1FOVA

Glutaredoxin 3 from escherichia coli in the fully oxidized form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
b'ANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGYDDLYALDARGGLDPLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN 3
publication title NMR structure of oxidized glutaredoxin 3 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fovA00
3F3QA 1GH2A 1PRXA 4IP6A 2AUVA 1OAZA 3GURA 4I6XA 4KAEA 4MK3A 4OD7A 5COHA 3PR8A 4XTSA 2DIZA 3QFAC 3A2XA 4KB3A 1OE7A 1S3AA 2CX4A 4NXIA 4MCUA 4YH2A 4MJAA 1TDIA 2IN3A 1GLQA 4ZB9A 4NV2A 1SD9A 5H5QA 5KN0A 2HRNA 2XC2A 2PERA 14GSA 5EPFA 3OR5A 5KEJA 3U5RE 5J41A 1B8XA 4BVXA 2DJ0A 5ID2B 2K8SA 2I3YA 2GDRA 1PSQA 2C80A 2LRNA 1EEMA 1M9BA 2C1YA 3L4NA 1M7TA 2F8AA 3HD5A 2CQ9A 4IKHA 1A24A 2HRFA 4YAVA 4G10A 2MBTA 4EKZA 16GSA 1ON4A 5ECSA 5AN1A 4ECJA 1WP0A 2GZZA 2HLSA 4N11A 4JBBA 1Y25A 3GKNA 2RM6A 3DYRA 1MDKA 5G31A 2PVOC 1XWBA 2XBIA 4RQRA 2OJLA 1VF1A 1YJ6A 4L5LA 4NMUA 4XIHA 2DJJA 2AV4A 1R7HA 4NPBA 1J08A 4HI7A 4XS4B 3ZTLA 2TRCP 2TIRA 2JZTA 4ZB6A 2YWOA 1O85A 1T1VA 1OC3A 4V2MA 2IFQA 5J3RA 1N8JA 5A5KA 1YY7A 1U87A 1AQWA 4RI7A 3MDKA 2AJQB 3A2WA 4PXOA 1AQVA 3ZMLA 4EDYA 2WDUA 2PWJA 6GSSA 2CAIA 2XPEA 1BG5A 3CXGA 5IM9A 4IVFA 4GQFA 2H0HA 1ZGNA 1BJXA 3ME8A 3EVIA 2YWMA 2CAQA 2O87A 4Q5NA 1EZKA 1QFNA 2C0FA 4L8EA 1XZOA 4YQVA 2OBIA 4KUNA 4KCEA 2HZEB 1SJIA 2IWTA 2V6OA 2GLRA 5IPGA 1T7PB 5JWQB 2H72A 3GX8A 3ZFLA 5C00A 5GSTA 2F9SA 1HD2A 4TKYA 3BCKA 4LLRA 2VLTA 1B9YC 2H6ZA 4Z7XA 4BL7A 2LQOA 4XHMA 3M9KA 1GSEA 1KEBA 5LD0A 4EXJA 5CRDA 4GQCA 3LXZA 2KP1A 3H1NA 2VD0A 2K18A 4QL7A 1RW1A 3UOMA 1PKZA 3IV4A 2ES7A 3KGKA 4MF5A 4OCEA 4RUVA 1TI3A 4IQAA 4XS1A 4BVYA 5DDLA 3TKSC 2G2QA 1R26A 4MP4A 3L9VA 3ZLPA 5E4WA 4TR1A 1LBKA 2V6KA 2H8LA 1TP9A 4O92A 1WOUA 1JZRA 1TJDA 3KEBA 5G5FA 4LL1B 4KSOA 1K3YA 1MD4A 3A3TA 2CZ3A 3QCPA 5DAKA 2IIYA 5B6NA 2K6VA 2E0QA 2YPMA 3SBCA 3HXSA 3EURA 4TXOA 1HNBA 1X9WB 2C0GA 2GSSA 1V2AA 3R2QA 3RPNA 3NOFA 4PURA 3P90A 3H4KA 1A2MA 4MA9A 1FG4A 4ZBDA 3ZMKA 4HOJA 4K2DA 3A5WA 5HR0A 2ON5A 3FHKA 3IXRA 3UMAA 1K0OA 2P0GA 13GSA 2VLVA 1XIYA 1K3OA 2OADA 2XHFA 1SKWB 2P31A 1K0BA 3KP8A 2MYGA 3UEMA 4PNFA 1AIUA 2C0DA 2JL4A 2FY6A 1TW9A 1F3BA 3IK7A 2B6MA 1S3CA 3KMOA 3D21A 12GSA 1SD8A 3HVVA 4CHSA 3KM6A 5IMFA 1DBYA 5DJMA 5DBQA 2F51A 4F0BA 4ZBAA 4OFNA 5A4WA 2OA7A 3G9BA 4IBPA 5H5RA 3GX0A 1TK5B 3US3A 5F0GA 3M1GA 4O7HA 2GQKA 3H93A 5G30A 5DQYA 3J7Yb 1RQMA 4DSSA 1V57A 1F2EA 4BPYA 1WMJA 1FW1A 2B5EA 5JCUA 3IAM2 5DCHA 3TDGA 1A23A 1W89A 4KCAA 3TJKA 1SKRB 4ZB8A 1ZZYA 22GSA 2L4QA 4TRXA 2CVDA 2A4VA 2K8VA 5HR3A 3UBLA 5B7CA 2VL2C 3GTUA 2PBJA 4JE1A 1DSBA 2CVBA 5F05A 2H1BA 1C72A 4IW9A 3MAKA 3FZ5A 2H01A 4PGTA 1UVZA 2X99A 1EOHA 3MNGA 4HEA2 3EC3A 2GQMA 5KN2A 1A2LA 2WRTA 3VK9A 4AJ6A 1Y6EA 5D96A 3SWLA 5JWRB 3D22A 3TJFA 3DIEA 3F3RA 3HY2A 3P2AA 3Q18A 4GF0A 2L5LA 4NWYA 1QQ2A 4XS6A 3DRNA 3VFIA 1OKDA 4TXVA 4HS1A 4NV5A 2H1GA 3KD0A 4E8HA 1SK1A 3VWXA 5GAPD 2GT5A 4ZILA 5IO0A 2VCWA 2VLUA 1PL2A 2ZNMA 1XW6A 3QDNA 2LJRA 5IQYA 3QAWA 4K7OA 1Z5YE 5LNKe 3FYGA 1MDJA 3QAVA 4JEDA 1ZCPA 1UC7A 3HA9A 4IJIA 4HU7A 5D93A 1O6JA 3O6TA 2L57A 3VWUA 2VO4A 3BD2A 2I9HA 5HFGA 4E8EA 2H66A 2H1AA 3ME7A 1SL0B 3EWLA 1X5EA 4MDCA 1N2AA 2AYTA 1I9DA 2VL3A 2KHPA 1O7UA 2YJHA 1YF1A 4YAPA 1A8YA 1FHEA 3KCMA 3TJBA 2TRXA 2GSTA 4XRDA 2FCHA 2R2JA 1ZOFA 3KIJA 1QK8A 1I5GA 2OACA 1AUCA 2PUKC 6GSYA 1GSDA 2PPTA 2VCTA 3GNJA 2X8GA 4K0GA 5F06A 1H75A 3H79A 4F03A 1FB6A 4K7IA 2B7KA 3EMXA 4PUFC 5DALA 3L9SA 2XPDA 5IOWA 2CT6A 1A0FA 1WPIA 1YEPA 2L6DA 3F0IA 1BAYA 1NM3A 2R4VA 4IS0A 4K6XA 1M2DA 2WJUA 3GYKA 2H30A 3L9UA 5EL8A 3K8NA 2BMXA 1XBSA 3GRXA 3UARA 3FK8A 2DJ1A 2BTOT 1SL1B 3TKSA 5CYYA 1NHOA 3ZIJA 1X9SB 4ZIJA 2GQLA 3GHAA 2VM2A 2GZYA 4BWSA 2YCDA 1Z7RA 3FR6A 3D6IA 2MZCA 1FB0A 3EU4A 4PX1A 4KW6A 2WFCA 2ALBA 3TKSE 3RDWA 1T8EB 1M99A 3GKXA 4WBRD 1M9AA 3ZVJD 1OC8A 1KTEA 4PUAA 2C3NA 4FH8A 4ECIA 3RPPA 2R37A 4XCSA 2QGVA 1IYHA 3C7MA 4OMVA 1X9MB 3KXOA 3G7IA 3U6VA 1TRWA 4KNDA 2REMA 2WCIA 1PA3A 1R4WA 4POBA 5HR2A 3IR4A 4I2UA 4WR4A 2JSYA 4LMVA 3LWAA 4TXOB 1U88A 1GTAA 2FA8A 1GSFA 4IQ1A 2VOCA 5D9TA 1ZMAA 1GP1A 1NW2A 1QMVA 1B4PA 1Z9HA 2VUPA 3VWWA 4WF4A 4KDUA 1Z6NA 1PGTA 3UBKA 4ECCA 1SK0A 4X0XA 3LYPA 1KNGA 1QUWA 1EV4A 5CP1A 1K0AA 2WS2A 4J57E 5CNWA 1O8WA 3TGZA 1V58A 3J7Yk 2OE3A 1FO5A 2IMFA 3E9JB 3TOTA 2GTUA 3HYPA 3L0HA 3A2VA 2LNSA 3UIWA 3HJMA 2DBCA 5A4UA 1XOAA 2HYXA 2R5GA 4LMWA 3E3EA 4MF7A 1M0UA 3F9UA 2P5RA 1S3DA 2HNLA 4RQXA 4IJ3A 4ZBBA 3TKQA 3VPQA 3FRCA 3Q19A 1XWCA 3FY7A 2YV9A 1GUMA 3FEUA 2EIQA 4MJBA 2VL2A 4POLA 3WGEA 3TRQA 1BEDA 5C04A 2KUCA 3RAZA 2EC4A 5IPHA 5FT3A 1VF4A 3UVTA 3BBYA 3KJYA 1E6BA 1TKDB 2GVPA 5G2ZA 1USBA 5ECMB 4F2IA 4IGJA 3BJ5A 3F6FA 3ZZXA 1O81A 5JWOB 2RLIA 3DKSA 2M46A 3CSJA 3KTLA 2FUG2 3QAGA 4N0VA 1GSQA 2HXKA 4LA1A 5H5SA 2IMEA 1GL8A 3F4TA 4J56E 3LORA 4GCIA 5D9XA 2WULA 3TRXA 4EL1A 2NPBA 1HQOA 4KH7A 5DVBA 4GSTA 2LQQA 3KH9A 2VAFA 4L0UA 3GIXA 3GKKA 5ID2A 1KBNA 2GSRA 2C8UA 4WKWA 4PQ1A 5HFKA 4IHUA 3FZ9A 1UA5A 6GSTA 2YOIA 1HYUA 4ML6A 3Q6OA 3D4MA 1TU8A 2LRCA 1PMTA 1A2JA 3LEFA 3IA1A 4JRRA 1M2AA 4X1UA 1V9WA 3IAS2 3ZVJA 2DJ2A 1AW9A 4ZXGA 3FZAA 1HNCA 3APQA 3O76A 1TRSA 1EP7A 2MBSA 3DXBA 4EO3A 5EVOA 4F0CA 2YV7A 5ECRB 2FWHA 3LXTA 2AB6A 2B7JA 3QFBC 3IRAA 2V1MA 4DSRA 2ON7A 1K0DA 1A0RP 4PQHA 4EC0A 1PKWA 3DMLA 1OC9A 1K0MA 4KE3A 3TKPA 1EGOA 4XS4A 4NHWA 4ZL8A 3TOUA 1B9XC 1F9MA 5AISA 5A4VA 1YEXA 1DUGA 4AJ7A 4AJ8A 1TU7A 1LJRA 4ID0A 5AGYA 2GS3A 2H71A 1TTZA 4G2EA 17GSA 3IK9A 3P7XA 1K0CA 1UN2A 4O32A 4MH2A 1G0TA 5F07A 2ZUPA 1XW9A 1CQHA 2VCXA 1TRUA 4I97A 4WETA 1XOBA 2GGTA 2OE0A 4EE0A 4N10A 1E2YA 3W8SA 3D5JA 4TR4A 5CRHA 4POMA 1TK0B 3MSZA 1GSUA 2HZEA 4G19A 4OWYA 3GN3A 5ECKB 1W4VA 4PQIA 4ZL7A 4OFTA 1ST9A 4I8BA 4IN0A 4D73B 5GZZB 4JZQA 1VF3A 4MJCA 2V2GA 4POKA 4MPFA 3G7YA 2Z9SA 1X0RA 3GMFA 2HSYA 4OCFA 2JZRA 1GTUA 1HNAA 3CMIA 2DLXA 2YZUA 2H74A 5IOXA 5ELAA 3CYNA 2B1KA 2GSQA 2F3MA 4KDYA 4L5OA 3C1SA 4N30A 1GTBA 6GSXA 1VF2A 3G7JA 3LYKA 2FGXA 3IC4A 3EU3A 11GSA 1G7EA 1JZOA 3HJOA 3ISOA 2LV3A 3F4RA 4KX4A 2IMDA 1XVWA 2N5AA 2I1UA 2JU5A 2H70A 2NVLA 1YKCA 5B8BA 2AHEA 1JZDA 1SL2B 3GSTA 2CX3A 3HDCA 5JCWA 5E59A 3TCOA 4DSQA 2OBKA 2LNTA 2V41A 2QKEA 3TB2A 2VIMA 2GT6A 3I9V2 3HJPA 2A2RA 4FIWA 2IPAA 3CSIA 3QPMA 5KN1A 3GL5A 1ZYEA 3EINA 5ECPB 4I2TA 3ERFA 2X64A 2H76A 4LL4B 1YZXA 2RIIA 5D8IA 3UJ1A 4YQUA 2FA4A 2VCVA 1A8LA 1SJ6A 2B1LA 2LJAA 5ECQB 1GUHA 1V98A 2L4CA 1EOGA 1EWXA 2FNOA 5AIVA 4MZBA 6GSVA 3ZYWA 2M72A 4CDOA 2JACA 3H8QA 4KSMA 4V2LA 4JR4A 1PX7A 1RK4A 1ERVA 3CSHA 4X43A 4V1Ap 2IFQB 3Q74A 1SK2A 2BJXA 3UL3A 1GLPA 1URMA 4F9ZA 2HT9A 3WGXA 1JFUA 1BX9A 3ED3A 5D9VA 3ZFBA 2P5QA 4JU5A 2YP6A 4P3YB 1IYIA 3N5OA 3ZIVA 1K3LA 3FR3A 1O8XA 1V40A 5ECIB 5F8BA 1XPVA 4PNGA 1OYJA 1GULA 3C73A 2O89A 1G6WA 2D2ZA 4XRAA 4WR5A 2C3QA 3EE2A 4YQMA 5B6MA 2VCQA 3MWHA 1YQ1A 1GSYA 2DJ3A 4K0NA 3W6GA 1U3IA 3HZ8A 2FHEA 5HR1A 1XWKA 1FVJA 4NAXA 2LKUA 2KP2A 1WE0A 3I43A 3I69A 3GL3A 4I5QA 1ILOA 5DQSA 4N0ZA 2HSHA 2FD3A 3BOAA 2LJKA 3E0UA 5DCGA 1TOFA 2G0FA 1YKAA 1SENA 2YWIA 1Z3EA 3HHVA 2JSZA 4FYCA 4HUAA 4QQ7A 3VI5A 5INYA 2VL9A 1XCCA 4GSSA 1MDIA 5IMAA 5D9WA 4F82A 2IMKA 3AY8A 3DVXA 3DVWA 4TVEA 4TR1B 4MMMA 2LEGA 3M3MA 4HQZA 4HU9A 1ZL9A 2H6XA 2RM5A 4EVMA 5DAKB 1PQNA 1R5PA 4K7NA 5ELGA 2YN1A 4O5RA 2XBQA 5HFIA 3QR6A 4ILFA 2YNXA 3WD6A 1EGRA 3TJJA 3S9FA 2V32A 2IJYA 1T4YA 5CAXA 3GA4A 4GTUA 5ECHB 2QSIA 3CRTA 4ZL9A 1ERWA 3APSA 3DGQA 2RUFA 3W8JA 3FR9A 2HE3A 5KN3A 1XXUA 3LGCA 2KOKA 5DJLA 1JLWA 3HVXA 1OC9B 3IOSA 2K9FA 3FZ4A 1GNEA 4K8MA 1SYXA 2A2SA 2DMLA 3QMXA 3ZRDA 1F37A 4K1FA 1J0FA 1X5DA 3PINA 5IMDA 2YZHA 1MEKA 3ZL5A 4RI6A 2ZCTA 4EDZA 2YWNA 4HQSA 1XWGA 2JADA 4WBJA 1THXA 5FHIA 1DE2A 3KMNA 3PH9A 4OO4A 5B8AA 5J9CA 3L78A 4JR6A 2EIOA 3F63A 4GSNA 2WZ9A 1DE1A 4WF5A 4DSSB 4ACSA 7GSSA 3TUEA 4L0WA 5G5EA 1JHBA 3IE3A 3GH9A 4MLYA 5JCGA 3QOUA 3ERWA 2CVKA 3RHBA 2C0EA 3ERGA 1U3AA 4TW5A 5D73A 8GSSA 3C1RA 3WT2A 3KTBA 3GTUB 2H19A 4MABA 3UVHA 3O3TA 2CV4A 1FOVA 5IO2A 2FLSA 2X8CA 2YJ7A 5AIXA 2B5XA 5CRGA 3ZREA 1AAZA 3V1WA 2JZSA 2WB9A 1BYEA 3JCML 2OKAA 3CTFA 2HZFA 2DC5A 4H86A 1GSSA 10GSA 3HKRA 1J9BA 3VLNA 1OVNA 4BWQA 1YDKA 5LCZA 2FWFA 4QL9A 4TR3A 4HZ2A 3NZNA 4KA0A 4ULXA 2MMAA 2HI7A 5ABRA 1Q98A 2FWGA 3FW2A 3FKFA 1ABAA 4G9HA 3VPTA 4AF2A 2IMIA 5G1KA 2VCZA 5EY6A 3TRPA 3F4SA 3LQ7A 3IPZA 1X5CA 1Z7PA 2R3XA 4V1Ag 4K9ZA 1OKTA 1T00A 3GUSA 4NHZA 4HJMA 3I6AA 3GSSA 3KP9A 2PVQA 3IBHA 2NDOA 4WEYA 1T3BA 2L6CA 2QC7A 1B48A 1TI1A 2M80A 2E7PA 2EIRA 1WIKA 5IMZA 1THOA 1ERUA 3KZQA 1FVKA 2MMNA 4EF0A 2DSAA 3D4TA 2O7KA 1GNWA 1R5AA 1NHYA 2LRTA 5IMVA 3VI7A 3VURA 1PD21 4MF6A 1VRSD 2E2MA 1Z6MA 4BA7A 3GH6A 5IMCA 3EYTA 2H1DA 1QGVA 3LJRA 1G6YA 2DMMA 1OE8A 4FO5A 1O73A 1ACVA 1VGLA 2H75A 3BCIA 1EP8A 2B3SA 1WWJA 2H0IA 3LSZA 5J5NA 5CO3A 5DALB 18GSA 5J9BA 4Q5QA 2N5BA 1JLVA 4ECBA 2LTKA 19GSA 1YF0A 4KDXA 3M0FA 3HVSA 2MMOA 5IIZA 3M8NA 5ENUA 1XVQA 1EV9A 5L71A 2OE1A 2LS5A 1AC1A 3HZ4A 1ERTA 3GKMA 5ECLB 1NSWA 1TRVA 1PL1A 2X8HA 3PGTA 20GSA 1F3AA 3DWVA 2PN8A 1U6TA 2F8FA 3GV1A 3TKRA 4MPGA 4IELA 1QXHA 1ML6A 4ISDA 1ZYQB 2I4AA 2J9HA 2H6YA 3P8WA 2H73A 2O8VB 3LFLA 4Q5FA 2NBSA 1CQGA 3M9JA 2H0GA 3WYWA 4OFMA 2RUEA 5GAND 1AQXA 2B5YA 4MZWA 2LSTA 4MJEA 2YANA 4FYBA 1JZWA 5ECOB 4TOPA 1SJZA 9GSSA 3N9JA 1GRXA 1PX6A 5HQPA 1BQ7A 1Q4JA 3WT1A 4CW9A 6GSWA 1TXXA 3APOA 4EUYA 2AAWA 1K0NA 4Q5RA 1H4OA 2I81A 4MZCA 4IP1A 2NTOA 3C8EA 2HFDA 3KH7A 2J23A 3C71A 4OO5A 2VD1A 4GWRA 4HJ2A 1T4ZA 2KLXA 5CREA 1TK8B 3RHCA 3WGDA 5FWGA 4GXZA 1SU9A 2IL3A 3EMPA 4TN8A 3CRUA 3DD3A 3HCZA 1G7OA 4TR0A 2C3TA 4V2NA 2O85A 1LU4A 3D0ZA 2N5FA 4DEJA 3F6DA 3LG6A 3RBTA 2MMZA 4KGIA 1GWCA 2CZ2A 4GRFA 1WJKA 2CA8A 2VM1A 5J4UA 1GUKA 3QD9A 1GTIA 3CBUA 3IHQA 5CRWA 2R6KA 3TJGA 3UAPA 4MH3A 1XW5A 1B4QA 1PN9A 3CTGA 5G1LA 2L59A 3VWVA 5ECNB 1WRYA 1FAAA 1XFLA 2PMTA 4HDEA 4J2FA 2PU9C 2E2GA 1M2BA 4HZ4A 2C4JA 2L5OA 1MTCA 2LUSA 3ZITA 2PGTA 1SKSB 4D73A 3DEXA 1F6MC 2DIYA 1MD3A 4DVCA 4WXTA 2DJKA 2WGRA 3NIVA 1AXDA 4GLTA 4AGSA 1SYRA 4FYUA 3IDVA 1EEJA 2FWEA 6GSUA 3F8UA 4ML1A 2GZPA 5GSSA 1XWAA 3GFKA
