRTA 2VCQA 2E2GA 1EZKA 2YOIA 2F8AA 1WWJA 3DVXA 4DSRA 1SK1A 4V1Ag 2L6DA 4IHUA 3KMOA 4XRDA 2JACA 4IGJA 14GSA 3E3EA 1SKRB 1TP9A 1O8WA 1ZYEA 4EVMA 2VLVA 2HYXA 1SD9A 2PVOC 3VK9A 4K8MA 4TR0A 2B5YA 2DIYA 3TCOA 1S3DA 4RI6A 1H75A 4TOPA 3C73A 4KH7A 2E0QA 4GXZA 4I8BA 1V9WA 2L4QA 1SYXA 4LMVA 1M0UA 2C3QA 1FB6A 2H71A 2B1KA 4HJMA 4HDEA 4MPFA 1YZXA 3TKRA 3D6IA 2VCZA 1TU8A 2WGRA 3PGTA 3H1NA 5D73A 1C72A 1K0AA 1I9DA 5CO3A 5IOXA 2B7KA 2AJQB 1GTIA 2YZUA 3HZ8A 1HNAA 2DBCA 4AF2A 1QMVA 4FYUA 3ZYWA 4I6XA 4V2NA 1FVJA 1KBNA 5ELGA 4KNDA 3DIEA 3Q74A 5DBQA 2HI7A 3DD3A 4P3YB 2P31A 4PURA 2X8CA 4N30A 4XCSA 2FWHA 2MMZA 3LQ7A 3QOUA 4HJ2A 5DALA 3FKFA 3UVHA 1V40A 2H6YA 2ON7A 3CRUA 4MMMA 3QFBC 5J5NA 1M7TA 4NWYA 4PXOA 1N2AA 3KP8A 1XW9A 2I1UA 2K8SA 4KSMA 5KN2A 3TGZA 1TRSA 2KP1A 4POMA 2CV4A 2CAIA 4GF0A 1Z6NA 4BPYA 2N5BA 4LLRA 2PVQA 4MZBA 5G5FA 3F0IA 4ML6A 2WFCA 4I2UA 1OC9A 1JZWA 3J7Yb 3ISOA 1GSFA 3D5JA 3GKMA 3H8QA 1ZZYA 3CMIA 3IV4A 2VD1A 5HQPA 3TJJA 2YWOA 2C4JA 2OA7A 3F3QA 5HR3A 1O81A 1EP7A 4MH3A 5ECIB 4MK3A 1GSQA 2VL9A 1A2JA 3I9V2 1TW9A 4XHMA 2FA8A 4CDOA 4F0BA 5AN1A 4F2IA 4YQUA 1AIUA 2GQMA 2LRNA 3F9UA 1A24A 5LCZA 4KCEA 3ZREA 5E59A 2CVKA 3GHAA 3WGDA 4O92A 4MF6A 1AC1A 2V6OA 2LUSA 3GSTA 3MWHA 3UARA 2AHEA 1EGRA 3VURA 2GSQA 4MABA 2C1YA 1N8JA 1AAZA 3Q18A 2LSTA 3Q6OA 3HD5A 3H4KA 2O85A 2OE3A 3TRQA 2QKEA 4OO4A 4WR5A 3P90A 3CSHA 4X43A 2RUEA 4TW5A 5A5KA 1NM3A 1TJDA 2FWFA 2DJ2A 2I4AA 3EU3A 3F3RA 2TRCP 5D9TA 2IN3A 1JLWA 2B5EA 2VM1A 3DEXA 1PMTA 3FY7A 4J56E 5IO0A 3BOAA 3ZMKA 1M9AA 4HQZA 2PN8A 5G2ZA 3FZ4A 3N5OA 3FRCA 1PSQA 5ECKB 1ERVA 4N0ZA 4PQIA 2FY6A 4WR4A 3EMXA 5IMAA 1AW9A 4I5QA 1OKTA 4GCIA 3M8NA 3D21A 1LBKA 2V6KA 1O6JA 2C80A 5J41A 1YEXA 5ECHB 2E7PA 2ZUPA 1GLPA 2N5AA 4PQ1A 2JSYA 3IAS2 4WKWA 2H76A 3WT2A 1R7HA 5ID2A 1QFNA 4MDCA 5G31A 3ZVJD 2DJ0A 2PU9C 4ZL8A 5LD0A 1V98A 4RQXA 1W4VA 1OC3A 2L57A 3H79A 4L5LA 4K1FA 2JSZA 2L5LA 3FR3A 1EV9A 3TKSE 5ECSA 3ZMLA 3IXRA 1Z9HA 4POLA 2R4VA 3HJOA 4YH2A 1K0BA 3FZ5A 4DVCA 3SBCA 1FW1A 5EVOA 4TR4A 1TRUA 3FHKA 2OE1A 1K0OA 2VCTA 1TKDB 1YKAA 3ZFBA 5D93A 2MYGA 1SJIA 1FHEA 3V1WA 10GSA 2QC7A 4ILFA 3ZFLA 4KAEA 3TJBA 2GSRA 1YY7A 5GAPD 5HR2A 1G6YA 1T7PB 4HZ4A 2XBQA 1WE0A 5G1KA 3IA1A 20GSA 1ERWA 2QGVA 18GSA 2I81A 1AXDA 3F4RA 4PQHA 4ZBAA 3GA4A 5ECRB 1TRWA 3GYKA 1X5DA 4ULXA 4MF5A 4F9ZA 3BD2A 3QR6A 3PR8A 1V57A 4IELA 3C1SA 4KSOA 3M0FA 5B8AA 3RHCA 1DBYA 2PERA 2LQQA 1U88A 3C71A 3QMXA 5INYA 1B8XA 2MZCA 4D73A 4Q5NA 1EEMA 3HKRA 2YPMA 2AV4A 1XZOA 5C04A 3Q19A 4YAPA 2I9HA 4ZB6A 4JRRA 2K18A 1XWCA 1KTEA 2XBIA 3GUSA 5H5RA 1TXXA 2NTOA 2ZCTA 2CA8A 4TR3A 5JCUA 2A2SA 1M2DA 3ME8A 2IL3A 2FCHA 5HR1A 1G0TA 1KNGA 5HFIA 4ZXGA 1BG5A 4I2TA 4OD7A 3W6GA 2YWNA 4NHWA 2ZNMA 1BQ7A 1RW1A 3KTBA 2IPAA 2VUPA 3OR5A 5JWQB 1F2EA 2YV9A 2H66A 4ZB8A 1ERUA 3BCIA 2C0FA 3M9KA 3R2QA 2JL4A 4GSSA 4GLTA 12GSA 2OBIA 1SL1B 4YQMA 1V2AA 4DSQA 2EIQA 2MMAA 4Q5QA 5DALB 2V41A 2QSIA 1Z3EA 1FG4A 2HZFA 2CAQA 1YF0A 2HLSA 3GV1A 2KUCA 2NBSA 2MMOA 1YEPA 4KDUA 1UN2A 5J9BA 4ISDA 4FO5A 5KN1A 2VCWA 3D4TA 1U3IA 2GQLA 4JR6A 1OC9B 4KB3A 2VL2C 2E2MA 3MSZA 3WYWA 1AQVA 3NIVA 3ZRDA 2CVDA 1X9WB 3KMNA 2EIOA 5DJLA 2OJLA 4G9HA 5DVBA 2H6ZA 6GSXA 1OVNA 3GTUA 3BJ5A 1NHOA 5ECQB 3UVTA 3MDKA 4AJ6A 4EUYA 4Z7XA 1TK0B 2JU5A 1HQOA 4JZQA 3GX8A 1WP0A 4KW6A 6GSTA 1XWKA 4XS6A 4NV5A 2REMA 2GTUA 4MLYA 2FWEA 5JWRB 3U5RE 5KEJA 2H6XA 3UMAA 3M1GA 3I69A 2LJAA 1M9BA 2LJRA 1T00A 3GKXA 1M99A 5CP1A 2X99A 4IP6A 1O73A 1F3AA 5LNKe 2FNOA 2YWIA 1JLVA 3TDGA 3US3A 5JWOB 3A2WA 5DQYA 4ZIJA 2GZYA 1JZOA 5HR0A 2YNXA 5FHIA 1HYUA 1JHBA 2F3MA 1F3BA 2J9HA 2H0GA 4FYBA 2H74A 2P0GA 4OFMA 4BWSA 4O5RA 1X9MB 2WDUA 3C7MA 2VL2A 3HVVA 2YN1A 1K3OA 5AGYA 3TKSA 4HUAA 4JR4A 1YDKA 1NHYA 2V2GA 4OFTA 4POKA 3VPTA 2GT6A 5ID2B 2X64A 3RBTA 1T3BA 1W89A 4OWYA 2PBJA 2HNLA 1YKCA 2L6CA 1WOUA 3QCPA 3GH6A 3EWLA 2TRXA 3FYGA 1GULA 2WS2A 2HSYA 3IDVA 3NZNA 4E8EA 4HU9A 4IS0A 1URMA 3APSA 1MD4A 2O8VB 4TXVA 2GS3A 2YANA 3TKPA 2RM6A 3FZAA 2XC2A 5F8BA 2LRTA 5B8BA 3D4MA 2H19A 1IYIA 1FVKA 3CTFA 2WCIA 4ECBA 4OFNA 2VCVA 5E4WA 1OYJA 2BJXA 5F06A 3QAWA 2CZ3A 5JCGA 2XHFA 1I5GA 2F8FA 1PQNA 2G0FA 3UIWA 5B7CA 1Q98A 5D9XA 2VIMA 1GP1A 3TJKA 3HA9A 2JZRA 3ZIVA 2YCDA 2B3SA 2G2QA 1XWAA 1U87A 1XCCA 1B48A 1PRXA 5DCHA 3DRNA 4PGTA 3RPPA 1ON4A 2IJYA 2D2ZA 3KD0A 4EDZA 4TR1B 1LU4A 5H5QA 6GSSA 3A3TA 2PMTA 1ACVA 2GDRA 2B5XA 1PGTA 2H01A 3GH9A 1ERTA 1SL2B 3DGQA 3IE3A 4D73B 1GSEA 5CAXA 2LQOA 3DXBA 2V32A 3IRAA 5DAKA 4JBBA 1EEJA 1ZL9A 1SKSB 3C1RA 4IW9A 3EMPA 1HNBA 3FZ9A 2OACA 1GH2A 3EYTA 3TOTA 4WXTA 2CZ2A 4JU5A 4I97A 4ML1A 2EIRA 1SENA 2LV3A 4K7IA 1ZCPA 2C0EA 2HXKA 3EVIA 2IMDA 3C8EA 3KH7A 2WZ9A 5KN3A 1XWBA 1Z7PA 2R5GA 4JE1A 1V58A 4MJAA 3WT1A 2H73A 3GN3A 2PWJA 3FK8A 3LEFA 2VL3A 4TKYA 3UJ1A 5AISA 2YV7A 4K9ZA 1NSWA 1A0RP 2H1AA 4KCAA 4L0WA 1TRVA 2DMLA 3EC3A 4O7HA 2A4VA 7GSSA 3MNGA 2IIYA 2HRFA 1K0NA 2BMXA 4XS4A 4DSSA 2NDOA 5IIZA 4L5OA 4WEYA 2TIRA 6GSWA 4IN0A 5D96A 3LWAA 4NPBA 4XRAA 2L4CA 3DWVA 3TB2A 3HJPA 4ZL7A 2LJKA 2C0DA 1QK8A 4XTSA 1T4ZA 4OO5A 4J57E 3GRXA 1Z7RA 1SJZA 2WULA 2DC5A 3CBUA 2HZEA 3ED3A 5ECOB 3KH9A 4IP1A 4MJBA 4PNGA 3QFAC 2P5QA 2NPBA 1AQXA 5ABRA 3KXOA 3WGXA 1U6TA 2KLXA 3M3MA 5GSSA 1G7OA 1FO5A 4IKHA 1GNWA 4RUVA 4F82A 4X0XA 3BBYA 11GSA 3APOA 3LXTA 4TR1A 4MZWA 1MDKA 4MA9A 1TDIA 3DVWA 3I43A 4LL4B 4AJ8A 3D0ZA 2CX4A 3KEBA 4TN8A 5IMVA 3DKSA 2C3TA 4HOJA 1DUGA 3M9JA 2OKAA 4FH8A 1J08A 1O7UA 2VO4A 1BJXA 4MJCA 4MH2A 2X8GA 2R2JA 3EURA 4WBRD 1K3YA 3ZVJA 3TJFA 4HI7A 2RUFA 1H4OA 4ECIA 2YJHA 1HNCA 1SK0A 4Q5RA 4QL7A 1T8EB 3GTUB 2VOCA 4G19A 3E0UA 5F0GA 3HZ4A 3HVXA 1KEBA 3VWVA 2ALBA 5CRDA 3A2XA 1RK4A 4MF7A 3ERGA 2LNSA 4ECCA 1EP8A 2K6VA 2VAFA 1PL1A 2FWGA 4KA0A 5L71A 2HFDA 3IBHA 5D9VA 2CX3A 3BCKA 1DSBA 4WF5A 2RLIA 1Y25A 2OBKA 3PH9A 1TOFA 5ECMB 3GKNA 4KX4A 1X9SB 2FHEA 2IFQB 2IMKA 3ZLPA 1XBSA 4N10A 2DJJA 1WPIA 4NAXA 2YP6A 5EY6A 5ECNB 1T1VA 4ID0A 3U6VA 1UVZA 2KOKA 2M72A 4N0VA 1FAAA 1F37A 4K7OA 2IMEA 5KN0A 3FW2A 1QUWA 5D9WA 1R5AA 1UC7A 3LYKA 5IQYA 3NOFA 1THOA 2DIZA 4EKZA 4K6XA 6GSVA 3GL5A 2HRNA 1HD2A 2AUVA 3G7YA 3LYPA 1GSDA 1VGLA 4MPGA 3H93A 1BAYA 3G7IA 2X8HA 4O32A 4F03A 5IPGA 2DJ3A 2WB9A 5CRGA 4OMVA 5G1LA 2YZHA 3APQA 2GGTA 1OC8A 5HFGA 2LS5A 2WRTA 4WETA 1XOBA 4EF0A 1MD3A 1VF3A 3MAKA 2O87A 2B1LA 2WJUA 1GSSA 4EDYA 4EC0A 3N9JA 3P8WA 2VCXA 3DYRA 5EPFA 1YJ6A 2B7JA 1PD21 1XXUA 5GAND 1S3AA 1DE2A 4ACSA 3JCML 3TKSC 2EC4A 2N5FA 3GSSA 3O76A 3CYNA 2H0HA 4MZCA 3GL3A 3ME7A 2VD0A 1O85A 3K8NA 2VM2A 1GWCA 4GSNA 2FA4A 2HSHA 3TJGA 5B6NA 1SK2A 2H8LA 2LKUA 4V2LA 3KGKA 1CQGA 4L0UA 4BWQA 1QQ2A 2R37A 1GL8A 4WBJA 2H72A 3ZL5A 5DJMA 1PX7A 2IMFA 16GSA 3VWUA 5ECLB 2IFQA 3KIJA 2ES7A 1SKWB 1O8XA 3L78A 4PUFC 2C3NA 3HY2A 1XOAA 1PKWA 3L4NA 5C00A 3TRPA 3UBKA 2YJ7A 3FEUA 4PUAA 2B6MA 4KE3A 1B4PA 2KHPA 3J7Yk 4GWRA 2A2RA 4K2DA
chains in the Genus database with same CATH superfamily
2GT5A 3IK9A 4FIWA 2Z9SA 2RIIA 5AIVA 3LORA 4BVXA 1JZRA 1TI3A 4IQ1A 5JCWA 2DLXA 4K0GA 2GSSA 4ZBBA 2GQKA 3O6TA 5J9CA 1ZYQB 2GZZA 5GSTA 4ECJA 2I3YA 1S3CA 3F8UA 4TXOA 5DAKB 1M2BA 1NW2A 3LGCA 1XVWA 1Z6MA 1E6BA 5F07A 1ST9A 3VPQA 3ZTLA 5FWGA 3LSZA 2H1GA 5A4WA 4BL7A 4HS1A 3F4TA 1QGVA 4N11A 3A5IA 3IHQA 1PL2A 1WIKA 22GSA 2GVPA 2H70A 3GFKA 1OE7A 3UAPA 2V1MA 19GSA 3EE2A 4XS1A 2C0GA 2PPTA 3D22A 1SJ6A 4KUNA 1AQWA 1THXA 4IJ3A 1PA3A 2DMMA 4XS4B 4DSSB 1FOVA 1QXHA 1GSUA 4HEA2 5DQSA 5EL8A 2MBSA 1JFUA 3I6AA 2H1BA 1ZMAA 1ILOA 2XPDA 4OCEA 2KP2A 4MCUA 1XFLA 5HFKA 2P5RA 2FD3A 2L59A 4H86A 1SU9A 2M46A 4BVYA 4HQSA 2JZSA 1OE8A 6GSYA 4ZB9A 2GLRA 2HZEB 2H1DA 4AGSA 1CQHA 1USBA 4GRFA 4FYCA 3AY8A 3VFIA 4KDXA 4LA1A 2O7KA 3HCZA 4CW9A 1A0FA 1U3AA 3QPMA 1K3LA 3SWLA 3QAGA 2GSTA 1G7EA 2FUG2 1XW6A 1GSYA 1PN9A 4NMUA 2LEGA 3IOSA 2RM5A 1R5PA 5G30A 1GTBA 1R4WA 1SYRA 1B4QA 3L0HA 1K0MA 2O89A 1ZGNA 4BA7A 2JADA 4J2FA 1TU7A 3QAVA 2C8UA 1A2MA 3QD9A 1OKDA 2R6KA 5ELAA 1A8YA 1E2YA 4OCFA 4QQ7A 3VWXA 1BEDA 1R26A 3ZIJA 9GSSA 3KP9A 1X0RA 1YQ1A 3W8JA 2HE3A 5COHA 4NXIA 2VLUA 1Q4JA 2BTOT 3HJMA 4GQCA 3UBLA 1ZOFA 3QDNA 3UEMA 1ABAA 3LJRA 1RQMA 8GSSA 4L8EA 4GSTA 5AIXA 3CXGA 3KCMA 1VRSD 2FGXA 3CTGA 4F0CA 1M3IA 5IPHA 1GRXA 5DCGA 4NV2A 1VF4A 3VI5A 1T4YA 3HXSA 2NVLA 4CHSA 1SD8A 5B6MA 1J0FA 5GZZB 6GSUA 2CQ9A 2YWMA 5CYYA 5IMCA 4AJ7A 1EOGA 2OADA 2PGTA 2H30A 1VF1A 5IMFA 1XWGA 3KJYA 3RAZA 3L9VA 1UA5A 3P2AA 1MDIA 4GQFA 2LTKA 2ON5A 4V2MA 3P7XA 1X5CA 3ERWA 1GLQA 1SL0B 2K9FA 1F6MC 4ZL9A 3WGEA 4EO3A 3CSIA 3A5WA 1GTAA 5ENUA 1WJKA 3IC4A 1Y6EA 2F9SA 4TRXA 4E8HA 1EV4A 1TK8B 4WF4A 1BX9A 3IAM2 5G5EA 3GKKA 3TUEA 5CREA 1XPVA 2OE0A 5D8IA 3L9SA 4PNFA 5BRTA 2CVBA 3LXZA 3O3TA 3VWWA 1A2LA 4K7NA 1MEKA 5CNWA 4EXJA 1YF1A 3F63A 4QL9A 2FLSA 4ZILA 4DEJA 4KDYA 2IWTA 3ERFA 1EOHA 4POBA 3RDWA 2M80A 3HDCA 4X1UA 1FB0A 2PUKC 3KZQA 4IQAA 2CT6A 4MP4A 4MJEA 3LFLA 5IM9A 4YQVA 1B9YC 2JZTA 1A8LA 1GNEA 3GIXA 3IPZA 2HT9A 4HZ2A 3IK7A 3CQFA 3GMFA 4K0NA 3L9UA 4NHZA 2MMNA 1IYHA 3ZITA 1BYEA 4Q5FA 4ZBDA 1JZDA 2J23A 3IR4A 4A5PA 3A2VA 5J3RA 1TI1A 3F6DA 4KGIA 3W8SA 1PKZA 1TTZA 3GX0A 1GUMA 1X5EA 