1FOVA

Glutaredoxin 3 from escherichia coli in the fully oxidized form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
ANVEIYTKETCPYCHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRTTVPQIFIDAQHIGGYDDLYALDARGGLDPLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of oxidized glutaredoxin 3 from Escherichia coli.
pubmed doi rcsb
molecule keywords GLUTAREDOXIN 3
molecule tags Electron transport
source organism Escherichia coli
total genus 26
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1fovA00
4X43A 2H1GA 1XIYA 1Z7PA 1UA5A 2HSYA 2FGXA 2JL4A 2B1LA 1YKAA 5D73A 3IA1A 3GL3A 2H75A 2HE3A 2OE1A 2WGRA 4OO5A 1OVNA 1A2LA 1G0TA 2KUCA 3LWAA 5KN3A 3IBHA 1AQXA 5IMVA 1VF2A 2FWEA 4MP4A 3GN3A 4ZL8A 4WXTA 2C0EA 3L9UA 5J3RA 2LSTA 1FB6A 3ZYWA 2DMMA 2GSQA 4FIWA 4PNFA 4K0GA 3DKSA 4RUVA 4XCSA 3IRAA 3GX8A 3QAVA 4L0WA 4O92A 2LKUA 1ML6A 4OFTA 4K1FA 4ZB8A 1HD2A 4DSSB 4L5LA 1V98A 4XS4A 2FWFA 2Z9SA 2CZ2A 1A2JA 3IK9A 2NTOA 4HZ4A 3F4SA 4OCEA 3CYNA 2GQMA 2YP6A 3TGZA 1OC8A 1HNCA 1A0RP 3C7MA 2LUSA 4Z7XA 2L57A 3ERGA 2B7KA 1MEKA 4IBPA 1BJXA 2L5OA 5ELGA 1PX6A 2YPMA 3EVIA 1TU7A 2WJUA 3EU4A 4ZBDA 3HKRA 3KEBA 17GSA 3HVVA 3G7YA 1XZOA 4KH7A 4LL1B 4WETA 5J5NA 3G7IA 1URMA 22GSA 4RI6A 3CSIA 3Q6OA 1MD4A 4JEDA 1K0CA 2P0GA 1KTEA 1SYRA 2RUFA 5KN2A 2I4AA 3E0UA 1F6MC 5DQSA 1B4QA 3UOMA 2OKAA 1B4PA 3NIVA 3KD0A 4HJ2A 3OR5A 4NHWA 1U88A 3TKRA 4OMVA 4TOPA 4MMMA 2WZ9A 1RQMA 3IOSA 2DIZA 2R2JA 2L4QA 2GSSA 1O73A 5A4WA 3EE2A 4EUYA 3GSTA 2CQ9A 1GH2A 4KAEA 1FG4A 1PSQA 2O87A 2H71A 1M2DA 2AB6A 4XRAA 4QL7A 4IN0A 5HR1A 2YWIA 4WR5A 2X8CA 5E4WA 1XWGA 1F37A 4PGTA 1GL8A 4HDEA 3R2QA 2P5QA 4EF0A 2CX4A 1Z5YE 2REMA 1NSWA 5GZZB 4ZXGA 2J23A 2KLXA 2H70A 1XWBA 3RBTA 4JZQA 4POBA 1THOA 4KGIA 2IFQA 1Z3EA 3LSZA 5JCGA 8GSSA 3TJFA 4GSSA 4IQAA 5B6NA 1K0BA 3H8QA 1EV9A 3ZTLA 5G2ZA 5DALA 2OACA 4POKA 3KP9A 5AN1A 2PBJA 2MMNA 3EMPA 4POLA 1E6BA 2H66A 2HFDA 3WYWA 3WD6A 4RQRA 2H30A 2KHPA 4K6XA 4HOJA 2VL9A 4MDCA 1N2AA 3VLNA 2C0GA 1R5AA 2VLVA 4MJCA 1SD8A 4KX4A 4OWYA 1A8LA 2EIRA 4MZWA 4QQ7A 5ECNB 3SBCA 3ME7A 5F05A 2LNSA 1ERUA 3L0HA 1YJ6A 4CW9A 2IPAA 5A4UA 4FYBA 4GLTA 2YWOA 5IM9A 3NZNA 2F8FA 3GUSA 4HQSA 1MTCA 2P31A 2XC2A 2R5GA 1Q98A 2I81A 1XWCA 4IQ1A 1ZOFA 1TRUA 3QDNA 2H1DA 1G7OA 3UARA 3FYGA 3GV1A 4K0NA 1PGTA 5DAKA 3TRQA 1C72A 3NOFA 4FYUA 2BTOT 3TUEA 4K7IA 1G6YA 1NHOA 1GSUA 1WOUA 2YWNA 4IP1A 1A24A 3LG6A 4ZB6A 4AJ7A 1TK8B 1A2MA 1GRXA 4ECCA 3F6FA 2YV7A 1GULA 2CVDA 2YZHA 4F03A 3M9KA 4ZB9A 3K8NA 3UL3A 2LV3A 2L6DA 2R6KA 3GA4A 4I2TA 4LLRA 2HZEA 5IPHA 3D4TA 5CP1A 4CHSA 4IP6A 2K6VA 2FA4A 2GZPA 4PURA 5F06A 2LQQA 3ERFA 5KN0A 1G6WA 5ID2B 1H75A 1BAYA 2YWMA 5F8BA 4ECIA 4NPBA 4X0XA 4ZL7A 1EEJA 2O85A 1TK5B 1KNGA 5CRGA 1EV4A 2VCVA 1GSEA 5AIVA 1GLPA 3EYTA 2QSIA 2OADA 3UBLA 1M0UA 2VLTA 5B8AA 1PX7A 3WGXA 5L71A 5HR2A 1SENA 1LBKA 3ZIVA 2N5FA 2RUEA 2VCXA 5HFKA 1K3YA 3JCML 4J56E 2DJ1A 3UEMA 4BWSA 2HZFA 10GSA 3DIEA 3HXSA 3I9V2 4ZILA 2DJ2A 5GAPD 1ON4A 2KOKA 3EURA 4BVXA 4NV5A 2PPTA 2VOCA 2YOIA 4IKHA 3F63A 1XVQA 1OYJA 1VGLA 3VURA 3VWXA 3M3MA 4EL1A 1V9WA 4TN8A 1X9WB 16GSA 2DSAA 2GZYA 2IJYA 1T3BA 6GSXA 5AISA 2ZUPA 9GSSA 1YF1A 2VCQA 5H5SA 4N30A 1TKDB 3M0FA 1PL2A 5IMZA 3EMXA 1PKZA 1DUGA 2JZSA 4IHUA 2XPDA 1U87A 2PN8A 2LS5A 1EGRA 3BCKA 1SJZA 3IE3A 5GSSA 5D8IA 1F3AA 5B7CA 4EXJA 3WGEA 3QFAC 4HQZA 2L4CA 2CAIA 2VCZA 1UVZA 4XS4B 4IS0A 4HS1A 1PMTA 4L5OA 2IIYA 1NM3A 2VLUA 2ALBA 2LRTA 4MZBA 1AUCA 2GDRA 4D73A 3GTUA 3WT2A 4POMA 3HDCA 2V41A 3A2WA 2I1UA 2QKEA 1SK0A 3P7XA 2MMOA 3VPQA 4JRRA 2WULA 3LORA 1AC1A 2CX3A 1TTZA 3GFKA 5AIXA 2ON7A 1XW9A 1UN2A 3UVTA 5IMAA 2B5EA 3ME8A 5DQYA 2B3SA 1QK8A 3P90A 1S3CA 4AJ6A 2H6XA 2IN3A 3UJ1A 2NBSA 3MNGA 5DVBA 3HZ4A 3TCOA 5DCHA 3IDVA 3J7Yb 2DBCA 2GVPA 4ECJA 1BEDA 2LRCA 6GSVA 2B5YA 4GF0A 3FZ4A 5D93A 1R7HA 4TXOA 1T1VA 2O7KA 2R3XA 7GSSA 1PA3A 1T00A 2IL3A 1ZMAA 4I8BA 1ZL9A 5DCGA 3ZZXA 4J2FA 4OFMA 3S9FA 1GNEA 3G9BA 1OC9A 3HVSA 4KA0A 1TRSA 2KP1A 2C1YA 5ECLB 1GSDA 1XFLA 3KXOA 3G7JA 2HNLA 3C73A 2FY6A 2OBKA 4K8MA 3KTLA 4I6XA 2X64A 4YAVA 1PN9A 5JCUA 1E2YA 2XHFA 4JBBA 3GKKA 3GNJA 1XOAA 1O6JA 1XW6A 2CVBA 2PVQA 3GL5A 4I2UA 4KCEA 1F3BA 3HVXA 4AF2A 3IAM2 3F6DA 4Q5RA 3ZREA 1AAZA 1JZWA 2HI7A 2C0FA 1QFNA 1GSSA 1F9MA 2V6KA 3KTBA 1JHBA 2D2ZA 4JE1A 5IIZA 19GSA 4PQ1A 3FRCA 4Q5FA 2VCTA 2VL2C 3A2VA 3TRXA 5DJLA 1PKWA 3FZ5A 3D0ZA 2K9FA 2I3YA 1MDJA 5DBQA 4V2NA 2G0FA 4O32A 1JFUA 4MH2A 1TRVA 2DLXA 1JZDA 3HJMA 1QQ2A 1NHYA 5A5KA 2V1MA 3H4KA 2JADA 3UMAA 1RW1A 1CQHA 2DMLA 3L9SA 2VIMA 5CYYA 5EY6A 4ZBBA 3ZVJA 4FH8A 3QCPA 4KE3A 5J9BA 5H5RA 4KUNA 4E8EA 1TXXA 3IV4A 4EVMA 3VWUA 2WB9A 3CTGA 5DDLA 4EO3A 5D9XA 3ZFBA 3GKNA 4XHMA 4MF6A 4MZCA 5DJMA 1HYUA 5JWOB 2EC4A 2KP2A 2AV4A 2FUG2 2GGTA 4LMWA 3TDGA 4WBJA 3VK9A 1SK1A 5C04A 5KEJA 3ZIJA 2C3NA 3BJ5A 4YH2A 4MJAA 1XOBA 1TI1A 4KDXA 3HJPA 4XS6A 2H6YA 2DJ3A 1ERVA 1TRWA 2R37A 3MAKA 4DSSA 4EDYA 1ZGNA 2N5AA 3V1WA 2IMKA 3KGKA 1XW5A 4GRFA 1GTBA 4V2MA 5ECQB 3TKQA 1Z9HA 5B8BA 12GSA 4PX1A 2VAFA 4GSNA 1M7TA 1R5PA 3M8NA 1U6TA 3MDKA 4K9ZA 3O6TA 3IPZA 1Z6MA 4PUAA 1VF4A 4TR1B 2F8AA 4RI7A 1LJRA 1OC3A 1DE2A 4L8EA 1W89A 2CZ3A 1PRXA 1I5GA 5F07A 1B8XA 2YN1A 3GIXA 4CDOA 1YEXA 1G7EA 4GXZA 1XWKA 3QFBC 2WRTA 3F4RA 3VI7A 3KH9A 5D9WA 3GHAA 1K0NA 3F4TA 3FK8A 2VM1A 4HU7A 1TW9A 2VD0A 5IPGA 4OD7A 1IYHA 2HRNA 3HCZA 5FHIA 3FHKA 1F2EA 1WMJA 3F9UA 1TP9A 3DRNA 3IR4A 3DEXA 1X5DA 4MH3A 1TJDA 2M72A 1V2AA 2WFCA 3FW2A 1FVKA 3CSHA 2K18A 2H1BA 4KDYA 3A5WA 4I5QA 2B5XA 3QAWA 2PU9C 4TW5A 3DD3A 1WWJA 2AUVA 3FR6A 2L6CA 4E8HA 2FA8A 2PGTA 1GUHA 2JACA 2F51A 4ID0A 3GH6A 1MDIA 3ZFLA 5ECSA 3CRTA 1SL1B 2BMXA 1HNBA 5ECRB 4J57E 2H6ZA 2VD1A 1TOFA 2AYTA 4LL4B 2CT6A 1OE7A 5J4UA 1XBSA 3U5RE 3VI5A 2K8VA 1VRSD 2H0GA 2FNOA 2C0DA 2X99A 1PQNA 4N0ZA 4OO4A 5ECPB 4HJMA 4BL7A 1GTUA 1BYEA 5CRHA 4GQCA 1SJ6A 2LTKA 2LRNA 3PGTA 2LEGA 2IMDA 4G9HA 1XPVA 4FYCA 4IGJA 2L59A 2PERA 3D22A 1GUMA 2MZCA 4N0VA 2YCDA 1OKDA 2OA7A 2VL2A 4KNDA 3Q74A 1HNAA 4MLYA 1J9BA 4G10A 4TKYA 1TDIA 2IMIA 2A2RA 4KSOA 1ZYQB 5C00A 1ST9A 2A4VA 3EU3A 5D9VA 2JZTA 5J9CA 1OAZA 1GNWA 2NVLA 4X1UA 3TB2A 3KMNA 1J0FA 1XVWA 1SJIA 4ECBA 20GSA 3LXTA 1Z6NA 4MPFA 