chains in the Genus database with same CATH superfamily
3F3QA 1GH2A 1PRXA 4IP6A 2AUVA 1OAZA 3GURA 4I6XA 4KAEA 4MK3A 4OD7A 5COHA 3PR8A 4XTSA 2DIZA 3QFAC 3A2XA 4KB3A 1OE7A 1S3AA 2CX4A 4NXIA 4MCUA 4YH2A 4MJAA 1TDIA 2IN3A 1GLQA 4ZB9A 3A5IA 4NV2A 1SD9A 5H5QA 5KN0A 2HRNA 2XC2A 2PERA 14GSA 5EPFA 3OR5A 5KEJA 3U5RE 5J41A 1B8XA 4BVXA 2DJ0A 5ID2B 2K8SA 2I3YA 4KF9A 2X49A 2GDRA 1PSQA 4G0LA 2C80A 2LRNA 1EEMA 1M9BA 2C1YA 3L4NA 1M7TA 2F8AA 3HD5A 2CQ9A 4IKHA 1A24A 2HRFA 4YAVA 4G10A 2MBTA 4EKZA 16GSA 1ON4A 5ECSA 5AN1A 4ECJA 1WP0A 2GZZA 2HLSA 4N11A 4JBBA 1Y25A 3GKNA 2RM6A 3DYRA 1MDKA 5G31A 2PVOC 1XWBA 2XBIA 4RQRA 4O5UA 2OJLA 1VF1A 1YJ6A 4L5LA 4NMUA 4XIHA 2DJJA 2AV4A 1R7HA 4NPBA 1J08A 4HI7A 4XS4B 3ZTLA 2TRCP 2TIRA 2JZTA 4ZB6A 2YWOA 1O85A 1T1VA 1OC3A 4V2MA 2IFQA 5J3RA 1N8JA 5A5KA 1YY7A 1U87A 1AQWA 4RI7A 3MDKA 2AJQB 3A2WA 4PXOA 1AQVA 3ZMLA 4EDYA 2WDUA 2PWJA 6GSSA 2CAIA 2XPEA 1BG5A 3CXGA 5IM9A 4IVFA 4GQFA 2H0HA 1ZGNA 1BJXA 3ME8A 3EVIA 2YWMA 2CAQA 2O87A 4Q5NA 1EZKA 1QFNA 2C0FA 4L8EA 1XZOA 4YQVA 2OBIA 4KUNA 4KCEA 2HZEB 1SJIA 2IWTA 2V6OA 2GLRA 5IPGA 1T7PB 5JWQB 2H72A 3GX8A 3ZFLA 5C00A 5GSTA 2F9SA 1HD2A 4TKYA 3BCKA 4LLRA 2VLTA 1B9YC 2H6ZA 4Z7XA 4BL7A 2LQOA 4XHMA 3M9KA 1GSEA 1KEBA 5LD0A 4EXJA 5CRDA 4GQCA 3LXZA 2KP1A 3H1NA 2VD0A 2K18A 4QL7A 1RW1A 3UOMA 1PKZA 3IV4A 2ES7A 3KGKA 4MF5A 4OCEA 4RUVA 2R0GA 1TI3A 4IQAA 4XS1A 4BVYA 5DDLA 3TKSC 2G2QA 1R26A 4MP4A 3L9VA 3ZLPA 5E4WA 4TR1A 1LBKA 2V6KA 2H8LA 1TP9A 4O92A 1WOUA 1JZRA 1TJDA 3KEBA 5G5FA 4LL1B 4KSOA 1K3YA 1MD4A 3A3TA 2CZ3A 3QCPA 5DAKA 1M3IA 2IIYA 5B6NA 2K6VA 2E0QA 2YPMA 3SBCA 3HXSA 3EURA 2HRAA 4TXOA 1HNBA 1X9WB 2C0GA 2GSSA 1V2AA 3R2QA 3RPNA 3NOFA 4PURA 3P90A 3H4KA 1A2MA 4MA9A 1FG4A 4ZBDA 3ZMKA 4HOJA 4K2DA 3A5WA 5HR0A 2ON5A 3FHKA 3IXRA 4K5RA 3UMAA 1K0OA 2P0GA 13GSA 2VLVA 1XIYA 1K3OA 2OADA 2XHFA 1SKWB 2P31A 1K0BA 3KP8A 2MYGA 3UEMA 4PNFA 1AIUA 2C0DA 2JL4A 2FY6A 1TW9A 1F3BA 3IK7A 2B6MA 1S3CA 3KMOA 3D21A 12GSA 1SD8A 3HVVA 4CHSA 3KM6A 5IMFA 1DBYA 5DJMA 5DBQA 2F51A 4F0BA 4ZBAA 4OFNA 5A4WA 2OA7A 3G9BA 4IBPA 5H5RA 3GX0A 1TK5B 3US3A 5F0GA 3M1GA 4O7HA 2GQKA 3H93A 5G30A 5DQYA 3J7Yb 1RQMA 4DSSA 1V57A 1F2EA 4BPYA 1WMJA 1FW1A 2B5EA 5JCUA 3IAM2 5DCHA 3TDGA 1A23A 1W89A 4KCAA 3TJKA 1SKRB 4ZB8A 1ZZYA 22GSA 2L4QA 4TRXA 2CVDA 2A4VA 2K8VA 5HR3A 3UBLA 5B7CA 2X4AA 2VL2C 3GTUA 2PBJA 4JE1A 1DSBA 2CVBA 5F05A 2H1BA 1C72A 4IW9A 3MAKA 3FZ5A 2H01A 4PGTA 1UVZA 2X99A 1EOHA 3MNGA 4HEA2 3EC3A 2GQMA 3CQFA 5KN2A 1A2LA 2WRTA 3VK9A 4AJ6A 1Y6EA 5D96A 3SWLA 5JWRB 3D22A 3TJFA 3DIEA 3F3RA 3HY2A 3P2AA 3Q18A 4GF0A 2L5LA 4NWYA 1QQ2A 4XS6A 3DRNA 3VFIA 1OKDA 4TXVA 4HS1A 4NV5A 2H1GA 3KD0A 4BVXB 4E8HA 1SK1A 3VWXA 5GAPD 2GT5A 1M3JA 4ZILA 5IO0A 2VCWA 2VLUA 1PL2A 2ZNMA 1XW6A 3QDNA 2LJRA 5IQYA 3QAWA 4K7OA 1Z5YE 5LNKe 3FYGA 1MDJA 3QAVA 4JEDA 1ZCPA 1UC7A 3HA9A 4IJIA 4HU7A 5D93A 1O6JA 2HSMA 3O6TA 2L57A 3VWUA 2VO4A 3BD2A 2I9HA 5HFGA 4E8EA 2H66A 2H1AA 4HSCX 2A4HA 3ME7A 3EWLA 1SL0B 1X5EA 4MDCA 1N2AA 2AYTA 1I9DA 2VL3A 2KHPA 1O7UA 2YJHA 1YF1A 4YAPA 1A8YA 1FHEA 3KCMA 3TJBA 2TRXA 2GSTA 4XRDA 2FCHA 2R2JA 1ZOFA 3KIJA 1QK8A 1I5GA 2OACA 1AUCA 2PUKC 6GSYA 1GSDA 2PPTA 2VCTA 3GNJA 2X8GA 4K0GA 5F06A 1H75A 3H79A 4F03A 1FB6A 4K7IA 2B7KA 3EMXA 4PUFC 5DALA 3L9SA 2XPDA 5IOWA 2CT6A 1A0FA 1WPIA 1YEPA 2L6DA 3F0IA 1BAYA 1NM3A 2R4VA 4IS0A 4K6XA 1M2DA 2WJUA 3GYKA 2H30A 3L9UA 5EL8A 3K8NA 2BMXA 1XBSA 3GRXA 3UARA 3FK8A 2DJ1A 2BTOT 1SL1B 3TKSA 5CYYA 1NHOA 3ZIJA 1X9SB 4ZIJA 2GQLA 3GHAA 2VM2A 2GZYA 1FOHA 2YCDA 4BWSA 1Z7RA 3FR6A 4USSA 3D6IA 2MZCA 1FB0A 3EU4A 4PX1A 4KW6A 2WFCA 2ALBA 3TKSE 3RDWA 1T8EB 1M99A 3GKXA 4WBRD 4Z2UA 1M9AA 3ZVJD 1OC8A 1KTEA 4PUAA 2C3NA 4FH8A 4Z2RA 4ECIA 3RPPA 2R37A 4XCSA 2QGVA 1IYHA 3C7MA 4OMVA 1X9MB 3KXOA 3G7IA 3U6VA 1TRWA 4KNDA 2REMA 2WCIA 1PA3A 1R4WA 4POBA 2QA1A 5HR2A 3IR4A 4I2UA 4WR4A 2JSYA 4LMVA 3LWAA 4TXOB 1U88A 1GTAA 2FA8A 1GSFA 4IQ1A 2VOCA 5D9TA 1ZMAA 1GP1A 1NW2A 1QMVA 1B4PA 1Z9HA 2VUPA 3VWWA 4WF4A 4KDUA 1Z6NA 1PGTA 3UBKA 4ECCA 1SK0A 4X0XA 3LYPA 1KNGA 1QUWA 1EV4A 5CP1A 1K0AA 2WS2A 4J57E 5CNWA 1O8WA 4YKFA 3TGZA 1V58A 3J7Yk 2OE3A 1FO5A 3HVNA 4K2XA 2IMFA 3E9JB 3TOTA 2GTUA 3HYPA 3L0HA 3A2VA 2LNSA 3UIWA 3HJMA 2DBCA 5A4UA 1XOAA 2HYXA 2R5GA 4LMWA 3E3EA 4MF7A 1M0UA 3F9UA 2P5RA 1S3DA 2HNLA 4RQXA 4IJ3A 4ZBBA 3TKQA 3VPQA 3FRCA 3Q19A 1XWCA 3FY7A 2YV9A 1GUMA 3FEUA 2EIQA 4MJBA 2VL2A 4POLA 3WGEA 3TRQA 1BEDA 5C04A 1PFOA 2KUCA 3RAZA 2EC4A 5IPHA 5FT3A 1VF4A 3UVTA 3BBYA 3KJYA 1E6BA 1TKDB 2GVPA 5G2ZA 1USBA 5ECMB 4F2IA 4IGJA 3BJ5A 3F6FA 3ZZXA 1O81A 5JWOB 2RLIA 3DKSA 2M46A 3CSJA 3KTLA 2FUG2 3QAGA 4N0VA 1GSQA 2HXKA 4LA1A 5H5SA 2IMEA 3FMWA 1GL8A 4X4JA 3F4TA 4J56E 3LORA 4GCIA 5D9XA 2WULA 3TRXA 4EL1A 2NPBA 1HQOA 4KH7A 5DVBA 4GSTA 2LQQA 3KH9A 2VAFA 4L0UA 3GIXA 3GKKA 5ID2A 1KBNA 2GSRA 2C8UA 4WKWA 4PQ1A 5HFKA 4IHUA 3FZ9A 1UA5A 6GSTA 2YOIA 1HYUA 4ML6A 3Q6OA 3D4MA 1TU8A 2LRCA 1PMTA 1A2JA 3LEFA 3IA1A 4JRRA 1M2AA 4X1UA 1V9WA 3IAS2 3ZVJA 2DJ2A 1AW9A 3MYDA 4ZXGA 3FZAA 1HNCA 3APQA 3O76A 1TRSA 5BMUA 1EP7A 2MBSA 3DXBA 4EO3A 5EVOA 4F0CA 2YV7A 5ECRB 4A5PA 2FWHA 3LXTA 2AB6A 2B7JA 3QFBC 3IRAA 1ZYNA 4G0KA 2V1MA 4DSRA 2ON7A 1K0DA 1A0RP 4PQHA 4EC0A 1PKWA 3DMLA 1OC9A 1K0MA 4KE3A 3TKPA 1EGOA 4XS4A 4NHWA 4ZL8A 3TOUA 1B9XC 1F9MA 5AISA 5A4VA 1YEXA 4EIPA 1DUGA 4AJ7A 4AJ8A 1TU7A 1LJRA 4ID0A 5AGYA 2GS3A 2H71A 1TTZA 4G2EA 17GSA 3IK9A 3P7XA 1K0CA 1UN2A 4O32A 4MH2A 1G0TA 5F07A 2ZUPA 1XW9A 1CQHA 2VCXA 4EIQA 1TRUA 4I97A 4WETA 1XOBA 2GGTA 2OE0A 4EE0A 4N10A 1E2YA 3W8SA 3D5JA 4TR4A 5CRHA 4POMA 1TK0B 3MSZA 1GSUA 2HZEA 4G19A 4O5QA 4OWYA 3GN3A 5ECKB 1W4VA 4PQIA 5BRTA 4ZL7A 4OFTA 1ST9A 4I8BA 4IN0A 4D73B 5GZZB 4JZQA 1VF3A 4MJCA 2V2GA 4POKA 4MPFA 3G7YA 2Z9SA 1X0RA 3GMFA 2HSYA 4OCFA 2JZRA 1GTUA 1HNAA 3CMIA 2DLXA 2YZUA 3LW9A 2H74A 5IOXA 5ELAA 3CYNA 2B1KA 2GSQA 2F3MA 4KDYA 4L5OA 3C1SA 4N30A 1GTBA 6GSXA 1VF2A 3G7JA 3LYKA 2FGXA 3IC4A 3EU3A 11GSA 1G7EA 1JZOA 3HJOA 3ISOA 2LV3A 3F4RA 4KX4A 2IMDA 1XVWA 2N5AA 2I1UA 2JU5A 2H70A 2NVLA 1YKCA 5B8BA 2AHEA 1JZDA 1SL2B 3GSTA 2CX3A 3HDCA 5JCWA 5E59A 3TCOA 4DSQA 2OBKA 2LNTA 2V41A 2QKEA 3TB2A 2VIMA 2GT6A 3I9V2 3HJPA 2A2RA 4FIWA 2IPAA 3CSIA 3QPMA 5KN1A 3GL5A 1ZYEA 3EINA 5ECPB 4I2TA 3ERFA 2X64A 2H76A 4LL4B 1YZXA 2RIIA 5D8IA 3UJ1A 4ICYA 4YQUA 2FA4A 2VCVA 1A8LA 1SJ6A 2B1LA 2LJAA 5ECQB 1GUHA 1V98A 2L4CA 1EOGA 1EWXA 2FNOA 5AIVA 4MZBA 6GSVA 1PN0A 3ZYWA 2M72A 4CDOA 2JACA 3H8QA 4KSMA 4V2LA 4JR4A 1PX7A 1RK4A 1ERVA 3CSHA 4X43A 4V1Ap 2IFQB 3Q74A 1SK2A 2BJXA 3UL3A 1GLPA 1URMA 4F9ZA 2HT9A 3WGXA 1JFUA 1BX9A 3ED3A 5D9VA 3ZFBA 2P5QA 2A2PA 4JU5A 2YP6A 4P3YB 1IYIA 3N5OA 3ZIVA 3MIXA 1K3LA 3FR3A 4PTSA 1O8XA 1V40A 5ECIB 5F8BA 1XPVA 4PNGA 1OYJA 1GULA 3C73A 2O89A 1G6WA 2D2ZA 4XRAA 4WR5A 2C3QA 3EE2A 4YQMA 5B6MA 2VCQA 3MWHA 1YQ1A 1GSYA 2DJ3A 4K0NA 3W6GA 1U3IA 3HZ8A 2FHEA 5HR1A 1XWKA 1FVJA 4NAXA 2LKUA 2KP2A 4BL7B 1WE0A 3I43A 3I69A 3GL3A 4I5QA 1ILOA 5DQSA 4N0ZA 2HSHA 2FD3A 3BOAA 2LJKA 3E0UA 5DCGA 1TOFA 2G0FA 1YKAA 1SENA 2YWIA 1Z3EA 3HHVA 2JSZA 4FYCA 4HUAA 4BVYB 4QQ7A 3VI5A 5INYA 2VL9A 1XCCA 4GSSA 1MDIA 5IMAA 5D9WA 4F82A 2IMKA 3AY8A 3DVXA 3DVWA 4TVEA 4TR1B 4MMMA 2LEGA 3M3MA 4HQZA 4HU9A 1ZL9A 2H6XA 2RM5A 4EVMA 5DAKB 1PQNA 1R5PA 4K7NA 5ELGA 2YN1A 4O5RA 2XBQA 5HFIA 3QR6A 4ILFA 2YNXA 3WD6A 1EGRA 3TJJA 3S9FA 2V32A 4G0IA 2IJYA 1T4YA 5CAXA 3GA4A 4GTUA 5ECHB 2QSIA 3CRTA 5KOXA 4ZL9A 1ERWA 3APSA 3DGQA 2RUFA 3W8JA 3FR9A 2HE3A 5KN3A 1XXUA 3LGCA 2KOKA 5DJLA 1JLWA 3HVXA 1OC9B 3IOSA 2K9FA 3FZ4A 1GNEA 2UZ8A 4K8MA 1SYXA 2A2SA 2DMLA 3QMXA 3ZRDA 1F37A 4K1FA 1J0FA 1X5DA 3PINA 5IMDA 2YZHA 1MEKA 2DKIA 4CY8A 3ZL5A 4RI6A 2ZCTA 4EDZA 2YWNA 4HQSA 1XWGA 2JADA 4WBJA 1THXA 5FHIA 1DE2A 3KMNA 3PH9A 4OO4A 5B8AA 5J9CA 3L78A 4JR6A 2EIOA 3F63A 4GSNA 2WZ9A 2QA2A 1DE1A 4WF5A 4DSSB 4ACSA 7GSSA 3TUEA 4L0WA 5G5EA 1JHBA 3IE3A 3GH9A 4MLYA 5JCGA 3QOUA 3ERWA 2CVKA 3RHBA 2C0EA 3ERGA 1U3AA 4TW5A 5D73A 8GSSA 2R0PA 3C1RA 3WT2A 3KTBA 3GTUB 2H19A 4MABA 3UVHA 3O3TA 2CV4A 1FOVA 5IO2A 2FLSA 2X8CA 2YJ7A 5AIXA 2B5XA 5CRGA 3ZREA 1AAZA 3V1WA 2JZSA 2WB9A 1BYEA 3JCML 2OKAA 4K5SA 3CTFA 2HZFA 2DC5A 4H86A 1GSSA 10GSA 3HKRA 1J9BA 3VLNA 1OVNA 4BWQA 1YDKA 5LCZA 2FWFA 4QL9A 4YKGA 4TR3A 4HZ2A 3NZNA 4KA0A 4ULXA 2MMAA 2HI7A 5ABRA 1Q98A 2FWGA 3FW2A 3FKFA 1ABAA 4G9HA 3VPTA 3R3EA 4AF2A 2IMIA 5G1KA 2VCZA 5EY6A 3TRPA 3F4SA 3LQ7A 3IPZA 1ZYPA 1X5CA 1Z7PA 2R3XA 4V1Ag 4K9ZA 1OKTA 1T00A 3GUSA 4NHZA 4HJMA 3I6AA 3GSSA 3KP9A 2PVQA 3IBHA 2NDOA 4WEYA 1T3BA 2L6CA 2QC7A 1B48A 1TI1A 2M80A 2E7PA 2EIRA 1WIKA 5IMZA 1THOA 4BIKA 1ERUA 3KZQA 1FVKA 2MMNA 4EF0A 2DSAA 3D4TA 2O7KA 1GNWA 1R5AA 1NHYA 2LRTA 5IMVA 3VI7A 3VURA 1PD21 4MF6A 1VRSD 2E2MA 1Z6MA 4BA7A 3GH6A 5IMCA 3EYTA 2H1DA 1QGVA 3LJRA 1G6YA 2DMMA 1OE8A 4FO5A 1O73A 1ACVA 1VGLA 2H75A 3BCIA 1EP8A 2B3SA 1WWJA 2H0IA 3LSZA 5J5NA 5CO3A 5DALB 18GSA 5J9BA 4Q5QA 2N5BA 1JLVA 4ECBA 3EPTA 2LTKA 19GSA 1YF0A 4KDXA 3M0FA 3HVSA 2MMOA 5IIZA 4Z2TA 3M8NA 5ENUA 1XVQA 1EV9A 4FQUA 5L71A 2OE1A 2LS5A 1AC1A 3HZ4A 1ERTA 3GKMA 4MNNA 5ECLB 1NSWA 1TRVA 1PL1A 2X8HA 3PGTA 20GSA 1F3AA 3DWVA 2PN8A 1U6TA 2F8FA 3GV1A 3TKRA 4MPGA 4IELA 1QXHA 3IHGA 1ML6A 4ISDA 1ZYQB 2I4AA 2HRKA 2J9HA 2H6YA 3P8WA 2H73A 2O8VB 5KOWA 3LFLA 4Q5FA 2NBSA 1CQGA 3M9JA 2H0GA 3WYWA 4OFMA 2RUEA 5GAND 1AQXA 2B5YA 4MZWA 2LSTA 4MJEA 2YANA 4FYBA 3IC8A 1JZWA 5ECOB 4TOPA 1SJZA 9GSSA 3N9JA 1GRXA 1PX6A 1XG8A 5HQPA 1BQ7A 1Q4JA 3WT1A 4CW9A 6GSWA 1TXXA 3APOA 4EUYA 2AAWA 1K0NA 4Q5RA 1H4OA 2I81A 4MZCA 4IP1A 2NTOA 3C8EA 2HFDA 3KH7A 2J23A 3C71A 4OO5A 2VD1A 4GWRA 4HJ2A 1T4ZA 2KLXA 5CREA 1TK8B 3RHCA 3WGDA 5FWGA 2R0CA 4GXZA 1SU9A 2IL3A 3EMPA 4TN8A 3CRUA 3DD3A 3HCZA 1G7OA 4TR0A 2C3TA 4V2NA 2O85A 1LU4A 3D0ZA 2N5FA 4DEJA 3F6DA 3LG6A 3RBTA 2MMZA 4KGIA 1GWCA 2CZ2A 4GRFA 1WJKA 2CA8A 2VM1A 5J4UA 1GUKA 3QD9A 1GTIA 3CBUA 3IHQA 5CRWA 2R6KA 3TJGA 3UAPA 4MH3A 3PPUA 1XW5A 1B4QA 1PN9A 3CTGA 5G1LA 1S3RA 2L59A 3VWVA 1WRYA 1FAAA 1XFLA 2PMTA 4HDEA 4J2FA 5ECNB 2PU9C 2E2GA 1M2BA 4HZ4A 2C4JA 2L5OA 1MTCA 2LUSA 3ZITA 2PGTA 1SKSB 4D73A 3DEXA 1F6MC 2DIYA 1MD3A 4DVCA 4WXTA 2DJKA 2WGRA 3NIVA 1AXDA 4GLTA 4AGSA 2DKHA 4CY6A 1SYRA 4FYUA 3IDVA 1EEJA 2FWEA 6GSUA 3F8UA 4ML1A 2GZPA 5GSSA 1XWAA 3GFKA