5DDLA 3HVSA 2X49A 4XIHA 17GSA 1J9BA 1DE1A 2IMIA 1EWXA 3WD6A 3HHVA 1GTUA 2LNTA 3F4SA 3HYPA 3UL3A 3G9BA 4EE0A 4V1Ap 1XG8A 3DMLA 3FR6A 1WMJA 2VLTA 4YAVA 2F51A 5A4UA 3TRXA 3EINA 5IOWA 3TKQA 1WRYA 2LRCA 13GSA 1F9MA 2R3XA 5J4UA 4RI7A 5IMDA 1TK5B 1LJRA 3GNJA 4RQRA 1EGOA 3TOUA 3ZZXA 4IVFA 3GURA 2XPEA 1K0CA 2L5OA 3FR9A 4BVXB 2GZPA 4EIQA 5CRHA 2AAWA 4IBPA 2DSAA 3F6FA 4JEDA 1G6WA 2DJ1A 1XVQA 1AUCA 2MBTA 3UOMA 3KTLA 1XW5A 4G2EA 4TXOB 5A4VA 1MDJA 3LG6A 2AYTA 1PX6A 5FT3A 4LMWA 1MTCA 1VF2A 4LL1B 3E9JB 3VI7A 2K8VA 3KM6A 1GUHA 1OAZA 3VLNA 4GTUA 5ECPB 4TVEA 1XIYA 4BL7B 5F05A 3S9FA 1B9XC 5H5SA 4IJIA 2H0IA 2UZ8A 1A23A 4G10A 5IO2A 1K0DA 1ML6A 5KOWA 3G7JA 4PX1A 3RPNA 2DJKA 5IMZA 2AB6A 5CRWA 3RHBA 3EU4A 4HU7A 3CSJA 1M2AA 3PINA 1GUKA 4EL1A 1Z5YE 2H75A 3CRTA 2VCQA 2E2GA 1EZKA 2YOIA 2F8AA 1WWJA 3DVXA 4DSRA 1SK1A 4V1Ag 2L6DA 4IHUA 3KMOA 4XRDA 2JACA 4IGJA 14GSA 2DKHA 3E3EA 1SKRB 1TP9A 1O8WA 1ZYEA 4EVMA 3MYDA 2VLVA 2HYXA 1SD9A 2PVOC 3VK9A 4BVYB 4K8MA 4TR0A 2B5YA 2DIYA 2R0GA 3TCOA 1S3DA 4RI6A 1H75A 4TOPA 3C73A 4KH7A 2E0QA 4GXZA 4I8BA 1FOHA 1V9WA 2L4QA 1SYXA 4LMVA 1M0UA 2C3QA 1FB6A 2H71A 2B1KA 4HJMA 4HDEA 4MPFA 4MNNA 1YZXA 3TKRA 3D6IA 2VCZA 1TU8A 2WGRA 3PGTA 3H1NA 5D73A 1C72A 1K0AA 1I9DA 2A2PA 5CO3A 5IOXA 2B7KA 2AJQB 1GTIA 2YZUA 3HZ8A 1HNAA 2DBCA 4AF2A 2R0CA 1QMVA 4FYUA 3ZYWA 4I6XA 4V2NA 1FVJA 3EPTA 1KBNA 5ELGA 4KNDA 2A4HA 3DIEA 3Q74A 5DBQA 2HI7A 3DD3A 4P3YB 2P31A 4PURA 2X8CA 4N30A 4XCSA 2FWHA 2MMZA 3LQ7A 3QOUA 4HJ2A 5DALA 3FKFA 3UVHA 1V40A 2H6YA 2ON7A 3CRUA 4MMMA 3QFBC 5J5NA 1M7TA 4NWYA 4PXOA 1N2AA 3KP8A 1XW9A 2I1UA 2K8SA 4KSMA 5KN2A 3TGZA 1TRSA 2KP1A 4POMA 2CV4A 2CAIA 4GF0A 1Z6NA 4O5QA 4BPYA 2N5BA 4LLRA 2PVQA 4MZBA 5G5FA 3F0IA 4ML6A 2WFCA 4I2UA 1OC9A 1JZWA 3J7Yb 3ISOA 1GSFA 3D5JA 3GKMA 3H8QA 1ZZYA 3CMIA 3IV4A 2VD1A 5HQPA 3TJJA 2YWOA 2C4JA 2OA7A 3F3QA 5HR3A 1O81A 1EP7A 4MH3A 5ECIB 4MK3A 1GSQA 2VL9A 1A2JA 3I9V2 1TW9A 4XHMA 2FA8A 4CDOA 4F0BA 5AN1A 4F2IA 4YQUA 1AIUA 2GQMA 2LRNA 3F9UA 1A24A 5LCZA 4KCEA 3ZREA 5E59A 2CVKA 3GHAA 3WGDA 4O92A 4MF6A 1AC1A 2V6OA 2LUSA 3GSTA 3MWHA 1M3JA 3UARA 2AHEA 1EGRA 3VURA 4Z2TA 2GSQA 4MABA 2C1YA 1N8JA 1AAZA 3Q18A 2LSTA 3Q6OA 3HD5A 3H4KA 2O85A 2OE3A 3TRQA 2QKEA 4OO4A 4WR5A 3P90A 3CSHA 4X43A 2RUEA 4TW5A 5A5KA 1NM3A 1TJDA 2FWFA 2DJ2A 2I4AA 3EU3A 3F3RA 2TRCP 5D9TA 2IN3A 1JLWA 2B5EA 2VM1A 3DEXA 1PMTA 3FY7A 4J56E 5IO0A 3BOAA 4YKFA 3ZMKA 1M9AA 4HQZA 2PN8A 5G2ZA 3FZ4A 3N5OA 3FRCA 1PSQA 5ECKB 1ERVA 4KF9A 4N0ZA 4PQIA 2FY6A 4WR4A 3EMXA 5IMAA 1AW9A 4I5QA 1OKTA 4GCIA 3M8NA 3D21A 1LBKA 2V6KA 1O6JA 2C80A 5J41A 1YEXA 5ECHB 2E7PA 2ZUPA 1GLPA 2N5AA 4PQ1A 2JSYA 3IAS2 4WKWA 2H76A 3WT2A 1R7HA 5ID2A 1QFNA 4MDCA 3HVNA 5G31A 3ZVJD 2DJ0A 2PU9C 4ZL8A 5LD0A 1V98A 4RQXA 1W4VA 1OC3A 2L57A 3H79A 4L5LA 4K1FA 2JSZA 2L5LA 3FR3A 1EV9A 3TKSE 5ECSA 3ZMLA 3IXRA 1Z9HA 4POLA 2R4VA 3HJOA 3IC8A 4YH2A 1K0BA 3FZ5A 2DKIA 4DVCA 3SBCA 1FW1A 5EVOA 4TR4A 1TRUA 3FHKA 2OE1A 1K0OA 2VCTA 1TKDB 1YKAA 3ZFBA 5D93A 2MYGA 1SJIA 1FHEA 3V1WA 10GSA 2QC7A 4ILFA 3ZFLA 4KAEA 4G0LA 3TJBA 2GSRA 1YY7A 5GAPD 5HR2A 1G6YA 1T7PB 4HZ4A 2XBQA 1WE0A 5G1KA 3IA1A 20GSA 1ERWA 2QGVA 18GSA 2I81A 1AXDA 3F4RA 4PQHA 4ZBAA 3GA4A 5ECRB 1TRWA 3GYKA 1X5DA 4ULXA 4MF5A 2QA1A 4F9ZA 3BD2A 3QR6A 3PR8A 1V57A 4IELA 3C1SA 4KSOA 1S3RA 3M0FA 5B8AA 3RHCA 1DBYA 2PERA 2LQQA 3MIXA 1U88A 3C71A 3QMXA 5INYA 1B8XA 2MZCA 4D73A 4Q5NA 1EEMA 3HKRA 2YPMA 2AV4A 1XZOA 5C04A 3Q19A 4YAPA 2I9HA 4ZB6A 4JRRA 4Z2RA 2K18A 1XWCA 1KTEA 2XBIA 3GUSA 5H5RA 1TXXA 2NTOA 2ZCTA 2CA8A 4TR3A 5JCUA 2A2SA 1M2DA 3ME8A 2IL3A 2FCHA 5HR1A 1G0TA 1KNGA 5HFIA 4ZXGA 1BG5A 4I2TA 4OD7A 3W6GA 2YWNA 4NHWA 1ZYPA 2ZNMA 1BQ7A 1RW1A 3KTBA 2IPAA 4CY6A 2VUPA 3OR5A 5JWQB 1F2EA 2YV9A 2H66A 4ZB8A 1ERUA 3BCIA 2C0FA 3M9KA 3R2QA 2JL4A 4GSSA 4GLTA 12GSA 2OBIA 1SL1B 4YQMA 1ZYNA 1V2AA 4DSQA 2EIQA 2MMAA 4Q5QA 5DALB 2X4AA 2V41A 2QSIA 1Z3EA 1FG4A 2HZFA 2CAQA 1YF0A 2HLSA 3GV1A 2KUCA 2NBSA 2MMOA 1YEPA 4KDUA 1UN2A 5J9BA 4ISDA 4FO5A 5KN1A 2VCWA 3D4TA 1U3IA 2GQLA 4JR6A 1OC9B 4KB3A 2VL2C 2E2MA 3MSZA 3WYWA 1AQVA 3NIVA 3ZRDA 2CVDA 1X9WB 3KMNA 2EIOA 2OJLA 5DJLA 4G9HA 5DVBA 2H6ZA 6GSXA 1OVNA 3GTUA 3BJ5A 1NHOA 5ECQB 3UVTA 3MDKA 4AJ6A 4EUYA 4Z7XA 2QA2A 1TK0B 2JU5A 1HQOA 4JZQA 3GX8A 1WP0A 4CY8A 4KW6A 6GSTA 1XWKA 4XS6A 4NV5A 2REMA 2GTUA 4MLYA 2FWEA 5JWRB 3U5RE 5KEJA 2H6XA 3UMAA 3M1GA 3I69A 2LJAA 1M9BA 2LJRA 1T00A 3GKXA 1M99A 5CP1A 2X99A 4IP6A 1O73A 1F3AA 5LNKe 2FNOA 2YWIA 1JLVA 3TDGA 3US3A 5KOXA 5JWOB 3A2WA 5DQYA 4ZIJA 2GZYA 1JZOA 5HR0A 2YNXA 5FHIA 1HYUA 1JHBA 2F3MA 1F3BA 2J9HA 2H0GA 4FYBA 2H74A 2P0GA 4OFMA 4Z2UA 4BWSA 4O5RA 1X9MB 2WDUA 3C7MA 2VL2A 3HVVA 2YN1A 1K3OA 4K2XA 5AGYA 3TKSA 4HUAA 4JR4A 1YDKA 1NHYA 2V2GA 4OFTA 4POKA 3VPTA 2GT6A 5ID2B 2X64A 3RBTA 4EIPA 1T3BA 1W89A 4OWYA 2PBJA 2HNLA 1YKCA 4O5UA 2L6CA 1WOUA 3QCPA 3GH6A 3EWLA 2TRXA 3FYGA 1GULA 2WS2A 2HSYA 3IDVA 3NZNA 4E8EA 4HU9A 4IS0A 1URMA 3APSA 1MD4A 2O8VB 4TXVA 2GS3A 2YANA 3TKPA 2RM6A 3FZAA 2XC2A 5F8BA 4PTSA 2LRTA 5B8BA 3D4MA 2H19A 1IYIA 1FVKA 3CTFA 2WCIA 4ECBA 4OFNA 2VCVA 5E4WA 1OYJA 2BJXA 5F06A 3QAWA 2CZ3A 5JCGA 2HRAA 2XHFA 1I5GA 2F8FA 1PQNA 2G0FA 3UIWA 5B7CA 1Q98A 5D9XA 2VIMA 1GP1A 1PN0A 3TJKA 3HA9A 2JZRA 3ZIVA 2YCDA 2B3SA 2G2QA 1XWAA 1U87A 4BIKA 1XCCA 1B48A 1PRXA 5DCHA 3DRNA 4PGTA 3RPPA 1ON4A 2IJYA 2D2ZA 3KD0A 4EDZA 4TR1B 1LU4A 5H5QA 6GSSA 3A3TA 2PMTA 1ACVA 2GDRA 2B5XA 1PGTA 2H01A 3GH9A 1ERTA 1SL2B 3DGQA 3IE3A 4D73B 1GSEA 5CAXA 2LQOA 3DXBA 2V32A 3IRAA 5DAKA 4JBBA 1EEJA 1ZL9A 1SKSB 3C1RA 4IW9A 3EMPA 1HNBA 3FZ9A 2OACA 4FQUA 1GH2A 3EYTA 3TOTA 4K5RA 4WXTA 2CZ2A 4JU5A 4I97A 4ML1A 2EIRA 1SENA 2LV3A 4K7IA 1ZCPA 2C0EA 2HXKA 3EVIA 2IMDA 3C8EA 3KH7A 2WZ9A 5KN3A 1XWBA 1Z7PA 2R5GA 4JE1A 1V58A 4MJAA 3WT1A 2H73A 3GN3A 2PWJA 3FK8A 3LEFA 2VL3A 4TKYA 3UJ1A 5AISA 2YV7A 4K9ZA 1NSWA 1A0RP 2H1AA 4G0IA 4KCAA 4L0WA 1TRVA 2DMLA 3EC3A 4O7HA 2A4VA 7GSSA 3MNGA 2IIYA 2HRFA 1K0NA 2BMXA 4XS4A 4DSSA 2NDOA 5IIZA 4L5OA 4WEYA 2TIRA 6GSWA 4IN0A 5D96A 3LWAA 4NPBA 4XRAA 2L4CA 3DWVA 3TB2A 3HJPA 4ZL7A 2LJKA 2C0DA 1QK8A 4XTSA 1T4ZA 4OO5A 4J57E 3GRXA 4X4JA 1Z7RA 1SJZA 2WULA 2DC5A 3CBUA 2HZEA 3ED3A 5ECOB 3KH9A 4IP1A 4MJBA 4G0KA 4PNGA 3QFAC 2P5QA 2NPBA 1AQXA 5ABRA 3KXOA 3WGXA 1U6TA 2KLXA 3M3MA 5GSSA 1G7OA 1FO5A 4IKHA 1GNWA 4RUVA 4F82A 4X0XA 3BBYA 11GSA 3APOA 3LXTA 4TR1A 4MZWA 1MDKA 4MA9A 1TDIA 3DVWA 3I43A 4LL4B 4AJ8A 3FMWA 3D0ZA 2CX4A 3KEBA 4TN8A 5IMVA 3DKSA 2C3TA 4HOJA 1DUGA 3M9JA 2OKAA 4USSA 4FH8A 1J08A 1O7UA 2VO4A 1BJXA 4MJCA 4MH2A 2X8GA 2R2JA 3EURA 4WBRD 1K3YA 3ZVJA 3TJFA 4HI7A 2RUFA 1H4OA 4ECIA 2YJHA 1HNCA 1SK0A 4Q5RA 4QL7A 1T8EB 3GTUB 2VOCA 4G19A 3E0UA 5F0GA 3HZ4A 3HVXA 1KEBA 3VWVA 2ALBA 5CRDA 3A2XA 1RK4A 4MF7A 3ERGA 2LNSA 4ECCA 1EP8A 2K6VA 2VAFA 1PL1A 2FWGA 4KA0A 5L71A 4YKGA 2HFDA 3IBHA 5D9VA 2CX3A 3BCKA 1DSBA 4WF5A 2RLIA 1Y25A 2OBKA 3PH9A 3R3EA 1TOFA 5ECMB 3GKNA 4KX4A 1X9SB 2FHEA 2IFQB 2IMKA 3ZLPA 1XBSA 4N10A 2DJJA 1WPIA 4NAXA 2YP6A 5EY6A 5ECNB 1T1VA 4ID0A 4K5SA 3U6VA 1UVZA 4ICYA 2KOKA 2M72A 4N0VA 1FAAA 1F37A 4K7OA 2IMEA 5KN0A 3FW2A 1QUWA 5D9WA 1R5AA 1UC7A 2HSMA 3LYKA 3LW9A 5IQYA 3NOFA 1THOA 2DIZA 4EKZA 3PPUA 4K6XA 6GSVA 3GL5A 2HRNA 1HD2A 2AUVA 3G7YA 3LYPA 1GSDA 1VGLA 4MPGA 3H93A 1BAYA 3G7IA 2X8HA 4O32A 4F03A 5IPGA 5BMUA 2DJ3A 2WB9A 1PFOA 4OMVA 5CRGA 5G1LA 2YZHA 3APQA 2GGTA 1OC8A 5HFGA 2LS5A 2WRTA 4WETA 1XOBA 4EF0A 1MD3A 1VF3A 3MAKA 2O87A 2B1LA 2WJUA 4HSCX 1GSSA 4EDYA 4EC0A 3N9JA 3P8WA 2VCXA 3DYRA 5EPFA 1YJ6A 2B7JA 1PD21 1XXUA 5GAND 1S3AA 1DE2A 4ACSA 3JCML 3TKSC 2EC4A 2N5FA 3GSSA 3O76A 3CYNA 2HRKA 2H0HA 4MZCA 3GL3A 3ME7A 2VD0A 1O85A 3K8NA 2VM2A 1GWCA 4GSNA 2FA4A 2HSHA 3TJGA 5B6NA 2R0PA 1SK2A 2H8LA 2LKUA 4V2LA 3KGKA 1CQGA 4L0UA 4BWQA 1QQ2A 2R37A 1GL8A 4WBJA 2H72A 3ZL5A 5DJMA 1PX7A 2IMFA 16GSA 3VWUA 5ECLB 2IFQA 3KIJA 2ES7A 1SKWB 1O8XA 3L78A 4PUFC 2C3NA 3HY2A 1XOAA 1PKWA 3L4NA 5C00A 3TRPA 3UBKA 2YJ7A 3FEUA 4PUAA 2B6MA 3IHGA 1B4PA 4KE3A 2KHPA 3J7Yk 4GWRA 2A2RA 4K2DA
chains in the Genus database with same CATH topology