4KSMA 1GP1A 2GS3A 5CAXA 1ERWA 3DVWA 3GRXA 4O5RA 2H76A 2XPEA 6GSSA 1FW1A 1SL2B 5IMDA 2X8GA 2CAQA 1A0FA 3TOUA 3AY8A 3GURA 2L5LA 2B7JA 3KCMA 3PINA 4HI7A 3DWVA 4AJ8A 5JCWA 3CTFA 3DVXA 4GCIA 4IJIA 4DEJA 2MBTA 3MWHA 4N10A 5KN1A 4TXVA 4TR3A 5HFIA 4GQFA 1MDKA 1FOVA 3ZL5A 4OCFA 1V57A 5IQYA 1EZKA 2HRFA 2PWJA 2GSTA 5IOXA 2E7PA 4K7OA 1AW9A 3ED3A 4AGSA 1ZYEA 2E0QA 4KDUA 4PQIA 4TRXA 5D9TA 1FHEA 3E9JB 3D4MA 3C1RA 3HHVA 1FVJA 5IMFA 3O76A 2MMAA 2TRXA 3TJGA 2HSHA 1O85A 3C8EA 5ID2A 3QAGA 1X9MB 4JU5A 2X8HA 3FR3A 2JU5A 1M9BA 4MJEA 1U3AA 2XBIA 4V1Ag 2NPBA 4ML1A 3IAS2 3BOAA 1V58A 2IWTA 2N5BA 1QMVA 2LJAA 4PUFC 3LYPA 2R4VA 4YQUA 2VM2A 1V40A 2HT9A 3LJRA 2E2MA 3ZITA 3H1NA 3GKXA 2VO4A 4DSRA 1RK4A 3KJYA 1WE0A 3FZ9A 1USBA 3DXBA 3ERWA 4JR6A 4F9ZA 4NAXA 4MJBA 5LD0A 3QPMA 3TJKA 4V2LA 2GT5A 4JR4A 3I6AA 3CXGA 4TR0A 2I9HA 2IMEA 3LEFA 4HU9A 3ZMKA 4ACSA 5GAND 4P3YB 2OE0A 1TU8A 2C80A 3KP8A 3ZVJD 3VPTA 1M2BA 3UBKA 1ACVA 2CA8A 4G19A 5ECHB 3N5OA 3F3QA 3H93A 1B48A 3IHQA 1Y25A 4IW9A 3W8SA 1CQGA 1Y6EA 4IELA 4HZ2A 4HUAA 4OFNA 5B6MA 3FZAA 3LQ7A 3F3RA 4EC0A 2V6OA 3DYRA 1K0DA 4TR4A 1VF1A 2ON5A 1VF3A 2QC7A 1XWAA 1YEPA 1S3AA 2GTUA 4EKZA 4BWQA 3W6GA 1AQWA 2VUPA 2IFQB 1GWCA 5ELAA 4IVFA 2FWGA 2GQLA 1T4YA 2MYGA 1WJKA 3RHBA 2YNXA 1KBNA 1GLQA 1JZRA 2DJJA 3ZRDA 1X0RA 3SWLA 5DALB 1XXUA 4Q5NA 4V1Ap 5ECOB 5ECIB 4GTUA 1YQ1A 2PUKC 4F82A 3I43A 4BA7A 2JSYA 3WGDA 1YDKA 4MPGA 3US3A 4PQHA 3GSSA 4ML6A 2YANA 2VL3A 1DSBA 3O3TA 4XTSA 2ZCTA 5G31A 1QXHA 3MSZA 2V2GA 3QR6A 5JWQB 5G5EA 5CRDA 3KZQA 5INYA 2AJQB 2J9HA 1ABAA 1YKCA 3ZMLA 1J08A 1EEMA 1AIUA 2FHEA 1EP7A 3KH7A 1TK0B 2LQOA 1TI3A 3A3TA 2TIRA 1H4OA 2RM6A 2C4JA 4MF5A 2DIYA 2GSRA 1T4ZA 1BX9A 3ISOA 5COHA 4ZIJA 1SKRB 1O8WA 2O8VB 4FO5A 5DAKB 3TJBA 4ZL9A 3KMOA 1SK2A 5AGYA 2YJ7A 2B1KA 5JWRB 1Z7RA 14GSA 3A2XA 3LFLA 3LGCA 3UIWA 4GSTA 2AHEA 3TRPA 3ZLPA 1ERTA 5H5QA 1GUKA 3E3EA 2IMFA 5J41A 4NWYA 3TKSC 3PH9A 2PVOC 2C8UA 1GSYA 1R26A 2RM5A 4F2IA 2YZUA 1JZOA 4WKWA 1R4WA 3TOTA 1T8EB 1JLWA 3UVHA 4ULXA 2HZEB 2G2QA 3PR8A 3BBYA 5G1LA 2LJKA 5ECKB 5GSTA 4I97A 4KCAA 18GSA 1FAAA 2WDUA 3TKPA 5EPFA 3LXZA 3APSA 4XIHA 2MMZA 1SYXA 3D6IA 4NV2A 1OE8A 11GSA 3I69A 4PNGA 5EVOA 3DGQA 2XBQA 4TVEA 2HYXA 3KM6A 1ZCPA 3UAPA 3CSJA 1AQVA 3EC3A 2MBSA 3M9JA 1WRYA 1S3DA 1WIKA 1KEBA 2JSZA 2H1AA 2DJ0A 2LJRA 2OJLA 5IO0A 4F0BA 5FWGA 4MABA 3QMXA 1K0AA 3HA9A 5G1KA 3FR9A 3L4NA 3C1SA 2FCHA 4N11A 3IXRA 1THXA 1YZXA 1EOGA 2C3TA 4H86A 6GSWA 1DE1A 5G30A 5HFGA 2M80A 1K0MA 2H01A 4ISDA 1K3OA 1FB0A 2HXKA 5LCZA 4WR4A 2H72A 2LNTA 3J7Yk 2H73A 2F9SA 3N9JA 3EWLA 3HJOA 3D21A 4YQMA 1SL0B 2H74A 2YJHA 4LMVA 1K3LA 2EIQA 3H79A 1B9XC 2GT6A 4WBRD 4MF7A 1IYIA 4XS1A 3F8UA 4G2EA 4NMUA 3BCIA 5ECMB 4DVCA 2M46A 3CMIA 1EOHA 3TKSE 3VWWA 5G5FA 1M2AA 3FKFA 3HY2A 1A8YA 3KIJA 5F0GA 2H8LA 2QGVA 3QD9A 1GTAA 1QUWA 2H0HA 2DC5A 1AXDA 1MD3A 4HEA2 2NDOA 1BQ7A 3U6VA 3D5JA 2OBIA 1GSQA 1QGVA 5IO2A 5D96A 1SU9A 2GQKA 4RQXA 5EL8A 1M9AA 4MCUA 4D73B 1Q4JA 3GTUB 3GKMA 2WCIA 3M1GA 5E59A 1T7PB 3BD2A 2TRCP 1WPIA 3GMFA 2O89A 5FT3A 3CBUA 5IMCA 1SKWB 4TR1A 2F3MA 5HR3A 1O8XA 1SD9A 1PD21 2EIOA 3IC4A 3QOUA 5LNKe 2WS2A 3TJJA 4F0CA 4XRDA 1I9DA 1GTIA 3F0IA 3RAZA 3VFIA 3C71A 2V32A 2CVKA 4KB3A 4MK3A 2RLIA 3APOA 3L9VA 1A23A 3RPPA 2OE3A 5CREA 2FLSA 2GLRA 2H19A 3FY7A 4YQVA 6GSTA 4MA9A 3P2AA 2H0IA 3HYPA 3CRUA 6GSYA 1ILOA 3L78A 1EWXA 3RDWA 4PXOA 4LA1A 3EINA 4TXOB 5A4VA 1HQOA 2GZZA 2CV4A 4ZBAA 1WP0A 3W8JA 3RPNA 2B6MA 5HR0A 1W4VA 5CO3A 4WF4A 4NHZA 1O7UA 3GX0A 3HZ8A 1OC9B 1EGOA 3VWVA 2PMTA 4QL9A 1K0OA 3TKSA 1GSFA 4L0UA 2A2SA 4O7HA 1O81A 1X5CA 1FO5A 4KW6A 2JZRA 4WEYA 4K2DA 1X9SB 1LU4A 4BVYA 1B9YC 4Q5QA 2FWHA 1JLVA 1XCCA 5CRWA 1M99A 3LYKA 1NW2A 4EE0A 3IK7A 3HD5A 4GWRA 1N8JA 3APQA 2DJKA 5ENUA 1ZZYA 2RIIA 4EDZA 4DSQA 2BJXA 1OKTA 4NXIA 3RHCA 2AAWA 2E2GA 1DBYA 5ABRA 4K7NA 3DMLA 5CNWA 1SKSB 2VCWA 3Q19A 6GSUA 2K8SA 3FEUA 5IOWA 4IJ3A 1UC7A 3WT1A 1EP8A 4YAPA 1YF0A 13GSA 2P5RA 2C3QA 3Q18A 1X5EA 4ILFA 1U3IA 3P8WA 5HQPA 2HLSA 1BG5A 4BPYA 2ZNMA 2ES7A 1PL1A 2FD3A 2YV9A 4WF5A 3GH9A 3GYKA 1YY7A
chains in the Genus database with same CATH superfamily
4X43A 2QA1A 2H1GA 1XIYA 1Z7PA 1UA5A 2HSYA 2FGXA 2JL4A 2B1LA 1YKAA 5D73A 3IA1A 3GL3A 2H75A 2HE3A 2OE1A 2WGRA 4OO5A 1OVNA 1A2LA 1G0TA 2KUCA 3LWAA 5KN3A 3IBHA 1AQXA 5IMVA 1VF2A 2FWEA 4MP4A 3GN3A 4ZL8A 2HSMA 4WXTA 2C0EA 3L9UA 5J3RA 2LSTA 1FB6A 3ZYWA 2DMMA 2GSQA 4FIWA 4PNFA 4K0GA 3DKSA 4RUVA 4XCSA 3IRAA 3GX8A 3QAVA 4L0WA 4O92A 2LKUA 1ML6A 4OFTA 4K1FA 4ZB8A 1HD2A 4DSSB 4L5LA 1V98A 4XS4A 2FWFA 2Z9SA 3IC8A 2CZ2A 1A2JA 3IK9A 2NTOA 4HZ4A 3F4SA 4OCEA 3CYNA 2GQMA 2YP6A 3TGZA 1OC8A 1HNCA 1A0RP 3C7MA 2LUSA 4Z7XA 2L57A 3ERGA 2B7KA 1MEKA 4IBPA 1BJXA 2L5OA 5ELGA 1PX6A 2YPMA 3EVIA 1TU7A 2WJUA 2R0GA 3EU4A 4ZBDA 3HKRA 3KEBA 17GSA 3HVVA 3G7YA 1XZOA 4KH7A 4LL1B 4WETA 5J5NA 3G7IA 1URMA 22GSA 4RI6A 3CSIA 3Q6OA 4K5RA 1MD4A 4JEDA 1K0CA 2P0GA 4YKFA 1KTEA 1SYRA 2RUFA 5KN2A 2I4AA 3E0UA 1F6MC 3FMWA 5DQSA 1B4QA 3UOMA 2OKAA 1B4PA 3NIVA 3KD0A 4HJ2A 3OR5A 4NHWA 1U88A 3TKRA 4OMVA 4TOPA 4MMMA 2WZ9A 1RQMA 3IOSA 2DIZA 2R2JA 2L4QA 2GSSA 1O73A 5A4WA 3EE2A 4EUYA 3MYDA 3GSTA 2CQ9A 1GH2A 4KAEA 1FG4A 1PSQA 2O87A 2H71A 1M2DA 2AB6A 4XRAA 4QL7A 4IN0A 5HR1A 2YWIA 1ZYPA 4WR5A 2X8CA 5E4WA 1XWGA 1F37A 4PGTA 1GL8A 4HDEA 3R2QA 2P5QA 4EF0A 2CX4A 1Z5YE 2REMA 5BRTA 1NSWA 5GZZB 4ZXGA 2J23A 2KLXA 2H70A 1XWBA 3RBTA 4JZQA 4POBA 1THOA 4BL7B 4KGIA 2IFQA 1Z3EA 3LSZA 5JCGA 8GSSA 3TJFA 2X49A 4GSSA 4IQAA 5B6NA 1K0BA 3H8QA 1EV9A 3ZTLA 5G2ZA 5DALA 2OACA 4POKA 3KP9A 2PBJA 2MMNA 3EMPA 5AN1A 4POLA 1E6BA 2H66A 2HFDA 3WYWA 3WD6A 3R3EA 4RQRA 2H30A 2KHPA 4K6XA 4HOJA 2VL9A 4MDCA 1N2AA 3VLNA 2C0GA 1R5AA 2QA2A 2VLVA 4MJCA 4EIQA 1SD8A 2R0PA 4KX4A 4OWYA 1A8LA 2EIRA 4MZWA 4QQ7A 5ECNB 3SBCA 4Z2UA 3ME7A 5F05A 2LNSA 1ERUA 4CY6A 3L0HA 1YJ6A 4CW9A 2IPAA 5A4UA 4FYBA 4GLTA 2YWOA 5IM9A 3NZNA 2F8FA 3GUSA 4HQSA 1MTCA 2P31A 2XC2A 2R5GA 1Q98A 2I81A 1XWCA 4IQ1A 1ZOFA 1TRUA 3QDNA 2H1DA 2X4AA 1G7OA 3UARA 3FYGA 3GV1A 4K0NA 1PGTA 5DAKA 3TRQA 1C72A 3NOFA 4FYUA 4HSCX 2BTOT 3TUEA 4Z2TA 4K7IA 1G6YA 1NHOA 1GSUA 1WOUA 3PPUA 2YWNA 4IP1A 1A24A 3LG6A 4ZB6A 4AJ7A 1TK8B 1A2MA 1GRXA 