chains in the Genus database with same CATH topology
3F3QA 1GH2A 1PRXA 4IP6A 2AUVA 1OAZA 3GURA 4I6XA 4KAEA 4MK3A 4OD7A 5COHA 3PR8A 4XTSA 2DIZA 3QFAC 3A2XA 4KB3A 1OE7A 1S3AA 2CX4A 4NXIA 4MCUA 4YH2A 4MJAA 1TDIA 2IN3A 1GLQA 4ZB9A 3A5IA 4NV2A 1SD9A 5H5QA 5KN0A 2HRNA 2XC2A 2PERA 14GSA 5EPFA 3OR5A 5KEJA 3U5RE 5J41A 1B8XA 4BVXA 2DJ0A 5ID2B 2K8SA 2I3YA 4KF9A 2X49A 2GDRA 1PSQA 4G0LA 2C80A 2LRNA 1EEMA 1M9BA 2C1YA 3L4NA 1M7TA 2F8AA 3HD5A 2CQ9A 4IKHA 1A24A 2HRFA 4YAVA 4G10A 2MBTA 4EKZA 16GSA 1ON4A 5ECSA 5AN1A 4ECJA 1WP0A 2GZZA 2HLSA 4N11A 4JBBA 1Y25A 3GKNA 2RM6A 3DYRA 1MDKA 5G31A 2PVOC 1XWBA 2XBIA 4RQRA 4O5UA 2OJLA 1VF1A 1YJ6A 4L5LA 4NMUA 4XIHA 2DJJA 2AV4A 1R7HA 4NPBA 1J08A 4HI7A 4XS4B 3ZTLA 2TRCP 2TIRA 2JZTA 4ZB6A 2YWOA 1O85A 1T1VA 1OC3A 4V2MA 2IFQA 5J3RA 1N8JA 5A5KA 1YY7A 1U87A 1AQWA 4RI7A 3MDKA 2AJQB 3A2WA 4PXOA 1AQVA 3ZMLA 4EDYA 2WDUA 2PWJA 6GSSA 2CAIA 2XPEA 1BG5A 3CXGA 5IM9A 4IVFA 4GQFA 2H0HA 1ZGNA 1BJXA 3ME8A 3EVIA 2YWMA 2CAQA 2O87A 4Q5NA 1EZKA 1QFNA 2C0FA 4L8EA 1XZOA 4YQVA 2OBIA 4KUNA 4KCEA 2HZEB 1SJIA 2IWTA 2V6OA 2GLRA 5IPGA 1T7PB 5JWQB 2H72A 3GX8A 3ZFLA 5C00A 5GSTA 2F9SA 1HD2A 4TKYA 3BCKA 4LLRA 2VLTA 1B9YC 2H6ZA 4Z7XA 4BL7A 2LQOA 4XHMA 3M9KA 1GSEA 1KEBA 5LD0A 4EXJA 5CRDA 4GQCA 3LXZA 2KP1A 3H1NA 2VD0A 2K18A 4QL7A 1RW1A 3UOMA 1PKZA 3IV4A 2ES7A 3KGKA 4MF5A 4OCEA 4RUVA 2R0GA 1TI3A 4IQAA 4XS1A 4BVYA 5DDLA 3TKSC 2G2QA 1R26A 4MP4A 3L9VA 3ZLPA 5E4WA 4TR1A 1LBKA 2V6KA 2H8LA 1TP9A 4O92A 1WOUA 1JZRA 1TJDA 3KEBA 5G5FA 4LL1B 4KSOA 1K3YA 1MD4A 3A3TA 2CZ3A 3QCPA 5DAKA 2IIYA 5B6NA 2K6VA 2E0QA 2YPMA 3SBCA 3HXSA 3EURA 2HRAA 4TXOA 1HNBA 1X9WB 2C0GA 2GSSA 1V2AA 3R2QA 3RPNA 3NOFA 4PURA 3P90A 3H4KA 1A2MA 4MA9A 1FG4A 4ZBDA 3ZMKA 4HOJA 4K2DA 3A5WA 5HR0A 2ON5A 3FHKA 3IXRA 4K5RA 3UMAA 1K0OA 2P0GA 13GSA 2VLVA 1XIYA 1K3OA 2OADA 2XHFA 1SKWB 2P31A 1K0BA 3KP8A 2MYGA 3UEMA 4PNFA 1AIUA 2C0DA 2JL4A 2FY6A 1TW9A 1F3BA 3IK7A 2B6MA 1S3CA 3KMOA 3D21A 12GSA 1SD8A 3HVVA 4CHSA 3KM6A 5IMFA 1DBYA 5DJMA 5DBQA 2F51A 4F0BA 4ZBAA 4OFNA 5A4WA 2OA7A 3G9BA 4IBPA 5H5RA 3GX0A 1TK5B 3US3A 5F0GA 3M1GA 4O7HA 2GQKA 3H93A 5G30A 5DQYA 3J7Yb 1RQMA 4DSSA 1V57A 1F2EA 4BPYA 1WMJA 1FW1A 2B5EA 5JCUA 3IAM2 5DCHA 3TDGA 1A23A 1W89A 4KCAA 3TJKA 1SKRB 4ZB8A 1ZZYA 22GSA 2L4QA 4TRXA 2CVDA 2A4VA 2K8VA 5HR3A 3UBLA 5B7CA 2X4AA 2VL2C 3GTUA 2PBJA 4JE1A 1DSBA 2CVBA 5F05A 2H1BA 1C72A 4IW9A 3MAKA 3FZ5A 2H01A 4PGTA 1UVZA 2X99A 1EOHA 3MNGA 4HEA2 3EC3A 2GQMA 5KN2A 1A2LA 2WRTA 3VK9A 4AJ6A 1Y6EA 5D96A 3SWLA 5JWRB 3D22A 3TJFA 3DIEA 3F3RA 3HY2A 3P2AA 3Q18A 4GF0A 2L5LA 4NWYA 1QQ2A 4XS6A 3DRNA 3VFIA 1OKDA 4TXVA 4HS1A 4NV5A 2H1GA 3KD0A 4BVXB 4E8HA 1SK1A 3VWXA 5GAPD 2GT5A 4ZILA 5IO0A 2VCWA 2VLUA 1PL2A 2ZNMA 1XW6A 3QDNA 2LJRA 5IQYA 3QAWA 4K7OA 1Z5YE 5LNKe 3FYGA 1MDJA 3QAVA 4JEDA 1ZCPA 1UC7A 3HA9A 4IJIA 4HU7A 5D93A 1O6JA 2HSMA 3O6TA 2L57A 3VWUA 2VO4A 3BD2A 2I9HA 5HFGA 4E8EA 2H66A 2H1AA 2A4HA 3ME7A 3EWLA 1SL0B 1X5EA 4MDCA 1N2AA 2AYTA 1I9DA 2VL3A 2KHPA 1O7UA 2YJHA 1YF1A 4YAPA 1A8YA 1FHEA 3KCMA 3TJBA 2TRXA 2GSTA 4XRDA 2FCHA 2R2JA 1ZOFA 3KIJA 1QK8A 1I5GA 2OACA 1AUCA 2PUKC 6GSYA 1GSDA 2PPTA 2VCTA 3GNJA 2X8GA 4K0GA 5F06A 1H75A 3H79A 4F03A 1FB6A 4K7IA 2B7KA 3EMXA 4PUFC 5DALA 3L9SA 2XPDA 5IOWA 2CT6A 1A0FA 1WPIA 1YEPA 2L6DA 3F0IA 1BAYA 1NM3A 2R4VA 4IS0A 4K6XA 1M2DA 2WJUA 3GYKA 2H30A 3L9UA 5EL8A 3K8NA 2BMXA 1XBSA 3GRXA 3UARA 3FK8A 2DJ1A 2BTOT 1SL1B 3TKSA 5CYYA 1NHOA 3ZIJA 1X9SB 4ZIJA 2GQLA 3GHAA 2VM2A 2GZYA 1FOHA 2YCDA 4BWSA 1Z7RA 3FR6A 4USSA 3D6IA 2MZCA 1FB0A 3EU4A 4PX1A 4KW6A 2WFCA 2ALBA 3TKSE 3RDWA 1T8EB 1M99A 3GKXA 4WBRD 4Z2UA 1M9AA 3ZVJD 1OC8A 1KTEA 4PUAA 2C3NA 4FH8A 4Z2RA 4ECIA 3RPPA 2R37A 4XCSA 2QGVA 1IYHA 3C7MA 4OMVA 1X9MB 3KXOA 3G7IA 3U6VA 1TRWA 4KNDA 2REMA 2WCIA 1PA3A 1R4WA 4POBA 2QA1A 5HR2A 3IR4A 4I2UA 4WR4A 2JSYA 4LMVA 3LWAA 4TXOB 1U88A 1GTAA 2FA8A 1GSFA 4IQ1A 2VOCA 5D9TA 1ZMAA 1GP1A 1NW2A 1QMVA 1B4PA 1Z9HA 2VUPA 3VWWA 4WF4A 4KDUA 1Z6NA 1PGTA 3UBKA 4ECCA 1SK0A 4X0XA 3LYPA 1KNGA 1QUWA 1EV4A 5CP1A 1K0AA 2WS2A 4J57E 5CNWA 1O8WA 4YKFA 3TGZA 1V58A 3J7Yk 2OE3A 1FO5A 4K2XA 2IMFA 3E9JB 3TOTA 2GTUA 3HYPA 3L0HA 3A2VA 2LNSA 3UIWA 3HJMA 2DBCA 5A4UA 1XOAA 2HYXA 2R5GA 4LMWA 3E3EA 4MF7A 1M0UA 3F9UA 2P5RA 1S3DA 2HNLA 4RQXA 4IJ3A 4ZBBA 3TKQA 3VPQA 3FRCA 3Q19A 1XWCA 3FY7A 2YV9A 1GUMA 3FEUA 2EIQA 4MJBA 2VL2A 4POLA 3WGEA 3TRQA 1BEDA 5C04A 2KUCA 3RAZA 2EC4A 5IPHA 5FT3A 1VF4A 3UVTA 3BBYA 3KJYA 1E6BA 1TKDB 2GVPA 5G2ZA 1USBA 5ECMB 4F2IA 4IGJA 3BJ5A 3F6FA 3ZZXA 1O81A 5JWOB 2RLIA 3DKSA 2M46A 3CSJA 3KTLA 2FUG2 3QAGA 4N0VA 1GSQA 2HXKA 4LA1A 5H5SA 2IMEA 3FMWA 1GL8A 4X4JA 3F4TA 4J56E 3LORA 4GCIA 5D9XA 2WULA 3TRXA 4EL1A 2NPBA 1HQOA 4KH7A 5DVBA 4GSTA 2LQQA 3KH9A 2VAFA 4L0UA 3GIXA 3GKKA 5ID2A 1KBNA 2GSRA 2C8UA 4WKWA 4PQ1A 5HFKA 4IHUA 3FZ9A 1UA5A 6GSTA 2YOIA 1HYUA 4ML6A 3Q6OA 3D4MA 1TU8A 2LRCA 1PMTA 1A2JA 3LEFA 3IA1A 4JRRA 1M2AA 4X1UA 1V9WA 3IAS2 3ZVJA 2DJ2A 1AW9A 3MYDA 4ZXGA 3FZAA 1HNCA 3APQA 3O76A 1TRSA 5BMUA 1EP7A 2MBSA 3DXBA 4EO3A 5EVOA 4F0CA 2YV7A 5ECRB 4A5PA 2FWHA 3LXTA 2AB6A 2B7JA 3QFBC 3IRAA 1ZYNA 4G0KA 2V1MA 4DSRA 2ON7A 1K0DA 1A0RP 4PQHA 4EC0A 1PKWA 3DMLA 1OC9A 1K0MA 4KE3A 3TKPA 1EGOA 4XS4A 4NHWA 4ZL8A 3TOUA 1B9XC 1F9MA 5AISA 5A4VA 1YEXA 4EIPA 1DUGA 4AJ7A 4AJ8A 1TU7A 1LJRA 4ID0A 5AGYA 2GS3A 2H71A 1TTZA 4G2EA 17GSA 3IK9A 3P7XA 1K0CA 1UN2A 4O32A 4MH2A 1G0TA 5F07A 2ZUPA 1XW9A 1CQHA 2VCXA 4EIQA 1TRUA 4I97A 4WETA 1XOBA 2GGTA 2OE0A 4EE0A 4N10A 1E2YA 3W8SA 3D5JA 4TR4A 5CRHA 4POMA 1TK0B 3MSZA 1GSUA 2HZEA 4G19A 4O5QA 4OWYA 3GN3A 5ECKB 1W4VA 4PQIA 5BRTA 4ZL7A 4OFTA 1ST9A 4I8BA 4IN0A 4D73B 5GZZB 4JZQA 1VF3A 4MJCA 2V2GA 4POKA 4MPFA 3G7YA 2Z9SA 1X0RA 3GMFA 2HSYA 4OCFA 2JZRA 1GTUA 1HNAA 3CMIA 2DLXA 2YZUA 3LW9A 2H74A 5IOXA 5ELAA 3CYNA 2B1KA 2GSQA 2F3MA 4KDYA 4L5OA 3C1SA 4N30A 1GTBA 6GSXA 1VF2A 3G7JA 3LYKA 2FGXA 3IC4A 3EU3A 11GSA 1G7EA 1JZOA 3HJOA 3ISOA 2LV3A 3F4RA 4KX4A 2IMDA 1XVWA 2N5AA 2I1UA 2JU5A 2H70A 2NVLA 1YKCA 5B8BA 2AHEA 1JZDA 1SL2B 3GSTA 2CX3A 3HDCA 5JCWA 5E59A 3TCOA 4DSQA 2OBKA 2LNTA 2V41A 2QKEA 3TB2A 2VIMA 2GT6A 3I9V2 3HJPA 2A2RA 4FIWA 2IPAA 3CSIA 3QPMA 5KN1A 3GL5A 1ZYEA 3EINA 5ECPB 4I2TA 3ERFA 2X64A 2H76A 4LL4B 1YZXA 2RIIA 5D8IA 3UJ1A 4ICYA 4YQUA 2FA4A 2VCVA 1A8LA 1SJ6A 2B1LA 2LJAA 5ECQB 1GUHA 1V98A 2L4CA 1EOGA 1EWXA 2FNOA 5AIVA 4MZBA 6GSVA 1PN0A 3ZYWA 2M72A 4CDOA 2JACA 3H8QA 4KSMA 4V2LA 4JR4A 1PX7A 1RK4A 1ERVA 3CSHA 4X43A 4V1Ap 2IFQB 3Q74A 1SK2A 2BJXA 3UL3A 1GLPA 1URMA 4F9ZA 2HT9A 3WGXA 1JFUA 1BX9A 3ED3A 5D9VA 3ZFBA 2P5QA 2A2PA 4JU5A 2YP6A 4P3YB 1IYIA 3N5OA 3ZIVA 3MIXA 1K3LA 3FR3A 4PTSA 1O8XA 1V40A 5ECIB 5F8BA 1XPVA 4PNGA 1OYJA 1GULA 3C73A 2O89A 1G6WA 2D2ZA 4XRAA 4WR5A 2C3QA 3EE2A 4YQMA 5B6MA 2VCQA 3MWHA 1YQ1A 1GSYA 2DJ3A 4K0NA 3W6GA 1U3IA 3HZ8A 2FHEA 5HR1A 1XWKA 1FVJA 4NAXA 2LKUA 2KP2A 4BL7B 1WE0A 3I43A 3I69A 3GL3A 4I5QA 1ILOA 5DQSA 4N0ZA 2HSHA 2FD3A 3BOAA 2LJKA 3E0UA 5DCGA 1TOFA 2G0FA 1YKAA 1SENA 2YWIA 1Z3EA 3HHVA 2JSZA 4FYCA 4HUAA 4BVYB 4QQ7A 3VI5A 5INYA 2VL9A 1XCCA 4GSSA 1MDIA 5IMAA 5D9WA 4F82A 2IMKA 3AY8A 3DVXA 3DVWA 4TVEA 4TR1B 4MMMA 2LEGA 3M3MA 4HQZA 4HU9A 1ZL9A 2H6XA 2RM5A 4EVMA 5DAKB 1PQNA 1R5PA 4K7NA 5ELGA 2YN1A 4O5RA 2XBQA 5HFIA 3QR6A 4ILFA 2YNXA 3WD6A 1EGRA 3TJJA 3S9FA 2V32A 4G0IA 2IJYA 1T4YA 5CAXA 3GA4A 4GTUA 5ECHB 2QSIA 3CRTA 5KOXA 4ZL9A 1ERWA 3APSA 3DGQA 2RUFA 3W8JA 3FR9A 2HE3A 5KN3A 1XXUA 3LGCA 2KOKA 5DJLA 1JLWA 3HVXA 1OC9B 3IOSA 2K9FA 3FZ4A 1GNEA 2UZ8A 4K8MA 1SYXA 2A2SA 2DMLA 3QMXA 3ZRDA 1F37A 4K1FA 1J0FA 1X5DA 3PINA 5IMDA 2YZHA 1MEKA 2DKIA 4CY8A 3ZL5A 4RI6A 2ZCTA 4EDZA 2YWNA 4HQSA 1XWGA 2JADA 4WBJA 1THXA 5FHIA 1DE2A 3KMNA 3PH9A 4OO4A 5B8AA 5J9CA 3L78A 4JR6A 2EIOA 3F63A 4GSNA 2WZ9A 2QA2A 1DE1A 4WF5A 4DSSB 4ACSA 7GSSA 3TUEA 4L0WA 5G5EA 1JHBA 3IE3A 3GH9A 4MLYA 5JCGA 3QOUA 3ERWA 2CVKA 3RHBA 2C0EA 3ERGA 1U3AA 4TW5A 5D73A 8GSSA 2R0PA 3C1RA 3WT2A 3KTBA 3GTUB 2H19A 4MABA 3UVHA 3O3TA 2CV4A 1FOVA 5IO2A 2FLSA 2X8CA 2YJ7A 5AIXA 2B5XA 5CRGA 3ZREA 1AAZA 3V1WA 2JZSA 2WB9A 