2GT5A 3IK9A 4FIWA 2Z9SA 2RIIA 5AIVA 3LORA 4BVXA 1JZRA 1TI3A 4IQ1A 5JCWA 2DLXA 4K0GA 2GSSA 4ZBBA 2GQKA 3O6TA 5J9CA 1ZYQB 2GZZA 5GSTA 4ECJA 2I3YA 1S3CA 3F8UA 4TXOA 5DAKB 1M2BA 1NW2A 3LGCA 1XVWA 1Z6MA 1E6BA 5F07A 1ST9A 3VPQA 3ZTLA 5FWGA 3LSZA 2H1GA 5A4WA 4BL7A 4HS1A 3F4TA 1QGVA 4N11A 3A5IA 3IHQA 1PL2A 1WIKA 22GSA 2GVPA 2H70A 3GFKA 1OE7A 3UAPA 2V1MA 19GSA 3EE2A 4XS1A 2C0GA 2PPTA 3D22A 1SJ6A 4KUNA 1AQWA 1THXA 4IJ3A 1PA3A 2DMMA 4XS4B 4DSSB 1FOVA 1QXHA 1GSUA 4HEA2 5DQSA 5EL8A 2MBSA 1JFUA 3I6AA 2H1BA 1ZMAA 1ILOA 2XPDA 4OCEA 2KP2A 4MCUA 1XFLA 5HFKA 2P5RA 2FD3A 2L59A 4H86A 1SU9A 2M46A 4BVYA 4HQSA 2JZSA 1OE8A 6GSYA 4ZB9A 2GLRA 2HZEB 2H1DA 4AGSA 1CQHA 1USBA 4GRFA 4FYCA 3AY8A 3VFIA 4KDXA 4LA1A 2O7KA 3HCZA 4CW9A 1A0FA 1U3AA 3QPMA 1K3LA 3SWLA 3QAGA 2GSTA 1G7EA 2FUG2 1XW6A 1GSYA 1PN9A 4NMUA 2LEGA 3IOSA 2RM5A 1R5PA 5G30A 1GTBA 1R4WA 1SYRA 1B4QA 3L0HA 1K0MA 2O89A 1ZGNA 4BA7A 2JADA 4J2FA 1TU7A 3QAVA 2C8UA 1A2MA 3QD9A 1OKDA 2R6KA 5ELAA 1A8YA 1E2YA 4OCFA 4QQ7A 3VWXA 1BEDA 1R26A 3ZIJA 9GSSA 3KP9A 1X0RA 1YQ1A 3W8JA 2HE3A 5COHA 4NXIA 2VLUA 1Q4JA 2BTOT 3HJMA 4GQCA 3UBLA 1ZOFA 3QDNA 3UEMA 1ABAA 3LJRA 1RQMA 8GSSA 4L8EA 4GSTA 5AIXA 3CXGA 3KCMA 1VRSD 2FGXA 3CTGA 4F0CA 5IPHA 1GRXA 5DCGA 4NV2A 1VF4A 3VI5A 1T4YA 3HXSA 2NVLA 4CHSA 1SD8A 5B6MA 1J0FA 5GZZB 6GSUA 2CQ9A 2YWMA 5CYYA 5IMCA 4AJ7A 1EOGA 2OADA 2PGTA 2H30A 1VF1A 5IMFA 1XWGA 3KJYA 3RAZA 3L9VA 1UA5A 3P2AA 1MDIA 4GQFA 2LTKA 2ON5A 4V2MA 3P7XA 1X5CA 3ERWA 1GLQA 1SL0B 2K9FA 1F6MC 4ZL9A 3WGEA 4EO3A 3CSIA 3A5WA 1GTAA 5ENUA 1WJKA 3IC4A 1Y6EA 2F9SA 4TRXA 4E8HA 1EV4A 1TK8B 4WF4A 1BX9A 3IAM2 5G5EA 3GKKA 3TUEA 5CREA 1XPVA 2OE0A 5D8IA 3L9SA 4PNFA 5BRTA 2CVBA 3LXZA 3O3TA 3VWWA 1A2LA 4K7NA 1MEKA 5CNWA 4EXJA 1YF1A 3F63A 4QL9A 2FLSA 4ZILA 4DEJA 4KDYA 2IWTA 3ERFA 1EOHA 4POBA 3RDWA 2M80A 3HDCA 4X1UA 1FB0A 2PUKC 3KZQA 4IQAA 2CT6A 4MP4A 4MJEA 3LFLA 5IM9A 4YQVA 1B9YC 2JZTA 1A8LA 1GNEA 3GIXA 3IPZA 2HT9A 4HZ2A 3IK7A 3GMFA 4K0NA 3L9UA 4NHZA 2MMNA 1IYHA 3ZITA 1BYEA 4Q5FA 4ZBDA 1JZDA 2J23A 3IR4A 4A5PA 3A2VA 5J3RA 1TI1A 3F6DA 4KGIA 3W8SA 1PKZA 1TTZA 3GX0A 1GUMA 1X5EA 5DDLA 3HVSA 2X49A 4XIHA 17GSA 1J9BA 1DE1A 2IMIA 1EWXA 3WD6A 3HHVA 1GTUA 2LNTA 3F4SA 3HYPA 3UL3A 3G9BA 4EE0A 4V1Ap 3DMLA 3FR6A 1WMJA 2VLTA 4YAVA 2F51A 5A4UA 3TRXA 3EINA 5IOWA 3TKQA 1WRYA 2LRCA 13GSA 1F9MA 2R3XA 5J4UA 4RI7A 5IMDA 1TK5B 1LJRA 3GNJA 4RQRA 1EGOA 3TOUA 3ZZXA 4IVFA 3GURA 2XPEA 1K0CA 2L5OA 3FR9A 4BVXB 2GZPA 4EIQA 5CRHA 2AAWA 4IBPA 2DSAA 3F6FA 4JEDA 1G6WA 2DJ1A 1XVQA 1AUCA 2MBTA 3UOMA 3KTLA 1XW5A 4G2EA 4TXOB 5A4VA 1MDJA 3LG6A 2AYTA 1PX6A 5FT3A 4LMWA 1MTCA 1VF2A 4LL1B 3E9JB 3VI7A 2K8VA 3KM6A 1GUHA 1OAZA 3VLNA 4GTUA 5ECPB 4TVEA 1XIYA 4BL7B 5F05A 3S9FA 1B9XC 5H5SA 4IJIA 2H0IA 2UZ8A 1A23A 4G10A 5IO2A 1K0DA 1ML6A 5KOWA 3G7JA 4PX1A 3RPNA 2DJKA 5IMZA 2AB6A 5CRWA 3RHBA 3EU4A 4HU7A 3CSJA 1M2AA 3PINA 1GUKA 4EL1A 1Z5YE 2H75A 3CRTA 2VCQA 2E2GA 1EZKA 2YOIA 2F8AA 1WWJA 3DVXA 4DSRA 1SK1A 4V1Ag 2L6DA 4IHUA 3KMOA 4XRDA 2JACA 4IGJA 14GSA 2DKHA 3E3EA 1SKRB 1TP9A 1O8WA 1ZYEA 4EVMA 3MYDA 2VLVA 2HYXA 1SD9A 2PVOC 3VK9A 4BVYB 4K8MA 4TR0A 2B5YA 2DIYA 2R0GA 3TCOA 1S3DA 4RI6A 1H75A 4TOPA 3C73A 4KH7A 2E0QA 4GXZA 4I8BA 1FOHA 1V9WA 2L4QA 1SYXA 4LMVA 1M0UA 2C3QA 1FB6A 2H71A 2B1KA 4HJMA 4HDEA 4MPFA 4MNNA 1YZXA 3TKRA 3D6IA 2VCZA 1TU8A 2WGRA 3PGTA 3H1NA 5D73A 1C72A 1K0AA 1I9DA 2A2PA 5CO3A 5IOXA 2B7KA 2AJQB 1GTIA 2YZUA 3HZ8A 1HNAA 2DBCA 4AF2A 2R0CA 1QMVA 4FYUA 3ZYWA 4I6XA 4V2NA 1FVJA 3EPTA 1KBNA 5ELGA 4KNDA 2A4HA 3DIEA 3Q74A 5DBQA 2HI7A 3DD3A 4P3YB 2P31A 4PURA 2X8CA 4N30A 4XCSA 2FWHA 2MMZA 3LQ7A 3QOUA 4HJ2A 5DALA 3FKFA 3UVHA 1V40A 2H6YA 2ON7A 3CRUA 4MMMA 3QFBC 5J5NA 1M7TA 4NWYA 4PXOA 1N2AA 3KP8A 1XW9A 2I1UA 2K8SA 4KSMA 5KN2A 3TGZA 1TRSA 2KP1A 4POMA 2CV4A 2CAIA 4GF0A 1Z6NA 4O5QA 4BPYA 2N5BA 4LLRA 2PVQA 4MZBA 5G5FA 3F0IA 4ML6A 2WFCA 4I2UA 1OC9A 1JZWA 3J7Yb 3ISOA 1GSFA 3D5JA 3GKMA 3H8QA 1ZZYA 3CMIA 3IV4A 2VD1A 5HQPA 3TJJA 2YWOA 2C4JA 2OA7A 3F3QA 5HR3A 1O81A 1EP7A 4MH3A 5ECIB 4MK3A 1GSQA 2VL9A 1A2JA 3I9V2 1TW9A 4XHMA 2FA8A 4CDOA 4F0BA 5AN1A 4F2IA 4YQUA 1AIUA 2GQMA 2LRNA 3F9UA 1A24A 5LCZA 4KCEA 3ZREA 5E59A 2CVKA 3GHAA 3WGDA 4O92A 4MF6A 1AC1A 2V6OA 2LUSA 3GSTA 3MWHA 3UARA 2AHEA 1EGRA 3VURA 4Z2TA 2GSQA 4MABA 2C1YA 1N8JA 1AAZA 3Q18A 2LSTA 3Q6OA 3HD5A 3H4KA 2O85A 2OE3A 3TRQA 2QKEA 4OO4A 4WR5A 3P90A 3CSHA 4X43A 2RUEA 4TW5A 5A5KA 1NM3A 1TJDA 2FWFA 2DJ2A 2I4AA 3EU3A 3F3RA 2TRCP 5D9TA 2IN3A 1JLWA 2B5EA 2VM1A 3DEXA 1PMTA 3FY7A 4J56E 5IO0A 3BOAA 4YKFA 3ZMKA 1M9AA 4HQZA 2PN8A 5G2ZA 3FZ4A 3N5OA 3FRCA 1PSQA 5ECKB 1ERVA 4KF9A 4N0ZA 4PQIA 2FY6A 4WR4A 3EMXA 5IMAA 1AW9A 4I5QA 1OKTA 4GCIA 3M8NA 3D21A 1LBKA 2V6KA 1O6JA 2C80A 5J41A 1YEXA 5ECHB 2E7PA 2ZUPA 1GLPA 2N5AA 4PQ1A 2JSYA 3IAS2 4WKWA 2H76A 3WT2A 1R7HA 5ID2A 1QFNA 4MDCA 5G31A 3ZVJD 2DJ0A 2PU9C 4ZL8A 5LD0A 1V98A 4RQXA 1W4VA 1OC3A 2L57A 3H79A 4L5LA 4K1FA 2JSZA 2L5LA 3FR3A 1EV9A 3TKSE 5ECSA 3ZMLA 3IXRA 1Z9HA 4POLA 2R4VA 3HJOA 3IC8A 4YH2A 1K0BA 3FZ5A 2DKIA 4DVCA 3SBCA 1FW1A 5EVOA 4TR4A 1TRUA 3FHKA 2OE1A 1K0OA 2VCTA 1TKDB 1YKAA 3ZFBA 5D93A 2MYGA 1SJIA 1FHEA 3V1WA 10GSA 2QC7A 4ILFA 3ZFLA 4KAEA 4G0LA 3TJBA 2GSRA 1YY7A 5GAPD 5HR2A 1G6YA 1T7PB 4HZ4A 2XBQA 1WE0A 5G1KA 3IA1A 20GSA 1ERWA 2QGVA 18GSA 2I81A 1AXDA 3F4RA 4PQHA 4ZBAA 3GA4A 5ECRB 1TRWA 3GYKA 1X5DA 4ULXA 4MF5A 2QA1A 4F9ZA 3BD2A 3QR6A 3PR8A 1V57A 4IELA 3C1SA 4KSOA 3M0FA 5B8AA 3RHCA 1DBYA 2PERA 2LQQA 3MIXA 1U88A 3C71A 3QMXA 5INYA 1B8XA 2MZCA 4D73A 4Q5NA 1EEMA 3HKRA 2YPMA 2AV4A 1XZOA 5C04A 3Q19A 4YAPA 2I9HA 4ZB6A 4JRRA 4Z2RA 2K18A 1XWCA 1KTEA 2XBIA 3GUSA 5H5RA 1TXXA 2NTOA 2ZCTA 2CA8A 4TR3A 5JCUA 2A2SA 1M2DA 3ME8A 2IL3A 2FCHA 5HR1A 1G0TA 1KNGA 5HFIA 4ZXGA 1BG5A 4I2TA 4OD7A 3W6GA 2YWNA 4NHWA 1ZYPA 2ZNMA 1BQ7A 1RW1A 3KTBA 2IPAA 4CY6A 2VUPA 3OR5A 5JWQB 1F2EA 2YV9A 2H66A 4ZB8A 1ERUA 3BCIA 2C0FA 3M9KA 3R2QA 2JL4A 4GSSA 4GLTA 12GSA 2OBIA 1SL1B 4YQMA 1ZYNA 1V2AA 4DSQA 2EIQA 2MMAA 4Q5QA 5DALB 2X4AA 2V41A 2QSIA 1Z3EA 1FG4A 2HZFA 2CAQA 1YF0A 2HLSA 3GV1A 2KUCA 2NBSA 2MMOA 1YEPA 4KDUA 1UN2A 5J9BA 4ISDA 4FO5A 5KN1A 2VCWA 3D4TA 1U3IA 2GQLA 4JR6A 1OC9B 4KB3A 2VL2C 2E2MA 3MSZA 3WYWA 1AQVA 3NIVA 3ZRDA 2CVDA 1X9WB 3KMNA 2EIOA 2OJLA 5DJLA 4G9HA 5DVBA 2H6ZA 6GSXA 1OVNA 3GTUA 3BJ5A 1NHOA 5ECQB 3UVTA 3MDKA 4AJ6A 4EUYA 4Z7XA 2QA2A 1TK0B 2JU5A 1HQOA 4JZQA 3GX8A 1WP0A 4CY8A 4KW6A 6GSTA 1XWKA 4XS6A 4NV5A 2REMA 2GTUA 4MLYA 2FWEA 5JWRB 3U5RE 5KEJA 2H6XA 3UMAA 3M1GA 3I69A 2LJAA 1M9BA 2LJRA 1T00A 3GKXA 1M99A 5CP1A 2X99A 4IP6A 1O73A 1F3AA 5LNKe 2FNOA 2YWIA 1JLVA 3TDGA 3US3A 5KOXA 5JWOB 3A2WA 5DQYA 4ZIJA 2GZYA 1JZOA 5HR0A 2YNXA 5FHIA 1HYUA 1JHBA 2F3MA 1F3BA 2J9HA 2H0GA 4FYBA 2H74A 2P0GA 4OFMA 4Z2UA 4BWSA 4O5RA 1X9MB 2WDUA 3C7MA 2VL2A 3HVVA 2YN1A 1K3OA 4K2XA 5AGYA 3TKSA 4HUAA 4JR4A 1YDKA 1NHYA 2V2GA 4OFTA 4POKA 3VPTA 2GT6A 5ID2B 2X64A 3RBTA 4EIPA 1T3BA 1W89A 4OWYA 2PBJA 2HNLA 1YKCA 4O5UA 2L6CA 1WOUA 3QCPA 3GH6A 3EWLA 2TRXA 3FYGA 1GULA 2WS2A 2HSYA 3IDVA 3NZNA 4E8EA 4HU9A 4IS0A 1URMA 3APSA 1MD4A 2O8VB 4TXVA 2GS3A 2YANA 3TKPA 2RM6A 3FZAA 2XC2A 5F8BA 4PTSA 2LRTA 5B8BA 3D4MA 2H19A 1IYIA 1FVKA 3CTFA 2WCIA 4ECBA 4OFNA 2VCVA 5E4WA 1OYJA 2BJXA 5F06A 3QAWA 2CZ3A 5JCGA 2HRAA 2XHFA 1I5GA 2F8FA 1PQNA 2G0FA 3UIWA 5B7CA 1Q98A 5D9XA 2VIMA 1GP1A 1PN0A 3TJKA 3HA9A 2JZRA 3ZIVA 2YCDA 2B3SA 2G2QA 1XWAA 1U87A 1XCCA 1B48A 1PRXA 5DCHA 3DRNA 4PGTA 3RPPA 1ON4A 2IJYA 2D2ZA 3KD0A 4EDZA 4TR1B 1LU4A 5H5QA 6GSSA 3A3TA 2PMTA 1ACVA 2GDRA 2B5XA 1PGTA 2H01A 3GH9A 1ERTA 1SL2B 3DGQA 3IE3A 4D73B 1GSEA 5CAXA 2LQOA 3DXBA 2V32A 3IRAA 5DAKA 4JBBA 1EEJA 1ZL9A 1SKSB 3C1RA 4IW9A 3EMPA 1HNBA 3FZ9A 2OACA 4FQUA 1GH2A 3EYTA 3TOTA 4K5RA 4WXTA 2CZ2A 4JU5A 4I97A 4ML1A 2EIRA 1SENA 2LV3A 4K7IA 1ZCPA 2C0EA 2HXKA 3EVIA 2IMDA 3C8EA 3KH7A 2WZ9A 5KN3A 1XWBA 1Z7PA 2R5GA 4JE1A 1V58A 4MJAA 3WT1A 2H73A 3GN3A 2PWJA 3FK8A 3LEFA 2VL3A 4TKYA 3UJ1A 5AISA 2YV7A 4K9ZA 1NSWA 1A0RP 2H1AA 4G0IA 4KCAA 4L0WA 1TRVA 2DMLA 3EC3A 4O7HA 2A4VA 7GSSA 3MNGA 2IIYA 2HRFA 1K0NA 2BMXA 4XS4A 4DSSA 2NDOA 5IIZA 4L5OA 4WEYA 2TIRA 6GSWA 4IN0A 5D96A 3LWAA 4NPBA 4XRAA 2L4CA 3DWVA 3TB2A 3HJPA 4ZL7A 2LJKA 2C0DA 1QK8A 4XTSA 1T4ZA 4OO5A 4J57E 3GRXA 4X4JA 1Z7RA 1SJZA 2WULA 2DC5A 3CBUA 2HZEA 3ED3A 5ECOB 3KH9A 4IP1A 4MJBA 4G0KA 4PNGA 3QFAC 2P5QA 2NPBA 1AQXA 5ABRA 3KXOA 3WGXA 1U6TA 2KLXA 3M3MA 5GSSA 1G7OA 1FO5A 4IKHA 1GNWA 4RUVA 4F82A 4X0XA 3BBYA 11GSA 3APOA 3LXTA 4TR1A 4MZWA 1MDKA 4MA9A 1TDIA 3DVWA 3I43A 4LL4B 4AJ8A 3FMWA 3D0ZA 2CX4A 3KEBA 4TN8A 5IMVA 3DKSA 2C3TA 4HOJA 1DUGA 3M9JA 2OKAA 4USSA 4FH8A 1J08A 1O7UA 2VO4A 1BJXA 4MJCA 4MH2A 2X8GA 2R2JA 3EURA 4WBRD 1K3YA 3ZVJA 3TJFA 4HI7A 2RUFA 1H4OA 4ECIA 2YJHA 1HNCA 1SK0A 4Q5RA 4QL7A 1T8EB 3GTUB 2VOCA 4G19A 3E0UA 5F0GA 3HZ4A 3HVXA 1KEBA 3VWVA 2ALBA 5CRDA 3A2XA 1RK4A 4MF7A 3ERGA 2LNSA 4ECCA 1EP8A 2K6VA 2VAFA 1PL1A 2FWGA 4KA0A 5L71A 4YKGA 2HFDA 3IBHA 5D9VA 2CX3A 3BCKA 1DSBA 4WF5A 2RLIA 1Y25A 2OBKA 3PH9A 3R3EA 1TOFA 5ECMB 3GKNA 4KX4A 1X9SB 2FHEA 2IFQB 2IMKA 3ZLPA 1XBSA 4N10A 2DJJA 1WPIA 4NAXA 2YP6A 5EY6A 5ECNB 1T1VA 4ID0A 4K5SA 3U6VA 1UVZA 4ICYA 2KOKA 2M72A 4N0VA 1FAAA 1F37A 4K7OA 2IMEA 5KN0A 3FW2A 1QUWA 5D9WA 1R5AA 1UC7A 2HSMA 3LYKA 3LW9A 5IQYA 3NOFA 1THOA 2DIZA 4EKZA 3PPUA 4K6XA 6GSVA 3GL5A 2HRNA 1HD2A 2AUVA 3G7YA 3LYPA 1GSDA 1VGLA 4MPGA 3H93A 1BAYA 3G7IA 2X8HA 4O32A 4F03A 5IPGA 5BMUA 2DJ3A 2WB9A 5CRGA 4OMVA 5G1LA 2YZHA 3APQA 2GGTA 1OC8A 5HFGA 2LS5A 2WRTA 4WETA 1XOBA 4EF0A 1MD3A 1VF3A 3MAKA 2O87A 2B1LA 2WJUA 1GSSA 4EDYA 4EC0A 3N9JA 3P8WA 2VCXA 3DYRA 5EPFA 1YJ6A 2B7JA 1PD21 1XXUA 5GAND 1S3AA 1DE2A 4ACSA 3JCML 3TKSC 2EC4A 2N5FA 3GSSA 3O76A 3CYNA 2HRKA 2H0HA 4MZCA 3GL3A 3ME7A 2VD0A 1O85A 3K8NA 2VM2A 1GWCA 4GSNA 2FA4A 2HSHA 3TJGA 5B6NA 2R0PA 1SK2A 2H8LA 2LKUA 4V2LA 3KGKA 1CQGA 4L0UA 4BWQA 1QQ2A 2R37A 1GL8A 4WBJA 2H72A 3ZL5A 5DJMA 1PX7A 2IMFA 16GSA 3VWUA 5ECLB 2IFQA 3KIJA 2ES7A 1SKWB 1O8XA 3L78A 4PUFC 2C3NA 3HY2A 1XOAA 1PKWA 3L4NA 5C00A 3TRPA 3UBKA 2YJ7A 3FEUA 