4ECCA 3F6FA 2YV7A 1GULA 2CVDA 2YZHA 4F03A 3M9KA 4ZB9A 3K8NA 3UL3A 2LV3A 2L6DA 2R6KA 3GA4A 4I2TA 4LLRA 2HZEA 5IPHA 3D4TA 5CP1A 4CHSA 4IP6A 2K6VA 1M3JA 2FA4A 2GZPA 4PURA 5F06A 2LQQA 3ERFA 5KN0A 1G6WA 4EIPA 5ID2B 1H75A 1BAYA 2YWMA 5F8BA 4ECIA 4NPBA 4X0XA 4ZL7A 1EEJA 2O85A 1TK5B 1KNGA 5CRGA 1EV4A 2VCVA 1GSEA 5AIVA 1GLPA 3EYTA 2QSIA 2OADA 3HVNA 1M0UA 2VLTA 3UBLA 5B8AA 1PX7A 3WGXA 5L71A 5HR2A 1SENA 1LBKA 3ZIVA 2N5FA 2RUEA 2VCXA 5HFKA 1K3YA 3JCML 4J56E 2DJ1A 3UEMA 4BWSA 2HZFA 10GSA 3DIEA 3HXSA 3I9V2 4ZILA 2DJ2A 5GAPD 1ON4A 2KOKA 3EURA 4BVXA 4NV5A 2PPTA 2VOCA 2YOIA 4IKHA 3F63A 1XVQA 1OYJA 1VGLA 3VURA 3VWXA 3M3MA 4EL1A 1V9WA 4TN8A 1X9WB 16GSA 2DSAA 2UZ8A 2GZYA 2IJYA 1T3BA 6GSXA 5AISA 2ZUPA 9GSSA 1YF1A 2VCQA 5H5SA 4N30A 1TKDB 3M0FA 1PL2A 5IMZA 3EMXA 1PKZA 1DUGA 2JZSA 4IHUA 2XPDA 4G0KA 1U87A 2PN8A 2LS5A 1EGRA 3BCKA 1SJZA 3IE3A 5GSSA 5D8IA 1F3AA 3MIXA 5B7CA 4EXJA 3WGEA 3QFAC 4HQZA 2L4CA 2CAIA 2VCZA 1UVZA 4XS4B 4IS0A 4HS1A 1PMTA 4L5OA 2IIYA 1NM3A 2VLUA 2ALBA 2LRTA 4MZBA 1AUCA 2GDRA 4D73A 3GTUA 3WT2A 4POMA 3HDCA 2V41A 3A2WA 2I1UA 2QKEA 1SK0A 3P7XA 2MMOA 3VPQA 4JRRA 2WULA 5KOWA 3LORA 1AC1A 2CX3A 1TTZA 3GFKA 5AIXA 2ON7A 1XW9A 1UN2A 3UVTA 5IMAA 2B5EA 3ME8A 5DQYA 2B3SA 1QK8A 3P90A 1S3CA 2A2PA 4AJ6A 5BMUA 2H6XA 2IN3A 3UJ1A 1PFOA 2NBSA 3MNGA 5DVBA 3HZ4A 3TCOA 5DCHA 3IDVA 3J7Yb 2DBCA 2GVPA 4ECJA 1BEDA 2LRCA 6GSVA 2B5YA 4GF0A 3FZ4A 5D93A 1R7HA 4TXOA 1T1VA 2O7KA 2R3XA 7GSSA 1PA3A 1T00A 2IL3A 1ZMAA 4I8BA 1ZL9A 5DCGA 3ZZXA 4J2FA 4OFMA 3S9FA 1GNEA 3G9BA 1OC9A 3HVSA 4KA0A 1TRSA 2KP1A 2C1YA 5ECLB 1GSDA 1XFLA 3KXOA 3G7JA 2HNLA 3C73A 2FY6A 2OBKA 4K8MA 3KTLA 4I6XA 2X64A 4YAVA 1PN9A 5JCUA 1E2YA 2XHFA 4X4JA 4JBBA 3GKKA 3GNJA 1XOAA 1O6JA 1XW6A 2CVBA 2PVQA 3GL5A 4I2UA 4KCEA 1F3BA 3HVXA 4AF2A 3IAM2 3F6DA 4Q5RA 3ZREA 1AAZA 1JZWA 2HI7A 2C0FA 1QFNA 1GSSA 1F9MA 2V6KA 3KTBA 1JHBA 2D2ZA 4JE1A 5IIZA 19GSA 4PQ1A 3FRCA 4Q5FA 2VCTA 2VL2C 3A2VA 3TRXA 5DJLA 1PKWA 3FZ5A 3D0ZA 2K9FA 2I3YA 1MDJA 5DBQA 4V2NA 2G0FA 4O32A 1JFUA 4MH2A 1TRVA 2DLXA 3IHGA 1JZDA 3HJMA 1QQ2A 1NHYA 5A5KA 2V1MA 3H4KA 2JADA 3UMAA 1RW1A 1CQHA 2DMLA 3L9SA 2VIMA 5CYYA 5EY6A 4ZBBA 3ZVJA 4CY8A 4FH8A 3QCPA 4KE3A 5J9BA 5H5RA 4KUNA 4E8EA 1TXXA 3IV4A 4EVMA 3VWUA 2WB9A 3CTGA 5DDLA 4EO3A 5D9XA 3ZFBA 3GKNA 4XHMA 4MF6A 4MZCA 5DJMA 1HYUA 5JWOB 2EC4A 2KP2A 2AV4A 2FUG2 2GGTA 4LMWA 3TDGA 4WBJA 3VK9A 1SK1A 5C04A 5KEJA 3ZIJA 2C3NA 4Z2RA 3BJ5A 4YH2A 4MJAA 1XOBA 1TI1A 4KDXA 3HJPA 4XS6A 2H6YA 2DJ3A 1ERVA 1TRWA 2R37A 3MAKA 4DSSA 4EDYA 1ZGNA 2N5AA 3V1WA 2IMKA 3KGKA 1XW5A 4GRFA 1GTBA 4V2MA 5ECQB 3TKQA 1Z9HA 5B8BA 12GSA 2HRKA 4PX1A 2VAFA 4GSNA 1M7TA 1R5PA 3M8NA 1U6TA 3MDKA 4K9ZA 3O6TA 3IPZA 1Z6MA 4PUAA 1VF4A 4TR1B 2F8AA 4O5QA 4RI7A 1LJRA 1OC3A 1DE2A 4L8EA 1W89A 2CZ3A 1PRXA 1I5GA 5F07A 1B8XA 2DKIA 2YN1A 3GIXA 4CDOA 1YEXA 1G7EA 4GXZA 1XWKA 3QFBC 2WRTA 3F4RA 3VI7A 3KH9A 5D9WA 3GHAA 1K0NA 3F4TA 3FK8A 2VM1A 4HU7A 1TW9A 2VD0A 5IPGA 4OD7A 1IYHA 2HRNA 3HCZA 5FHIA 3FHKA 1F2EA 1WMJA 3F9UA 1TP9A 3DRNA 3IR4A 3DEXA 1X5DA 4MH3A 1TJDA 2M72A 1V2AA 2WFCA 3FW2A 1FVKA 3CSHA 2K18A 2H1BA 4KDYA 3A5WA 4I5QA 2B5XA 3QAWA 2PU9C 4TW5A 3DD3A 4YKGA 1WWJA 2AUVA 4K2XA 3FR6A 2L6CA 4E8HA 2FA8A 2PGTA 1GUHA 2JACA 2F51A 4ID0A 3GH6A 1MDIA 3ZFLA 5ECSA 3CRTA 1SL1B 2BMXA 1HNBA 5ECRB 4J57E 2H6ZA 2VD1A 1TOFA 2AYTA 4LL4B 2CT6A 1OE7A 5J4UA 1XBSA 3U5RE 3VI5A 2K8VA 4BVYB 1VRSD 2H0GA 2FNOA 2C0DA 2X99A 1PQNA 4N0ZA 4OO4A 5ECPB 4HJMA 4BL7A 1GTUA 1BYEA 5CRHA 4GQCA 1SJ6A 2LTKA 2LRNA 3PGTA 2LEGA 2IMDA 4G9HA 1XPVA 4FYCA 4IGJA 2L59A 2PERA 3D22A 1FOHA 1GUMA 2MZCA 4N0VA 2YCDA 1OKDA 2OA7A 2VL2A 4BIKA 4KNDA 3Q74A 1HNAA 4MLYA 1J9BA 4G10A 4TKYA 1TDIA 2IMIA 2A2RA 4KSOA 1ZYQB 5C00A 1ST9A 2A4VA 3EU3A 4PTSA 5D9VA 2JZTA 5J9CA 1OAZA 1GNWA 2NVLA 4X1UA 3TB2A 3KMNA 1J0FA 1XVWA 1SJIA 4ECBA 3A5IA 20GSA 3LXTA 2R0CA 1Z6NA 4MPFA 4KSMA 1GP1A 2GS3A 4FQUA 5CAXA 1ERWA 3DVWA 3GRXA 4O5RA 2H76A 2XPEA 6GSSA 1FW1A 1SL2B 5IMDA 2X8GA 2CAQA 1A0FA 3TOUA 3AY8A 3GURA 2L5LA 2B7JA 3KCMA 3PINA 4HI7A 3DWVA 4AJ8A 5JCWA 3CTFA 3DVXA 4GCIA 4IJIA 4DEJA 2MBTA 3MWHA 4N10A 5KN1A 4TXVA 4TR3A 5HFIA 4GQFA 1MDKA 1FOVA 3ZL5A 4OCFA 1V57A 5IQYA 1EZKA 2HRFA 2PWJA 2GSTA 5IOXA 2E7PA 4K7OA 1AW9A 3ED3A 4AGSA 1ZYEA 2E0QA 4KDUA 4PQIA 4TRXA 5D9TA 1FHEA 3E9JB 3D4MA 3C1RA 3HHVA 1FVJA 5IMFA 3O76A 2MMAA 2TRXA 3TJGA 2HSHA 1O85A 3C8EA 5ID2A 3QAGA 1X9MB 4JU5A 2X8HA 3FR3A 2JU5A 1M9BA 4MJEA 1U3AA 2XBIA 4V1Ag 2NPBA 4ML1A 4O5UA 3IAS2 3BOAA 1V58A 2IWTA 2N5BA 1QMVA 2LJAA 4PUFC 1PN0A 3LYPA 2R4VA 4YQUA 2VM2A 1V40A 2HT9A 3LJRA 2E2MA 3ZITA 3H1NA 3GKXA 2VO4A 4DSRA 1RK4A 3KJYA 1WE0A 3FZ9A 1USBA 3DXBA 3ERWA 4JR6A 4F9ZA 4NAXA 4MJBA 5LD0A 3QPMA 3TJKA 4V2LA 2GT5A 4JR4A 3I6AA 3CXGA 4TR0A 2I9HA 2IMEA 3LEFA 4HU9A 3ZMKA 4ACSA 5GAND 4P3YB 2OE0A 1TU8A 2C80A 3KP8A 3ZVJD 3VPTA 1M2BA 3UBKA 1ACVA 2CA8A 4G19A 5ECHB 3N5OA 3F3QA 3H93A 1B48A 3IHQA 1Y25A 4IW9A 3W8SA 1CQGA 1Y6EA 4IELA 4HZ2A 4HUAA 4OFNA 5B6MA 3FZAA 3LQ7A 3F3RA 4EC0A 2V6OA 3DYRA 1K0DA 4TR4A 1VF1A 2ON5A 1VF3A 2QC7A 1XWAA 1YEPA 1S3AA 2GTUA 4EKZA 4BWQA 4A5PA 3W6GA 1AQWA 2VUPA 2IFQB 1GWCA 5ELAA 4IVFA 2FWGA 2GQLA 1T4YA 2MYGA 1WJKA 3RHBA 2YNXA 1KBNA 1GLQA 1JZRA 2DJJA 3ZRDA 1X0RA 3SWLA 5DALB 1XXUA 4Q5NA 4V1Ap 5ECOB 5ECIB 4GTUA 1YQ1A 4MNNA 2PUKC 4F82A 3I43A 4BA7A 2JSYA 3WGDA 1YDKA 4MPGA 3US3A 4PQHA 3GSSA 4ML6A 2YANA 2VL3A 1DSBA 3O3TA 4XTSA 2ZCTA 5G31A 1QXHA 3MSZA 2V2GA 3QR6A 5JWQB 5G5EA 5CRDA 3KZQA 5INYA 2AJQB 4USSA 2J9HA 1ABAA 1YKCA 3ZMLA 1J08A 1EEMA 1AIUA 2FHEA 1EP7A 3KH7A 1TK0B 2LQOA 1TI3A 3A3TA 2TIRA 1H4OA 2RM6A 2C4JA 4MF5A 2DIYA 2GSRA 1T4ZA 1BX9A 3ISOA 5COHA 4ZIJA 1SKRB 1O8WA 2O8VB 4FO5A 5DAKB 3TJBA 4ZL9A 3KMOA 1SK2A 5AGYA 2YJ7A 2B1KA 5JWRB 1Z7RA 14GSA 3A2XA 3LFLA 3LGCA 3UIWA 4GSTA 2AHEA 3TRPA 3ZLPA 1ERTA 5H5QA 1GUKA 4KF9A 3E3EA 2IMFA 5J41A 4NWYA 3CQFA 3TKSC 3PH9A 2PVOC 2C8UA 1GSYA 1R26A 2RM5A 4F2IA 2YZUA 1JZOA 4WKWA 1R4WA 3TOTA 1T8EB 1JLWA 3UVHA 4ULXA 2HZEB 2G2QA 3PR8A 3BBYA 5G1LA 2LJKA 5ECKB 2A4HA 5GSTA 4I97A 4KCAA 18GSA 1FAAA 2WDUA 3TKPA 5EPFA 3LXZA 3APSA 4XIHA 2MMZA 4ICYA 1SYXA 3D6IA 4NV2A 1OE8A 11GSA 3I69A 4PNGA 5EVOA 3DGQA 4G0LA 2XBQA 4TVEA 2HYXA 