1BYEA 3JCML 2OKAA 4K5SA 3CTFA 2HZFA 2DC5A 4H86A 1GSSA 10GSA 3HKRA 1J9BA 3VLNA 1OVNA 4BWQA 1YDKA 5LCZA 2FWFA 4QL9A 4YKGA 4TR3A 4HZ2A 3NZNA 4KA0A 4ULXA 2MMAA 2HI7A 5ABRA 1Q98A 2FWGA 3FW2A 3FKFA 1ABAA 4G9HA 3VPTA 3R3EA 4AF2A 2IMIA 5G1KA 2VCZA 5EY6A 3TRPA 3F4SA 3LQ7A 3IPZA 1ZYPA 1X5CA 1Z7PA 2R3XA 4V1Ag 4K9ZA 1OKTA 1T00A 3GUSA 4NHZA 4HJMA 3I6AA 3GSSA 3KP9A 2PVQA 3IBHA 2NDOA 4WEYA 1T3BA 2L6CA 2QC7A 1B48A 1TI1A 2M80A 2E7PA 2EIRA 1WIKA 5IMZA 1THOA 1ERUA 3KZQA 1FVKA 2MMNA 4EF0A 2DSAA 3D4TA 2O7KA 1GNWA 1R5AA 1NHYA 2LRTA 5IMVA 3VI7A 3VURA 1PD21 4MF6A 1VRSD 2E2MA 1Z6MA 4BA7A 3GH6A 5IMCA 3EYTA 2H1DA 1QGVA 3LJRA 1G6YA 2DMMA 1OE8A 4FO5A 1O73A 1ACVA 1VGLA 2H75A 3BCIA 1EP8A 2B3SA 1WWJA 2H0IA 3LSZA 5J5NA 5CO3A 5DALB 18GSA 5J9BA 4Q5QA 2N5BA 1JLVA 4ECBA 3EPTA 2LTKA 19GSA 1YF0A 4KDXA 3M0FA 3HVSA 2MMOA 5IIZA 4Z2TA 3M8NA 5ENUA 1XVQA 1EV9A 4FQUA 5L71A 2OE1A 2LS5A 1AC1A 3HZ4A 1ERTA 3GKMA 4MNNA 5ECLB 1NSWA 1TRVA 1PL1A 2X8HA 3PGTA 20GSA 1F3AA 3DWVA 2PN8A 1U6TA 2F8FA 3GV1A 3TKRA 4MPGA 4IELA 1QXHA 3IHGA 1ML6A 4ISDA 1ZYQB 2I4AA 2HRKA 2J9HA 2H6YA 3P8WA 2H73A 2O8VB 5KOWA 3LFLA 4Q5FA 2NBSA 1CQGA 3M9JA 2H0GA 3WYWA 4OFMA 2RUEA 5GAND 1AQXA 2B5YA 4MZWA 2LSTA 4MJEA 2YANA 4FYBA 3IC8A 1JZWA 5ECOB 4TOPA 1SJZA 9GSSA 3N9JA 1GRXA 1PX6A 5HQPA 1BQ7A 1Q4JA 3WT1A 4CW9A 6GSWA 1TXXA 3APOA 4EUYA 2AAWA 1K0NA 4Q5RA 1H4OA 2I81A 4MZCA 4IP1A 2NTOA 3C8EA 2HFDA 3KH7A 2J23A 3C71A 4OO5A 2VD1A 4GWRA 4HJ2A 1T4ZA 2KLXA 5CREA 1TK8B 3RHCA 3WGDA 5FWGA 2R0CA 4GXZA 1SU9A 2IL3A 3EMPA 4TN8A 3CRUA 3DD3A 3HCZA 1G7OA 4TR0A 2C3TA 4V2NA 2O85A 1LU4A 3D0ZA 2N5FA 4DEJA 3F6DA 3LG6A 3RBTA 2MMZA 4KGIA 1GWCA 2CZ2A 4GRFA 1WJKA 2CA8A 2VM1A 5J4UA 1GUKA 3QD9A 1GTIA 3CBUA 3IHQA 5CRWA 2R6KA 3TJGA 3UAPA 4MH3A 3PPUA 1XW5A 1B4QA 1PN9A 3CTGA 5G1LA 2L59A 3VWVA 1WRYA 1FAAA 1XFLA 2PMTA 4HDEA 4J2FA 5ECNB 2PU9C 2E2GA 1M2BA 4HZ4A 2C4JA 2L5OA 1MTCA 2LUSA 3ZITA 2PGTA 1SKSB 4D73A 3DEXA 1F6MC 2DIYA 1MD3A 4DVCA 4WXTA 2DJKA 2WGRA 3NIVA 1AXDA 4GLTA 4AGSA 2DKHA 4CY6A 1SYRA 4FYUA 3IDVA 1EEJA 2FWEA 6GSUA 3F8UA 4ML1A 2GZPA 5GSSA 1XWAA 3GFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3Q A;  1GH2 A;  1PRX A;  4IP6 A;  2AUV A;  1OAZ A;  3GUR A;  4I6X A;  4KAE A;  4MK3 A;  4OD7 A;  5COH A;  3PR8 A;  4XTS A;  2DIZ A;  3QFA C;  3A2X A;  4KB3 A;  1OE7 A;  1S3A A;  2CX4 A;  4NXI A;  4MCU A;  4YH2 A;  4MJA A;  1TDI A;  2IN3 A;  1GLQ A;  4ZB9 A;  4NV2 A;  1SD9 A;  5H5Q A;  5KN0 A;  2HRN A;  2XC2 A;  2PER A;  14GS A;  5EPF A;  3OR5 A;  5KEJ A;  3U5R E;  5J41 A;  1B8X A;  4BVX A;  2DJ0 A;  5ID2 B;  2K8S A;  2I3Y A;  2GDR A;  1PSQ A;  2C80 A;  2LRN A;  1EEM A;  1M9B A;  2C1Y A;  3L4N A;  1M7T A;  2F8A A;  3HD5 A;  2CQ9 A;  4IKH A;  1A24 A;  2HRF A;  4YAV A;  4G10 A;  2MBT A;  4EKZ A;  16GS A;  1ON4 A;  5ECS A;  5AN1 A;  4ECJ A;  1WP0 A;  2GZZ A;  2HLS A;  4N11 A;  4JBB A;  1Y25 A;  3GKN A;  2RM6 A;  3DYR A;  1MDK A;  5G31 A;  2PVO C;  1XWB A;  2XBI A;  4RQR A;  2OJL A;  1VF1 A;  1YJ6 A;  4L5L A;  4NMU A;  4XIH A;  2DJJ A;  2AV4 A;  1R7H A;  4NPB A;  1J08 A;  4HI7 A;  4XS4 B;  3ZTL A;  2TRC P;  2TIR A;  2JZT A;  4ZB6 A;  2YWO A;  1O85 A;  1T1V A;  1OC3 A;  4V2M A;  2IFQ A;  5J3R A;  1N8J A;  5A5K A;  1YY7 A;  1U87 A;  1AQW A;  4RI7 A;  3MDK A;  2AJQ B;  3A2W A;  4PXO A;  1AQV A;  3ZML A;  4EDY A;  2WDU A;  2PWJ A;  6GSS A;  2CAI A;  2XPE A;  1BG5 A;  3CXG A;  5IM9 A;  4IVF A;  4GQF A;  2H0H A;  1ZGN A;  1BJX A;  3ME8 A;  3EVI A;  2YWM A;  2CAQ A;  2O87 A;  4Q5N A;  1EZK A;  1QFN A;  2C0F A;  4L8E A;  1XZO A;  4YQV A;  2OBI A;  4KUN A;  4KCE A;  2HZE B;  1SJI A;  2IWT A;  2V6O A;  2GLR A;  5IPG A;  1T7P B;  5JWQ B;  2H72 A;  3GX8 A;  3ZFL A;  5C00 A;  5GST A;  2F9S A;  1HD2 A;  4TKY A;  3BCK A;  4LLR A;  2VLT A;  1B9Y C;  2H6Z A;  4Z7X A;  4BL7 A;  2LQO A;  4XHM A;  3M9K A;  1GSE A;  1KEB A;  5LD0 A;  4EXJ A;  5CRD A;  4GQC A;  3LXZ A;  2KP1 A;  3H1N A;  2VD0 A;  2K18 A;  4QL7 A;  1RW1 A;  3UOM A;  1PKZ A;  3IV4 A;  2ES7 A;  3KGK A;  4MF5 A;  4OCE A;  4RUV A;  1TI3 A;  4IQA A;  4XS1 A;  4BVY A;  5DDL A;  3TKS C;  2G2Q A;  1R26 A;  4MP4 A;  3L9V A;  3ZLP A;  5E4W A;  4TR1 A;  1LBK A;  2V6K A;  2H8L A;  1TP9 A;  4O92 A;  1WOU A;  1JZR A;  1TJD A;  3KEB A;  5G5F A;  4LL1 B;  4KSO A;  1K3Y A;  1MD4 A;  3A3T A;  2CZ3 A;  3QCP A;  5DAK A;  2IIY A;  5B6N A;  2K6V A;  2E0Q A;  2YPM A;  3SBC A;  3HXS A;  3EUR A;  4TXO A;  1HNB A;  1X9W B;  2C0G A;  2GSS A;  1V2A A;  3R2Q A;  3RPN A;  3NOF A;  4PUR A;  3P90 A;  3H4K A;  1A2M A;  4MA9 A;  1FG4 A;  4ZBD A;  3ZMK A;  4HOJ A;  4K2D A;  3A5W A;  5HR0 A;  2ON5 A;  3FHK A;  3IXR A;  3UMA A;  1K0O A;  2P0G A;  13GS A;  2VLV A;  1XIY A;  1K3O A;  2OAD A;  2XHF A;  1SKW B;  2P31 A;  1K0B A;  3KP8 A;  2MYG A;  3UEM A;  4PNF A;  1AIU A;  2C0D A;  2JL4 A;  2FY6 A;  1TW9 A;  1F3B A;  3IK7 A;  2B6M A;  1S3C A;  3KMO A;  3D21 A;  12GS A;  1SD8 A;  3HVV A;  4CHS A;  3KM6 A;  5IMF A;  1DBY A;  5DJM A;  5DBQ A;  2F51 A;  4F0B A;  4ZBA A;  4OFN A;  5A4W A;  2OA7 A;  3G9B A;  4IBP A;  5H5R A;  3GX0 A;  1TK5 B;  3US3 A;  5F0G A;  3M1G A;  4O7H A;  2GQK A;  3H93 A;  5G30 A;  5DQY A;  3J7Y b;  1RQM A;  4DSS A;  1V57 A;  1F2E A;  4BPY A;  1WMJ A;  1FW1 A;  2B5E A;  5JCU A;  3IAM 2;  5DCH A;  3TDG A;  1A23 A;  1W89 A;  4KCA A;  3TJK A;  1SKR B;  4ZB8 A;  1ZZY A;  22GS A;  2L4Q A;  4TRX A;  2CVD A;  2A4V A;  2K8V A;  5HR3 A;  3UBL A;  5B7C A;  2VL2 C;  3GTU A;  2PBJ A;  4JE1 A;  1DSB A;  2CVB A;  5F05 A;  2H1B A;  1C72 A;  4IW9 A;  3MAK A;  3FZ5 A;  2H01 A;  4PGT A;  1UVZ A;  2X99 A;  1EOH A;  3MNG A;  4HEA 2;  3EC3 A;  2GQM A;  5KN2 A;  1A2L A;  2WRT A;  3VK9 A;  4AJ6 A;  1Y6E A;  5D96 A;  3SWL A;  5JWR B;  3D22 A;  3TJF A;  3DIE A;  3F3R A;  3HY2 A;  3P2A A;  3Q18 A;  4GF0 A;  2L5L A;  4NWY A;  1QQ2 A;  4XS6 A;  3DRN A;  3VFI A;  1OKD A;  4TXV A;  4HS1 A;  4NV5 A;  2H1G A;  3KD0 A;  4E8H A;  1SK1 A;  3VWX A;  5GAP D;  2GT5 A;  4ZIL A;  5IO0 A;  2VCW A;  2VLU A;  1PL2 A;  2ZNM A;  1XW6 A;  3QDN A;  2LJR A;  5IQY A;  3QAW A;  4K7O A;  1Z5Y E;  5LNK e;  3FYG A;  1MDJ A;  3QAV A;  4JED A;  1ZCP A;  1UC7 A;  3HA9 A;  4IJI A;  4HU7 A;  5D93 A;  1O6J A;  3O6T A;  2L57 A;  3VWU A;  2VO4 A;  3BD2 A;  2I9H A;  5HFG A;  4E8E A;  2H66 A;  2H1A A;  3ME7 A;  1SL0 B;  3EWL A;  1X5E A;  4MDC A;  1N2A A;  2AYT A;  1I9D A;  2VL3 A;  2KHP A;  1O7U A;  2YJH A;  1YF1 A;  4YAP A;  1A8Y A;  1FHE A;  3KCM A;  3TJB A;  2TRX A;  2GST A;  4XRD A;  2FCH A;  2R2J A;  1ZOF A;  3KIJ A;  1QK8 A;  1I5G A;  2OAC A;  1AUC A;  2PUK C;  6GSY A;  1GSD A;  2PPT A;  2VCT A;  3GNJ A;  2X8G A;  4K0G A;  5F06 A;  1H75 A;  3H79 A;  4F03 A;  1FB6 A;  4K7I A;  2B7K A;  3EMX A;  4PUF C;  5DAL A;  3L9S A;  2XPD A;  5IOW A;  2CT6 A;  1A0F A;  1WPI A;  1YEP A;  2L6D A;  3F0I A;  1BAY A;  1NM3 A;  2R4V A;  4IS0 A;  4K6X A;  1M2D A;  2WJU A;  3GYK A;  2H30 A;  3L9U A;  5EL8 A;  3K8N A;  2BMX A;  1XBS A;  3GRX A;  3UAR A;  3FK8 A;  2DJ1 A;  2BTO T;  1SL1 B;  3TKS A;  5CYY A;  1NHO A;  3ZIJ A;  1X9S B;  4ZIJ A;  2GQL A;  3GHA A;  2VM2 A;  2GZY A;  4BWS A;  2YCD A;  1Z7R A;  3FR6 A;  3D6I A;  2MZC A;  1FB0 A;  3EU4 A;  4PX1 A;  4KW6 A;  2WFC A;  2ALB A;  3TKS E;  3RDW A;  1T8E B;  1M99 A;  3GKX A;  4WBR D;  1M9A A;  3ZVJ D;  1OC8 A;  1KTE A;  4PUA A;  2C3N A;  4FH8 A;  4ECI A;  3RPP A;  2R37 A;  4XCS A;  2QGV A;  1IYH A;  3C7M A;  4OMV A;  1X9M B;  3KXO A;  3G7I A;  3U6V A;  1TRW A;  4KND A;  2REM A;  2WCI A;  1PA3 A;  1R4W A;  4POB A;  5HR2 A;  3IR4 A;  4I2U A;  4WR4 A;  2JSY A;  4LMV A;  3LWA A;  4TXO B;  1U88 A;  1GTA A;  2FA8 A;  1GSF A;  4IQ1 A;  2VOC A;  5D9T A;  1ZMA A;  1GP1 A;  1NW2 A;  1QMV A;  1B4P A;  1Z9H A;  2VUP A;  3VWW A;  4WF4 A;  4KDU A;  1Z6N A;  1PGT A;  3UBK A;  4ECC A;  1SK0 A;  4X0X A;  3LYP A;  1KNG A;  1QUW A;  1EV4 A;  5CP1 A;  1K0A A;  2WS2 A;  4J57 E;  5CNW A;  1O8W A;  3TGZ A;  1V58 A;  3J7Y k;  2OE3 A;  1FO5 A;  2IMF A;  3E9J B;  3TOT A;  2GTU A;  3HYP A;  3L0H A;  3A2V A;  2LNS A;  3UIW A;  3HJM A;  2DBC A;  5A4U A;  1XOA A;  2HYX A;  2R5G A;  4LMW A;  3E3E A;  4MF7 A;  1M0U A;  3F9U A;  2P5R A;  1S3D A;  2HNL A;  4RQX A;  4IJ3 A;  4ZBB A;  3TKQ A;  3VPQ A;  3FRC A;  3Q19 A;  1XWC A;  3FY7 A;  2YV9 A;  1GUM A;  3FEU A;  2EIQ A;  4MJB A;  2VL2 A;  4POL A;  3WGE A;  3TRQ A;  1BED A;  5C04 A;  2KUC A;  3RAZ A;  2EC4 A;  5IPH A;  5FT3 A;  1VF4 A;  3UVT A;  3BBY A;  3KJY A;  1E6B A;  1TKD B;  2GVP A;  5G2Z A;  1USB A;  5ECM B;  4F2I A;  4IGJ A;  3BJ5 A;  3F6F A;  3ZZX A;  1O81 A;  5JWO B;  2RLI A;  3DKS A;  2M46 A;  3CSJ A;  3KTL A;  2FUG 2;  3QAG A;  4N0V A;  1GSQ A;  2HXK A;  4LA1 A;  5H5S A;  2IME A;  1GL8 A;  3F4T A;  4J56 E;  3LOR A;  4GCI A;  5D9X A;  2WUL A;  3TRX A;  4EL1 A;  2NPB A;  1HQO A;  4KH7 A;  5DVB A;  4GST A;  2LQQ A;  3KH9 A;  2VAF A;  4L0U A;  3GIX A;  3GKK A;  5ID2 A;  1KBN A;  2GSR A;  2C8U A;  4WKW A;  4PQ1 A;  5HFK A;  4IHU A;  3FZ9 A;  1UA5 A;  6GST A;  2YOI A;  1HYU A;  4ML6 A;  3Q6O A;  3D4M A;  1TU8 A;  2LRC A;  1PMT A;  1A2J A;  3LEF A;  3IA1 A;  4JRR A;  1M2A A;  4X1U A;  1V9W A;  3IAS 2;  3ZVJ A;  2DJ2 A;  1AW9 A;  4ZXG A;  3FZA A;  1HNC A;  3APQ A;  3O76 A;  1TRS A;  1EP7 A;  2MBS A;  3DXB A;  4EO3 A;  5EVO A;  4F0C A;  2YV7 A;  5ECR B;  