4PUAA 2B6MA 3IHGA 1B4PA 4KE3A 2KHPA 3J7Yk 4GWRA 2A2RA 4K2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GT5 A;  3IK9 A;  4FIW A;  2Z9S A;  2RII A;  5AIV A;  3LOR A;  4BVX A;  1JZR A;  1TI3 A;  4IQ1 A;  5JCW A;  2DLX A;  4K0G A;  2GSS A;  4ZBB A;  2GQK A;  3O6T A;  5J9C A;  1ZYQ B;  2GZZ A;  5GST A;  4ECJ A;  2I3Y A;  1S3C A;  3F8U A;  4TXO A;  5DAK B;  1M2B A;  1NW2 A;  3LGC A;  1XVW A;  1Z6M A;  1E6B A;  5F07 A;  1ST9 A;  3VPQ A;  3ZTL A;  5FWG A;  3LSZ A;  2H1G A;  5A4W A;  4BL7 A;  4HS1 A;  3F4T A;  1QGV A;  4N11 A;  3IHQ A;  1PL2 A;  1WIK A;  22GS A;  2GVP A;  2H70 A;  3GFK A;  1OE7 A;  3UAP A;  2V1M A;  19GS A;  3EE2 A;  4XS1 A;  2C0G A;  2PPT A;  3D22 A;  1SJ6 A;  4KUN A;  1AQW A;  1THX A;  4IJ3 A;  1PA3 A;  2DMM A;  4XS4 B;  4DSS B;  1FOV A;  1QXH A;  1GSU A;  4HEA 2;  5EL8 A;  5DQS A;  2MBS A;  1JFU A;  3I6A A;  2H1B A;  1ZMA A;  1ILO A;  2XPD A;  4OCE A;  2KP2 A;  4MCU A;  1XFL A;  5HFK A;  2P5R A;  2FD3 A;  2L59 A;  4H86 A;  1SU9 A;  2M46 A;  4BVY A;  4HQS A;  2JZS A;  1OE8 A;  6GSY A;  4ZB9 A;  2GLR A;  2HZE B;  2H1D A;  4AGS A;  1CQH A;  1USB A;  4GRF A;  4FYC A;  3AY8 A;  3VFI A;  4KDX A;  4LA1 A;  2O7K A;  3HCZ A;  4CW9 A;  1A0F A;  1U3A A;  3QPM A;  1K3L A;  3SWL A;  3QAG A;  2GST A;  1G7E A;  2FUG 2;  1XW6 A;  1GSY A;  1PN9 A;  4NMU A;  2LEG A;  3IOS A;  2RM5 A;  1R5P A;  5G30 A;  1GTB A;  1R4W A;  1SYR A;  1B4Q A;  3L0H A;  1K0M A;  2O89 A;  1ZGN A;  4BA7 A;  2JAD A;  4J2F A;  1TU7 A;  3QAV A;  2C8U A;  1A2M A;  3QD9 A;  1OKD A;  2R6K A;  5ELA A;  1A8Y A;  1E2Y A;  4OCF A;  4QQ7 A;  3VWX A;  1BED A;  1R26 A;  3ZIJ A;  9GSS A;  3KP9 A;  1X0R A;  1YQ1 A;  3W8J A;  2HE3 A;  5COH A;  4NXI A;  2VLU A;  1Q4J A;  2BTO T;  3HJM A;  4GQC A;  3UBL A;  1ZOF A;  3QDN A;  3UEM A;  1ABA A;  3LJR A;  1RQM A;  8GSS A;  4L8E A;  4GST A;  5AIX A;  3CXG A;  3KCM A;  1VRS D;  2FGX A;  3CTG A;  4F0C A;  5IPH A;  1GRX A;  5DCG A;  4NV2 A;  1VF4 A;  3VI5 A;  1T4Y A;  3HXS A;  2NVL A;  4CHS A;  1SD8 A;  5B6M A;  1J0F A;  5GZZ B;  6GSU A;  2CQ9 A;  2YWM A;  5CYY A;  5IMC A;  4AJ7 A;  1EOG A;  2OAD A;  2PGT A;  2H30 A;  1VF1 A;  5IMF A;  1XWG A;  3KJY A;  3RAZ A;  3L9V A;  1UA5 A;  3P2A A;  1MDI A;  4GQF A;  2LTK A;  2ON5 A;  4V2M A;  3P7X A;  1X5C A;  3ERW A;  1GLQ A;  1SL0 B;  2K9F A;  1F6M C;  4ZL9 A;  3WGE A;  4EO3 A;  3CSI A;  3A5W A;  1GTA A;  5ENU A;  1WJK A;  3IC4 A;  1Y6E A;  2F9S A;  4TRX A;  4E8H A;  1EV4 A;  1TK8 B;  4WF4 A;  1BX9 A;  3IAM 2;  5G5E A;  3GKK A;  3TUE A;  5CRE A;  1XPV A;  2OE0 A;  5D8I A;  3L9S A;  4PNF A;  2CVB A;  3LXZ A;  3O3T A;  3VWW A;  1A2L A;  4K7N A;  1MEK A;  5CNW A;  4EXJ A;  1YF1 A;  3F63 A;  4QL9 A;  2FLS A;  4ZIL A;  4DEJ A;  4KDY A;  2IWT A;  3ERF A;  1EOH A;  4POB A;  3RDW A;  2M80 A;  3HDC A;  4X1U A;  1FB0 A;  2PUK C;  3KZQ A;  4IQA A;  2CT6 A;  4MP4 A;  4MJE A;  3LFL A;  5IM9 A;  4YQV A;  1B9Y C;  2JZT A;  1A8L A;  1GNE A;  3GIX A;  3IPZ A;  2HT9 A;  4HZ2 A;  3IK7 A;  3GMF A;  4K0N A;  3L9U A;  4NHZ A;  2MMN A;  1IYH A;  3ZIT A;  1BYE A;  4Q5F A;  4ZBD A;  1JZD A;  2J23 A;  3IR4 A;  3A2V A;  5J3R A;  1TI1 A;  3F6D A;  4KGI A;  3W8S A;  1PKZ A;  1TTZ A;  3GX0 A;  1GUM A;  1X5E A;  5DDL A;  3HVS A;  4XIH A;  17GS A;  1J9B A;  1DE1 A;  2IMI A;  1EWX A;  3WD6 A;  3HHV A;  1GTU A;  2LNT A;  3F4S A;  3HYP A;  3UL3 A;  3G9B A;  4EE0 A;  4V1A p;  3DML A;  3FR6 A;  1WMJ A;  2VLT A;  4YAV A;  2F51 A;  5A4U A;  3TRX A;  3EIN A;  5IOW A;  3TKQ A;  1WRY A;  2LRC A;  13GS A;  1F9M A;  2R3X A;  5J4U A;  4RI7 A;  5IMD A;  1TK5 B;  1LJR A;  3GNJ A;  4RQR A;  1EGO A;  3TOU A;  3ZZX A;  4IVF A;  3GUR A;  2XPE A;  1K0C A;  2L5O A;  3FR9 A;  2GZP A;  5CRH A;  2AAW A;  4IBP A;  2DSA A;  3F6F A;  4JED A;  1G6W A;  2DJ1 A;  1XVQ A;  1AUC A;  2MBT A;  3UOM A;  3KTL A;  1XW5 A;  4G2E A;  4TXO B;  5A4V A;  1MDJ A;  3LG6 A;  2AYT A;  1PX6 A;  5FT3 A;  4LMW A;  1MTC A;  1VF2 A;  4LL1 B;  3E9J B;  3VI7 A;  2K8V A;  3KM6 A;  1GUH A;  1OAZ A;  3VLN A;  4GTU A;  5ECP B;  4TVE A;  1XIY A;  5F05 A;  3S9F A;  1B9X C;  5H5S A;  4IJI A;  2H0I A;  1A23 A;  4G10 A;  5IO2 A;  1K0D A;  1ML6 A;  3G7J A;  4PX1 A;  3RPN A;  2DJK A;  5IMZ A;  2AB6 A;  5CRW A;  3RHB A;  3EU4 A;  4HU7 A;  3CSJ A;  1M2A A;  3PIN A;  1GUK A;  4EL1 A;  1Z5Y E;  2H75 A;  3CRT A;  2VCQ A;  2E2G A;  1EZK A;  2YOI A;  2F8A A;  1WWJ A;  3DVX A;  4DSR A;  1SK1 A;  4V1A g;  2L6D A;  4IHU A;  3KMO A;  4XRD A;  2JAC A;  4IGJ A;  14GS A;  3E3E A;  1SKR B;  1TP9 A;  1O8W A;  1ZYE A;  4EVM A;  2VLV A;  2HYX A;  1SD9 A;  2PVO C;  3VK9 A;  4K8M A;  4TR0 A;  2B5Y A;  2DIY A;  3TCO A;  1S3D A;  4RI6 A;  1H75 A;  4TOP A;  3C73 A;  4KH7 A;  2E0Q A;  4GXZ A;  4I8B A;  1V9W A;  2L4Q A;  1SYX A;  4LMV A;  1M0U A;  2C3Q A;  1FB6 A;  2H71 A;  2B1K A;  4HJM A;  4HDE A;  4MPF A;  1YZX A;  3TKR A;  3D6I A;  2VCZ A;  1TU8 A;  2WGR A;  3PGT A;  3H1N A;  5D73 A;  1C72 A;  1K0A A;  1I9D A;  5CO3 A;  5IOX A;  2B7K A;  2AJQ B;  1GTI A;  2YZU A;  3HZ8 A;  1HNA A;  2DBC A;  4AF2 A;  1QMV A;  4FYU A;  3ZYW A;  4I6X A;  4V2N A;  1FVJ A;  1KBN A;  5ELG A;  4KND A;  3DIE A;  3Q74 A;  5DBQ A;  2HI7 A;  3DD3 A;  4P3Y B;  2P31 A;  4PUR A;  2X8C A;  4N30 A;  4XCS A;  2FWH A;  2MMZ A;  3LQ7 A;  3QOU A;  4HJ2 A;  5DAL A;  3FKF A;  3UVH A;  1V40 A;  2H6Y A;  2ON7 A;  3CRU A;  4MMM A;  3QFB C;  5J5N A;  1M7T A;  4NWY A;  4PXO A;  1N2A A;  3KP8 A;  1XW9 A;  2I1U A;  2K8S A;  4KSM A;  5KN2 A;  3TGZ A;  1TRS A;  2KP1 A;  4POM A;  2CV4 A;  2CAI A;  4GF0 A;  1Z6N A;  4BPY A;  2N5B A;  4LLR A;  2PVQ A;  4MZB A;  5G5F A;  3F0I A;  4ML6 A;  2WFC A;  4I2U A;  1OC9 A;  1JZW A;  3J7Y b;  3ISO A;  1GSF A;  3D5J A;  3GKM A;  3H8Q A;  1ZZY A;  3CMI A;  3IV4 A;  2VD1 A;  5HQP A;  3TJJ A;  2YWO A;  2C4J A;  2OA7 A;  3F3Q A;  5HR3 A;  1O81 A;  1EP7 A;  4MH3 A;  5ECI B;  4MK3 A;  1GSQ A;  2VL9 A;  1A2J A;  3I9V 2;  1TW9 A;  4XHM A;  2FA8 A;  4CDO A;  4F0B A;  5AN1 A;  4F2I A;  4YQU A;  1AIU A;  2GQM A;  2LRN A;  3F9U A;  1A24 A;  5LCZ A;  4KCE A;  3ZRE A;  5E59 A;  2CVK A;  3GHA A;  3WGD A;  4O92 A;  4MF6 A;  1AC1 A;  2V6O A;  2LUS A;  3GST A;  3MWH A;  3UAR A;  2AHE A;  1EGR A;  3VUR A;  2GSQ A;  4MAB A;  2C1Y A;  1N8J A;  1AAZ A;  3Q18 A;  2LST A;  3Q6O A;  3HD5 A;  3H4K A;  2O85 A;  2OE3 A;  3TRQ A;  2QKE A;  4OO4 A;  4WR5 A;  3P90 A;  3CSH A;  4X43 A;  2RUE A;  4TW5 A;  5A5K A;  1NM3 A;  1TJD A;  2FWF A;  2DJ2 A;  2I4A A;  3EU3 A;  3F3R A;  2TRC P;  5D9T A;  2IN3 A;  1JLW A;  2B5E A;  2VM1 A;  3DEX A;  1PMT A;  3FY7 A;  4J56 E;  5IO0 A;  3BOA A;  3ZMK A;  1M9A A;  4HQZ A;  2PN8 A;  5G2Z A;  3FZ4 A;  3N5O A;  3FRC A;  1PSQ A;  5ECK B;  1ERV A;  4N0Z A;  4PQI A;  2FY6 A;  4WR4 A;  3EMX A;  5IMA A;  1AW9 A;  4I5Q A;  1OKT A;  4GCI A;  3M8N A;  3D21 A;  1LBK A;  2V6K A;  1O6J A;  2C80 A;  5J41 A;  1YEX A;  5ECH B;  2E7P A;  2ZUP A;  1GLP A;  2N5A A;  4PQ1 A;  2JSY A;  3IAS 2;  4WKW A;  2H76 A;  3WT2 A;  1R7H A;  5ID2 A;  1QFN A;  4MDC A;  5G31 A;  3ZVJ D;  2DJ0 A;  2PU9 C;  4ZL8 A;  5LD0 A;  1V98 A;  4RQX A;  1W4V A;  1OC3 A;  2L57 A;  3H79 A;  4L5L A;  4K1F A;  2JSZ A;  2L5L A;  3FR3 A;  1EV9 A;  3TKS E;  5ECS A;  3ZML A;  3IXR A;  1Z9H A;  4POL A;  2R4V A;  3HJO A;  4YH2 A;  1K0B A;  3FZ5 A;  4DVC A;  3SBC A;  1FW1 A;  5EVO A;  4TR4 A;  1TRU A;  3FHK A;  2OE1 A;  1K0O A;  2VCT A;  1TKD B;  1YKA A;  3ZFB A;  5D93 A;  2MYG A;  1SJI A;  1FHE A;  3V1W A;  10GS A;  2QC7 A;  4ILF A;  3ZFL A;  4KAE A;  3TJB A;  2GSR A;  1YY7 A;  5GAP D;  5HR2 A;  1G6Y A;  1T7P B;  4HZ4 A;  2XBQ A;  1WE0 A;  5G1K A;  3IA1 A;  20GS A;  1ERW A;  2QGV A;  18GS A;  2I81 A;  1AXD A;  3F4R A;  4PQH A;  4ZBA A;  3GA4 A;  5ECR B;  1TRW A;  3GYK A;  1X5D A;  4ULX A;  4MF5 A;  4F9Z A;  3BD2 A;  3QR6 A;  3PR8 A;  1V57 A;  4IEL A;  3C1S A;  4KSO A;  3M0F A;  5B8A A;  3RHC A;  1DBY A;  2PER A;  2LQQ A;  1U88 A;  3C71 A;  3QMX A;  5INY A;  1B8X A;  2MZC A;  4D73 A;  4Q5N A;  1EEM A;  3HKR A;  2YPM A;  2AV4 A;  1XZO A;  5C04 A;  3Q19 A;  4YAP A;  2I9H A;  4ZB6 A;  4JRR A;  2K18 A;  1XWC A;  1KTE A;  2XBI A;  3GUS A;  5H5R A;  1TXX A;  2NTO A;  2ZCT A;  2CA8 A;  4TR3 A;  5JCU A;  2A2S A;  1M2D A;  3ME8 A;  2IL3 A;  2FCH A;  5HR1 A;  1G0T A;  1KNG A;  5HFI A;  4ZXG A;  1BG5 A;  4I2T A;  4OD7 A;  3W6G A;  2YWN A;  4NHW A;  2ZNM A;  1BQ7 A;  1RW1 A;  3KTB A;  2IPA A;  2VUP A;  3OR5 A;  5JWQ B;  1F2E A;  2YV9 A;  2H66 A;  4ZB8 A;  1ERU A;  3BCI A;  2C0F A;  3M9K A;  3R2Q A;  2JL4 A;  4GSS A;  4GLT A;  12GS A;  2OBI A;  1SL1 B;  4YQM A;  1V2A A;  4DSQ A;  2EIQ A;  2MMA A;  4Q5Q A;  5DAL B;  2V41 A;  2QSI A;  1Z3E A;  1FG4 A;  2HZF A;  2CAQ A;  1YF0 A;  2HLS A;  3GV1 A;  2KUC A;  2NBS A;  2MMO A;  1YEP A;  4KDU A;  1UN2 A;  5J9B A;  4ISD A;  4FO5 A;  5KN1 A;  2VCW A;  3D4T A;  1U3I A;  2GQL A;  4JR6 