3KM6A 1ZCPA 3UAPA 3CSJA 1AQVA 3EC3A 2MBSA 3M9JA 1WRYA 1S3DA 1WIKA 1KEBA 2JSZA 2H1AA 2DJ0A 2LJRA 2OJLA 5IO0A 4F0BA 5KOXA 5FWGA 4MABA 3QMXA 1K0AA 3HA9A 5G1KA 3FR9A 3L4NA 3C1SA 2FCHA 4N11A 3IXRA 1THXA 1YZXA 1EOGA 2C3TA 4H86A 6GSWA 1DE1A 5G30A 5HFGA 2M80A 1K0MA 2H01A 4ISDA 4BVXB 1K3OA 1FB0A 2HXKA 4G0IA 5LCZA 4WR4A 2H72A 2LNTA 3J7Yk 2H73A 2F9SA 3N9JA 3EWLA 3HJOA 3D21A 4YQMA 1SL0B 2H74A 2YJHA 4LMVA 1K3LA 2EIQA 3H79A 1B9XC 2GT6A 1XG8A 4WBRD 4MF7A 1IYIA 4XS1A 3F8UA 4G2EA 4NMUA 3BCIA 5ECMB 4DVCA 2M46A 3CMIA 1EOHA 3TKSE 3VWWA 5G5FA 1M2AA 3FKFA 3HY2A 1A8YA 3KIJA 5F0GA 2H8LA 2QGVA 3QD9A 1GTAA 1QUWA 2H0HA 2DC5A 1AXDA 1MD3A 2HRAA 4HEA2 2NDOA 1BQ7A 3U6VA 3D5JA 2OBIA 1GSQA 1QGVA 5IO2A 5D96A 1SU9A 2GQKA 4RQXA 5EL8A 1M9AA 4MCUA 4D73B 1Q4JA 3GTUB 3GKMA 2WCIA 3M1GA 5E59A 1T7PB 3BD2A 2TRCP 1WPIA 3GMFA 2O89A 5FT3A 3CBUA 5IMCA 1SKWB 4TR1A 2F3MA 5HR3A 1O8XA 1SD9A 1PD21 2EIOA 3IC4A 3QOUA 5LNKe 2WS2A 3TJJA 4F0CA 4XRDA 1M3IA 1I9DA 1GTIA 3F0IA 3RAZA 3VFIA 3C71A 2V32A 2CVKA 4KB3A 4MK3A 2RLIA 3APOA 3L9VA 1A23A 3RPPA 2OE3A 5CREA 2FLSA 2GLRA 2H19A 3FY7A 4YQVA 6GSTA 4MA9A 3P2AA 2H0IA 3HYPA 3CRUA 6GSYA 1ILOA 3L78A 1EWXA 3RDWA 4PXOA 4LA1A 3EINA 4TXOB 5A4VA 1HQOA 2GZZA 2CV4A 4ZBAA 1WP0A 3W8JA 3RPNA 2B6MA 5HR0A 1W4VA 5CO3A 4WF4A 4K5SA 4NHZA 1O7UA 3GX0A 3HZ8A 1OC9B 1EGOA 3VWVA 2PMTA 4QL9A 1K0OA 3TKSA 1GSFA 4L0UA 2A2SA 4O7HA 1O81A 1X5CA 1FO5A 4KW6A 2JZRA 4WEYA 4K2DA 1X9SB 1LU4A 4BVYA 1B9YC 4Q5QA 2FWHA 1JLVA 1XCCA 5CRWA 1M99A 3LYKA 1NW2A 4EE0A 3IK7A 3HD5A 4GWRA 2DKHA 1N8JA 3APQA 2DJKA 5ENUA 1ZZYA 2RIIA 4EDZA 4DSQA 2BJXA 1OKTA 4NXIA 3LW9A 3RHCA 2AAWA 2E2GA 1DBYA 5ABRA 4K7NA 3DMLA 5CNWA 1SKSB 2VCWA 3Q19A 6GSUA 1ZYNA 2K8SA 3FEUA 5IOWA 4IJ3A 1S3RA 1UC7A 3WT1A 1EP8A 4YAPA 1YF0A 13GSA 2P5RA 2C3QA 3Q18A 1X5EA 4ILFA 1U3IA 3P8WA 5HQPA 2HLSA 1BG5A 3EPTA 4BPYA 2ZNMA 2ES7A 1PL1A 2FD3A 2YV9A 4WF5A 3GH9A 3GYKA 1YY7A
chains in the Genus database with same CATH topology
4X43A 2QA1A 2H1GA 1XIYA 1Z7PA 1UA5A 2HSYA 2FGXA 2JL4A 2B1LA 1YKAA 5D73A 3IA1A 3GL3A 2H75A 2HE3A 2OE1A 2WGRA 4OO5A 1OVNA 1A2LA 1G0TA 2KUCA 3LWAA 5KN3A 3IBHA 1AQXA 5IMVA 1VF2A 2FWEA 4MP4A 3GN3A 4ZL8A 2HSMA 4WXTA 2C0EA 3L9UA 5J3RA 2LSTA 1FB6A 3ZYWA 2DMMA 2GSQA 4FIWA 4PNFA 4K0GA 3DKSA 4RUVA 4XCSA 3IRAA 3GX8A 3QAVA 4L0WA 4O92A 2LKUA 1ML6A 4OFTA 4K1FA 4ZB8A 1HD2A 4DSSB 4L5LA 1V98A 4XS4A 2FWFA 2Z9SA 3IC8A 2CZ2A 1A2JA 3IK9A 2NTOA 4HZ4A 3F4SA 4OCEA 3CYNA 2GQMA 2YP6A 3TGZA 1OC8A 1HNCA 1A0RP 3C7MA 2LUSA 4Z7XA 2L57A 3ERGA 2B7KA 1MEKA 4IBPA 1BJXA 2L5OA 5ELGA 1PX6A 2YPMA 3EVIA 1TU7A 2WJUA 2R0GA 3EU4A 4ZBDA 3HKRA 3KEBA 17GSA 3HVVA 3G7YA 1XZOA 4KH7A 4LL1B 4WETA 5J5NA 3G7IA 1URMA 22GSA 4RI6A 3CSIA 3Q6OA 4K5RA 1MD4A 4JEDA 1K0CA 2P0GA 4YKFA 1KTEA 1SYRA 2RUFA 5KN2A 2I4AA 3E0UA 1F6MC 3FMWA 5DQSA 1B4QA 3UOMA 2OKAA 1B4PA 3NIVA 3KD0A 4HJ2A 3OR5A 4NHWA 1U88A 3TKRA 4OMVA 4TOPA 4MMMA 2WZ9A 1RQMA 3IOSA 2DIZA 2R2JA 2L4QA 2GSSA 1O73A 5A4WA 3EE2A 4EUYA 3MYDA 3GSTA 2CQ9A 1GH2A 4KAEA 1FG4A 1PSQA 2O87A 2H71A 1M2DA 2AB6A 4XRAA 4QL7A 4IN0A 5HR1A 2YWIA 1ZYPA 4WR5A 2X8CA 5E4WA 1XWGA 1F37A 4PGTA 1GL8A 4HDEA 3R2QA 2P5QA 4EF0A 2CX4A 1Z5YE 2REMA 5BRTA 1NSWA 5GZZB 4ZXGA 2J23A 2KLXA 2H70A 1XWBA 3RBTA 4JZQA 4POBA 1THOA 4BL7B 4KGIA 2IFQA 1Z3EA 3LSZA 5JCGA 8GSSA 3TJFA 2X49A 4GSSA 4IQAA 5B6NA 1K0BA 3H8QA 1EV9A 3ZTLA 5G2ZA 5DALA 2OACA 4POKA 3KP9A 2PBJA 2MMNA 3EMPA 5AN1A 4POLA 1E6BA 2H66A 2HFDA 3WYWA 3WD6A 3R3EA 4RQRA 2H30A 2KHPA 4K6XA 4HOJA 2VL9A 4MDCA 1N2AA 3VLNA 2C0GA 1R5AA 2QA2A 2VLVA 4MJCA 4EIQA 1SD8A 2R0PA 4KX4A 4OWYA 1A8LA 2EIRA 4MZWA 4QQ7A 5ECNB 3SBCA 4Z2UA 3ME7A 5F05A 2LNSA 1ERUA 4CY6A 3L0HA 1YJ6A 4CW9A 2IPAA 5A4UA 4FYBA 4GLTA 2YWOA 5IM9A 3NZNA 2F8FA 3GUSA 4HQSA 1MTCA 2P31A 2XC2A 2R5GA 1Q98A 2I81A 1XWCA 4IQ1A 1ZOFA 1TRUA 3QDNA 2H1DA 2X4AA 1G7OA 3UARA 3FYGA 3GV1A 4K0NA 1PGTA 5DAKA 3TRQA 1C72A 3NOFA 4FYUA 2BTOT 3TUEA 4Z2TA 4K7IA 1G6YA 1NHOA 1GSUA 1WOUA 3PPUA 2YWNA 4IP1A 1A24A 3LG6A 4ZB6A 4AJ7A 1TK8B 1A2MA 1GRXA 4ECCA 3F6FA 2YV7A 1GULA 2CVDA 2YZHA 4F03A 3M9KA 4ZB9A 3K8NA 3UL3A 2LV3A 2L6DA 2R6KA 3GA4A 4I2TA 4LLRA 2HZEA 5IPHA 3D4TA 5CP1A 4CHSA 4IP6A 2K6VA 2FA4A 2GZPA 4PURA 5F06A 2LQQA 3ERFA 5KN0A 1G6WA 4EIPA 5ID2B 1H75A 1BAYA 2YWMA 5F8BA 4ECIA 4NPBA 4X0XA 4ZL7A 1EEJA 2O85A 1TK5B 1KNGA 5CRGA 1EV4A 2VCVA 1GSEA 5AIVA 1GLPA 3EYTA 2QSIA 2OADA 3UBLA 1M0UA 2VLTA 5B8AA 1PX7A 3WGXA 5L71A 5HR2A 1SENA 1LBKA 3ZIVA 2N5FA 2RUEA 2VCXA 5HFKA 1K3YA 3JCML 4J56E 2DJ1A 3UEMA 4BWSA 2HZFA 10GSA 3DIEA 3HXSA 3I9V2 4ZILA 2DJ2A 5GAPD 1ON4A 2KOKA 3EURA 4BVXA 4NV5A 2PPTA 2VOCA 2YOIA 4IKHA 3F63A 1XVQA 1OYJA 1VGLA 3VURA 3VWXA 3M3MA 4EL1A 1V9WA 4TN8A 1X9WB 16GSA 2DSAA 2UZ8A 2GZYA 2IJYA 1T3BA 6GSXA 5AISA 2ZUPA 9GSSA 1YF1A 2VCQA 5H5SA 4N30A 1TKDB 3M0FA 1PL2A 5IMZA 3EMXA 1PKZA 1DUGA 2JZSA 4IHUA 2XPDA 4G0KA 1U87A 2PN8A 2LS5A 1EGRA 3BCKA 1SJZA 3IE3A 5GSSA 5D8IA 1F3AA 3MIXA 5B7CA 4EXJA 3WGEA 3QFAC 4HQZA 2L4CA 2CAIA 2VCZA 1UVZA 4XS4B 4IS0A 4HS1A 1PMTA 4L5OA 2IIYA 1NM3A 2VLUA 2ALBA 2LRTA 4MZBA 1AUCA 2GDRA 4D73A 3GTUA 3WT2A 4POMA 3HDCA 2V41A 3A2WA 2I1UA 2QKEA 1SK0A 3P7XA 2MMOA 3VPQA 4JRRA 2WULA 5KOWA 3LORA 1AC1A 2CX3A 1TTZA 3GFKA 5AIXA 2ON7A 1XW9A 1UN2A 3UVTA 5IMAA 2B5EA 3ME8A 5DQYA 2B3SA 1QK8A 3P90A 1S3CA 2A2PA 4AJ6A 5BMUA 2H6XA 2IN3A 3UJ1A 2NBSA 3MNGA 5DVBA 3HZ4A 3TCOA 5DCHA 3IDVA 3J7Yb 2DBCA 2GVPA 4ECJA 1BEDA 2LRCA 6GSVA 2B5YA 4GF0A 3FZ4A 5D93A 1R7HA 4TXOA 1T1VA 2O7KA 2R3XA 7GSSA 1PA3A 1T00A 2IL3A 1ZMAA 4I8BA 1ZL9A 5DCGA 3ZZXA 4J2FA 4OFMA 3S9FA 1GNEA 3G9BA 1OC9A 3HVSA 4KA0A 1TRSA 2KP1A 2C1YA 5ECLB 1GSDA 1XFLA 3KXOA 3G7JA 2HNLA 3C73A 2FY6A 2OBKA 4K8MA 3KTLA 4I6XA 2X64A 4YAVA 1PN9A 5JCUA 1E2YA 2XHFA 4X4JA 4JBBA 3GKKA 3GNJA 1XOAA 1O6JA 1XW6A 2CVBA 2PVQA 3GL5A 4I2UA 4KCEA 1F3BA 3HVXA 4AF2A 3IAM2 3F6DA 4Q5RA 3ZREA 1AAZA 1JZWA 2HI7A 2C0FA 1QFNA 1GSSA 1F9MA 2V6KA 3KTBA 1JHBA 2D2ZA 4JE1A 5IIZA 19GSA 4PQ1A 3FRCA 4Q5FA 2VCTA 2VL2C 3A2VA 3TRXA 5DJLA 1PKWA 3FZ5A 3D0ZA 2K9FA 2I3YA 1MDJA 5DBQA 4V2NA 2G0FA 4O32A 1JFUA 4MH2A 1TRVA 2DLXA 3IHGA 1JZDA 3HJMA 1QQ2A 1NHYA 5A5KA 2V1MA 3H4KA 2JADA 3UMAA 1RW1A 1CQHA 2DMLA 3L9SA 2VIMA 5CYYA 5EY6A 4ZBBA 