2FWH A;  3LXT A;  2AB6 A;  2B7J A;  3QFB C;  3IRA A;  2V1M A;  4DSR A;  2ON7 A;  1K0D A;  1A0R P;  4PQH A;  4EC0 A;  1PKW A;  3DML A;  1OC9 A;  1K0M A;  4KE3 A;  3TKP A;  1EGO A;  4XS4 A;  4NHW A;  4ZL8 A;  3TOU A;  1B9X C;  1F9M A;  5AIS A;  5A4V A;  1YEX A;  1DUG A;  4AJ7 A;  4AJ8 A;  1TU7 A;  1LJR A;  4ID0 A;  5AGY A;  2GS3 A;  2H71 A;  1TTZ A;  4G2E A;  17GS A;  3IK9 A;  3P7X A;  1K0C A;  1UN2 A;  4O32 A;  4MH2 A;  1G0T A;  5F07 A;  2ZUP A;  1XW9 A;  1CQH A;  2VCX A;  1TRU A;  4I97 A;  4WET A;  1XOB A;  2GGT A;  2OE0 A;  4EE0 A;  4N10 A;  1E2Y A;  3W8S A;  3D5J A;  4TR4 A;  5CRH A;  4POM A;  1TK0 B;  3MSZ A;  1GSU A;  2HZE A;  4G19 A;  4OWY A;  3GN3 A;  5ECK B;  1W4V A;  4PQI A;  4ZL7 A;  4OFT A;  1ST9 A;  4I8B A;  4IN0 A;  4D73 B;  5GZZ B;  4JZQ A;  1VF3 A;  4MJC A;  2V2G A;  4POK A;  4MPF A;  3G7Y A;  2Z9S A;  1X0R A;  3GMF A;  2HSY A;  4OCF A;  2JZR A;  1GTU A;  1HNA A;  3CMI A;  2DLX A;  2YZU A;  2H74 A;  5IOX A;  5ELA A;  3CYN A;  2B1K A;  2GSQ A;  2F3M A;  4KDY A;  4L5O A;  3C1S A;  4N30 A;  1GTB A;  6GSX A;  1VF2 A;  3G7J A;  3LYK A;  2FGX A;  3IC4 A;  3EU3 A;  11GS A;  1G7E A;  1JZO A;  3HJO A;  3ISO A;  2LV3 A;  3F4R A;  4KX4 A;  2IMD A;  1XVW A;  2N5A A;  2I1U A;  2JU5 A;  2H70 A;  2NVL A;  1YKC A;  5B8B A;  2AHE A;  1JZD A;  1SL2 B;  3GST A;  2CX3 A;  3HDC A;  5JCW A;  5E59 A;  3TCO A;  4DSQ A;  2OBK A;  2LNT A;  2V41 A;  2QKE A;  3TB2 A;  2VIM A;  2GT6 A;  3I9V 2;  3HJP A;  2A2R A;  4FIW A;  2IPA A;  3CSI A;  3QPM A;  5KN1 A;  3GL5 A;  1ZYE A;  3EIN A;  5ECP B;  4I2T A;  3ERF A;  2X64 A;  2H76 A;  4LL4 B;  1YZX A;  2RII A;  5D8I A;  3UJ1 A;  4YQU A;  2FA4 A;  2VCV A;  1A8L A;  1SJ6 A;  2B1L A;  2LJA A;  5ECQ B;  1GUH A;  1V98 A;  2L4C A;  1EOG A;  1EWX A;  2FNO A;  5AIV A;  4MZB A;  6GSV A;  3ZYW A;  2M72 A;  4CDO A;  2JAC A;  3H8Q A;  4KSM A;  4V2L A;  4JR4 A;  1PX7 A;  1RK4 A;  1ERV A;  3CSH A;  4X43 A;  4V1A p;  2IFQ B;  3Q74 A;  1SK2 A;  2BJX A;  3UL3 A;  1GLP A;  1URM A;  4F9Z A;  2HT9 A;  3WGX A;  1JFU A;  1BX9 A;  3ED3 A;  5D9V A;  3ZFB A;  2P5Q A;  4JU5 A;  2YP6 A;  4P3Y B;  1IYI A;  3N5O A;  3ZIV A;  1K3L A;  3FR3 A;  1O8X A;  1V40 A;  5ECI B;  5F8B A;  1XPV A;  4PNG A;  1OYJ A;  1GUL A;  3C73 A;  2O89 A;  1G6W A;  2D2Z A;  4XRA A;  4WR5 A;  2C3Q A;  3EE2 A;  4YQM A;  5B6M A;  2VCQ A;  3MWH A;  1YQ1 A;  1GSY A;  2DJ3 A;  4K0N A;  3W6G A;  1U3I A;  3HZ8 A;  2FHE A;  5HR1 A;  1XWK A;  1FVJ A;  4NAX A;  2LKU A;  2KP2 A;  1WE0 A;  3I43 A;  3I69 A;  3GL3 A;  4I5Q A;  1ILO A;  5DQS A;  4N0Z A;  2HSH A;  2FD3 A;  3BOA A;  2LJK A;  3E0U A;  5DCG A;  1TOF A;  2G0F A;  1YKA A;  1SEN A;  2YWI A;  1Z3E A;  3HHV A;  2JSZ A;  4FYC A;  4HUA A;  4QQ7 A;  3VI5 A;  5INY A;  2VL9 A;  1XCC A;  4GSS A;  1MDI A;  5IMA A;  5D9W A;  4F82 A;  2IMK A;  3AY8 A;  3DVX A;  3DVW A;  4TVE A;  4TR1 B;  4MMM A;  2LEG A;  3M3M A;  4HQZ A;  4HU9 A;  1ZL9 A;  2H6X A;  2RM5 A;  4EVM A;  5DAK B;  1PQN A;  1R5P A;  4K7N A;  5ELG A;  2YN1 A;  4O5R A;  2XBQ A;  5HFI A;  3QR6 A;  4ILF A;  2YNX A;  3WD6 A;  1EGR A;  3TJJ A;  3S9F A;  2V32 A;  2IJY A;  1T4Y A;  5CAX A;  3GA4 A;  4GTU A;  5ECH B;  2QSI A;  3CRT A;  4ZL9 A;  1ERW A;  3APS A;  3DGQ A;  2RUF A;  3W8J A;  3FR9 A;  2HE3 A;  5KN3 A;  1XXU A;  3LGC A;  2KOK A;  5DJL A;  1JLW A;  3HVX A;  1OC9 B;  3IOS A;  2K9F A;  3FZ4 A;  1GNE A;  4K8M A;  1SYX A;  2A2S A;  2DML A;  3QMX A;  3ZRD A;  1F37 A;  4K1F A;  1J0F A;  1X5D A;  3PIN A;  5IMD A;  2YZH A;  1MEK A;  3ZL5 A;  4RI6 A;  2ZCT A;  4EDZ A;  2YWN A;  4HQS A;  1XWG A;  2JAD A;  4WBJ A;  1THX A;  5FHI A;  1DE2 A;  3KMN A;  3PH9 A;  4OO4 A;  5B8A A;  5J9C A;  3L78 A;  4JR6 A;  2EIO A;  3F63 A;  4GSN A;  2WZ9 A;  1DE1 A;  4WF5 A;  4DSS B;  4ACS A;  7GSS A;  3TUE A;  4L0W A;  5G5E A;  1JHB A;  3IE3 A;  3GH9 A;  4MLY A;  5JCG A;  3QOU A;  3ERW A;  2CVK A;  3RHB A;  2C0E A;  3ERG A;  1U3A A;  4TW5 A;  5D73 A;  8GSS A;  3C1R A;  3WT2 A;  3KTB A;  3GTU B;  2H19 A;  4MAB A;  3UVH A;  3O3T A;  2CV4 A;  1FOV A;  5IO2 A;  2FLS A;  2X8C A;  2YJ7 A;  5AIX A;  2B5X A;  5CRG A;  3ZRE A;  1AAZ A;  3V1W A;  2JZS A;  2WB9 A;  1BYE A;  3JCM L;  2OKA A;  3CTF A;  2HZF A;  2DC5 A;  4H86 A;  1GSS A;  10GS A;  3HKR A;  1J9B A;  3VLN A;  1OVN A;  4BWQ A;  1YDK A;  5LCZ A;  2FWF A;  4QL9 A;  4TR3 A;  4HZ2 A;  3NZN A;  4KA0 A;  4ULX A;  2MMA A;  2HI7 A;  5ABR A;  1Q98 A;  2FWG A;  3FW2 A;  3FKF A;  1ABA A;  4G9H A;  3VPT A;  4AF2 A;  2IMI A;  5G1K A;  2VCZ A;  5EY6 A;  3TRP A;  3F4S A;  3LQ7 A;  3IPZ A;  1X5C A;  1Z7P A;  2R3X A;  4V1A g;  4K9Z A;  1OKT A;  1T00 A;  3GUS A;  4NHZ A;  4HJM A;  3I6A A;  3GSS A;  3KP9 A;  2PVQ A;  3IBH A;  2NDO A;  4WEY A;  1T3B A;  2L6C A;  2QC7 A;  1B48 A;  1TI1 A;  2M80 A;  2E7P A;  2EIR A;  1WIK A;  5IMZ A;  1THO A;  1ERU A;  3KZQ A;  1FVK A;  2MMN A;  4EF0 A;  2DSA A;  3D4T A;  2O7K A;  1GNW A;  1R5A A;  1NHY A;  2LRT A;  5IMV A;  3VI7 A;  3VUR A;  1PD2 1;  4MF6 A;  1VRS D;  2E2M A;  1Z6M A;  4BA7 A;  3GH6 A;  5IMC A;  3EYT A;  2H1D A;  1QGV A;  3LJR A;  1G6Y A;  2DMM A;  1OE8 A;  4FO5 A;  1O73 A;  1ACV A;  1VGL A;  2H75 A;  3BCI A;  1EP8 A;  2B3S A;  1WWJ A;  2H0I A;  3LSZ A;  5J5N A;  5CO3 A;  5DAL B;  18GS A;  5J9B A;  4Q5Q A;  2N5B A;  1JLV A;  4ECB A;  2LTK A;  19GS A;  1YF0 A;  4KDX A;  3M0F A;  3HVS A;  2MMO A;  5IIZ A;  3M8N A;  5ENU A;  1XVQ A;  1EV9 A;  5L71 A;  2OE1 A;  2LS5 A;  1AC1 A;  3HZ4 A;  1ERT A;  3GKM A;  5ECL B;  1NSW A;  1TRV A;  1PL1 A;  2X8H A;  3PGT A;  20GS A;  1F3A A;  3DWV A;  2PN8 A;  1U6T A;  2F8F A;  3GV1 A;  3TKR A;  4MPG A;  4IEL A;  1QXH A;  1ML6 A;  4ISD A;  1ZYQ B;  2I4A A;  2J9H A;  2H6Y A;  3P8W A;  2H73 A;  2O8V B;  3LFL A;  4Q5F A;  2NBS A;  1CQG A;  3M9J A;  2H0G A;  3WYW A;  4OFM A;  2RUE A;  5GAN D;  1AQX A;  2B5Y A;  4MZW A;  2LST A;  4MJE A;  2YAN A;  4FYB A;  1JZW A;  5ECO B;  4TOP A;  1SJZ A;  9GSS A;  3N9J A;  1GRX A;  1PX6 A;  5HQP A;  1BQ7 A;  1Q4J A;  3WT1 A;  4CW9 A;  6GSW A;  1TXX A;  3APO A;  4EUY A;  2AAW A;  1K0N A;  4Q5R A;  1H4O A;  2I81 A;  4MZC A;  4IP1 A;  2NTO A;  3C8E A;  2HFD A;  3KH7 A;  2J23 A;  3C71 A;  4OO5 A;  2VD1 A;  4GWR A;  4HJ2 A;  1T4Z A;  2KLX A;  5CRE A;  1TK8 B;  3RHC A;  3WGD A;  5FWG A;  4GXZ A;  1SU9 A;  2IL3 A;  3EMP A;  4TN8 A;  3CRU A;  3DD3 A;  3HCZ A;  1G7O A;  4TR0 A;  2C3T A;  4V2N A;  2O85 A;  1LU4 A;  3D0Z A;  2N5F A;  4DEJ A;  3F6D A;  3LG6 A;  3RBT A;  2MMZ A;  4KGI A;  1GWC A;  2CZ2 A;  4GRF A;  1WJK A;  2CA8 A;  2VM1 A;  5J4U A;  1GUK A;  3QD9 A;  1GTI A;  3CBU A;  3IHQ A;  5CRW A;  2R6K A;  3TJG A;  3UAP A;  4MH3 A;  1XW5 A;  1B4Q A;  1PN9 A;  3CTG A;  5G1L A;  2L59 A;  3VWV A;  5ECN B;  1WRY A;  1FAA A;  1XFL A;  2PMT A;  4HDE A;  4J2F A;  2PU9 C;  2E2G A;  1M2B A;  4HZ4 A;  2C4J A;  2L5O A;  1MTC A;  2LUS A;  3ZIT A;  2PGT A;  1SKS B;  4D73 A;  3DEX A;  1F6M C;  2DIY A;  1MD3 A;  4DVC A;  4WXT A;  2DJK A;  2WGR A;  3NIV A;  1AXD A;  4GLT A;  4AGS A;  1SYR A;  4FYU A;  3IDV A;  1EEJ A;  2FWE A;  6GSU A;  3F8U A;  4ML1 A;  2GZP A;  5GSS A;  1XWA A;  3GFK A; 
#chains in the Genus database with same CATH topology
 3F3Q A;  1GH2 A;  1PRX A;  4IP6 A;  2AUV A;  1OAZ A;  3GUR A;  4I6X A;  4KAE A;  4MK3 A;  4OD7 A;  5COH A;  3PR8 A;  4XTS A;  2DIZ A;  3QFA C;  3A2X A;  4KB3 A;  1OE7 A;  1S3A A;  2CX4 A;  4NXI A;  4MCU A;  4YH2 A;  4MJA A;  1TDI A;  2IN3 A;  1GLQ A;  4ZB9 A;  3A5I A;  4NV2 A;  1SD9 A;  5H5Q A;  5KN0 A;  2HRN A;  2XC2 A;  2PER A;  14GS A;  5EPF A;  3OR5 A;  5KEJ A;  3U5R E;  5J41 A;  1B8X A;  4BVX A;  2DJ0 A;  5ID2 B;  2K8S A;  2I3Y A;  4KF9 A;  2X49 A;  2GDR A;  1PSQ A;  4G0L A;  2C80 A;  2LRN A;  1EEM A;  1M9B A;  2C1Y A;  3L4N A;  1M7T A;  2F8A A;  3HD5 A;  2CQ9 A;  4IKH A;  1A24 A;  2HRF A;  4YAV A;  4G10 A;  2MBT A;  4EKZ A;  16GS A;  1ON4 A;  5ECS A;  5AN1 A;  4ECJ A;  1WP0 A;  2GZZ A;  2HLS A;  4N11 A;  4JBB A;  1Y25 A;  3GKN A;  2RM6 A;  3DYR A;  1MDK A;  5G31 A;  2PVO C;  1XWB A;  2XBI A;  4RQR A;  4O5U A;  2OJL A;  1VF1 A;  1YJ6 A;  4L5L A;  4NMU A;  4XIH A;  2DJJ A;  2AV4 A;  1R7H A;  4NPB A;  1J08 A;  4HI7 A;  4XS4 B;  3ZTL A;  2TRC P;  2TIR A;  2JZT A;  4ZB6 A;  2YWO A;  1O85 A;  1T1V A;  1OC3 A;  4V2M A;  2IFQ A;  5J3R A;  1N8J A;  5A5K A;  1YY7 A;  1U87 A;  1AQW A;  4RI7 A;  3MDK A;  2AJQ B;  3A2W A;  4PXO A;  1AQV A;  3ZML A;  4EDY A;  2WDU A;  2PWJ A;  6GSS A;  2CAI A;  2XPE A;  1BG5 A;  3CXG A;  5IM9 A;  4IVF A;  4GQF A;  2H0H A;  1ZGN A;  1BJX A;  3ME8 A;  3EVI A;  2YWM A;  2CAQ A;  2O87 A;  4Q5N A;  1EZK A;  1QFN A;  2C0F A;  4L8E A;  1XZO A;  4YQV A;  2OBI A;  4KUN A;  4KCE A;  2HZE B;  1SJI A;  2IWT A;  2V6O A;  2GLR A;  5IPG A;  1T7P B;  5JWQ B;  2H72 A;  3GX8 A;  3ZFL A;  5C00 A;  5GST A;  2F9S A;  1HD2 A;  4TKY A;  3BCK A;  4LLR A;  2VLT A;  1B9Y C;  2H6Z A;  4Z7X A;  4BL7 A;  2LQO A;  4XHM A;  3M9K A;  1GSE A;  1KEB A;  5LD0 A;  4EXJ A;  5CRD A;  4GQC A;  3LXZ A;  2KP1 A;  3H1N A;  2VD0 A;  2K18 A;  4QL7 A;  1RW1 A;  3UOM A;  1PKZ A;  3IV4 A;  2ES7 A;  3KGK A;  4MF5 A;  4OCE A;  4RUV A;  2R0G A;  1TI3 A;  4IQA A;  4XS1 A;  4BVY A;  5DDL A;  3TKS C;  2G2Q A;  1R26 A;  4MP4 A;  3L9V A;  3ZLP A;  5E4W A;  4TR1 A;  1LBK A;  2V6K