A;  1OC9 B;  4KB3 A;  2VL2 C;  2E2M A;  3MSZ A;  3WYW A;  1AQV A;  3NIV A;  3ZRD A;  2CVD A;  1X9W B;  3KMN A;  2EIO A;  5DJL A;  2OJL A;  4G9H A;  5DVB A;  2H6Z A;  6GSX A;  1OVN A;  3GTU A;  3BJ5 A;  1NHO A;  5ECQ B;  3UVT A;  3MDK A;  4AJ6 A;  4EUY A;  4Z7X A;  1TK0 B;  2JU5 A;  1HQO A;  4JZQ A;  3GX8 A;  1WP0 A;  4KW6 A;  6GST A;  1XWK A;  4XS6 A;  4NV5 A;  2REM A;  2GTU A;  4MLY A;  2FWE A;  5JWR B;  3U5R E;  5KEJ A;  2H6X A;  3UMA A;  3M1G A;  3I69 A;  2LJA A;  1M9B A;  2LJR A;  1T00 A;  3GKX A;  1M99 A;  5CP1 A;  2X99 A;  4IP6 A;  1O73 A;  1F3A A;  5LNK e;  2FNO A;  2YWI A;  1JLV A;  3TDG A;  3US3 A;  5JWO B;  3A2W A;  5DQY A;  4ZIJ A;  2GZY A;  1JZO A;  5HR0 A;  2YNX A;  5FHI A;  1HYU A;  1JHB A;  2F3M A;  1F3B A;  2J9H A;  2H0G A;  4FYB A;  2H74 A;  2P0G A;  4OFM A;  4BWS A;  4O5R A;  1X9M B;  2WDU A;  3C7M A;  2VL2 A;  3HVV A;  2YN1 A;  1K3O A;  5AGY A;  3TKS A;  4HUA A;  4JR4 A;  1YDK A;  1NHY A;  2V2G A;  4OFT A;  4POK A;  3VPT A;  2GT6 A;  5ID2 B;  2X64 A;  3RBT A;  1T3B A;  1W89 A;  4OWY A;  2PBJ A;  2HNL A;  1YKC A;  2L6C A;  1WOU A;  3QCP A;  3GH6 A;  3EWL A;  2TRX A;  3FYG A;  1GUL A;  2WS2 A;  2HSY A;  3IDV A;  3NZN A;  4E8E A;  4HU9 A;  4IS0 A;  1URM A;  3APS A;  1MD4 A;  2O8V B;  4TXV A;  2GS3 A;  2YAN A;  3TKP A;  2RM6 A;  3FZA A;  2XC2 A;  5F8B A;  2LRT A;  5B8B A;  3D4M A;  2H19 A;  1IYI A;  1FVK A;  3CTF A;  2WCI A;  4ECB A;  4OFN A;  2VCV A;  5E4W A;  1OYJ A;  2BJX A;  5F06 A;  3QAW A;  2CZ3 A;  5JCG A;  2XHF A;  1I5G A;  2F8F A;  1PQN A;  2G0F A;  3UIW A;  5B7C A;  1Q98 A;  5D9X A;  2VIM A;  1GP1 A;  3TJK A;  3HA9 A;  2JZR A;  3ZIV A;  2YCD A;  2B3S A;  2G2Q A;  1XWA A;  1U87 A;  1XCC A;  1B48 A;  1PRX A;  5DCH A;  3DRN A;  4PGT A;  3RPP A;  1ON4 A;  2IJY A;  2D2Z A;  3KD0 A;  4EDZ A;  4TR1 B;  1LU4 A;  5H5Q A;  6GSS A;  3A3T A;  2PMT A;  1ACV A;  2GDR A;  2B5X A;  1PGT A;  2H01 A;  3GH9 A;  1ERT A;  1SL2 B;  3DGQ A;  3IE3 A;  4D73 B;  1GSE A;  5CAX A;  2LQO A;  3DXB A;  2V32 A;  3IRA A;  5DAK A;  4JBB A;  1EEJ A;  1ZL9 A;  1SKS B;  3C1R A;  4IW9 A;  3EMP A;  1HNB A;  3FZ9 A;  2OAC A;  1GH2 A;  3EYT A;  3TOT A;  4WXT A;  2CZ2 A;  4JU5 A;  4I97 A;  4ML1 A;  2EIR A;  1SEN A;  2LV3 A;  4K7I A;  1ZCP A;  2C0E A;  2HXK A;  3EVI A;  2IMD A;  3C8E A;  3KH7 A;  2WZ9 A;  5KN3 A;  1XWB A;  1Z7P A;  2R5G A;  4JE1 A;  1V58 A;  4MJA A;  3WT1 A;  2H73 A;  3GN3 A;  2PWJ A;  3FK8 A;  3LEF A;  2VL3 A;  4TKY A;  3UJ1 A;  5AIS A;  2YV7 A;  4K9Z A;  1NSW A;  1A0R P;  2H1A A;  4KCA A;  4L0W A;  1TRV A;  2DML A;  3EC3 A;  4O7H A;  2A4V A;  7GSS A;  3MNG A;  2IIY A;  2HRF A;  1K0N A;  2BMX A;  4XS4 A;  4DSS A;  2NDO A;  5IIZ A;  4L5O A;  4WEY A;  2TIR A;  6GSW A;  4IN0 A;  5D96 A;  3LWA A;  4NPB A;  4XRA A;  2L4C A;  3DWV A;  3TB2 A;  3HJP A;  4ZL7 A;  2LJK A;  2C0D A;  1QK8 A;  4XTS A;  1T4Z A;  4OO5 A;  4J57 E;  3GRX A;  1Z7R A;  1SJZ A;  2WUL A;  2DC5 A;  3CBU A;  2HZE A;  3ED3 A;  5ECO B;  3KH9 A;  4IP1 A;  4MJB A;  4PNG A;  3QFA C;  2P5Q A;  2NPB A;  1AQX A;  5ABR A;  3KXO A;  3WGX A;  1U6T A;  2KLX A;  3M3M A;  5GSS A;  1G7O A;  1FO5 A;  4IKH A;  1GNW A;  4RUV A;  4F82 A;  4X0X A;  3BBY A;  11GS A;  3APO A;  3LXT A;  4TR1 A;  4MZW A;  1MDK A;  4MA9 A;  1TDI A;  3DVW A;  3I43 A;  4LL4 B;  4AJ8 A;  3D0Z A;  2CX4 A;  3KEB A;  4TN8 A;  5IMV A;  3DKS A;  2C3T A;  4HOJ A;  1DUG A;  3M9J A;  2OKA A;  4FH8 A;  1J08 A;  1O7U A;  2VO4 A;  1BJX A;  4MJC A;  4MH2 A;  2X8G A;  2R2J A;  3EUR A;  4WBR D;  1K3Y A;  3ZVJ A;  3TJF A;  4HI7 A;  2RUF A;  1H4O A;  4ECI A;  2YJH A;  1HNC A;  1SK0 A;  4Q5R A;  4QL7 A;  1T8E B;  3GTU B;  2VOC A;  4G19 A;  3E0U A;  5F0G A;  3HZ4 A;  3HVX A;  1KEB A;  3VWV A;  2ALB A;  5CRD A;  3A2X A;  1RK4 A;  4MF7 A;  3ERG A;  2LNS A;  4ECC A;  1EP8 A;  2K6V A;  2VAF A;  1PL1 A;  2FWG A;  4KA0 A;  5L71 A;  2HFD A;  3IBH A;  5D9V A;  2CX3 A;  3BCK A;  1DSB A;  4WF5 A;  2RLI A;  1Y25 A;  2OBK A;  3PH9 A;  1TOF A;  5ECM B;  3GKN A;  4KX4 A;  1X9S B;  2FHE A;  2IFQ B;  2IMK A;  3ZLP A;  1XBS A;  4N10 A;  2DJJ A;  1WPI A;  4NAX A;  2YP6 A;  5EY6 A;  5ECN B;  1T1V A;  4ID0 A;  3U6V A;  1UVZ A;  2KOK A;  2M72 A;  4N0V A;  1FAA A;  1F37 A;  4K7O A;  2IME A;  5KN0 A;  3FW2 A;  1QUW A;  5D9W A;  1R5A A;  1UC7 A;  3LYK A;  5IQY A;  3NOF A;  1THO A;  2DIZ A;  4EKZ A;  4K6X A;  6GSV A;  3GL5 A;  2HRN A;  1HD2 A;  2AUV A;  3G7Y A;  3LYP A;  1GSD A;  1VGL A;  4MPG A;  3H93 A;  1BAY A;  3G7I A;  2X8H A;  4O32 A;  4F03 A;  5IPG A;  2DJ3 A;  2WB9 A;  5CRG A;  4OMV A;  5G1L A;  2YZH A;  3APQ A;  2GGT A;  1OC8 A;  5HFG A;  2LS5 A;  2WRT A;  4WET A;  1XOB A;  4EF0 A;  1MD3 A;  1VF3 A;  3MAK A;  2O87 A;  2B1L A;  2WJU A;  1GSS A;  4EDY A;  4EC0 A;  3N9J A;  3P8W A;  2VCX A;  3DYR A;  5EPF A;  1YJ6 A;  2B7J A;  1PD2 1;  1XXU A;  5GAN D;  1S3A A;  1DE2 A;  4ACS A;  3JCM L;  3TKS C;  2EC4 A;  2N5F A;  3GSS A;  3O76 A;  3CYN A;  2H0H A;  4MZC A;  3GL3 A;  3ME7 A;  2VD0 A;  1O85 A;  3K8N A;  2VM2 A;  1GWC A;  4GSN A;  2FA4 A;  2HSH A;  3TJG A;  5B6N A;  1SK2 A;  2H8L A;  2LKU A;  4V2L A;  3KGK A;  1CQG A;  4L0U A;  4BWQ A;  1QQ2 A;  2R37 A;  1GL8 A;  4WBJ A;  2H72 A;  3ZL5 A;  5DJM A;  1PX7 A;  2IMF A;  16GS A;  3VWU A;  5ECL B;  2IFQ A;  3KIJ A;  2ES7 A;  1SKW B;  1O8X A;  3L78 A;  4PUF C;  2C3N A;  3HY2 A;  1XOA A;  1PKW A;  3L4N A;  5C00 A;  3TRP A;  3UBK A;  2YJ7 A;  3FEU A;  4PUA A;  2B6M A;  4KE3 A;  1B4P A;  2KHP A;  3J7Y k;  4GWR A;  2A2R A;  4K2D A; 
#chains in the Genus database with same CATH topology
 2GT5 A;  3IK9 A;  4FIW A;  2Z9S A;  2RII A;  5AIV A;  3LOR A;  4BVX A;  1JZR A;  1TI3 A;  4IQ1 A;  5JCW A;  2DLX A;  4K0G A;  2GSS A;  4ZBB A;  2GQK A;  3O6T A;  5J9C A;  1ZYQ B;  2GZZ A;  5GST A;  4ECJ A;  2I3Y A;  1S3C A;  3F8U A;  4TXO A;  5DAK B;  1M2B A;  1NW2 A;  3LGC A;  1XVW A;  1Z6M A;  1E6B A;  5F07 A;  1ST9 A;  3VPQ A;  3ZTL A;  5FWG A;  3LSZ A;  2H1G A;  5A4W A;  4BL7 A;  4HS1 A;  3F4T A;  1QGV A;  4N11 A;  3A5I A;  3IHQ A;  1PL2 A;  1WIK A;  22GS A;  2GVP A;  2H70 A;  3GFK A;  1OE7 A;  3UAP A;  2V1M A;  19GS A;  3EE2 A;  4XS1 A;  2C0G A;  2PPT A;  3D22 A;  1SJ6 A;  4KUN A;  1AQW A;  1THX A;  4IJ3 A;  1PA3 A;  2DMM A;  4XS4 B;  4DSS B;  1FOV A;  1QXH A;  1GSU A;  4HEA 2;  5DQS A;  5EL8 A;  2MBS A;  1JFU A;  3I6A A;  2H1B A;  1ZMA A;  1ILO A;  2XPD A;  4OCE A;  2KP2 A;  4MCU A;  1XFL A;  5HFK A;  2P5R A;  2FD3 A;  2L59 A;  4H86 A;  1SU9 A;  2M46 A;  4BVY A;  4HQS A;  2JZS A;  1OE8 A;  6GSY A;  4ZB9 A;  2GLR A;  2HZE B;  2H1D A;  4AGS A;  1CQH A;  1USB A;  4GRF A;  4FYC A;  3AY8 A;  3VFI A;  4KDX A;  4LA1 A;  2O7K A;  3HCZ A;  4CW9 A;  1A0F A;  1U3A A;  3QPM A;  1K3L A;  3SWL A;  3QAG A;  2GST A;  1G7E A;  2FUG 2;  1XW6 A;  1GSY A;  1PN9 A;  4NMU A;  2LEG A;  3IOS A;  2RM5 A;  1R5P A;  5G30 A;  1GTB A;  1R4W A;  1SYR A;  1B4Q A;  3L0H A;  1K0M A;  2O89 A;  1ZGN A;  4BA7 A;  2JAD A;  4J2F A;  1TU7 A;  3QAV A;  2C8U A;  1A2M A;  3QD9 A;  1OKD A;  2R6K A;  5ELA A;  1A8Y A;  1E2Y A;  4OCF A;  4QQ7 A;  3VWX A;  1BED A;  1R26 A;  3ZIJ A;  9GSS A;  3KP9 A;  1X0R A;  1YQ1 A;  3W8J A;  2HE3 A;  5COH A;  4NXI A;  2VLU A;  1Q4J A;  2BTO T;  3HJM A;  4GQC A;  3UBL A;  1ZOF A;  3QDN A;  3UEM A;  1ABA A;  3LJR A;  1RQM A;  8GSS A;  4L8E A;  4GST A;  5AIX A;  3CXG A;  3KCM A;  1VRS D;  2FGX A;  3CTG A;  4F0C A;  1M3I A;  5IPH A;  1GRX A;  5DCG A;  4NV2 A;  1VF4 A;  3VI5 A;  1T4Y A;  3HXS A;  2NVL A;  4CHS A;  1SD8 A;  5B6M A;  1J0F A;  5GZZ B;  6GSU A;  2CQ9 A;  2YWM A;  5CYY A;  5IMC A;  4AJ7 A;  1EOG A;  2OAD A;  2PGT A;  2H30 A;  1VF1 A;  5IMF A;  1XWG A;  3KJY A;  3RAZ A;  3L9V A;  1UA5 A;  3P2A A;  1MDI A;  4GQF A;  2LTK A;  2ON5 A;  4V2M A;  3P7X A;  1X5C A;  3ERW A;  1GLQ A;  1SL0 B;  2K9F A;  1F6M C;  4ZL9 A;  3WGE A;  4EO3 A;  3CSI A;  3A5W A;  1GTA A;  5ENU A;  1WJK A;  3IC4 A;  1Y6E A;  2F9S A;  4TRX A;  4E8H A;  1EV4 A;  1TK8 B;  4WF4 A;  1BX9 A;  3IAM 2;  5G5E A;  3GKK A;  3TUE A;  5CRE A;  1XPV A;  2OE0 A;  5D8I A;  3L9S A;  4PNF A;  5BRT A;  2CVB A;  3LXZ A;  3O3T A;  3VWW A;  1A2L A;  4K7N A;  1MEK A;  5CNW A;  4EXJ A;  1YF1 A;  3F63 A;  4QL9 A;  2FLS A;  4ZIL A;  4DEJ A;  4KDY A;  2IWT A;  3ERF A;  1EOH A;  4POB A;  3RDW A;  2M80 A;  3HDC A;  4X1U A;  1FB0 A;  2PUK C;  3KZQ A;  4IQA A;  2CT6 A;  4MP4 A;  4MJE A;  3LFL A;  5IM9 A;  4YQV A;  1B9Y C;  2JZT A;  1A8L A;  1GNE A;  3GIX A;  3IPZ A;  2HT9 A;  4HZ2 A;  3IK7 A;  3CQF A;  3GMF A;  4K0N A;  3L9U A;  4NHZ A;  2MMN A;  1IYH A;  3ZIT A;  1BYE A;  4Q5F A;  4ZBD A;  1JZD A;  2J23 A;  3IR4 A;  4A5P A;  3A2V A;  5J3R A;  1TI1 A;  3F6D A;  4KGI A;  3W8S A;  1PKZ A;  1TTZ A;  3GX0 A;  1GUM A;  1X5E A;  5DDL A;  3HVS A;  2X49 A;  4XIH A;  17GS A;  1J9B A;  1DE1 A;  2IMI A;  1EWX A;  3WD6 A;  3HHV A;  1GTU A;  2LNT