3ZVJA 4CY8A 4FH8A 3QCPA 4KE3A 5J9BA 5H5RA 4KUNA 4E8EA 1TXXA 3IV4A 4EVMA 3VWUA 2WB9A 3CTGA 5DDLA 4EO3A 5D9XA 3ZFBA 3GKNA 4XHMA 4MF6A 4MZCA 5DJMA 1HYUA 5JWOB 2EC4A 2KP2A 2AV4A 2FUG2 2GGTA 4LMWA 3TDGA 4WBJA 3VK9A 1SK1A 5C04A 5KEJA 3ZIJA 2C3NA 4Z2RA 3BJ5A 4YH2A 4MJAA 1XOBA 1TI1A 4KDXA 3HJPA 4XS6A 2H6YA 2DJ3A 1ERVA 1TRWA 2R37A 3MAKA 4DSSA 4EDYA 1ZGNA 2N5AA 3V1WA 2IMKA 3KGKA 1XW5A 4GRFA 1GTBA 4V2MA 5ECQB 3TKQA 1Z9HA 5B8BA 12GSA 2HRKA 4PX1A 2VAFA 4GSNA 1M7TA 1R5PA 3M8NA 1U6TA 3MDKA 4K9ZA 3O6TA 3IPZA 1Z6MA 4PUAA 1VF4A 4TR1B 2F8AA 4O5QA 4RI7A 1LJRA 1OC3A 1DE2A 4L8EA 1W89A 2CZ3A 1PRXA 1I5GA 5F07A 1B8XA 2DKIA 2YN1A 3GIXA 4CDOA 1YEXA 1G7EA 4GXZA 1XWKA 3QFBC 2WRTA 3F4RA 3VI7A 3KH9A 5D9WA 3GHAA 1K0NA 3F4TA 3FK8A 2VM1A 4HU7A 1TW9A 2VD0A 5IPGA 4OD7A 1IYHA 2HRNA 3HCZA 5FHIA 3FHKA 1F2EA 1WMJA 3F9UA 1TP9A 3DRNA 3IR4A 3DEXA 1X5DA 4MH3A 1TJDA 2M72A 1V2AA 2WFCA 3FW2A 1FVKA 3CSHA 2K18A 2H1BA 4KDYA 3A5WA 4I5QA 2B5XA 3QAWA 2PU9C 4TW5A 3DD3A 4YKGA 1WWJA 2AUVA 4K2XA 3FR6A 2L6CA 4E8HA 2FA8A 2PGTA 1GUHA 2JACA 2F51A 4ID0A 3GH6A 1MDIA 3ZFLA 5ECSA 3CRTA 1SL1B 2BMXA 1HNBA 5ECRB 4J57E 2H6ZA 2VD1A 1TOFA 2AYTA 4LL4B 2CT6A 1OE7A 5J4UA 1XBSA 3U5RE 3VI5A 2K8VA 4BVYB 1VRSD 2H0GA 2FNOA 2C0DA 2X99A 1PQNA 4N0ZA 4OO4A 5ECPB 4HJMA 4BL7A 1GTUA 1BYEA 5CRHA 4GQCA 1SJ6A 2LTKA 2LRNA 3PGTA 2LEGA 2IMDA 4G9HA 1XPVA 4FYCA 4IGJA 2L59A 2PERA 3D22A 1FOHA 1GUMA 2MZCA 4N0VA 2YCDA 1OKDA 2OA7A 2VL2A 4KNDA 3Q74A 1HNAA 4MLYA 1J9BA 4G10A 4TKYA 1TDIA 2IMIA 2A2RA 4KSOA 1ZYQB 5C00A 1ST9A 2A4VA 3EU3A 4PTSA 5D9VA 2JZTA 5J9CA 1OAZA 1GNWA 2NVLA 4X1UA 3TB2A 3KMNA 1J0FA 1XVWA 1SJIA 4ECBA 3A5IA 20GSA 3LXTA 2R0CA 1Z6NA 4MPFA 4KSMA 1GP1A 2GS3A 4FQUA 5CAXA 1ERWA 3DVWA 3GRXA 4O5RA 2H76A 2XPEA 6GSSA 1FW1A 1SL2B 5IMDA 2X8GA 2CAQA 1A0FA 3TOUA 3AY8A 3GURA 2L5LA 2B7JA 3KCMA 3PINA 4HI7A 3DWVA 4AJ8A 5JCWA 3CTFA 3DVXA 4GCIA 4IJIA 4DEJA 2MBTA 3MWHA 4N10A 5KN1A 4TXVA 4TR3A 5HFIA 4GQFA 1MDKA 1FOVA 3ZL5A 4OCFA 1V57A 5IQYA 1EZKA 2HRFA 2PWJA 2GSTA 5IOXA 2E7PA 4K7OA 1AW9A 3ED3A 4AGSA 1ZYEA 2E0QA 4KDUA 4PQIA 4TRXA 5D9TA 1FHEA 3E9JB 3D4MA 3C1RA 3HHVA 1FVJA 5IMFA 3O76A 2MMAA 2TRXA 3TJGA 2HSHA 1O85A 3C8EA 5ID2A 3QAGA 1X9MB 4JU5A 2X8HA 3FR3A 2JU5A 1M9BA 4MJEA 1U3AA 2XBIA 4V1Ag 2NPBA 4ML1A 4O5UA 3IAS2 3BOAA 1V58A 2IWTA 2N5BA 1QMVA 2LJAA 4PUFC 1PN0A 3LYPA 2R4VA 4YQUA 2VM2A 1V40A 2HT9A 3LJRA 2E2MA 3ZITA 3H1NA 3GKXA 2VO4A 4DSRA 1RK4A 3KJYA 1WE0A 3FZ9A 1USBA 3DXBA 3ERWA 4JR6A 4F9ZA 4NAXA 4MJBA 5LD0A 3QPMA 3TJKA 4V2LA 2GT5A 4JR4A 3I6AA 3CXGA 4TR0A 2I9HA 2IMEA 3LEFA 4HU9A 3ZMKA 4ACSA 5GAND 4P3YB 2OE0A 1TU8A 2C80A 3KP8A 3ZVJD 3VPTA 1M2BA 3UBKA 1ACVA 2CA8A 4G19A 5ECHB 3N5OA 3F3QA 3H93A 1B48A 3IHQA 1Y25A 4IW9A 3W8SA 1CQGA 1Y6EA 4IELA 4HZ2A 4HUAA 4OFNA 5B6MA 3FZAA 3LQ7A 3F3RA 4EC0A 2V6OA 3DYRA 1K0DA 4TR4A 1VF1A 2ON5A 1VF3A 2QC7A 1XWAA 1YEPA 1S3AA 2GTUA 4EKZA 4BWQA 4A5PA 3W6GA 1AQWA 2VUPA 2IFQB 1GWCA 5ELAA 4IVFA 2FWGA 2GQLA 1T4YA 2MYGA 1WJKA 3RHBA 2YNXA 1KBNA 1GLQA 1JZRA 2DJJA 3ZRDA 1X0RA 3SWLA 5DALB 1XXUA 4Q5NA 4V1Ap 5ECOB 5ECIB 4GTUA 1YQ1A 4MNNA 2PUKC 4F82A 3I43A 4BA7A 2JSYA 3WGDA 1YDKA 4MPGA 3US3A 4PQHA 3GSSA 4ML6A 2YANA 2VL3A 1DSBA 3O3TA 4XTSA 2ZCTA 5G31A 1QXHA 3MSZA 2V2GA 3QR6A 5JWQB 5G5EA 5CRDA 3KZQA 5INYA 2AJQB 4USSA 2J9HA 1ABAA 1YKCA 3ZMLA 1J08A 1EEMA 1AIUA 2FHEA 1EP7A 3KH7A 1TK0B 2LQOA 1TI3A 3A3TA 2TIRA 1H4OA 2RM6A 2C4JA 4MF5A 2DIYA 2GSRA 1T4ZA 1BX9A 3ISOA 5COHA 4ZIJA 1SKRB 1O8WA 2O8VB 4FO5A 5DAKB 3TJBA 4ZL9A 3KMOA 1SK2A 5AGYA 2YJ7A 2B1KA 5JWRB 1Z7RA 14GSA 3A2XA 3LFLA 3LGCA 3UIWA 4GSTA 2AHEA 3TRPA 3ZLPA 1ERTA 5H5QA 1GUKA 4KF9A 3E3EA 2IMFA 5J41A 4NWYA 3TKSC 3PH9A 2PVOC 2C8UA 1GSYA 1R26A 2RM5A 4F2IA 2YZUA 1JZOA 4WKWA 1R4WA 3TOTA 1T8EB 1JLWA 3UVHA 4ULXA 2HZEB 2G2QA 3PR8A 3BBYA 5G1LA 2LJKA 5ECKB 2A4HA 5GSTA 4I97A 4KCAA 18GSA 1FAAA 2WDUA 3TKPA 5EPFA 3LXZA 3APSA 4XIHA 2MMZA 4ICYA 1SYXA 3D6IA 4NV2A 1OE8A 11GSA 3I69A 4PNGA 5EVOA 3DGQA 4G0LA 2XBQA 4TVEA 2HYXA 3KM6A 1ZCPA 3UAPA 3CSJA 1AQVA 3EC3A 2MBSA 3M9JA 1WRYA 1S3DA 1WIKA 1KEBA 2JSZA 2H1AA 2DJ0A 2LJRA 2OJLA 5IO0A 4F0BA 5KOXA 5FWGA 4MABA 3QMXA 1K0AA 3HA9A 5G1KA 3FR9A 3L4NA 3C1SA 2FCHA 4N11A 3IXRA 1THXA 1YZXA 1EOGA 2C3TA 4H86A 6GSWA 1DE1A 5G30A 5HFGA 2M80A 1K0MA 2H01A 4ISDA 4BVXB 1K3OA 1FB0A 2HXKA 4G0IA 5LCZA 4WR4A 2H72A 2LNTA 3J7Yk 2H73A 2F9SA 3N9JA 3EWLA 3HJOA 3D21A 4YQMA 1SL0B 2H74A 2YJHA 4LMVA 1K3LA 2EIQA 3H79A 1B9XC 2GT6A 4WBRD 4MF7A 1IYIA 4XS1A 3F8UA 4G2EA 4NMUA 3BCIA 5ECMB 4DVCA 2M46A 3CMIA 1EOHA 3TKSE 3VWWA 5G5FA 1M2AA 3FKFA 3HY2A 1A8YA 3KIJA 5F0GA 2H8LA 2QGVA 3QD9A 1GTAA 1QUWA 2H0HA 2DC5A 1AXDA 1MD3A 2HRAA 4HEA2 2NDOA 1BQ7A 3U6VA 3D5JA 2OBIA 1GSQA 1QGVA 5IO2A 5D96A 1SU9A 2GQKA 4RQXA 5EL8A 1M9AA 4MCUA 4D73B 1Q4JA 3GTUB 3GKMA 2WCIA 3M1GA 5E59A 1T7PB 3BD2A 2TRCP 1WPIA 3GMFA 2O89A 5FT3A 3CBUA 5IMCA 1SKWB 4TR1A 2F3MA 5HR3A 1O8XA 1SD9A 1PD21 2EIOA 3IC4A 3QOUA 5LNKe 2WS2A 3TJJA 4F0CA 4XRDA 1I9DA 1GTIA 3F0IA 3RAZA 3VFIA 3C71A 2V32A 2CVKA 4KB3A 4MK3A 2RLIA 3APOA 3L9VA 1A23A 3RPPA 2OE3A 5CREA 2FLSA 2GLRA 2H19A 3FY7A 4YQVA 6GSTA 4MA9A 3P2AA 2H0IA 3HYPA 3CRUA 6GSYA 1ILOA 3L78A 1EWXA 3RDWA 4PXOA 4LA1A 3EINA 4TXOB 5A4VA 1HQOA 2GZZA 2CV4A 4ZBAA 1WP0A 3W8JA 3RPNA 2B6MA 5HR0A 1W4VA 5CO3A 4WF4A 4K5SA 4NHZA 1O7UA 3GX0A 3HZ8A 1OC9B 1EGOA 3VWVA 2PMTA 4QL9A 1K0OA 3TKSA 1GSFA 4L0UA 2A2SA 4O7HA 1O81A 1X5CA 1FO5A 4KW6A 2JZRA 4WEYA 4K2DA 1X9SB 1LU4A 4BVYA 1B9YC 4Q5QA 2FWHA 1JLVA 1XCCA 5CRWA 1M99A 3LYKA 1NW2A 4EE0A 3IK7A 3HD5A 4GWRA 2DKHA 1N8JA 3APQA 2DJKA 5ENUA 1ZZYA 2RIIA 4EDZA 4DSQA 2BJXA 1OKTA 4NXIA 3LW9A 3RHCA 2AAWA 2E2GA 1DBYA 5ABRA 4K7NA 3DMLA 5CNWA 1SKSB 2VCWA 3Q19A 6GSUA 1ZYNA 2K8SA 3FEUA 5IOWA 4IJ3A 1UC7A 3WT1A 1EP8A 4YAPA 1YF0A 13GSA 2P5RA 2C3QA 3Q18A 1X5EA 4ILFA 1U3IA 3P8WA 5HQPA 2HLSA 1BG5A 3EPTA 4BPYA 2ZNMA 2ES7A 1PL1A 2FD3A 2YV9A 4WF5A 3GH9A 3GYKA 1YY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X43 A;  2H1G A;  1XIY A;  1Z7P A;  1UA5 A;  2HSY A;  2FGX A;  2JL4 A;  2B1L A;  1YKA A;  5D73 A;  3IA1 A;  3GL3 A;  2H75 A;  2HE3 A;  2OE1 A;  2WGR A;  4OO5 A;  1OVN A;  1A2L A;  1G0T A;  2KUC A;  3LWA A;  5KN3 A;  