A;  2H8L A;  1TP9 A;  4O92 A;  1WOU A;  1JZR A;  1TJD A;  3KEB A;  5G5F A;  4LL1 B;  4KSO A;  1K3Y A;  1MD4 A;  3A3T A;  2CZ3 A;  3QCP A;  5DAK A;  1M3I A;  2IIY A;  5B6N A;  2K6V A;  2E0Q A;  2YPM A;  3SBC A;  3HXS A;  3EUR A;  2HRA A;  4TXO A;  1HNB A;  1X9W B;  2C0G A;  2GSS A;  1V2A A;  3R2Q A;  3RPN A;  3NOF A;  4PUR A;  3P90 A;  3H4K A;  1A2M A;  4MA9 A;  1FG4 A;  4ZBD A;  3ZMK A;  4HOJ A;  4K2D A;  3A5W A;  5HR0 A;  2ON5 A;  3FHK A;  3IXR A;  4K5R A;  3UMA A;  1K0O A;  2P0G A;  13GS A;  2VLV A;  1XIY A;  1K3O A;  2OAD A;  2XHF A;  1SKW B;  2P31 A;  1K0B A;  3KP8 A;  2MYG A;  3UEM A;  4PNF A;  1AIU A;  2C0D A;  2JL4 A;  2FY6 A;  1TW9 A;  1F3B A;  3IK7 A;  2B6M A;  1S3C A;  3KMO A;  3D21 A;  12GS A;  1SD8 A;  3HVV A;  4CHS A;  3KM6 A;  5IMF A;  1DBY A;  5DJM A;  5DBQ A;  2F51 A;  4F0B A;  4ZBA A;  4OFN A;  5A4W A;  2OA7 A;  3G9B A;  4IBP A;  5H5R A;  3GX0 A;  1TK5 B;  3US3 A;  5F0G A;  3M1G A;  4O7H A;  2GQK A;  3H93 A;  5G30 A;  5DQY A;  3J7Y b;  1RQM A;  4DSS A;  1V57 A;  1F2E A;  4BPY A;  1WMJ A;  1FW1 A;  2B5E A;  5JCU A;  3IAM 2;  5DCH A;  3TDG A;  1A23 A;  1W89 A;  4KCA A;  3TJK A;  1SKR B;  4ZB8 A;  1ZZY A;  22GS A;  2L4Q A;  4TRX A;  2CVD A;  2A4V A;  2K8V A;  5HR3 A;  3UBL A;  5B7C A;  2X4A A;  2VL2 C;  3GTU A;  2PBJ A;  4JE1 A;  1DSB A;  2CVB A;  5F05 A;  2H1B A;  1C72 A;  4IW9 A;  3MAK A;  3FZ5 A;  2H01 A;  4PGT A;  1UVZ A;  2X99 A;  1EOH A;  3MNG A;  4HEA 2;  3EC3 A;  2GQM A;  3CQF A;  5KN2 A;  1A2L A;  2WRT A;  3VK9 A;  4AJ6 A;  1Y6E A;  5D96 A;  3SWL A;  5JWR B;  3D22 A;  3TJF A;  3DIE A;  3F3R A;  3HY2 A;  3P2A A;  3Q18 A;  4GF0 A;  2L5L A;  4NWY A;  1QQ2 A;  4XS6 A;  3DRN A;  3VFI A;  1OKD A;  4TXV A;  4HS1 A;  4NV5 A;  2H1G A;  3KD0 A;  4BVX B;  4E8H A;  1SK1 A;  3VWX A;  5GAP D;  2GT5 A;  1M3J A;  4ZIL A;  5IO0 A;  2VCW A;  2VLU A;  1PL2 A;  2ZNM A;  1XW6 A;  3QDN A;  2LJR A;  5IQY A;  3QAW A;  4K7O A;  1Z5Y E;  5LNK e;  3FYG A;  1MDJ A;  3QAV A;  4JED A;  1ZCP A;  1UC7 A;  3HA9 A;  4IJI A;  4HU7 A;  5D93 A;  1O6J A;  2HSM A;  3O6T A;  2L57 A;  3VWU A;  2VO4 A;  3BD2 A;  2I9H A;  5HFG A;  4E8E A;  2H66 A;  2H1A A;  4HSC X;  2A4H A;  3ME7 A;  3EWL A;  1SL0 B;  1X5E A;  4MDC A;  1N2A A;  2AYT A;  1I9D A;  2VL3 A;  2KHP A;  1O7U A;  2YJH A;  1YF1 A;  4YAP A;  1A8Y A;  1FHE A;  3KCM A;  3TJB A;  2TRX A;  2GST A;  4XRD A;  2FCH A;  2R2J A;  1ZOF A;  3KIJ A;  1QK8 A;  1I5G A;  2OAC A;  1AUC A;  2PUK C;  6GSY A;  1GSD A;  2PPT A;  2VCT A;  3GNJ A;  2X8G A;  4K0G A;  5F06 A;  1H75 A;  3H79 A;  4F03 A;  1FB6 A;  4K7I A;  2B7K A;  3EMX A;  4PUF C;  5DAL A;  3L9S A;  2XPD A;  5IOW A;  2CT6 A;  1A0F A;  1WPI A;  1YEP A;  2L6D A;  3F0I A;  1BAY A;  1NM3 A;  2R4V A;  4IS0 A;  4K6X A;  1M2D A;  2WJU A;  3GYK A;  2H30 A;  3L9U A;  5EL8 A;  3K8N A;  2BMX A;  1XBS A;  3GRX A;  3UAR A;  3FK8 A;  2DJ1 A;  2BTO T;  1SL1 B;  3TKS A;  5CYY A;  1NHO A;  3ZIJ A;  1X9S B;  4ZIJ A;  2GQL A;  3GHA A;  2VM2 A;  2GZY A;  1FOH A;  2YCD A;  4BWS A;  1Z7R A;  3FR6 A;  4USS A;  3D6I A;  2MZC A;  1FB0 A;  3EU4 A;  4PX1 A;  4KW6 A;  2WFC A;  2ALB A;  3TKS E;  3RDW A;  1T8E B;  1M99 A;  3GKX A;  4WBR D;  4Z2U A;  1M9A A;  3ZVJ D;  1OC8 A;  1KTE A;  4PUA A;  2C3N A;  4FH8 A;  4Z2R A;  4ECI A;  3RPP A;  2R37 A;  4XCS A;  2QGV A;  1IYH A;  3C7M A;  4OMV A;  1X9M B;  3KXO A;  3G7I A;  3U6V A;  1TRW A;  4KND A;  2REM A;  2WCI A;  1PA3 A;  1R4W A;  4POB A;  2QA1 A;  5HR2 A;  3IR4 A;  4I2U A;  4WR4 A;  2JSY A;  4LMV A;  3LWA A;  4TXO B;  1U88 A;  1GTA A;  2FA8 A;  1GSF A;  4IQ1 A;  2VOC A;  5D9T A;  1ZMA A;  1GP1 A;  1NW2 A;  1QMV A;  1B4P A;  1Z9H A;  2VUP A;  3VWW A;  4WF4 A;  4KDU A;  1Z6N A;  1PGT A;  3UBK A;  4ECC A;  1SK0 A;  4X0X A;  3LYP A;  1KNG A;  1QUW A;  1EV4 A;  5CP1 A;  1K0A A;  2WS2 A;  4J57 E;  5CNW A;  1O8W A;  4YKF A;  3TGZ A;  1V58 A;  3J7Y k;  2OE3 A;  1FO5 A;  3HVN A;  4K2X A;  2IMF A;  3E9J B;  3TOT A;  2GTU A;  3HYP A;  3L0H A;  3A2V A;  2LNS A;  3UIW A;  3HJM A;  2DBC A;  5A4U A;  1XOA A;  2HYX A;  2R5G A;  4LMW A;  3E3E A;  4MF7 A;  1M0U A;  3F9U A;  2P5R A;  1S3D A;  2HNL A;  4RQX A;  4IJ3 A;  4ZBB A;  3TKQ A;  3VPQ A;  3FRC A;  3Q19 A;  1XWC A;  3FY7 A;  2YV9 A;  1GUM A;  3FEU A;  2EIQ A;  4MJB A;  2VL2 A;  4POL A;  3WGE A;  3TRQ A;  1BED A;  5C04 A;  1PFO A;  2KUC A;  3RAZ A;  2EC4 A;  5IPH A;  5FT3 A;  1VF4 A;  3UVT A;  3BBY A;  3KJY A;  1E6B A;  1TKD B;  2GVP A;  5G2Z A;  1USB A;  5ECM B;  4F2I A;  4IGJ A;  3BJ5 A;  3F6F A;  3ZZX A;  1O81 A;  5JWO B;  2RLI A;  3DKS A;  2M46 A;  3CSJ A;  3KTL A;  2FUG 2;  3QAG A;  4N0V A;  1GSQ A;  2HXK A;  4LA1 A;  5H5S A;  2IME A;  3FMW A;  1GL8 A;  4X4J A;  3F4T A;  4J56 E;  3LOR A;  4GCI A;  5D9X A;  2WUL A;  3TRX A;  4EL1 A;  2NPB A;  1HQO A;  4KH7 A;  5DVB A;  4GST A;  2LQQ A;  3KH9 A;  2VAF A;  4L0U A;  3GIX A;  3GKK A;  5ID2 A;  1KBN A;  2GSR A;  2C8U A;  4WKW A;  4PQ1 A;  5HFK A;  4IHU A;  3FZ9 A;  1UA5 A;  6GST A;  2YOI A;  1HYU A;  4ML6 A;  3Q6O A;  3D4M A;  1TU8 A;  2LRC A;  1PMT A;  1A2J A;  3LEF A;  3IA1 A;  4JRR A;  1M2A A;  4X1U A;  1V9W A;  3IAS 2;  3ZVJ A;  2DJ2 A;  1AW9 A;  3MYD A;  4ZXG A;  3FZA A;  1HNC A;  3APQ A;  3O76 A;  1TRS A;  5BMU A;  1EP7 A;  2MBS A;  3DXB A;  4EO3 A;  5EVO A;  4F0C A;  2YV7 A;  5ECR B;  4A5P A;  2FWH A;  3LXT A;  2AB6 A;  2B7J A;  3QFB C;  3IRA A;  1ZYN A;  4G0K A;  2V1M A;  4DSR A;  2ON7 A;  1K0D A;  1A0R P;  4PQH A;  4EC0 A;  1PKW A;  3DML A;  1OC9 A;  1K0M A;  4KE3 A;  3TKP A;  1EGO A;  4XS4 A;  4NHW A;  4ZL8 A;  3TOU A;  1B9X C;  1F9M A;  5AIS A;  5A4V A;  1YEX A;  4EIP A;  1DUG A;  4AJ7 A;  4AJ8 A;  1TU7 A;  1LJR A;  4ID0 A;  5AGY A;  2GS3 A;  2H71 A;  1TTZ A;  4G2E A;  17GS A;  3IK9 A;  3P7X A;  1K0C A;  1UN2 A;  4O32 A;  4MH2 A;  1G0T A;  5F07 A;  2ZUP A;  1XW9 A;  1CQH A;  2VCX A;  4EIQ A;  1TRU A;  4I97 A;  4WET A;  1XOB A;  2GGT A;  2OE0 A;  4EE0 A;  4N10 A;  1E2Y A;  3W8S A;  3D5J A;  4TR4 A;  5CRH A;  4POM A;  1TK0 B;  3MSZ A;  1GSU A;  2HZE A;  4G19 A;  4O5Q A;  4OWY A;  3GN3 A;  5ECK B;  1W4V A;  4PQI A;  5BRT A;  4ZL7 A;  4OFT A;  1ST9 A;  4I8B A;  4IN0 A;  4D73 B;  5GZZ B;  4JZQ A;  1VF3 A;  4MJC A;  2V2G A;  4POK A;  4MPF A;  3G7Y A;  2Z9S A;  1X0R A;  3GMF A;  2HSY A;  4OCF A;  2JZR A;  1GTU A;  1HNA A;  3CMI A;  2DLX A;  2YZU A;  3LW9 A;  2H74 A;  5IOX A;  5ELA A;  3CYN A;  2B1K A;  2GSQ A;  2F3M A;  4KDY A;  4L5O A;  3C1S A;  4N30 A;  1GTB A;  6GSX A;  1VF2 A;  3G7J A;  3LYK A;  2FGX A;  3IC4 A;  3EU3 A;  11GS A;  1G7E A;  1JZO A;  3HJO A;  3ISO A;  2LV3 A;  3F4R A;  4KX4 A;  2IMD A;  1XVW A;  2N5A A;  2I1U A;  2JU5 A;  2H70 A;  2NVL A;  1YKC A;  5B8B A;  2AHE A;  1JZD A;  1SL2 B;  3GST A;  2CX3 A;  3HDC A;  5JCW A;  5E59 A;  3TCO A;  4DSQ A;  2OBK A;  2LNT A;  2V41 A;  2QKE A;  3TB2 A;  2VIM A;  2GT6 A;  3I9V 2;  3HJP A;  2A2R A;  4FIW A;  2IPA A;  3CSI A;  3QPM A;  5KN1 A;  3GL5 A;  1ZYE A;  3EIN A;  5ECP B;  4I2T A;  3ERF A;  2X64 A;  2H76 A;  4LL4 B;  1YZX A;  2RII A;  5D8I A;  3UJ1 A;  4ICY A;  4YQU A;  2FA4 A;  2VCV A;  1A8L A;  1SJ6 A;  2B1L A;  2LJA A;  5ECQ B;  1GUH A;  1V98 A;  2L4C A;  1EOG A;  1EWX A;  2FNO A;  5AIV A;  4MZB A;  6GSV A;  1PN0 A;  3ZYW A;  2M72 A;  4CDO A;  2JAC A;  3H8Q A;  4KSM A;  4V2L A;  4JR4 A;  1PX7 A;  1RK4 A;  1ERV A;  3CSH A;  4X43 A;  4V1A p;  2IFQ B;  3Q74 A;  1SK2 A;  2BJX A;  3UL3 A;  1GLP A;  1URM A;  4F9Z A;  2HT9 A;  3WGX A;  1JFU A;  1BX9 A;  3ED3 A;  5D9V A;  3ZFB A;  2P5Q A;  2A2P A;  4JU5 A;  2YP6 A;  4P3Y B;  1IYI A;  3N5O A;  3ZIV A;  3MIX A;  1K3L A;  3FR3 A;  4PTS A;  1O8X A;  1V40 A;  5ECI B;  5F8B A;  1XPV A;  4PNG A;  1OYJ A;  1GUL A;  3C73 A;  2O89 A;  1G6W A;  2D2Z A;  4XRA A;  4WR5 A;  2C3Q A;  3EE2 A;  4YQM A;  5B6M A;  2VCQ A;  3MWH A;  1YQ1 A;  1GSY A;  2DJ3 A;  4K0N A;  3W6G A;  1U3I A;  3HZ8 A;  2FHE A;  5HR1 A;  1XWK A;  1FVJ A;  4NAX A;  2LKU A;  2KP2 A;  4BL7 B;  1WE0 A;  3I43 A;  3I69 A;  3GL3 A;  4I5Q A;  1ILO A;  5DQS A;  4N0Z A;  2HSH A;  2FD3 A;  3BOA A;  2LJK A;  3E0U A;  5DCG A;  1TOF A;  2G0F A;  1YKA A;  1SEN A;  2YWI A;  1Z3E A;  3HHV A;  2JSZ A;  4FYC A;  4HUA A;  4BVY B;  4QQ7 A;  3VI5 A;  5INY A;  2VL9 A;  1XCC A;  4GSS A;  1MDI A;  5IMA A;  5D9W A;  4F82 A;  2IMK A;  3AY8 A;  3DVX A;  3DVW A;  4TVE A;  4TR1 B;  4MMM A;  2LEG A;  3M3M A;  4HQZ A;  4HU9 A;  1ZL9 A;  2H6X A;  2RM5 A;  4EVM A;  5DAK B;  1PQN A;  1R5P A;  4K7N A;  5ELG A;  2YN1 A;  4O5R A;  2XBQ A;  5HFI A;  3QR6 A;  4ILF A;  2YNX A;  3WD6 A;  1EGR A;  3TJJ A;  3S9F A;  2V32 A;  4G0I A;  2IJY A;  1T4Y A;  5CAX A;  3GA4 A;  4GTU A;  5ECH B;  2QSI A;  3CRT A;  5KOX A;  4ZL9 A;  1ERW A;  3APS A;  3DGQ A;  2RUF A;  3W8J A;  3FR9 A;  2HE3 A;  5KN3 A;  1XXU A;  3LGC A;  2KOK A;  5DJL A;  1JLW A;  3HVX A;  1OC9 B;  3IOS A;  2K9F A;  3FZ4 A;  1GNE A;  2UZ8 A;  4K8M A;  1SYX A;  2A2S A;  2DML A;  3QMX A;  3ZRD A;  1F37 A;  4K1F A;  1J0F A;  1X5D A;  3PIN A;  5IMD A;  2YZH A;  1MEK A;  2DKI A;  4CY8 A;  3ZL5 A;  4RI6 A;  2ZCT A;  4EDZ A;  2YWN A;  4HQS A;  1XWG A;  2JAD A;  4WBJ A;  1THX A;  5FHI A;  1DE2 A;  3KMN A;  3PH9 A;  4OO4 A;  5B8A A;  5J9C A;  3L78 A;  4JR6 A;  2EIO A;  3F63 A;  4GSN A;  2WZ9 A;  