A;  3F4S A;  3HYP A;  3UL3 A;  3G9B A;  4EE0 A;  4V1A p;  1XG8 A;  3DML A;  3FR6 A;  1WMJ A;  2VLT A;  4YAV A;  2F51 A;  5A4U A;  3TRX A;  3EIN A;  5IOW A;  3TKQ A;  1WRY A;  2LRC A;  13GS A;  1F9M A;  2R3X A;  5J4U A;  4RI7 A;  5IMD A;  1TK5 B;  1LJR A;  3GNJ A;  4RQR A;  1EGO A;  3TOU A;  3ZZX A;  4IVF A;  3GUR A;  2XPE A;  1K0C A;  2L5O A;  3FR9 A;  4BVX B;  2GZP A;  4EIQ A;  5CRH A;  2AAW A;  4IBP A;  2DSA A;  3F6F A;  4JED A;  1G6W A;  2DJ1 A;  1XVQ A;  1AUC A;  2MBT A;  3UOM A;  3KTL A;  1XW5 A;  4G2E A;  4TXO B;  5A4V A;  1MDJ A;  3LG6 A;  2AYT A;  1PX6 A;  5FT3 A;  4LMW A;  1MTC A;  1VF2 A;  4LL1 B;  3E9J B;  3VI7 A;  2K8V A;  3KM6 A;  1GUH A;  1OAZ A;  3VLN A;  4GTU A;  5ECP B;  4TVE A;  1XIY A;  4BL7 B;  5F05 A;  3S9F A;  1B9X C;  5H5S A;  4IJI A;  2H0I A;  2UZ8 A;  1A23 A;  4G10 A;  5IO2 A;  1K0D A;  1ML6 A;  5KOW A;  3G7J A;  4PX1 A;  3RPN A;  2DJK A;  5IMZ A;  2AB6 A;  5CRW A;  3RHB A;  3EU4 A;  4HU7 A;  3CSJ A;  1M2A A;  3PIN A;  1GUK A;  4EL1 A;  1Z5Y E;  2H75 A;  3CRT A;  2VCQ A;  2E2G A;  1EZK A;  2YOI A;  2F8A A;  1WWJ A;  3DVX A;  4DSR A;  1SK1 A;  4V1A g;  2L6D A;  4IHU A;  3KMO A;  4XRD A;  2JAC A;  4IGJ A;  14GS A;  2DKH A;  3E3E A;  1SKR B;  1TP9 A;  1O8W A;  1ZYE A;  4EVM A;  3MYD A;  2VLV A;  2HYX A;  1SD9 A;  2PVO C;  3VK9 A;  4BVY B;  4K8M A;  4TR0 A;  2B5Y A;  2DIY A;  2R0G A;  3TCO A;  1S3D A;  4RI6 A;  1H75 A;  4TOP A;  3C73 A;  4KH7 A;  2E0Q A;  4GXZ A;  4I8B A;  1FOH A;  1V9W A;  2L4Q A;  1SYX A;  4LMV A;  1M0U A;  2C3Q A;  1FB6 A;  2H71 A;  2B1K A;  4HJM A;  4HDE A;  4MPF A;  4MNN A;  1YZX A;  3TKR A;  3D6I A;  2VCZ A;  1TU8 A;  2WGR A;  3PGT A;  3H1N A;  5D73 A;  1C72 A;  1K0A A;  1I9D A;  2A2P A;  5CO3 A;  5IOX A;  2B7K A;  2AJQ B;  1GTI A;  2YZU A;  3HZ8 A;  1HNA A;  2DBC A;  4AF2 A;  2R0C A;  1QMV A;  4FYU A;  3ZYW A;  4I6X A;  4V2N A;  1FVJ A;  3EPT A;  1KBN A;  5ELG A;  4KND A;  2A4H A;  3DIE A;  3Q74 A;  5DBQ A;  2HI7 A;  3DD3 A;  4P3Y B;  2P31 A;  4PUR A;  2X8C A;  4N30 A;  4XCS A;  2FWH A;  2MMZ A;  3LQ7 A;  3QOU A;  4HJ2 A;  5DAL A;  3FKF A;  3UVH A;  1V40 A;  2H6Y A;  2ON7 A;  3CRU A;  4MMM A;  3QFB C;  5J5N A;  1M7T A;  4NWY A;  4PXO A;  1N2A A;  3KP8 A;  1XW9 A;  2I1U A;  2K8S A;  4KSM A;  5KN2 A;  3TGZ A;  1TRS A;  2KP1 A;  4POM A;  2CV4 A;  2CAI A;  4GF0 A;  1Z6N A;  4O5Q A;  4BPY A;  2N5B A;  4LLR A;  2PVQ A;  4MZB A;  5G5F A;  3F0I A;  4ML6 A;  2WFC A;  4I2U A;  1OC9 A;  1JZW A;  3J7Y b;  3ISO A;  1GSF A;  3D5J A;  3GKM A;  3H8Q A;  1ZZY A;  3CMI A;  3IV4 A;  2VD1 A;  5HQP A;  3TJJ A;  2YWO A;  2C4J A;  2OA7 A;  3F3Q A;  5HR3 A;  1O81 A;  1EP7 A;  4MH3 A;  5ECI B;  4MK3 A;  1GSQ A;  2VL9 A;  1A2J A;  3I9V 2;  1TW9 A;  4XHM A;  2FA8 A;  4CDO A;  4F0B A;  5AN1 A;  4F2I A;  4YQU A;  1AIU A;  2GQM A;  2LRN A;  3F9U A;  1A24 A;  5LCZ A;  4KCE A;  3ZRE A;  5E59 A;  2CVK A;  3GHA A;  3WGD A;  4O92 A;  4MF6 A;  1AC1 A;  2V6O A;  2LUS A;  3GST A;  3MWH A;  1M3J A;  3UAR A;  2AHE A;  1EGR A;  3VUR A;  4Z2T A;  2GSQ A;  4MAB A;  2C1Y A;  1N8J A;  1AAZ A;  3Q18 A;  2LST A;  3Q6O A;  3HD5 A;  3H4K A;  2O85 A;  2OE3 A;  3TRQ A;  2QKE A;  4OO4 A;  4WR5 A;  3P90 A;  3CSH A;  4X43 A;  2RUE A;  4TW5 A;  5A5K A;  1NM3 A;  1TJD A;  2FWF A;  2DJ2 A;  2I4A A;  3EU3 A;  3F3R A;  2TRC P;  5D9T A;  2IN3 A;  1JLW A;  2B5E A;  2VM1 A;  3DEX A;  1PMT A;  3FY7 A;  4J56 E;  5IO0 A;  3BOA A;  4YKF A;  3ZMK A;  1M9A A;  4HQZ A;  2PN8 A;  5G2Z A;  3FZ4 A;  3N5O A;  3FRC A;  1PSQ A;  5ECK B;  1ERV A;  4KF9 A;  4N0Z A;  4PQI A;  2FY6 A;  4WR4 A;  3EMX A;  5IMA A;  1AW9 A;  4I5Q A;  1OKT A;  4GCI A;  3M8N A;  3D21 A;  1LBK A;  2V6K A;  1O6J A;  2C80 A;  5J41 A;  1YEX A;  5ECH B;  2E7P A;  2ZUP A;  1GLP A;  2N5A A;  4PQ1 A;  2JSY A;  3IAS 2;  4WKW A;  2H76 A;  3WT2 A;  1R7H A;  5ID2 A;  1QFN A;  4MDC A;  3HVN A;  5G31 A;  3ZVJ D;  2DJ0 A;  2PU9 C;  4ZL8 A;  5LD0 A;  1V98 A;  4RQX A;  1W4V A;  1OC3 A;  2L57 A;  3H79 A;  4L5L A;  4K1F A;  2JSZ A;  2L5L A;  3FR3 A;  1EV9 A;  3TKS E;  5ECS A;  3ZML A;  3IXR A;  1Z9H A;  4POL A;  2R4V A;  3HJO A;  3IC8 A;  4YH2 A;  1K0B A;  3FZ5 A;  2DKI A;  4DVC A;  3SBC A;  1FW1 A;  5EVO A;  4TR4 A;  1TRU A;  3FHK A;  2OE1 A;  1K0O A;  2VCT A;  1TKD B;  1YKA A;  3ZFB A;  5D93 A;  2MYG A;  1SJI A;  1FHE A;  3V1W A;  10GS A;  2QC7 A;  4ILF A;  3ZFL A;  4KAE A;  4G0L A;  3TJB A;  2GSR A;  1YY7 A;  5GAP D;  5HR2 A;  1G6Y A;  1T7P B;  4HZ4 A;  2XBQ A;  1WE0 A;  5G1K A;  3IA1 A;  20GS A;  1ERW A;  2QGV A;  18GS A;  2I81 A;  1AXD A;  3F4R A;  4PQH A;  4ZBA A;  3GA4 A;  5ECR B;  1TRW A;  3GYK A;  1X5D A;  4ULX A;  4MF5 A;  2QA1 A;  4F9Z A;  3BD2 A;  3QR6 A;  3PR8 A;  1V57 A;  4IEL A;  3C1S A;  4KSO A;  1S3R A;  3M0F A;  5B8A A;  3RHC A;  1DBY A;  2PER A;  2LQQ A;  3MIX A;  1U88 A;  3C71 A;  3QMX A;  5INY A;  1B8X A;  2MZC A;  4D73 A;  4Q5N A;  1EEM A;  3HKR A;  2YPM A;  2AV4 A;  1XZO A;  5C04 A;  3Q19 A;  4YAP A;  2I9H A;  4ZB6 A;  4JRR A;  4Z2R A;  2K18 A;  1XWC A;  1KTE A;  2XBI A;  3GUS A;  5H5R A;  1TXX A;  2NTO A;  2ZCT A;  2CA8 A;  4TR3 A;  5JCU A;  2A2S A;  1M2D A;  3ME8 A;  2IL3 A;  2FCH A;  5HR1 A;  1G0T A;  1KNG A;  5HFI A;  4ZXG A;  1BG5 A;  4I2T A;  4OD7 A;  3W6G A;  2YWN A;  4NHW A;  1ZYP A;  2ZNM A;  1BQ7 A;  1RW1 A;  3KTB A;  2IPA A;  4CY6 A;  2VUP A;  3OR5 A;  5JWQ B;  1F2E A;  2YV9 A;  2H66 A;  4ZB8 A;  1ERU A;  3BCI A;  2C0F A;  3M9K A;  3R2Q A;  2JL4 A;  4GSS A;  4GLT A;  12GS A;  2OBI A;  1SL1 B;  4YQM A;  1ZYN A;  1V2A A;  4DSQ A;  2EIQ A;  2MMA A;  4Q5Q A;  5DAL B;  2X4A A;  2V41 A;  2QSI A;  1Z3E A;  1FG4 A;  2HZF A;  2CAQ A;  1YF0 A;  2HLS A;  3GV1 A;  2KUC A;  2NBS A;  2MMO A;  1YEP A;  4KDU A;  1UN2 A;  5J9B A;  4ISD A;  4FO5 A;  5KN1 A;  2VCW A;  3D4T A;  1U3I A;  2GQL A;  4JR6 A;  1OC9 B;  4KB3 A;  2VL2 C;  2E2M A;  3MSZ A;  3WYW A;  1AQV A;  3NIV A;  3ZRD A;  2CVD A;  1X9W B;  3KMN A;  2EIO A;  2OJL A;  5DJL A;  4G9H A;  5DVB A;  2H6Z A;  6GSX A;  1OVN A;  3GTU A;  3BJ5 A;  1NHO A;  5ECQ B;  3UVT A;  3MDK A;  4AJ6 A;  4EUY A;  4Z7X A;  2QA2 A;  1TK0 B;  2JU5 A;  1HQO A;  4JZQ A;  3GX8 A;  1WP0 A;  4CY8 A;  4KW6 A;  6GST A;  1XWK A;  4XS6 A;  4NV5 A;  2REM A;  2GTU A;  4MLY A;  2FWE A;  5JWR B;  3U5R E;  5KEJ A;  2H6X A;  3UMA A;  3M1G A;  3I69 A;  2LJA A;  1M9B A;  2LJR A;  1T00 A;  3GKX A;  1M99 A;  5CP1 A;  2X99 A;  4IP6 A;  1O73 A;  1F3A A;  5LNK e;  2FNO A;  2YWI A;  1JLV A;  3TDG A;  3US3 A;  5KOX A;  5JWO B;  3A2W A;  5DQY A;  4ZIJ A;  2GZY A;  1JZO A;  5HR0 A;  2YNX A;  5FHI A;  1HYU A;  1JHB A;  2F3M A;  1F3B A;  2J9H A;  2H0G A;  4FYB A;  2H74 A;  2P0G A;  4OFM A;  4Z2U A;  4BWS A;  4O5R A;  1X9M B;  2WDU A;  3C7M A;  2VL2 A;  3HVV A;  2YN1 A;  1K3O A;  4K2X A;  5AGY A;  3TKS A;  4HUA A;  4JR4 A;  1YDK A;  1NHY A;  2V2G A;  4OFT A;  4POK A;  3VPT A;  2GT6 A;  5ID2 B;  2X64 A;  3RBT A;  4EIP A;  1T3B A;  1W89 A;  4OWY A;  2PBJ A;  2HNL A;  1YKC A;  4O5U A;  2L6C A;  1WOU A;  3QCP A;  3GH6 A;  3EWL A;  2TRX A;  3FYG A;  1GUL A;  2WS2 A;  2HSY A;  3IDV A;  3NZN A;  4E8E A;  4HU9 A;  4IS0 A;  1URM A;  3APS A;  1MD4 A;  2O8V B;  4TXV A;  2GS3 A;  2YAN A;  3TKP A;  2RM6 A;  3FZA A;  2XC2 A;  5F8B A;  4PTS A;  2LRT A;  5B8B A;  3D4M A;  2H19 A;  1IYI A;  1FVK A;  3CTF A;  2WCI A;  4ECB A;  4OFN A;  2VCV A;  5E4W A;  1OYJ A;  2BJX A;  5F06 A;  3QAW A;  2CZ3 A;  5JCG A;  2HRA A;  2XHF A;  1I5G A;  2F8F A;  1PQN A;  2G0F A;  3UIW A;  5B7C A;  1Q98 A;  5D9X A;  2VIM A;  1GP1 A;  1PN0 A;  3TJK A;  3HA9 A;  2JZR A;  3ZIV A;  2YCD A;  2B3S A;  2G2Q A;  1XWA A;  1U87 A;  4BIK A;  1XCC A;  1B48 A;  1PRX A;  5DCH A;  3DRN A;  4PGT A;  3RPP A;  1ON4 A;  2IJY A;  2D2Z A;  3KD0 A;  4EDZ A;  4TR1 B;  1LU4 A;  5H5Q A;  6GSS A;  3A3T A;  2PMT A;  1ACV A;  2GDR A;  2B5X A;  1PGT A;  2H01 A;  3GH9 A;  1ERT A;  1SL2 B;  3DGQ A;  3IE3 A;  4D73 B;  1GSE A;  5CAX A;  2LQO A;  3DXB A;  2V32 A;  3IRA A;  5DAK A;  4JBB A;  1EEJ A;  1ZL9 A;  1SKS B;  3C1R A;  4IW9 A;  3EMP A;  1HNB A;  3FZ9 A;  2OAC A;  4FQU A;  1GH2 A;  3EYT A;  3TOT A;  4K5R A;  4WXT A;  2CZ2 A;  4JU5 A;  4I97 A;  4ML1 A;  2EIR A;  1SEN A;  2LV3 A;  4K7I A;  1ZCP A;  2C0E A;  2HXK A;  3EVI A;  2IMD A;  3C8E A;  3KH7 A;  2WZ9 A;  5KN3 A;  1XWB A;  1Z7P A;  2R5G A;  4JE1 A;  1V58 A;  4MJA A;  3WT1 A;  2H73 A;  3GN3 A;  2PWJ A;  3FK8 A;  3LEF A;  2VL3 A;  4TKY A;  3UJ1 A;  5AIS A;  2YV7 A;  4K9Z A;  1NSW A;  1A0R P;  2H1A A;  4G0I A;  4KCA A;  4L0W A;  1TRV A;  2DML A;  3EC3 A;  4O7H A;  2A4V A;  7GSS A;  3MNG A;  2IIY A;  2HRF A;  1K0N A;  2BMX A;  4XS4 A;  4DSS A;  2NDO A;  5IIZ A;  4L5O A;  4WEY A;  2TIR A;  6GSW A;  4IN0 A;  5D96 A;  3LWA A;  4NPB A;  4XRA A;  2L4C A;  3DWV A;  3TB2 A;  3HJP A;  4ZL7 A;  2LJK A;  2C0D A;  1QK8 A;  4XTS A;  1T4Z A;  4OO5 A;  4J57 