3IBH A;  1AQX A;  5IMV A;  1VF2 A;  2FWE A;  4MP4 A;  3GN3 A;  4ZL8 A;  4WXT A;  2C0E A;  3L9U A;  5J3R A;  2LST A;  1FB6 A;  3ZYW A;  2DMM A;  2GSQ A;  4FIW A;  4PNF A;  4K0G A;  3DKS A;  4RUV A;  4XCS A;  3IRA A;  3GX8 A;  3QAV A;  4L0W A;  4O92 A;  2LKU A;  1ML6 A;  4OFT A;  4K1F A;  4ZB8 A;  1HD2 A;  4DSS B;  4L5L A;  1V98 A;  4XS4 A;  2FWF A;  2Z9S A;  2CZ2 A;  1A2J A;  3IK9 A;  2NTO A;  4HZ4 A;  3F4S A;  4OCE A;  3CYN A;  2GQM A;  2YP6 A;  3TGZ A;  1OC8 A;  1HNC A;  1A0R P;  3C7M A;  2LUS A;  4Z7X A;  2L57 A;  3ERG A;  2B7K A;  1MEK A;  4IBP A;  1BJX A;  2L5O A;  5ELG A;  1PX6 A;  2YPM A;  3EVI A;  1TU7 A;  2WJU A;  3EU4 A;  4ZBD A;  3HKR A;  3KEB A;  17GS A;  3HVV A;  3G7Y A;  1XZO A;  4KH7 A;  4LL1 B;  4WET A;  5J5N A;  3G7I A;  1URM A;  22GS A;  4RI6 A;  3CSI A;  3Q6O A;  1MD4 A;  4JED A;  1K0C A;  2P0G A;  1KTE A;  1SYR A;  2RUF A;  5KN2 A;  2I4A A;  3E0U A;  1F6M C;  5DQS A;  1B4Q A;  3UOM A;  2OKA A;  1B4P A;  3NIV A;  3KD0 A;  4HJ2 A;  3OR5 A;  4NHW A;  1U88 A;  3TKR A;  4OMV A;  4TOP A;  4MMM A;  2WZ9 A;  1RQM A;  3IOS A;  2DIZ A;  2R2J A;  2L4Q A;  2GSS A;  1O73 A;  5A4W A;  3EE2 A;  4EUY A;  3GST A;  2CQ9 A;  1GH2 A;  4KAE A;  1FG4 A;  1PSQ A;  2O87 A;  2H71 A;  1M2D A;  2AB6 A;  4XRA A;  4QL7 A;  4IN0 A;  5HR1 A;  2YWI A;  4WR5 A;  2X8C A;  5E4W A;  1XWG A;  1F37 A;  4PGT A;  1GL8 A;  4HDE A;  3R2Q A;  2P5Q A;  4EF0 A;  2CX4 A;  1Z5Y E;  2REM A;  1NSW A;  5GZZ B;  4ZXG A;  2J23 A;  2KLX A;  2H70 A;  1XWB A;  3RBT A;  4JZQ A;  4POB A;  1THO A;  4KGI A;  2IFQ A;  1Z3E A;  3LSZ A;  5JCG A;  8GSS A;  3TJF A;  4GSS A;  4IQA A;  5B6N A;  1K0B A;  3H8Q A;  1EV9 A;  3ZTL A;  5G2Z A;  5DAL A;  2OAC A;  4POK A;  3KP9 A;  5AN1 A;  2PBJ A;  2MMN A;  3EMP A;  4POL A;  1E6B A;  2H66 A;  2HFD A;  3WYW A;  3WD6 A;  4RQR A;  2H30 A;  2KHP A;  4K6X A;  4HOJ A;  2VL9 A;  4MDC A;  1N2A A;  3VLN A;  2C0G A;  1R5A A;  2VLV A;  4MJC A;  1SD8 A;  4KX4 A;  4OWY A;  1A8L A;  2EIR A;  4MZW A;  4QQ7 A;  5ECN B;  3SBC A;  3ME7 A;  5F05 A;  2LNS A;  1ERU A;  3L0H A;  1YJ6 A;  4CW9 A;  2IPA A;  5A4U A;  4FYB A;  4GLT A;  2YWO A;  5IM9 A;  3NZN A;  2F8F A;  3GUS A;  4HQS A;  1MTC A;  2P31 A;  2XC2 A;  2R5G A;  1Q98 A;  2I81 A;  1XWC A;  4IQ1 A;  1ZOF A;  1TRU A;  3QDN A;  2H1D A;  1G7O A;  3UAR A;  3FYG A;  3GV1 A;  4K0N A;  1PGT A;  5DAK A;  3TRQ A;  1C72 A;  3NOF A;  4FYU A;  2BTO T;  3TUE A;  4K7I A;  1G6Y A;  1NHO A;  1GSU A;  1WOU A;  2YWN A;  4IP1 A;  1A24 A;  3LG6 A;  4ZB6 A;  4AJ7 A;  1TK8 B;  1A2M A;  1GRX A;  4ECC A;  3F6F A;  2YV7 A;  1GUL A;  2CVD A;  2YZH A;  4F03 A;  3M9K A;  4ZB9 A;  3K8N A;  3UL3 A;  2LV3 A;  2L6D A;  2R6K A;  3GA4 A;  4I2T A;  4LLR A;  2HZE A;  5IPH A;  3D4T A;  5CP1 A;  4CHS A;  4IP6 A;  2K6V A;  2FA4 A;  2GZP A;  4PUR A;  5F06 A;  2LQQ A;  3ERF A;  5KN0 A;  1G6W A;  5ID2 B;  1H75 A;  1BAY A;  2YWM A;  5F8B A;  4ECI A;  4NPB A;  4X0X A;  4ZL7 A;  1EEJ A;  2O85 A;  1TK5 B;  1KNG A;  5CRG A;  1EV4 A;  2VCV A;  1GSE A;  5AIV A;  1GLP A;  3EYT A;  2QSI A;  2OAD A;  3UBL A;  1M0U A;  2VLT A;  5B8A A;  1PX7 A;  3WGX A;  5L71 A;  5HR2 A;  1SEN A;  1LBK A;  3ZIV A;  2N5F A;  2RUE A;  2VCX A;  5HFK A;  1K3Y A;  3JCM L;  4J56 E;  2DJ1 A;  3UEM A;  4BWS A;  2HZF A;  10GS A;  3DIE A;  3HXS A;  3I9V 2;  4ZIL A;  2DJ2 A;  5GAP D;  1ON4 A;  2KOK A;  3EUR A;  4BVX A;  4NV5 A;  2PPT A;  2VOC A;  2YOI A;  4IKH A;  3F63 A;  1XVQ A;  1OYJ A;  1VGL A;  3VUR A;  3VWX A;  3M3M A;  4EL1 A;  1V9W A;  4TN8 A;  1X9W B;  16GS A;  2DSA A;  2GZY A;  2IJY A;  1T3B A;  6GSX A;  5AIS A;  2ZUP A;  9GSS A;  1YF1 A;  2VCQ A;  5H5S A;  4N30 A;  1TKD B;  3M0F A;  1PL2 A;  5IMZ A;  3EMX A;  1PKZ A;  1DUG A;  2JZS A;  4IHU A;  2XPD A;  1U87 A;  2PN8 A;  2LS5 A;  1EGR A;  3BCK A;  1SJZ A;  3IE3 A;  5GSS A;  5D8I A;  1F3A A;  5B7C A;  4EXJ A;  3WGE A;  3QFA C;  4HQZ A;  2L4C A;  2CAI A;  2VCZ A;  1UVZ A;  4XS4 B;  4IS0 A;  4HS1 A;  1PMT A;  4L5O A;  2IIY A;  1NM3 A;  2VLU A;  2ALB A;  2LRT A;  4MZB A;  1AUC A;  2GDR A;  4D73 A;  3GTU A;  3WT2 A;  4POM A;  3HDC A;  2V41 A;  3A2W A;  2I1U A;  2QKE A;  1SK0 A;  3P7X A;  2MMO A;  3VPQ A;  4JRR A;  2WUL A;  3LOR A;  1AC1 A;  2CX3 A;  1TTZ A;  3GFK A;  5AIX A;  2ON7 A;  1XW9 A;  1UN2 A;  3UVT A;  5IMA A;  2B5E A;  3ME8 A;  5DQY A;  2B3S A;  1QK8 A;  3P90 A;  1S3C A;  4AJ6 A;  2H6X A;  2IN3 A;  3UJ1 A;  2NBS A;  3MNG A;  5DVB A;  3HZ4 A;  3TCO A;  5DCH A;  3IDV A;  3J7Y b;  2DBC A;  2GVP A;  4ECJ A;  1BED A;  2LRC A;  6GSV A;  2B5Y A;  4GF0 A;  3FZ4 A;  5D93 A;  1R7H A;  4TXO A;  1T1V A;  2O7K A;  2R3X A;  7GSS A;  1PA3 A;  1T00 A;  2IL3 A;  1ZMA A;  4I8B A;  1ZL9 A;  5DCG A;  3ZZX A;  4J2F A;  4OFM A;  3S9F A;  1GNE A;  3G9B A;  1OC9 A;  3HVS A;  4KA0 A;  1TRS A;  2KP1 A;  2C1Y A;  5ECL B;  1GSD A;  1XFL A;  3KXO A;  3G7J A;  2HNL A;  3C73 A;  2FY6 A;  2OBK A;  4K8M A;  3KTL A;  4I6X A;  2X64 A;  4YAV A;  1PN9 A;  5JCU A;  1E2Y A;  2XHF A;  4JBB A;  3GKK A;  3GNJ A;  1XOA A;  1O6J A;  1XW6 A;  2CVB A;  2PVQ A;  3GL5 A;  4I2U A;  4KCE A;  1F3B A;  3HVX A;  4AF2 A;  3IAM 2;  3F6D A;  4Q5R A;  3ZRE A;  1AAZ A;  1JZW A;  2HI7 A;  2C0F A;  1QFN A;  1GSS A;  1F9M A;  2V6K A;  3KTB A;  1JHB A;  2D2Z A;  4JE1 A;  5IIZ A;  19GS A;  4PQ1 A;  3FRC A;  4Q5F A;  2VCT A;  2VL2 C;  3A2V A;  3TRX A;  5DJL A;  1PKW A;  3FZ5 A;  3D0Z A;  2K9F A;  2I3Y A;  1MDJ A;  5DBQ A;  4V2N A;  2G0F A;  4O32 A;  1JFU A;  4MH2 A;  1TRV A;  2DLX A;  1JZD A;  3HJM A;  1QQ2 A;  1NHY A;  5A5K A;  2V1M A;  3H4K A;  2JAD A;  3UMA A;  1RW1 A;  1CQH A;  2DML A;  3L9S A;  2VIM A;  5CYY A;  5EY6 A;  4ZBB A;  3ZVJ A;  4FH8 A;  3QCP A;  4KE3 A;  5J9B A;  5H5R A;  4KUN A;  4E8E A;  1TXX A;  3IV4 A;  4EVM A;  3VWU A;  2WB9 A;  3CTG A;  5DDL A;  4EO3 A;  5D9X A;  3ZFB A;  3GKN A;  4XHM A;  4MF6 A;  4MZC A;  5DJM A;  1HYU A;  5JWO B;  2EC4 A;  2KP2 A;  2AV4 A;  2FUG 2;  2GGT A;  4LMW A;  3TDG A;  4WBJ A;  3VK9 A;  1SK1 A;  5C04 A;  5KEJ A;  3ZIJ A;  2C3N A;  3BJ5 A;  4YH2 A;  4MJA A;  