2QA2 A;  1DE1 A;  4WF5 A;  4DSS B;  4ACS A;  7GSS A;  3TUE A;  4L0W A;  5G5E A;  1JHB A;  3IE3 A;  3GH9 A;  4MLY A;  5JCG A;  3QOU A;  3ERW A;  2CVK A;  3RHB A;  2C0E A;  3ERG A;  1U3A A;  4TW5 A;  5D73 A;  8GSS A;  2R0P A;  3C1R A;  3WT2 A;  3KTB A;  3GTU B;  2H19 A;  4MAB A;  3UVH A;  3O3T A;  2CV4 A;  1FOV A;  5IO2 A;  2FLS A;  2X8C A;  2YJ7 A;  5AIX A;  2B5X A;  5CRG A;  3ZRE A;  1AAZ A;  3V1W A;  2JZS A;  2WB9 A;  1BYE A;  3JCM L;  2OKA A;  4K5S A;  3CTF A;  2HZF A;  2DC5 A;  4H86 A;  1GSS A;  10GS A;  3HKR A;  1J9B A;  3VLN A;  1OVN A;  4BWQ A;  1YDK A;  5LCZ A;  2FWF A;  4QL9 A;  4YKG A;  4TR3 A;  4HZ2 A;  3NZN A;  4KA0 A;  4ULX A;  2MMA A;  2HI7 A;  5ABR A;  1Q98 A;  2FWG A;  3FW2 A;  3FKF A;  1ABA A;  4G9H A;  3VPT A;  3R3E A;  4AF2 A;  2IMI A;  5G1K A;  2VCZ A;  5EY6 A;  3TRP A;  3F4S A;  3LQ7 A;  3IPZ A;  1ZYP A;  1X5C A;  1Z7P A;  2R3X A;  4V1A g;  4K9Z A;  1OKT A;  1T00 A;  3GUS A;  4NHZ A;  4HJM A;  3I6A A;  3GSS A;  3KP9 A;  2PVQ A;  3IBH A;  2NDO A;  4WEY A;  1T3B A;  2L6C A;  2QC7 A;  1B48 A;  1TI1 A;  2M80 A;  2E7P A;  2EIR A;  1WIK A;  5IMZ A;  1THO A;  4BIK A;  1ERU A;  3KZQ A;  1FVK A;  2MMN A;  4EF0 A;  2DSA A;  3D4T A;  2O7K A;  1GNW A;  1R5A A;  1NHY A;  2LRT A;  5IMV A;  3VI7 A;  3VUR A;  1PD2 1;  4MF6 A;  1VRS D;  2E2M A;  1Z6M A;  4BA7 A;  3GH6 A;  5IMC A;  3EYT A;  2H1D A;  1QGV A;  3LJR A;  1G6Y A;  2DMM A;  1OE8 A;  4FO5 A;  1O73 A;  1ACV A;  1VGL A;  2H75 A;  3BCI A;  1EP8 A;  2B3S A;  1WWJ A;  2H0I A;  3LSZ A;  5J5N A;  5CO3 A;  5DAL B;  18GS A;  5J9B A;  4Q5Q A;  2N5B A;  1JLV A;  4ECB A;  3EPT A;  2LTK A;  19GS A;  1YF0 A;  4KDX A;  3M0F A;  3HVS A;  2MMO A;  5IIZ A;  4Z2T A;  3M8N A;  5ENU A;  1XVQ A;  1EV9 A;  4FQU A;  5L71 A;  2OE1 A;  2LS5 A;  1AC1 A;  3HZ4 A;  1ERT A;  3GKM A;  4MNN A;  5ECL B;  1NSW A;  1TRV A;  1PL1 A;  2X8H A;  3PGT A;  20GS A;  1F3A A;  3DWV A;  2PN8 A;  1U6T A;  2F8F A;  3GV1 A;  3TKR A;  4MPG A;  4IEL A;  1QXH A;  3IHG A;  1ML6 A;  4ISD A;  1ZYQ B;  2I4A A;  2HRK A;  2J9H A;  2H6Y A;  3P8W A;  2H73 A;  2O8V B;  5KOW A;  3LFL A;  4Q5F A;  2NBS A;  1CQG A;  3M9J A;  2H0G A;  3WYW A;  4OFM A;  2RUE A;  5GAN D;  1AQX A;  2B5Y A;  4MZW A;  2LST A;  4MJE A;  2YAN A;  4FYB A;  3IC8 A;  1JZW A;  5ECO B;  4TOP A;  1SJZ A;  9GSS A;  3N9J A;  1GRX A;  1PX6 A;  1XG8 A;  5HQP A;  1BQ7 A;  1Q4J A;  3WT1 A;  4CW9 A;  6GSW A;  1TXX A;  3APO A;  4EUY A;  2AAW A;  1K0N A;  4Q5R A;  1H4O A;  2I81 A;  4MZC A;  4IP1 A;  2NTO A;  3C8E A;  2HFD A;  3KH7 A;  2J23 A;  3C71 A;  4OO5 A;  2VD1 A;  4GWR A;  4HJ2 A;  1T4Z A;  2KLX A;  5CRE A;  1TK8 B;  3RHC A;  3WGD A;  5FWG A;  2R0C A;  4GXZ A;  1SU9 A;  2IL3 A;  3EMP A;  4TN8 A;  3CRU A;  3DD3 A;  3HCZ A;  1G7O A;  4TR0 A;  2C3T A;  4V2N A;  2O85 A;  1LU4 A;  3D0Z A;  2N5F A;  4DEJ A;  3F6D A;  3LG6 A;  3RBT A;  2MMZ A;  4KGI A;  1GWC A;  2CZ2 A;  4GRF A;  1WJK A;  2CA8 A;  2VM1 A;  5J4U A;  1GUK A;  3QD9 A;  1GTI A;  3CBU A;  3IHQ A;  5CRW A;  2R6K A;  3TJG A;  3UAP A;  4MH3 A;  3PPU A;  1XW5 A;  1B4Q A;  1PN9 A;  3CTG A;  5G1L A;  1S3R A;  2L59 A;  3VWV A;  1WRY A;  1FAA A;  1XFL A;  2PMT A;  4HDE A;  4J2F A;  5ECN B;  2PU9 C;  2E2G A;  1M2B A;  4HZ4 A;  2C4J A;  2L5O A;  1MTC A;  2LUS A;  3ZIT A;  2PGT A;  1SKS B;  4D73 A;  3DEX A;  1F6M C;  2DIY A;  1MD3 A;  4DVC A;  4WXT A;  2DJK A;  2WGR A;  3NIV A;  1AXD A;  4GLT A;  4AGS A;  2DKH A;  4CY6 A;  1SYR A;  4FYU A;  3IDV A;  1EEJ A;  2FWE A;  6GSU A;  3F8U A;  4ML1 A;  2GZP A;  5GSS A;  1XWA A;  3GFK A; 
#chains in the Genus database with same CATH homology
 3F3Q A;  1GH2 A;  1PRX A;  4IP6 A;  2AUV A;  1OAZ A;  3GUR A;  4I6X A;  4KAE A;  4MK3 A;  4OD7 A;  5COH A;  3PR8 A;  4XTS A;  2DIZ A;  3QFA C;  3A2X A;  4KB3 A;  1OE7 A;  1S3A A;  2CX4 A;  4NXI A;  4MCU A;  4YH2 A;  4MJA A;  1TDI A;  2IN3 A;  1GLQ A;  4ZB9 A;  3A5I A;  4NV2 A;  1SD9 A;  5H5Q A;  5KN0 A;  2HRN A;  2XC2 A;  2PER A;  14GS A;  5EPF A;  3OR5 A;  5KEJ A;  3U5R E;  5J41 A;  1B8X A;  4BVX A;  2DJ0 A;  5ID2 B;  2K8S A;  2I3Y A;  4KF9 A;  2X49 A;  2GDR A;  1PSQ A;  4G0L A;  2C80 A;  2LRN A;  1EEM A;  1M9B A;  2C1Y A;  3L4N A;  1M7T A;  2F8A A;  3HD5 A;  2CQ9 A;  4IKH A;  1A24 A;  2HRF A;  4YAV A;  4G10 A;  2MBT A;  4EKZ A;  16GS A;  1ON4 A;  5ECS A;  5AN1 A;  4ECJ A;  1WP0 A;  2GZZ A;  2HLS A;  4N11 A;  4JBB A;  1Y25 A;  3GKN A;  2RM6 A;  3DYR A;  1MDK A;  5G31 A;  2PVO C;  1XWB A;  2XBI A;  4RQR A;  4O5U A;  2OJL A;  1VF1 A;  1YJ6 A;  4L5L A;  4NMU A;  4XIH A;  2DJJ A;  2AV4 A;  1R7H A;  4NPB A;  1J08 A;  4HI7 A;  4XS4 B;  3ZTL A;  2TRC P;  2TIR A;  2JZT A;  4ZB6 A;  2YWO A;  1O85 A;  1T1V A;  1OC3 A;  4V2M A;  2IFQ A;  5J3R A;  1N8J A;  5A5K A;  1YY7 A;  1U87 A;  1AQW A;  4RI7 A;  3MDK A;  2AJQ B;  3A2W A;  4PXO A;  1AQV A;  3ZML A;  4EDY A;  2WDU A;  2PWJ A;  6GSS A;  2CAI A;  2XPE A;  1BG5 A;  3CXG A;  5IM9 A;  4IVF A;  4GQF A;  2H0H A;  1ZGN A;  1BJX A;  3ME8 A;  3EVI A;  2YWM A;  2CAQ A;  2O87 A;  4Q5N A;  1EZK A;  1QFN A;  2C0F A;  4L8E A;  1XZO A;  4YQV A;  2OBI A;  4KUN A;  4KCE A;  2HZE B;  1SJI A;  2IWT A;  2V6O A;  2GLR A;  5IPG A;  1T7P B;  5JWQ B;  2H72 A;  3GX8 A;  3ZFL A;  5C00 A;  5GST A;  2F9S A;  1HD2 A;  4TKY A;  3BCK A;  4LLR A;  2VLT A;  1B9Y C;  2H6Z A;  4Z7X A;  4BL7 A;  2LQO A;  4XHM A;  3M9K A;  1GSE A;  1KEB A;  5LD0 A;  4EXJ A;  5CRD A;  4GQC A;  3LXZ A;  2KP1 A;  3H1N A;  2VD0 A;  2K18 A;  4QL7 A;  1RW1 A;  3UOM A;  1PKZ A;  3IV4 A;  2ES7 A;  3KGK A;  4MF5 A;  4OCE A;  4RUV A;  2R0G A;  1TI3 A;  4IQA A;  4XS1 A;  4BVY A;  5DDL A;  3TKS C;  2G2Q A;  1R26 A;  4MP4 A;  3L9V A;  3ZLP A;  5E4W A;  4TR1 A;  1LBK A;  2V6K A;  2H8L A;  1TP9 A;  4O92 A;  1WOU A;  1JZR A;  1TJD A;  3KEB A;  5G5F A;  4LL1 B;  4KSO A;  1K3Y A;  1MD4 A;  3A3T A;  2CZ3 A;  3QCP A;  5DAK A;  2IIY A;  5B6N A;  2K6V A;  2E0Q A;  2YPM A;  3SBC A;  3HXS A;  3EUR A;  2HRA A;  4TXO A;  1HNB A;  1X9W B;  2C0G A;  2GSS A;  1V2A A;  3R2Q A;  3RPN A;  3NOF A;  4PUR A;  3P90 A;  3H4K A;  1A2M A;  4MA9 A;  1FG4 A;  4ZBD A;  3ZMK A;  4HOJ A;  4K2D A;  3A5W A;  5HR0 A;  2ON5 A;  3FHK A;  3IXR A;  4K5R A;  3UMA A;  1K0O A;  2P0G A;  13GS A;  2VLV A;  1XIY A;  1K3O A;  2OAD A;  2XHF A;  1SKW B;  2P31 A;  1K0B A;  3KP8 A;  2MYG A;  3UEM A;  4PNF A;  1AIU A;  2C0D A;  2JL4 A;  2FY6 A;  1TW9 A;  1F3B A;  3IK7 A;  2B6M A;  1S3C A;  3KMO A;  3D21 A;  12GS A;  1SD8 A;  3HVV A;  4CHS A;  3KM6 A;  5IMF A;  1DBY A;  5DJM A;  5DBQ A;  2F51 A;  4F0B A;  4ZBA A;  4OFN A;  5A4W A;  2OA7 A;  3G9B A;  4IBP A;  5H5R A;  3GX0 A;  1TK5 B;  3US3 A;  5F0G A;  3M1G A;  4O7H A;  2GQK A;  3H93 A;  5G30 A;  5DQY A;  3J7Y b;  1RQM A;  4DSS A;  1V57 A;  1F2E A;  4BPY A;  1WMJ A;  1FW1 A;  2B5E A;  5JCU A;  3IAM 2;  5DCH A;  3TDG A;  1A23 A;  1W89 A;  4KCA A;  3TJK A;  1SKR B;  4ZB8 A;  1ZZY A;  22GS A;  2L4Q A;  4TRX A;  2CVD A;  2A4V A;  2K8V A;  5HR3 A;  3UBL A;  5B7C A;  2X4A A;  2VL2 C;  3GTU A;  2PBJ A;  4JE1 A;  1DSB A;  2CVB A;  5F05 A;  2H1B A;  1C72 A;  4IW9 A;  3MAK A;  3FZ5 A;  2H01 A;  4PGT A;  1UVZ A;  2X99 A;  1EOH A;  3MNG A;  4HEA 2;  3EC3 A;  2GQM A;  5KN2 A;  1A2L A;  2WRT A;  3VK9 A;  4AJ6 A;  1Y6E A;  5D96 A;  3SWL A;  5JWR B;  3D22 A;  3TJF A;  3DIE A;  3F3R A;  3HY2 A;  3P2A A;  3Q18 A;  4GF0 A;  2L5L A;  4NWY A;  1QQ2 A;  4XS6 A;  3DRN A;  3VFI A;  1OKD A;  4TXV A;  4HS1 A;  4NV5 A;  2H1G A;  3KD0 A;  4BVX B;  4E8H A;  1SK1 A;  3VWX A;  5GAP D;  2GT5 A;  4ZIL A;  5IO0 A;  2VCW A;  2VLU A;  1PL2 A;  2ZNM A;  1XW6 A;  3QDN A;  2LJR A;  5IQY A;  3QAW A;  4K7O A;  1Z5Y E;  5LNK e;  3FYG A;  1MDJ A;  3QAV A;  4JED A;  1ZCP A;  1UC7 A;  3HA9 A;  4IJI A;  4HU7 A;  5D93 A;  1O6J A;  2HSM A;  3O6T A;  2L57 A;  3VWU A;  2VO4 A;  3BD2 A;  2I9H A;  5HFG A;  4E8E A;  2H66 A;  2H1A A;  2A4H A;  3ME7 A;  3EWL A;  1SL0 B;  1X5E A;  4MDC A;  1N2A A;  2AYT A;  1I9D A;  2VL3 A;  2KHP A;  1O7U A;  2YJH A;  1YF1 A;  4YAP A;  1A8Y A;  1FHE A;  3KCM A;  3TJB A;  2TRX A;  2GST A;  4XRD A;  2FCH A;  2R2J A;  1ZOF A;  3KIJ A;  1QK8 A;  1I5G A;  2OAC A;  1AUC A;  2PUK C;  6GSY A;  1GSD A;  2PPT A;  2VCT A;  3GNJ A;  2X8G A;  4K0G A;  5F06 A;  1H75 A;  3H79 A;  4F03 A;  1FB6 A;  4K7I A;  2B7K A;  3EMX A;  4PUF C;  5DAL A;  3L9S A;  2XPD A;  5IOW A;  2CT6 A;  1A0F A;  1WPI A;  1YEP A;  2L6D A;  3F0I A;  1BAY A;  1NM3 A;  2R4V A;  4IS0 A;  4K6X A;  1M2D A;  2WJU A;  3GYK A;  2H30 A;  3L9U A;  5EL8 A;  3K8N A;  2BMX A;  1XBS A;  3GRX A;  3UAR A;  3FK8 A;  2DJ1 A;  2BTO T;  1SL1 B;  3TKS A;  5CYY A;  1NHO A;  3ZIJ A;  1X9S B;  4ZIJ A;  2GQL A;  3GHA A;  2VM2 A;  2GZY A;  1FOH A;  2YCD A;  4BWS A;  1Z7R A;  3FR6 A;  4USS A;  3D6I A;  2MZC A;  1FB0 A;  3EU4 A;  4PX1 A;  4KW6 A;  2WFC A;  2ALB A;  3TKS E;  3RDW A;  1T8E B;  1M99 A;  3GKX A;  4WBR D;  4Z2U A;  1M9A A;  3ZVJ D;  1OC8 A;  1KTE A;  4PUA A;  2C3N A;  4FH8 A;  4Z2R A;  4ECI A;  3RPP A;  2R37 A;  4XCS A;  2QGV A;  1IYH A;  3C7M A;  4OMV A;  1X9M B;  3KXO A;  3G7I A;  3U6V A;  1TRW A;  4KND A;  2REM A;  2WCI A;  1PA3 A;  1R4W A;  4POB A;  2QA1 A;  5HR2 A;  3IR4 A;  4I2U A;  4WR4 A;  2JSY A;  4LMV A;  3LWA A;  4TXO B;  1U88 A;  1GTA A;  2FA8 A;  