E;  3GRX A;  4X4J A;  1Z7R A;  1SJZ A;  2WUL A;  2DC5 A;  3CBU A;  2HZE A;  3ED3 A;  5ECO B;  3KH9 A;  4IP1 A;  4MJB A;  4G0K A;  4PNG A;  3QFA C;  2P5Q A;  2NPB A;  1AQX A;  5ABR A;  3KXO A;  3WGX A;  1U6T A;  2KLX A;  3M3M A;  5GSS A;  1G7O A;  1FO5 A;  4IKH A;  1GNW A;  4RUV A;  4F82 A;  4X0X A;  3BBY A;  11GS A;  3APO A;  3LXT A;  4TR1 A;  4MZW A;  1MDK A;  4MA9 A;  1TDI A;  3DVW A;  3I43 A;  4LL4 B;  4AJ8 A;  3FMW A;  3D0Z A;  2CX4 A;  3KEB A;  4TN8 A;  5IMV A;  3DKS A;  2C3T A;  4HOJ A;  1DUG A;  3M9J A;  2OKA A;  4USS A;  4FH8 A;  1J08 A;  1O7U A;  2VO4 A;  1BJX A;  4MJC A;  4MH2 A;  2X8G A;  2R2J A;  3EUR A;  4WBR D;  1K3Y A;  3ZVJ A;  3TJF A;  4HI7 A;  2RUF A;  1H4O A;  4ECI A;  2YJH A;  1HNC A;  1SK0 A;  4Q5R A;  4QL7 A;  1T8E B;  3GTU B;  2VOC A;  4G19 A;  3E0U A;  5F0G A;  3HZ4 A;  3HVX A;  1KEB A;  3VWV A;  2ALB A;  5CRD A;  3A2X A;  1RK4 A;  4MF7 A;  3ERG A;  2LNS A;  4ECC A;  1EP8 A;  2K6V A;  2VAF A;  1PL1 A;  2FWG A;  4KA0 A;  5L71 A;  4YKG A;  2HFD A;  3IBH A;  5D9V A;  2CX3 A;  3BCK A;  1DSB A;  4WF5 A;  2RLI A;  1Y25 A;  2OBK A;  3PH9 A;  3R3E A;  1TOF A;  5ECM B;  3GKN A;  4KX4 A;  1X9S B;  2FHE A;  2IFQ B;  2IMK A;  3ZLP A;  1XBS A;  4N10 A;  2DJJ A;  1WPI A;  4NAX A;  2YP6 A;  5EY6 A;  5ECN B;  1T1V A;  4ID0 A;  4K5S A;  3U6V A;  1UVZ A;  4ICY A;  2KOK A;  2M72 A;  4N0V A;  1FAA A;  1F37 A;  4K7O A;  2IME A;  5KN0 A;  3FW2 A;  1QUW A;  5D9W A;  1R5A A;  1UC7 A;  2HSM A;  3LYK A;  3LW9 A;  5IQY A;  3NOF A;  1THO A;  2DIZ A;  4EKZ A;  3PPU A;  4K6X A;  6GSV A;  3GL5 A;  2HRN A;  1HD2 A;  2AUV A;  3G7Y A;  3LYP A;  1GSD A;  1VGL A;  4MPG A;  3H93 A;  1BAY A;  3G7I A;  2X8H A;  4O32 A;  4F03 A;  5IPG A;  5BMU A;  2DJ3 A;  2WB9 A;  1PFO A;  4OMV A;  5CRG A;  5G1L A;  2YZH A;  3APQ A;  2GGT A;  1OC8 A;  5HFG A;  2LS5 A;  2WRT A;  4WET A;  1XOB A;  4EF0 A;  1MD3 A;  1VF3 A;  3MAK A;  2O87 A;  2B1L A;  2WJU A;  4HSC X;  1GSS A;  4EDY A;  4EC0 A;  3N9J A;  3P8W A;  2VCX A;  3DYR A;  5EPF A;  1YJ6 A;  2B7J A;  1PD2 1;  1XXU A;  5GAN D;  1S3A A;  1DE2 A;  4ACS A;  3JCM L;  3TKS C;  2EC4 A;  2N5F A;  3GSS A;  3O76 A;  3CYN A;  2HRK A;  2H0H A;  4MZC A;  3GL3 A;  3ME7 A;  2VD0 A;  1O85 A;  3K8N A;  2VM2 A;  1GWC A;  4GSN A;  2FA4 A;  2HSH A;  3TJG A;  5B6N A;  2R0P A;  1SK2 A;  2H8L A;  2LKU A;  4V2L A;  3KGK A;  1CQG A;  4L0U A;  4BWQ A;  1QQ2 A;  2R37 A;  1GL8 A;  4WBJ A;  2H72 A;  3ZL5 A;  5DJM A;  1PX7 A;  2IMF A;  16GS A;  3VWU A;  5ECL B;  2IFQ A;  3KIJ A;  2ES7 A;  1SKW B;  1O8X A;  3L78 A;  4PUF C;  2C3N A;  3HY2 A;  1XOA A;  1PKW A;  3L4N A;  5C00 A;  3TRP A;  3UBK A;  2YJ7 A;  3FEU A;  4PUA A;  2B6M A;  3IHG A;  1B4P A;  4KE3 A;  2KHP A;  3J7Y k;  4GWR A;  2A2R A;  4K2D A; 
#chains in the Genus database with same CATH homology
 2GT5 A;  3IK9 A;  4FIW A;  2Z9S A;  2RII A;  5AIV A;  3LOR A;  4BVX A;  1JZR A;  1TI3 A;  4IQ1 A;  5JCW A;  2DLX A;  4K0G A;  2GSS A;  4ZBB A;  2GQK A;  3O6T A;  5J9C A;  1ZYQ B;  2GZZ A;  5GST A;  4ECJ A;  2I3Y A;  1S3C A;  3F8U A;  4TXO A;  5DAK B;  1M2B A;  1NW2 A;  3LGC A;  1XVW A;  1Z6M A;  1E6B A;  5F07 A;  1ST9 A;  3VPQ A;  3ZTL A;  5FWG A;  3LSZ A;  2H1G A;  5A4W A;  4BL7 A;  4HS1 A;  3F4T A;  1QGV A;  4N11 A;  3A5I A;  3IHQ A;  1PL2 A;  1WIK A;  22GS A;  2GVP A;  2H70 A;  3GFK A;  1OE7 A;  3UAP A;  2V1M A;  19GS A;  3EE2 A;  4XS1 A;  2C0G A;  2PPT A;  3D22 A;  1SJ6 A;  4KUN A;  1AQW A;  1THX A;  4IJ3 A;  1PA3 A;  2DMM A;  4XS4 B;  4DSS B;  1FOV A;  1QXH A;  1GSU A;  4HEA 2;  5DQS A;  5EL8 A;  2MBS A;  1JFU A;  3I6A A;  2H1B A;  1ZMA A;  1ILO A;  2XPD A;  4OCE A;  2KP2 A;  4MCU A;  1XFL A;  5HFK A;  2P5R A;  2FD3 A;  2L59 A;  4H86 A;  1SU9 A;  2M46 A;  4BVY A;  4HQS A;  2JZS A;  1OE8 A;  6GSY A;  4ZB9 A;  2GLR A;  2HZE B;  2H1D A;  4AGS A;  1CQH A;  1USB A;  4GRF A;  4FYC A;  3AY8 A;  3VFI A;  4KDX A;  4LA1 A;  2O7K A;  3HCZ A;  4CW9 A;  1A0F A;  1U3A A;  3QPM A;  1K3L A;  3SWL A;  3QAG A;  2GST A;  1G7E A;  2FUG 2;  1XW6 A;  1GSY A;  1PN9 A;  4NMU A;  2LEG A;  3IOS A;  2RM5 A;  1R5P A;  5G30 A;  1GTB A;  1R4W A;  1SYR A;  1B4Q A;  3L0H A;  1K0M A;  2O89 A;  1ZGN A;  4BA7 A;  2JAD A;  4J2F A;  1TU7 A;  3QAV A;  2C8U A;  1A2M A;  3QD9 A;  1OKD A;  2R6K A;  5ELA A;  1A8Y A;  1E2Y A;  4OCF A;  4QQ7 A;  3VWX A;  1BED A;  1R26 A;  3ZIJ A;  9GSS A;  3KP9 A;  1X0R A;  1YQ1 A;  3W8J A;  2HE3 A;  5COH A;  4NXI A;  2VLU A;  1Q4J A;  2BTO T;  3HJM A;  4GQC A;  3UBL A;  1ZOF A;  3QDN A;  3UEM A;  1ABA A;  3LJR A;  1RQM A;  8GSS A;  4L8E A;  4GST A;  5AIX A;  3CXG A;  3KCM A;  1VRS D;  2FGX A;  3CTG A;  4F0C A;  5IPH A;  1GRX A;  5DCG A;  4NV2 A;  1VF4 A;  3VI5 A;  1T4Y A;  3HXS A;  2NVL A;  4CHS A;  1SD8 A;  5B6M A;  1J0F A;  5GZZ B;  6GSU A;  2CQ9 A;  2YWM A;  5CYY A;  5IMC A;  4AJ7 A;  1EOG A;  2OAD A;  2PGT A;  2H30 A;  1VF1 A;  5IMF A;  1XWG A;  3KJY A;  3RAZ A;  3L9V A;  1UA5 A;  3P2A A;  1MDI A;  4GQF A;  2LTK A;  2ON5 A;  4V2M A;  3P7X A;  1X5C A;  3ERW A;  1GLQ A;  1SL0 B;  2K9F A;  1F6M C;  4ZL9 A;  3WGE A;  4EO3 A;  3CSI A;  3A5W A;  1GTA A;  5ENU A;  1WJK A;  3IC4 A;  1Y6E A;  2F9S A;  4TRX A;  4E8H A;  1EV4 A;  1TK8 B;  4WF4 A;  1BX9 A;  3IAM 2;  5G5E A;  3GKK A;  3TUE A;  5CRE A;  1XPV A;  2OE0 A;  5D8I A;  3L9S A;  4PNF A;  5BRT A;  2CVB A;  3LXZ A;  3O3T A;  3VWW A;  1A2L A;  4K7N A;  1MEK A;  5CNW A;  4EXJ A;  1YF1 A;  3F63 A;  4QL9 A;  2FLS A;  4ZIL A;  4DEJ A;  4KDY A;  2IWT A;  3ERF A;  1EOH A;  4POB A;  3RDW A;  2M80 A;  3HDC A;  4X1U A;  1FB0 A;  2PUK C;  3KZQ A;  4IQA A;  2CT6 A;  4MP4 A;  4MJE A;  3LFL A;  5IM9 A;  4YQV A;  1B9Y C;  2JZT A;  1A8L A;  1GNE A;  3GIX A;  3IPZ A;  2HT9 A;  4HZ2 A;  3IK7 A;  3GMF A;  4K0N A;  3L9U A;  4NHZ A;  2MMN A;  1IYH A;  3ZIT A;  1BYE A;  4Q5F A;  4ZBD A;  1JZD A;  2J23 A;  3IR4 A;  4A5P A;  3A2V A;  5J3R A;  1TI1 A;  3F6D A;  4KGI A;  3W8S A;  1PKZ A;  1TTZ A;  3GX0 A;  1GUM A;  1X5E A;  5DDL A;  3HVS A;  2X49 A;  4XIH A;  17GS A;  1J9B A;  1DE1 A;  2IMI A;  1EWX A;  3WD6 A;  3HHV A;  1GTU A;  2LNT A;  3F4S A;  3HYP A;  3UL3 A;  3G9B A;  4EE0 A;  4V1A p;  3DML A;  3FR6 A;  1WMJ A;  2VLT A;  4YAV A;  2F51 A;  5A4U A;  3TRX A;  3EIN A;  5IOW A;  3TKQ A;  1WRY A;  2LRC A;  13GS A;  1F9M A;  2R3X A;  5J4U A;  4RI7 A;  5IMD A;  1TK5 B;  1LJR A;  3GNJ A;  4RQR A;  1EGO A;  3TOU A;  3ZZX A;  4IVF A;  3GUR A;  2XPE A;  1K0C A;  2L5O A;  3FR9 A;  4BVX B;  2GZP A;  4EIQ A;  5CRH A;  2AAW A;  4IBP A;  2DSA A;  3F6F A;  4JED A;  1G6W A;  2DJ1 A;  1XVQ A;  1AUC A;  2MBT A;  3UOM A;  3KTL A;  1XW5 A;  4G2E A;  4TXO B;  5A4V A;  1MDJ A;  3LG6 A;  2AYT A;  1PX6 A;  5FT3 A;  4LMW A;  1MTC A;  1VF2 A;  4LL1 B;  3E9J B;  3VI7 A;  2K8V A;  3KM6 A;  1GUH A;  1OAZ A;  3VLN A;  4GTU A;  5ECP B;  4TVE A;  1XIY A;  4BL7 B;  5F05 A;  3S9F A;  1B9X C;  5H5S A;  4IJI A;  2H0I A;  2UZ8 A;  1A23 A;  4G10 A;  5IO2 A;  1K0D A;  1ML6 A;  5KOW A;  3G7J A;  4PX1 A;  3RPN A;  2DJK A;  5IMZ A;  2AB6 A;  5CRW A;  3RHB A;  3EU4 A;  4HU7 A;  3CSJ A;  1M2A A;  3PIN A;  1GUK A;  4EL1 A;  1Z5Y E;  2H75 A;  3CRT A;  2VCQ A;  2E2G A;  1EZK A;  2YOI A;  2F8A A;  1WWJ A;  3DVX A;  4DSR A;  1SK1 A;  4V1A g;  2L6D A;  4IHU A;  3KMO A;  4XRD A;  2JAC A;  4IGJ A;  14GS A;  2DKH A;  3E3E A;  1SKR B;  1TP9 A;  1O8W A;  1ZYE A;  4EVM A;  3MYD A;  2VLV A;  2HYX A;  1SD9 A;  2PVO C;  3VK9 A;  4BVY B;  4K8M A;  4TR0 A;  2B5Y A;  2DIY A;  2R0G A;  3TCO A;  1S3D A;  4RI6 A;  1H75 A;  4TOP A;  3C73 A;  4KH7 A;  2E0Q A;  4GXZ A;  4I8B A;  1FOH A;  1V9W A;  2L4Q A;  1SYX A;  4LMV A;  1M0U A;  2C3Q A;  1FB6 A;  2H71 A;  2B1K A;  4HJM A;  4HDE A;  4MPF A;  4MNN A;  1YZX A;  3TKR A;  3D6I A;  2VCZ A;  1TU8 A;  2WGR A;  3PGT A;  3H1N A;  5D73 A;  1C72 A;  1K0A A;  1I9D A;  2A2P A;  5CO3 A;  5IOX A;  2B7K A;  2AJQ B;  1GTI A;  2YZU A;  3HZ8 A;  1HNA A;  2DBC A;  4AF2 A;  2R0C A;  1QMV A;  4FYU A;  3ZYW A;  4I6X A;  4V2N A;  1FVJ A;  3EPT A;  1KBN A;  5ELG A;  4KND A;  2A4H A;  3DIE A;  3Q74 A;  5DBQ A;  2HI7 A;  3DD3 A;  4P3Y B;  2P31 A;  4PUR A;  2X8C A;  4N30 A;  4XCS A;  2FWH A;  2MMZ A;  3LQ7 A;  3QOU A;  4HJ2 A;  5DAL A;  3FKF A;  3UVH A;  1V40 A;  2H6Y A;  2ON7 A;  3CRU A;  4MMM A;  3QFB C;  5J5N A;  1M7T A;  4NWY A;  4PXO A;  1N2A A;  3KP8 A;  1XW9 A;  2I1U A;  2K8S A;  4KSM A;  5KN2 A;  3TGZ A;  1TRS A;  2KP1 A;  4POM A;  2CV4 A;  2CAI A;  4GF0 A;  1Z6N A;  4O5Q A;  4BPY A;  2N5B A;  4LLR A;  2PVQ A;  4MZB A;  5G5F A;  3F0I A;  4ML6 A;  2WFC A;  4I2U A;  1OC9 A;  1JZW A;  3J7Y b;  3ISO A;  1GSF A;  3D5J A;  3GKM A;  3H8Q A;  1ZZY A;  3CMI A;  3IV4 A;  2VD1 A;  5HQP A;  3TJJ A;  2YWO A;  2C4J A;  2OA7 A;  3F3Q A;  5HR3 A;  1O81 A;  1EP7 A;  4MH3 A;  5ECI B;  4MK3 A;  1GSQ A;  2VL9 A;  1A2J A;  3I9V 2;  1TW9 A;  4XHM A;  2FA8 A;  4CDO