1XOB A;  1TI1 A;  4KDX A;  3HJP A;  4XS6 A;  2H6Y A;  2DJ3 A;  1ERV A;  1TRW A;  2R37 A;  3MAK A;  4DSS A;  4EDY A;  1ZGN A;  2N5A A;  3V1W A;  2IMK A;  3KGK A;  1XW5 A;  4GRF A;  1GTB A;  4V2M A;  5ECQ B;  3TKQ A;  1Z9H A;  5B8B A;  12GS A;  4PX1 A;  2VAF A;  4GSN A;  1M7T A;  1R5P A;  3M8N A;  1U6T A;  3MDK A;  4K9Z A;  3O6T A;  3IPZ A;  1Z6M A;  4PUA A;  1VF4 A;  4TR1 B;  2F8A A;  4RI7 A;  1LJR A;  1OC3 A;  1DE2 A;  4L8E A;  1W89 A;  2CZ3 A;  1PRX A;  1I5G A;  5F07 A;  1B8X A;  2YN1 A;  3GIX A;  4CDO A;  1YEX A;  1G7E A;  4GXZ A;  1XWK A;  3QFB C;  2WRT A;  3F4R A;  3VI7 A;  3KH9 A;  5D9W A;  3GHA A;  1K0N A;  3F4T A;  3FK8 A;  2VM1 A;  4HU7 A;  1TW9 A;  2VD0 A;  5IPG A;  4OD7 A;  1IYH A;  2HRN A;  3HCZ A;  5FHI A;  3FHK A;  1F2E A;  1WMJ A;  3F9U A;  1TP9 A;  3DRN A;  3IR4 A;  3DEX A;  1X5D A;  4MH3 A;  1TJD A;  2M72 A;  1V2A A;  2WFC A;  3FW2 A;  1FVK A;  3CSH A;  2K18 A;  2H1B A;  4KDY A;  3A5W A;  4I5Q A;  2B5X A;  3QAW A;  2PU9 C;  4TW5 A;  3DD3 A;  1WWJ A;  2AUV A;  3FR6 A;  2L6C A;  4E8H A;  2FA8 A;  2PGT A;  1GUH A;  2JAC A;  2F51 A;  4ID0 A;  3GH6 A;  1MDI A;  3ZFL A;  5ECS A;  3CRT A;  1SL1 B;  2BMX A;  1HNB A;  5ECR B;  4J57 E;  2H6Z A;  2VD1 A;  1TOF A;  2AYT A;  4LL4 B;  2CT6 A;  1OE7 A;  5J4U A;  1XBS A;  3U5R E;  3VI5 A;  2K8V A;  1VRS D;  2H0G A;  2FNO A;  2C0D A;  2X99 A;  1PQN A;  4N0Z A;  4OO4 A;  5ECP B;  4HJM A;  4BL7 A;  1GTU A;  1BYE A;  5CRH A;  4GQC A;  1SJ6 A;  2LTK A;  2LRN A;  3PGT A;  2LEG A;  2IMD A;  4G9H A;  1XPV A;  4FYC A;  4IGJ A;  2L59 A;  2PER A;  3D22 A;  1GUM A;  2MZC A;  4N0V A;  2YCD A;  1OKD A;  2OA7 A;  2VL2 A;  4KND A;  3Q74 A;  1HNA A;  4MLY A;  1J9B A;  4G10 A;  4TKY A;  1TDI A;  2IMI A;  2A2R A;  4KSO A;  1ZYQ B;  5C00 A;  1ST9 A;  2A4V A;  3EU3 A;  5D9V A;  2JZT A;  5J9C A;  1OAZ A;  1GNW A;  2NVL A;  4X1U A;  3TB2 A;  3KMN A;  1J0F A;  1XVW A;  1SJI A;  4ECB A;  20GS A;  3LXT A;  1Z6N A;  4MPF A;  4KSM A;  1GP1 A;  2GS3 A;  5CAX A;  1ERW A;  3DVW A;  3GRX A;  4O5R A;  2H76 A;  2XPE A;  6GSS A;  1FW1 A;  1SL2 B;  5IMD A;  2X8G A;  2CAQ A;  1A0F A;  3TOU A;  3AY8 A;  3GUR A;  2L5L A;  2B7J A;  3KCM A;  3PIN A;  4HI7 A;  3DWV A;  4AJ8 A;  5JCW A;  3CTF A;  3DVX A;  4GCI A;  4IJI A;  4DEJ A;  2MBT A;  3MWH A;  4N10 A;  5KN1 A;  4TXV A;  4TR3 A;  5HFI A;  4GQF A;  1MDK A;  1FOV A;  3ZL5 A;  4OCF A;  1V57 A;  5IQY A;  1EZK A;  2HRF A;  2PWJ A;  2GST A;  5IOX A;  2E7P A;  4K7O A;  1AW9 A;  3ED3 A;  4AGS A;  1ZYE A;  2E0Q A;  4KDU A;  4PQI A;  4TRX A;  5D9T A;  1FHE A;  3E9J B;  3D4M A;  3C1R A;  3HHV A;  1FVJ A;  5IMF A;  3O76 A;  2MMA A;  2TRX A;  3TJG A;  2HSH A;  1O85 A;  3C8E A;  5ID2 A;  3QAG A;  1X9M B;  4JU5 A;  2X8H A;  3FR3 A;  2JU5 A;  1M9B A;  4MJE A;  1U3A A;  2XBI A;  4V1A g;  2NPB A;  4ML1 A;  3IAS 2;  3BOA A;  1V58 A;  2IWT A;  2N5B A;  1QMV A;  2LJA A;  4PUF C;  3LYP A;  2R4V A;  4YQU A;  2VM2 A;  1V40 A;  2HT9 A;  3LJR A;  2E2M A;  3ZIT A;  3H1N A;  3GKX A;  2VO4 A;  4DSR A;  1RK4 A;  3KJY A;  1WE0 A;  3FZ9 A;  1USB A;  3DXB A;  3ERW A;  4JR6 A;  4F9Z A;  4NAX A;  4MJB A;  5LD0 A;  3QPM A;  3TJK A;  4V2L A;  2GT5 A;  4JR4 A;  3I6A A;  3CXG A;  4TR0 A;  2I9H A;  2IME A;  3LEF A;  4HU9 A;  3ZMK A;  4ACS A;  5GAN D;  4P3Y B;  2OE0 A;  1TU8 A;  2C80 A;  3KP8 A;  3ZVJ D;  3VPT A;  1M2B A;  3UBK A;  1ACV A;  2CA8 A;  4G19 A;  5ECH B;  3N5O A;  3F3Q A;  3H93 A;  1B48 A;  3IHQ A;  1Y25 A;  4IW9 A;  3W8S A;  1CQG A;  1Y6E A;  4IEL A;  4HZ2 A;  4HUA A;  4OFN A;  5B6M A;  3FZA A;  3LQ7 A;  3F3R A;  4EC0 A;  2V6O A;  3DYR A;  1K0D A;  4TR4 A;  1VF1 A;  2ON5 A;  1VF3 A;  2QC7 A;  1XWA A;  1YEP A;  1S3A A;  2GTU A;  4EKZ A;  4BWQ A;  3W6G A;  1AQW A;  2VUP A;  2IFQ B;  1GWC A;  5ELA A;  4IVF A;  2FWG A;  2GQL A;  1T4Y A;  2MYG A;  1WJK A;  3RHB A;  2YNX A;  1KBN A;  1GLQ A;  1JZR A;  2DJJ A;  3ZRD A;  1X0R A;  3SWL A;  5DAL B;  1XXU A;  4Q5N A;  4V1A p;  5ECO B;  5ECI B;  4GTU A;  1YQ1 A;  2PUK C;  4F82 A;  3I43 A;  4BA7 A;  2JSY A;  3WGD A;  1YDK A;  4MPG A;  3US3 A;  4PQH A;  3GSS A;  4ML6 A;  2YAN A;  2VL3 A;  1DSB A;  3O3T A;  4XTS A;  2ZCT A;  5G31 A;  1QXH A;  3MSZ A;  2V2G A;  3QR6 A;  5JWQ B;  5G5E A;  5CRD A;  3KZQ A;  5INY A;  2AJQ B;  2J9H A;  1ABA A;  1YKC A;  3ZML A;  1J08 A;  1EEM A;  1AIU A;  2FHE A;  1EP7 A;  3KH7 A;  1TK0 B;  2LQO A;  1TI3 A;  3A3T A;  2TIR A;  1H4O A;  2RM6 A;  2C4J A;  4MF5 A;  2DIY A;  2GSR A;  1T4Z A;  1BX9 A;  3ISO A;  5COH A;  4ZIJ A;  1SKR B;  1O8W A;  2O8V B;  4FO5 A;  5DAK B;  3TJB A;  4ZL9 A;  3KMO A;  1SK2 A;  5AGY A;  2YJ7 A;  2B1K A;  5JWR B;  1Z7R A;  14GS A;  3A2X A;  3LFL A;  3LGC A;  3UIW A;  4GST A;  2AHE A;  3TRP A;  3ZLP A;  1ERT A;  5H5Q A;  1GUK A;  3E3E A;  2IMF A;  5J41 A;  4NWY A;  3TKS C;  3PH9 A;  2PVO C;  2C8U A;  1GSY A;  1R26 A;  2RM5 A;  4F2I A;  2YZU A;  1JZO A;  4WKW A;  1R4W A;  3TOT A;  1T8E B;  1JLW A;  3UVH A;  4ULX A;  2HZE B;  2G2Q A;  3PR8 A;  3BBY A;  5G1L A;  2LJK A;  5ECK B;  5GST A;  4I97 A;  4KCA A;  18GS A;  1FAA A;  2WDU A;  3TKP A;  5EPF A;  3LXZ A;  3APS A;  4XIH A;  2MMZ A;  1SYX A;  3D6I A;  4NV2 A;  1OE8 A;  11GS A;  3I69 A;  4PNG A;  5EVO A;  3DGQ A;  2XBQ A;  4TVE A;  2HYX A;  3KM6 A;  1ZCP A;  3UAP A;  3CSJ A;  1AQV A;  3EC3 A;  2MBS A;  3M9J A;  1WRY A;  1S3D A;  1WIK A;  1KEB A;  2JSZ A;  2H1A A;  2DJ0 A;  2LJR A;  2OJL A;  5IO0 A;  4F0B A;  5FWG A;  4MAB A;  3QMX A;  1K0A A;  3HA9 A;  5G1K A;  3FR9 A;  3L4N A;  3C1S A;  2FCH A;  4N11 A;  3IXR A;  1THX A;  1YZX A;  1EOG A;  2C3T A;  4H86 A;  6GSW A;  1DE1 A;  5G30 A;  5HFG A;  2M80 A;  1K0M A;  2H01 A;  4ISD A;  1K3O A;  1FB0 A;  2HXK A;  5LCZ A;  4WR4 A;  2H72 A;  2LNT A;  3J7Y k;  2H73 A;  2F9S A;  3N9J A;  3EWL A;  3HJO A;  3D21 A;  4YQM A;  1SL0 B;  2H74 A;  2YJH A;  4LMV A;  1K3L A;  2EIQ A;  3H79 A;  1B9X C;  2GT6 A;  4WBR D;  4MF7 A;  1IYI A;  4XS1 A;  3F8U A;  4G2E A;  4NMU A;  3BCI A;  5ECM B;  4DVC A;  2M46 A;  3CMI A;  1EOH A;  3TKS E;  3VWW A;  5G5F A;  1M2A