1GSF A;  4IQ1 A;  2VOC A;  5D9T A;  1ZMA A;  1GP1 A;  1NW2 A;  1QMV A;  1B4P A;  1Z9H A;  2VUP A;  3VWW A;  4WF4 A;  4KDU A;  1Z6N A;  1PGT A;  3UBK A;  4ECC A;  1SK0 A;  4X0X A;  3LYP A;  1KNG A;  1QUW A;  1EV4 A;  5CP1 A;  1K0A A;  2WS2 A;  4J57 E;  5CNW A;  1O8W A;  4YKF A;  3TGZ A;  1V58 A;  3J7Y k;  2OE3 A;  1FO5 A;  4K2X A;  2IMF A;  3E9J B;  3TOT A;  2GTU A;  3HYP A;  3L0H A;  3A2V A;  2LNS A;  3UIW A;  3HJM A;  2DBC A;  5A4U A;  1XOA A;  2HYX A;  2R5G A;  4LMW A;  3E3E A;  4MF7 A;  1M0U A;  3F9U A;  2P5R A;  1S3D A;  2HNL A;  4RQX A;  4IJ3 A;  4ZBB A;  3TKQ A;  3VPQ A;  3FRC A;  3Q19 A;  1XWC A;  3FY7 A;  2YV9 A;  1GUM A;  3FEU A;  2EIQ A;  4MJB A;  2VL2 A;  4POL A;  3WGE A;  3TRQ A;  1BED A;  5C04 A;  2KUC A;  3RAZ A;  2EC4 A;  5IPH A;  5FT3 A;  1VF4 A;  3UVT A;  3BBY A;  3KJY A;  1E6B A;  1TKD B;  2GVP A;  5G2Z A;  1USB A;  5ECM B;  4F2I A;  4IGJ A;  3BJ5 A;  3F6F A;  3ZZX A;  1O81 A;  5JWO B;  2RLI A;  3DKS A;  2M46 A;  3CSJ A;  3KTL A;  2FUG 2;  3QAG A;  4N0V A;  1GSQ A;  2HXK A;  4LA1 A;  5H5S A;  2IME A;  3FMW A;  1GL8 A;  4X4J A;  3F4T A;  4J56 E;  3LOR A;  4GCI A;  5D9X A;  2WUL A;  3TRX A;  4EL1 A;  2NPB A;  1HQO A;  4KH7 A;  5DVB A;  4GST A;  2LQQ A;  3KH9 A;  2VAF A;  4L0U A;  3GIX A;  3GKK A;  5ID2 A;  1KBN A;  2GSR A;  2C8U A;  4WKW A;  4PQ1 A;  5HFK A;  4IHU A;  3FZ9 A;  1UA5 A;  6GST A;  2YOI A;  1HYU A;  4ML6 A;  3Q6O A;  3D4M A;  1TU8 A;  2LRC A;  1PMT A;  1A2J A;  3LEF A;  3IA1 A;  4JRR A;  1M2A A;  4X1U A;  1V9W A;  3IAS 2;  3ZVJ A;  2DJ2 A;  1AW9 A;  3MYD A;  4ZXG A;  3FZA A;  1HNC A;  3APQ A;  3O76 A;  1TRS A;  5BMU A;  1EP7 A;  2MBS A;  3DXB A;  4EO3 A;  5EVO A;  4F0C A;  2YV7 A;  5ECR B;  4A5P A;  2FWH A;  3LXT A;  2AB6 A;  2B7J A;  3QFB C;  3IRA A;  1ZYN A;  4G0K A;  2V1M A;  4DSR A;  2ON7 A;  1K0D A;  1A0R P;  4PQH A;  4EC0 A;  1PKW A;  3DML A;  1OC9 A;  1K0M A;  4KE3 A;  3TKP A;  1EGO A;  4XS4 A;  4NHW A;  4ZL8 A;  3TOU A;  1B9X C;  1F9M A;  5AIS A;  5A4V A;  1YEX A;  4EIP A;  1DUG A;  4AJ7 A;  4AJ8 A;  1TU7 A;  1LJR A;  4ID0 A;  5AGY A;  2GS3 A;  2H71 A;  1TTZ A;  4G2E A;  17GS A;  3IK9 A;  3P7X A;  1K0C A;  1UN2 A;  4O32 A;  4MH2 A;  1G0T A;  5F07 A;  2ZUP A;  1XW9 A;  1CQH A;  2VCX A;  4EIQ A;  1TRU A;  4I97 A;  4WET A;  1XOB A;  2GGT A;  2OE0 A;  4EE0 A;  4N10 A;  1E2Y A;  3W8S A;  3D5J A;  4TR4 A;  5CRH A;  4POM A;  1TK0 B;  3MSZ A;  1GSU A;  2HZE A;  4G19 A;  4O5Q A;  4OWY A;  3GN3 A;  5ECK B;  1W4V A;  4PQI A;  5BRT A;  4ZL7 A;  4OFT A;  1ST9 A;  4I8B A;  4IN0 A;  4D73 B;  5GZZ B;  4JZQ A;  1VF3 A;  4MJC A;  2V2G A;  4POK A;  4MPF A;  3G7Y A;  2Z9S A;  1X0R A;  3GMF A;  2HSY A;  4OCF A;  2JZR A;  1GTU A;  1HNA A;  3CMI A;  2DLX A;  2YZU A;  3LW9 A;  2H74 A;  5IOX A;  5ELA A;  3CYN A;  2B1K A;  2GSQ A;  2F3M A;  4KDY A;  4L5O A;  3C1S A;  4N30 A;  1GTB A;  6GSX A;  1VF2 A;  3G7J A;  3LYK A;  2FGX A;  3IC4 A;  3EU3 A;  11GS A;  1G7E A;  1JZO A;  3HJO A;  3ISO A;  2LV3 A;  3F4R A;  4KX4 A;  2IMD A;  1XVW A;  2N5A A;  2I1U A;  2JU5 A;  2H70 A;  2NVL A;  1YKC A;  5B8B A;  2AHE A;  1JZD A;  1SL2 B;  3GST A;  2CX3 A;  3HDC A;  5JCW A;  5E59 A;  3TCO A;  4DSQ A;  2OBK A;  2LNT A;  2V41 A;  2QKE A;  3TB2 A;  2VIM A;  2GT6 A;  3I9V 2;  3HJP A;  2A2R A;  4FIW A;  2IPA A;  3CSI A;  3QPM A;  5KN1 A;  3GL5 A;  1ZYE A;  3EIN A;  5ECP B;  4I2T A;  3ERF A;  2X64 A;  2H76 A;  4LL4 B;  1YZX A;  2RII A;  5D8I A;  3UJ1 A;  4ICY A;  4YQU A;  2FA4 A;  2VCV A;  1A8L A;  1SJ6 A;  2B1L A;  2LJA A;  5ECQ B;  1GUH A;  1V98 A;  2L4C A;  1EOG A;  1EWX A;  2FNO A;  5AIV A;  4MZB A;  6GSV A;  1PN0 A;  3ZYW A;  2M72 A;  4CDO A;  2JAC A;  3H8Q A;  4KSM A;  4V2L A;  4JR4 A;  1PX7 A;  1RK4 A;  1ERV A;  3CSH A;  4X43 A;  4V1A p;  2IFQ B;  3Q74 A;  1SK2 A;  2BJX A;  3UL3 A;  1GLP A;  1URM A;  4F9Z A;  2HT9 A;  3WGX A;  1JFU A;  1BX9 A;  3ED3 A;  5D9V A;  3ZFB A;  2P5Q A;  2A2P A;  4JU5 A;  2YP6 A;  4P3Y B;  1IYI A;  3N5O A;  3ZIV A;  3MIX A;  1K3L A;  3FR3 A;  4PTS A;  1O8X A;  1V40 A;  5ECI B;  5F8B A;  1XPV A;  4PNG A;  1OYJ A;  1GUL A;  3C73 A;  2O89 A;  1G6W A;  2D2Z A;  4XRA A;  4WR5 A;  2C3Q A;  3EE2 A;  4YQM A;  5B6M A;  2VCQ A;  3MWH A;  1YQ1 A;  1GSY A;  2DJ3 A;  4K0N A;  3W6G A;  1U3I A;  3HZ8 A;  2FHE A;  5HR1 A;  1XWK A;  1FVJ A;  4NAX A;  2LKU A;  2KP2 A;  4BL7 B;  1WE0 A;  3I43 A;  3I69 A;  3GL3 A;  4I5Q A;  1ILO A;  5DQS A;  4N0Z A;  2HSH A;  2FD3 A;  3BOA A;  2LJK A;  3E0U A;  5DCG A;  1TOF A;  2G0F A;  1YKA A;  1SEN A;  2YWI A;  1Z3E A;  3HHV A;  2JSZ A;  4FYC A;  4HUA A;  4BVY B;  4QQ7 A;  3VI5 A;  5INY A;  2VL9 A;  1XCC A;  4GSS A;  1MDI A;  5IMA A;  5D9W A;  4F82 A;  2IMK A;  3AY8 A;  3DVX A;  3DVW A;  4TVE A;  4TR1 B;  4MMM A;  2LEG A;  3M3M A;  4HQZ A;  4HU9 A;  1ZL9 A;  2H6X A;  2RM5 A;  4EVM A;  5DAK B;  1PQN A;  1R5P A;  4K7N A;  5ELG A;  2YN1 A;  4O5R A;  2XBQ A;  5HFI A;  3QR6 A;  4ILF A;  2YNX A;  3WD6 A;  1EGR A;  3TJJ A;  3S9F A;  2V32 A;  4G0I A;  2IJY A;  1T4Y A;  5CAX A;  3GA4 A;  4GTU A;  5ECH B;  2QSI A;  3CRT A;  5KOX A;  4ZL9 A;  1ERW A;  3APS A;  3DGQ A;  2RUF A;  3W8J A;  3FR9 A;  2HE3 A;  5KN3 A;  1XXU A;  3LGC A;  2KOK A;  5DJL A;  1JLW A;  3HVX A;  1OC9 B;  3IOS A;  2K9F A;  3FZ4 A;  1GNE A;  2UZ8 A;  4K8M A;  1SYX A;  2A2S A;  2DML A;  3QMX A;  3ZRD A;  1F37 A;  4K1F A;  1J0F A;  1X5D A;  3PIN A;  5IMD A;  2YZH A;  1MEK A;  2DKI A;  4CY8 A;  3ZL5 A;  4RI6 A;  2ZCT A;  4EDZ A;  2YWN A;  4HQS A;  1XWG A;  2JAD A;  4WBJ A;  1THX A;  5FHI A;  1DE2 A;  3KMN A;  3PH9 A;  4OO4 A;  5B8A A;  5J9C A;  3L78 A;  4JR6 A;  2EIO A;  3F63 A;  4GSN A;  2WZ9 A;  2QA2 A;  1DE1 A;  4WF5 A;  4DSS B;  4ACS A;  7GSS A;  3TUE A;  4L0W A;  5G5E A;  1JHB A;  3IE3 A;  3GH9 A;  4MLY A;  5JCG A;  3QOU A;  3ERW A;  2CVK A;  3RHB A;  2C0E A;  3ERG A;  1U3A A;  4TW5 A;  5D73 A;  8GSS A;  2R0P A;  3C1R A;  3WT2 A;  3KTB A;  3GTU B;  2H19 A;  4MAB A;  3UVH A;  3O3T A;  2CV4 A;  1FOV A;  5IO2 A;  2FLS A;  2X8C A;  2YJ7 A;  5AIX A;  2B5X A;  5CRG A;  3ZRE A;  1AAZ A;  3V1W A;  2JZS A;  2WB9 A;  1BYE A;  3JCM L;  2OKA A;  4K5S A;  3CTF A;  2HZF A;  2DC5 A;  4H86 A;  1GSS A;  10GS A;  3HKR A;  1J9B A;  3VLN A;  1OVN A;  4BWQ A;  1YDK A;  5LCZ A;  2FWF A;  4QL9 A;  4YKG A;  4TR3 A;  4HZ2 A;  3NZN A;  4KA0 A;  4ULX A;  2MMA A;  2HI7 A;  5ABR A;  1Q98 A;  2FWG A;  3FW2 A;  3FKF A;  1ABA A;  4G9H A;  3VPT A;  3R3E A;  4AF2 A;  2IMI A;  5G1K A;  2VCZ A;  5EY6 A;  3TRP A;  3F4S A;  3LQ7 A;  3IPZ A;  1ZYP A;  1X5C A;  1Z7P A;  2R3X A;  4V1A g;  4K9Z A;  1OKT A;  1T00 A;  3GUS A;  4NHZ A;  4HJM A;  3I6A A;  3GSS A;  3KP9 A;  2PVQ A;  3IBH A;  2NDO A;  4WEY A;  1T3B A;  2L6C A;  2QC7 A;  1B48 A;  1TI1 A;  2M80 A;  2E7P A;  2EIR A;  1WIK A;  5IMZ A;  1THO A;  1ERU A;  3KZQ A;  1FVK A;  2MMN A;  4EF0 A;  2DSA A;  3D4T A;  2O7K A;  1GNW A;  1R5A A;  1NHY A;  2LRT A;  5IMV A;  3VI7 A;  3VUR A;  1PD2 1;  4MF6 A;  1VRS D;  2E2M A;  1Z6M A;  4BA7 A;  3GH6 A;  5IMC A;  3EYT A;  2H1D A;  1QGV A;  3LJR A;  1G6Y A;  2DMM A;  1OE8 A;  4FO5 A;  1O73 A;  1ACV A;  1VGL A;  2H75 A;  3BCI A;  1EP8 A;  2B3S A;  1WWJ A;  2H0I A;  3LSZ A;  5J5N A;  5CO3 A;  5DAL B;  18GS A;  5J9B A;  4Q5Q A;  2N5B A;  1JLV A;  4ECB A;  3EPT A;  2LTK A;  19GS A;  1YF0 A;  4KDX A;  3M0F A;  3HVS A;  2MMO A;  5IIZ A;  4Z2T A;  3M8N A;  5ENU A;  1XVQ A;  1EV9 A;  4FQU A;  5L71 A;  2OE1 A;  2LS5 A;  1AC1 A;  3HZ4 A;  1ERT A;  3GKM A;  4MNN A;  5ECL B;  1NSW A;  1TRV A;  1PL1 A;  2X8H A;  3PGT A;  20GS A;  1F3A A;  3DWV A;  2PN8 A;  1U6T A;  2F8F A;  3GV1 A;  3TKR A;  4MPG A;  4IEL A;  1QXH A;  3IHG A;  1ML6 A;  4ISD A;  1ZYQ B;  2I4A A;  2HRK A;  2J9H A;  2H6Y A;  3P8W A;  2H73 A;  2O8V B;  5KOW A;  3LFL A;  4Q5F A;  2NBS A;  1CQG A;  3M9J A;  2H0G A;  3WYW A;  4OFM A;  2RUE A;  5GAN D;  1AQX A;  2B5Y A;  4MZW A;  2LST A;  4MJE A;  2YAN A;  4FYB A;  3IC8 A;  1JZW A;  5ECO B;  4TOP A;  1SJZ A;  9GSS A;  3N9J A;  1GRX A;  1PX6 A;  5HQP A;  1BQ7 A;  1Q4J A;  3WT1 A;  4CW9 A;  6GSW A;  1TXX A;  3APO A;  4EUY A;  2AAW A;  1K0N A;  4Q5R A;  1H4O A;  2I81 A;  4MZC A;  4IP1 A;  2NTO A;  3C8E A;  2HFD A;  3KH7 A;  2J23 A;  3C71 A;  4OO5 A;  2VD1 A;  4GWR A;  4HJ2 A;  1T4Z A;  2KLX A;  5CRE A;  1TK8 B;  3RHC A;  3WGD A;  5FWG A;  2R0C A;  4GXZ A;  1SU9 A;  2IL3 A;  3EMP A;  4TN8 A;  3CRU A;  3DD3 A;  3HCZ A;  1G7O A;  4TR0 A;  2C3T A;  4V2N A;  2O85 A;  1LU4 A;  3D0Z A;  2N5F A;  4DEJ A;  3F6D A;  3LG6 A;  3RBT A;  2MMZ A;  4KGI A;  1GWC A;  2CZ2 A;  4GRF A;  1WJK A;  2CA8 A;  2VM1 A;  5J4U A;  1GUK A;  3QD9 A;  1GTI A;  3CBU A;  3IHQ A;  5CRW A;  2R6K A;  3TJG A;  3UAP A;  4MH3 A;  3PPU A;  1XW5 A;  1B4Q A;  1PN9 A;  3CTG A;  5G1L A;  2L59 A;  3VWV A;  1WRY A;  1FAA A;  1XFL A;  2PMT A;  4HDE A;  4J2F A;  5ECN B;  2PU9 C;  2E2G A;  1M2B A;  4HZ4 A;  2C4J A;  2L5O A;  1MTC A;  2LUS A;  3ZIT A;  2PGT A;  1SKS B;  4D73 A;  3DEX A;  1F6M C;  2DIY A;  1MD3 A;  4DVC A;  4WXT A;  2DJK A;  2WGR A;  3NIV A;  1AXD A;  4GLT A;  4AGS A;  2DKH A;  4CY6 A;  1SYR A;  4FYU A;  3IDV A;  1EEJ A;  2FWE A;  6GSU A;  3F8U A;  4ML1 A;  2GZP A;  5GSS A;  1XWA A;  3GFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...