A;  4F0B A;  5AN1 A;  4F2I A;  4YQU A;  1AIU A;  2GQM A;  2LRN A;  3F9U A;  1A24 A;  5LCZ A;  4KCE A;  3ZRE A;  5E59 A;  2CVK A;  3GHA A;  3WGD A;  4O92 A;  4MF6 A;  1AC1 A;  2V6O A;  2LUS A;  3GST A;  3MWH A;  3UAR A;  2AHE A;  1EGR A;  3VUR A;  4Z2T A;  2GSQ A;  4MAB A;  2C1Y A;  1N8J A;  1AAZ A;  3Q18 A;  2LST A;  3Q6O A;  3HD5 A;  3H4K A;  2O85 A;  2OE3 A;  3TRQ A;  2QKE A;  4OO4 A;  4WR5 A;  3P90 A;  3CSH A;  4X43 A;  2RUE A;  4TW5 A;  5A5K A;  1NM3 A;  1TJD A;  2FWF A;  2DJ2 A;  2I4A A;  3EU3 A;  3F3R A;  2TRC P;  5D9T A;  2IN3 A;  1JLW A;  2B5E A;  2VM1 A;  3DEX A;  1PMT A;  3FY7 A;  4J56 E;  5IO0 A;  3BOA A;  4YKF A;  3ZMK A;  1M9A A;  4HQZ A;  2PN8 A;  5G2Z A;  3FZ4 A;  3N5O A;  3FRC A;  1PSQ A;  5ECK B;  1ERV A;  4KF9 A;  4N0Z A;  4PQI A;  2FY6 A;  4WR4 A;  3EMX A;  5IMA A;  1AW9 A;  4I5Q A;  1OKT A;  4GCI A;  3M8N A;  3D21 A;  1LBK A;  2V6K A;  1O6J A;  2C80 A;  5J41 A;  1YEX A;  5ECH B;  2E7P A;  2ZUP A;  1GLP A;  2N5A A;  4PQ1 A;  2JSY A;  3IAS 2;  4WKW A;  2H76 A;  3WT2 A;  1R7H A;  5ID2 A;  1QFN A;  4MDC A;  5G31 A;  3ZVJ D;  2DJ0 A;  2PU9 C;  4ZL8 A;  5LD0 A;  1V98 A;  4RQX A;  1W4V A;  1OC3 A;  2L57 A;  3H79 A;  4L5L A;  4K1F A;  2JSZ A;  2L5L A;  3FR3 A;  1EV9 A;  3TKS E;  5ECS A;  3ZML A;  3IXR A;  1Z9H A;  4POL A;  2R4V A;  3HJO A;  3IC8 A;  4YH2 A;  1K0B A;  3FZ5 A;  2DKI A;  4DVC A;  3SBC A;  1FW1 A;  5EVO A;  4TR4 A;  1TRU A;  3FHK A;  2OE1 A;  1K0O A;  2VCT A;  1TKD B;  1YKA A;  3ZFB A;  5D93 A;  2MYG A;  1SJI A;  1FHE A;  3V1W A;  10GS A;  2QC7 A;  4ILF A;  3ZFL A;  4KAE A;  4G0L A;  3TJB A;  2GSR A;  1YY7 A;  5GAP D;  5HR2 A;  1G6Y A;  1T7P B;  4HZ4 A;  2XBQ A;  1WE0 A;  5G1K A;  3IA1 A;  20GS A;  1ERW A;  2QGV A;  18GS A;  2I81 A;  1AXD A;  3F4R A;  4PQH A;  4ZBA A;  3GA4 A;  5ECR B;  1TRW A;  3GYK A;  1X5D A;  4ULX A;  4MF5 A;  2QA1 A;  4F9Z A;  3BD2 A;  3QR6 A;  3PR8 A;  1V57 A;  4IEL A;  3C1S A;  4KSO A;  3M0F A;  5B8A A;  3RHC A;  1DBY A;  2PER A;  2LQQ A;  3MIX A;  1U88 A;  3C71 A;  3QMX A;  5INY A;  1B8X A;  2MZC A;  4D73 A;  4Q5N A;  1EEM A;  3HKR A;  2YPM A;  2AV4 A;  1XZO A;  5C04 A;  3Q19 A;  4YAP A;  2I9H A;  4ZB6 A;  4JRR A;  4Z2R A;  2K18 A;  1XWC A;  1KTE A;  2XBI A;  3GUS A;  5H5R A;  1TXX A;  2NTO A;  2ZCT A;  2CA8 A;  4TR3 A;  5JCU A;  2A2S A;  1M2D A;  3ME8 A;  2IL3 A;  2FCH A;  5HR1 A;  1G0T A;  1KNG A;  5HFI A;  4ZXG A;  1BG5 A;  4I2T A;  4OD7 A;  3W6G A;  2YWN A;  4NHW A;  1ZYP A;  2ZNM A;  1BQ7 A;  1RW1 A;  3KTB A;  2IPA A;  4CY6 A;  2VUP A;  3OR5 A;  5JWQ B;  1F2E A;  2YV9 A;  2H66 A;  4ZB8 A;  1ERU A;  3BCI A;  2C0F A;  3M9K A;  3R2Q A;  2JL4 A;  4GSS A;  4GLT A;  12GS A;  2OBI A;  1SL1 B;  4YQM A;  1ZYN A;  1V2A A;  4DSQ A;  2EIQ A;  2MMA A;  4Q5Q A;  5DAL B;  2X4A A;  2V41 A;  2QSI A;  1Z3E A;  1FG4 A;  2HZF A;  2CAQ A;  1YF0 A;  2HLS A;  3GV1 A;  2KUC A;  2NBS A;  2MMO A;  1YEP A;  4KDU A;  1UN2 A;  5J9B A;  4ISD A;  4FO5 A;  5KN1 A;  2VCW A;  3D4T A;  1U3I A;  2GQL A;  4JR6 A;  1OC9 B;  4KB3 A;  2VL2 C;  2E2M A;  3MSZ A;  3WYW A;  1AQV A;  3NIV A;  3ZRD A;  2CVD A;  1X9W B;  3KMN A;  2EIO A;  2OJL A;  5DJL A;  4G9H A;  5DVB A;  2H6Z A;  6GSX A;  1OVN A;  3GTU A;  3BJ5 A;  1NHO A;  5ECQ B;  3UVT A;  3MDK A;  4AJ6 A;  4EUY A;  4Z7X A;  2QA2 A;  1TK0 B;  2JU5 A;  1HQO A;  4JZQ A;  3GX8 A;  1WP0 A;  4CY8 A;  4KW6 A;  6GST A;  1XWK A;  4XS6 A;  4NV5 A;  2REM A;  2GTU A;  4MLY A;  2FWE A;  5JWR B;  3U5R E;  5KEJ A;  2H6X A;  3UMA A;  3M1G A;  3I69 A;  2LJA A;  1M9B A;  2LJR A;  1T00 A;  3GKX A;  1M99 A;  5CP1 A;  2X99 A;  4IP6 A;  1O73 A;  1F3A A;  5LNK e;  2FNO A;  2YWI A;  1JLV A;  3TDG A;  3US3 A;  5KOX A;  5JWO B;  3A2W A;  5DQY A;  4ZIJ A;  2GZY A;  1JZO A;  5HR0 A;  2YNX A;  5FHI A;  1HYU A;  1JHB A;  2F3M A;  1F3B A;  2J9H A;  2H0G A;  4FYB A;  2H74 A;  2P0G A;  4OFM A;  4Z2U A;  4BWS A;  4O5R A;  1X9M B;  2WDU A;  3C7M A;  2VL2 A;  3HVV A;  2YN1 A;  1K3O A;  4K2X A;  5AGY A;  3TKS A;  4HUA A;  4JR4 A;  1YDK A;  1NHY A;  2V2G A;  4OFT A;  4POK A;  3VPT A;  2GT6 A;  5ID2 B;  2X64 A;  3RBT A;  4EIP A;  1T3B A;  1W89 A;  4OWY A;  2PBJ A;  2HNL A;  1YKC A;  4O5U A;  2L6C A;  1WOU A;  3QCP A;  3GH6 A;  3EWL A;  2TRX A;  3FYG A;  1GUL A;  2WS2 A;  2HSY A;  3IDV A;  3NZN A;  4E8E A;  4HU9 A;  4IS0 A;  1URM A;  3APS A;  1MD4 A;  2O8V B;  4TXV A;  2GS3 A;  2YAN A;  3TKP A;  2RM6 A;  3FZA A;  2XC2 A;  5F8B A;  4PTS A;  2LRT A;  5B8B A;  3D4M A;  2H19 A;  1IYI A;  1FVK A;  3CTF A;  2WCI A;  4ECB A;  4OFN A;  2VCV A;  5E4W A;  1OYJ A;  2BJX A;  5F06 A;  3QAW A;  2CZ3 A;  5JCG A;  2HRA A;  2XHF A;  1I5G A;  2F8F A;  1PQN A;  2G0F A;  3UIW A;  5B7C A;  1Q98 A;  5D9X A;  2VIM A;  1GP1 A;  1PN0 A;  3TJK A;  3HA9 A;  2JZR A;  3ZIV A;  2YCD A;  2B3S A;  2G2Q A;  1XWA A;  1U87 A;  1XCC A;  1B48 A;  1PRX A;  5DCH A;  3DRN A;  4PGT A;  3RPP A;  1ON4 A;  2IJY A;  2D2Z A;  3KD0 A;  4EDZ A;  4TR1 B;  1LU4 A;  5H5Q A;  6GSS A;  3A3T A;  2PMT A;  1ACV A;  2GDR A;  2B5X A;  1PGT A;  2H01 A;  3GH9 A;  1ERT A;  1SL2 B;  3DGQ A;  3IE3 A;  4D73 B;  1GSE A;  5CAX A;  2LQO A;  3DXB A;  2V32 A;  3IRA A;  5DAK A;  4JBB A;  1EEJ A;  1ZL9 A;  1SKS B;  3C1R A;  4IW9 A;  3EMP A;  1HNB A;  3FZ9 A;  2OAC A;  4FQU A;  1GH2 A;  3EYT A;  3TOT A;  4K5R A;  4WXT A;  2CZ2 A;  4JU5 A;  4I97 A;  4ML1 A;  2EIR A;  1SEN A;  2LV3 A;  4K7I A;  1ZCP A;  2C0E A;  2HXK A;  3EVI A;  2IMD A;  3C8E A;  3KH7 A;  2WZ9 A;  5KN3 A;  1XWB A;  1Z7P A;  2R5G A;  4JE1 A;  1V58 A;  4MJA A;  3WT1 A;  2H73 A;  3GN3 A;  2PWJ A;  3FK8 A;  3LEF A;  2VL3 A;  4TKY A;  3UJ1 A;  5AIS A;  2YV7 A;  4K9Z A;  1NSW A;  1A0R P;  2H1A A;  4G0I A;  4KCA A;  4L0W A;  1TRV A;  2DML A;  3EC3 A;  4O7H A;  2A4V A;  7GSS A;  3MNG A;  2IIY A;  2HRF A;  1K0N A;  2BMX A;  4XS4 A;  4DSS A;  2NDO A;  5IIZ A;  4L5O A;  4WEY A;  2TIR A;  6GSW A;  4IN0 A;  5D96 A;  3LWA A;  4NPB A;  4XRA A;  2L4C A;  3DWV A;  3TB2 A;  3HJP A;  4ZL7 A;  2LJK A;  2C0D A;  1QK8 A;  4XTS A;  1T4Z A;  4OO5 A;  4J57 E;  3GRX A;  4X4J A;  1Z7R A;  1SJZ A;  2WUL A;  2DC5 A;  3CBU A;  2HZE A;  3ED3 A;  5ECO B;  3KH9 A;  4IP1 A;  4MJB A;  4G0K A;  4PNG A;  3QFA C;  2P5Q A;  2NPB A;  1AQX A;  5ABR A;  3KXO A;  3WGX A;  1U6T A;  2KLX A;  3M3M A;  5GSS A;  1G7O A;  1FO5 A;  4IKH A;  1GNW A;  4RUV A;  4F82 A;  4X0X A;  3BBY A;  11GS A;  3APO A;  3LXT A;  4TR1 A;  4MZW A;  1MDK A;  4MA9 A;  1TDI A;  3DVW A;  3I43 A;  4LL4 B;  4AJ8 A;  3FMW A;  3D0Z A;  2CX4 A;  3KEB A;  4TN8 A;  5IMV A;  3DKS A;  2C3T A;  4HOJ A;  1DUG A;  3M9J A;  2OKA A;  4USS A;  4FH8 A;  1J08 A;  1O7U A;  2VO4 A;  1BJX A;  4MJC A;  4MH2 A;  2X8G A;  2R2J A;  3EUR A;  4WBR D;  1K3Y A;  3ZVJ A;  3TJF A;  4HI7 A;  2RUF A;  1H4O A;  4ECI A;  2YJH A;  1HNC A;  1SK0 A;  4Q5R A;  4QL7 A;  1T8E B;  3GTU B;  2VOC A;  4G19 A;  3E0U A;  5F0G A;  3HZ4 A;  3HVX A;  1KEB A;  3VWV A;  2ALB A;  5CRD A;  3A2X A;  1RK4 A;  4MF7 A;  3ERG A;  2LNS A;  4ECC A;  1EP8 A;  2K6V A;  2VAF A;  1PL1 A;  2FWG A;  4KA0 A;  5L71 A;  4YKG A;  2HFD A;  3IBH A;  5D9V A;  2CX3 A;  3BCK A;  1DSB A;  4WF5 A;  2RLI A;  1Y25 A;  2OBK A;  3PH9 A;  3R3E A;  1TOF A;  5ECM B;  3GKN A;  4KX4 A;  1X9S B;  2FHE A;  2IFQ B;  2IMK A;  3ZLP A;  1XBS A;  4N10 A;  2DJJ A;  1WPI A;  4NAX A;  2YP6 A;  5EY6 A;  5ECN B;  1T1V A;  4ID0 A;  4K5S A;  3U6V A;  1UVZ A;  4ICY A;  2KOK A;  2M72 A;  4N0V A;  1FAA A;  1F37 A;  4K7O A;  2IME A;  5KN0 A;  3FW2 A;  1QUW A;  5D9W A;  1R5A A;  1UC7 A;  2HSM A;  3LYK A;  3LW9 A;  5IQY A;  3NOF A;  1THO A;  2DIZ A;  4EKZ A;  3PPU A;  4K6X A;  6GSV A;  3GL5 A;  2HRN A;  1HD2 A;  2AUV A;  3G7Y A;  3LYP A;  1GSD A;  1VGL A;  4MPG A;  3H93 A;  1BAY A;  3G7I A;  2X8H A;  4O32 A;  4F03 A;  5IPG A;  5BMU A;  2DJ3 A;  2WB9 A;  5CRG A;  4OMV A;  5G1L A;  2YZH A;  3APQ A;  2GGT A;  1OC8 A;  5HFG A;  2LS5 A;  2WRT A;  4WET A;  1XOB A;  4EF0 A;  1MD3 A;  1VF3 A;  3MAK A;  2O87 A;  2B1L A;  2WJU A;  1GSS A;  4EDY A;  4EC0 A;  3N9J A;  3P8W A;  2VCX A;  3DYR A;  5EPF A;  1YJ6 A;  2B7J A;  1PD2 1;  1XXU A;  5GAN D;  1S3A A;  1DE2 A;  4ACS A;  3JCM L;  3TKS C;  2EC4 A;  2N5F A;  3GSS A;  3O76 A;  3CYN A;  2HRK A;  2H0H A;  4MZC A;  3GL3 A;  3ME7 A;  2VD0 A;  1O85 A;  3K8N A;  2VM2 A;  1GWC A;  4GSN A;  2FA4 A;  2HSH A;  3TJG A;  5B6N A;  2R0P A;  1SK2 A;  2H8L A;  2LKU A;  4V2L A;  3KGK A;  1CQG A;  4L0U A;  4BWQ A;  1QQ2 A;  2R37 A;  1GL8 A;  4WBJ A;  2H72 A;  3ZL5 A;  5DJM A;  1PX7 A;  2IMF A;  16GS A;  3VWU A;  5ECL B;  2IFQ A;  3KIJ A;  2ES7 A;  1SKW B;  1O8X A;  3L78 A;  4PUF C;  2C3N A;  3HY2 A;  1XOA A;  1PKW A;  3L4N A;  5C00 A;  3TRP A;  3UBK A;  2YJ7 A;  3FEU A;  4PUA A;  2B6M A;  3IHG A;  1B4P A;  4KE3 A;  2KHP A;  3J7Y k;  4GWR A;  2A2R A;  4K2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...