A;  3FKF A;  3HY2 A;  1A8Y A;  3KIJ A;  5F0G A;  2H8L A;  2QGV A;  3QD9 A;  1GTA A;  1QUW A;  2H0H A;  2DC5 A;  1AXD A;  1MD3 A;  4HEA 2;  2NDO A;  1BQ7 A;  3U6V A;  3D5J A;  2OBI A;  1GSQ A;  1QGV A;  5IO2 A;  5D96 A;  1SU9 A;  2GQK A;  4RQX A;  5EL8 A;  1M9A A;  4MCU A;  4D73 B;  1Q4J A;  3GTU B;  3GKM A;  2WCI A;  3M1G A;  5E59 A;  1T7P B;  3BD2 A;  2TRC P;  1WPI A;  3GMF A;  2O89 A;  5FT3 A;  3CBU A;  5IMC A;  1SKW B;  4TR1 A;  2F3M A;  5HR3 A;  1O8X A;  1SD9 A;  1PD2 1;  2EIO A;  3IC4 A;  3QOU A;  5LNK e;  2WS2 A;  3TJJ A;  4F0C A;  4XRD A;  1I9D A;  1GTI A;  3F0I A;  3RAZ A;  3VFI A;  3C71 A;  2V32 A;  2CVK A;  4KB3 A;  4MK3 A;  2RLI A;  3APO A;  3L9V A;  1A23 A;  3RPP A;  2OE3 A;  5CRE A;  2FLS A;  2GLR A;  2H19 A;  3FY7 A;  4YQV A;  6GST A;  4MA9 A;  3P2A A;  2H0I A;  3HYP A;  3CRU A;  6GSY A;  1ILO A;  3L78 A;  1EWX A;  3RDW A;  4PXO A;  4LA1 A;  3EIN A;  4TXO B;  5A4V A;  1HQO A;  2GZZ A;  2CV4 A;  4ZBA A;  1WP0 A;  3W8J A;  3RPN A;  2B6M A;  5HR0 A;  1W4V A;  5CO3 A;  4WF4 A;  4NHZ A;  1O7U A;  3GX0 A;  3HZ8 A;  1OC9 B;  1EGO A;  3VWV A;  2PMT A;  4QL9 A;  1K0O A;  3TKS A;  1GSF A;  4L0U A;  2A2S A;  4O7H A;  1O81 A;  1X5C A;  1FO5 A;  4KW6 A;  2JZR A;  4WEY A;  4K2D A;  1X9S B;  1LU4 A;  4BVY A;  1B9Y C;  4Q5Q A;  2FWH A;  1JLV A;  1XCC A;  5CRW A;  1M99 A;  3LYK A;  1NW2 A;  4EE0 A;  3IK7 A;  3HD5 A;  4GWR A;  1N8J A;  3APQ A;  2DJK A;  5ENU A;  1ZZY A;  2RII A;  4EDZ A;  4DSQ A;  2BJX A;  1OKT A;  4NXI A;  3RHC A;  2AAW A;  2E2G A;  1DBY A;  5ABR A;  4K7N A;  3DML A;  5CNW A;  1SKS B;  2VCW A;  3Q19 A;  6GSU A;  2K8S A;  3FEU A;  5IOW A;  4IJ3 A;  1UC7 A;  3WT1 A;  1EP8 A;  4YAP A;  1YF0 A;  13GS A;  2P5R A;  2C3Q A;  3Q18 A;  1X5E A;  4ILF A;  1U3I A;  3P8W A;  5HQP A;  2HLS A;  1BG5 A;  4BPY A;  2ZNM A;  2ES7 A;  1PL1 A;  2FD3 A;  2YV9 A;  4WF5 A;  3GH9 A;  3GYK A;  1YY7 A; 
#chains in the Genus database with same CATH topology
 4X43 A;  2QA1 A;  2H1G A;  1XIY A;  1Z7P A;  1UA5 A;  2HSY A;  2FGX A;  2JL4 A;  2B1L A;  1YKA A;  5D73 A;  3IA1 A;  3GL3 A;  2H75 A;  2HE3 A;  2OE1 A;  2WGR A;  4OO5 A;  1OVN A;  1A2L A;  1G0T A;  2KUC A;  3LWA A;  5KN3 A;  3IBH A;  1AQX A;  5IMV A;  1VF2 A;  2FWE A;  4MP4 A;  3GN3 A;  4ZL8 A;  2HSM A;  4WXT A;  2C0E A;  3L9U A;  5J3R A;  2LST A;  1FB6 A;  3ZYW A;  2DMM A;  2GSQ A;  4FIW A;  4PNF A;  4K0G A;  3DKS A;  4RUV A;  4XCS A;  3IRA A;  3GX8 A;  3QAV A;  4L0W A;  4O92 A;  2LKU A;  1ML6 A;  4OFT A;  4K1F A;  4ZB8 A;  1HD2 A;  4DSS B;  4L5L A;  1V98 A;  4XS4 A;  2FWF A;  2Z9S A;  3IC8 A;  2CZ2 A;  1A2J A;  3IK9 A;  2NTO A;  4HZ4 A;  3F4S A;  4OCE A;  3CYN A;  2GQM A;  2YP6 A;  3TGZ A;  1OC8 A;  1HNC A;  1A0R P;  3C7M A;  2LUS A;  4Z7X A;  2L57 A;  3ERG A;  2B7K A;  1MEK A;  4IBP A;  1BJX A;  2L5O A;  5ELG A;  1PX6 A;  2YPM A;  3EVI A;  1TU7 A;  2WJU A;  2R0G A;  3EU4 A;  4ZBD A;  3HKR A;  3KEB A;  17GS A;  3HVV A;  3G7Y A;  1XZO A;  4KH7 A;  4LL1 B;  4WET A;  5J5N A;  3G7I A;  1URM A;  22GS A;  4RI6 A;  3CSI A;  3Q6O A;  4K5R A;  1MD4 A;  4JED A;  1K0C A;  2P0G A;  4YKF A;  1KTE A;  1SYR A;  2RUF A;  5KN2 A;  2I4A A;  3E0U A;  1F6M C;  3FMW A;  5DQS A;  1B4Q A;  3UOM A;  2OKA A;  1B4P A;  3NIV A;  3KD0 A;  4HJ2 A;  3OR5 A;  4NHW A;  1U88 A;  3TKR A;  4OMV A;  4TOP A;  4MMM A;  2WZ9 A;  1RQM A;  3IOS A;  2DIZ A;  2R2J A;  2L4Q A;  2GSS A;  1O73 A;  5A4W A;  3EE2 A;  4EUY A;  3MYD A;  3GST A;  2CQ9 A;  1GH2 A;  4KAE A;  1FG4 A;  1PSQ A;  2O87 A;  2H71 A;  1M2D A;  2AB6 A;  4XRA A;  4QL7 A;  4IN0 A;  5HR1 A;  2YWI A;  1ZYP A;  4WR5 A;  2X8C A;  5E4W A;  1XWG A;  1F37 A;  4PGT A;  1GL8 A;  4HDE A;  3R2Q A;  2P5Q A;  4EF0 A;  2CX4 A;  1Z5Y E;  2REM A;  5BRT A;  1NSW A;  5GZZ B;  4ZXG A;  2J23 A;  2KLX A;  2H70 A;  1XWB A;  3RBT A;  4JZQ A;  4POB A;  1THO A;  4BL7 B;  4KGI A;  2IFQ A;  1Z3E A;  3LSZ A;  5JCG A;  8GSS A;  3TJF A;  2X49 A;  4GSS A;  4IQA A;  5B6N A;  1K0B A;  3H8Q A;  1EV9 A;  3ZTL A;  5G2Z A;  5DAL A;  2OAC A;  4POK A;  3KP9 A;  2PBJ A;  2MMN A;  3EMP A;  5AN1 A;  4POL A;  1E6B A;  2H66 A;  2HFD A;  3WYW A;  3WD6 A;  3R3E A;  4RQR A;  2H30 A;  2KHP A;  4K6X A;  4HOJ A;  2VL9 A;  4MDC A;  1N2A A;  3VLN A;  2C0G A;  1R5A A;  2QA2 A;  2VLV A;  4MJC A;  4EIQ A;  1SD8 A;  2R0P A;  4KX4 A;  4OWY A;  1A8L A;  2EIR A;  4MZW A;  4QQ7 A;  5ECN B;  3SBC A;  4Z2U A;  3ME7 A;  5F05 A;  2LNS A;  1ERU A;  4CY6 A;  3L0H A;  1YJ6 A;  4CW9 A;  2IPA A;  5A4U A;  4FYB A;  4GLT A;  2YWO A;  5IM9 A;  3NZN A;  2F8F A;  3GUS A;  4HQS A;  1MTC A;  2P31 A;  2XC2 A;  2R5G A;  1Q98 A;  2I81 A;  1XWC A;  4IQ1 A;  1ZOF A;  1TRU A;  3QDN A;  2H1D A;  2X4A A;  1G7O A;  3UAR A;  3FYG A;  3GV1 A;  4K0N A;  1PGT A;  5DAK A;  3TRQ A;  1C72 A;  3NOF A;  4FYU A;  4HSC X;  2BTO T;  3TUE A;  4Z2T A;  4K7I A;  1G6Y A;  1NHO A;  1GSU A;  1WOU A;  3PPU A;  2YWN A;  4IP1 A;  1A24 A;  3LG6 A;  4ZB6 A;  4AJ7 A;  1TK8 B;  1A2M A;  1GRX A;  4ECC A;  3F6F A;  2YV7 A;  1GUL A;  2CVD A;  2YZH A;  4F03 A;  3M9K A;  4ZB9 A;  3K8N A;  3UL3 A;  2LV3 A;  2L6D A;  2R6K A;  3GA4 A;  4I2T A;  4LLR A;  2HZE A;  5IPH A;  3D4T A;  5CP1 A;  4CHS A;  4IP6 A;  2K6V A;  1M3J A;  2FA4 A;  2GZP A;  4PUR A;  5F06 A;  2LQQ A;  3ERF A;  5KN0 A;  1G6W A;  4EIP A;  5ID2 B;  1H75 A;  1BAY A;  2YWM A;  5F8B A;  4ECI A;  4NPB A;  4X0X A;  4ZL7 A;  1EEJ A;  2O85 A;  1TK5 B;  1KNG A;  5CRG A;  1EV4 A;  2VCV A;  1GSE A;  5AIV A;  1GLP A;  3EYT A;  2QSI A;  2OAD A;  3HVN A;  1M0U A;  2VLT A;  3UBL A;  5B8A A;  1PX7 A;  3WGX A;  5L71 A;  5HR2 A;  1SEN A;  1LBK A;  3ZIV A;  2N5F A;  2RUE A;  2VCX A;  5HFK A;  1K3Y A;  3JCM L;  4J56 E;  2DJ1 A;  3UEM A;  4BWS A;  2HZF A;  10GS A;  3DIE A;  3HXS A;  3I9V 2;  4ZIL A;  2DJ2 A;  5GAP D;  1ON4 A;  2KOK A;  3EUR A;  4BVX A;  4NV5 A;  2PPT A;  2VOC A;  2YOI A;  4IKH A;  3F63 A;  1XVQ A;  1OYJ A;  1VGL A;  3VUR A;  3VWX A;  3M3M A;  4EL1 A;  1V9W A;  4TN8 A;  1X9W B;  16GS A;  2DSA A;  2UZ8 A;  2GZY A;  2IJY A;  1T3B A;  6GSX A;  5AIS A;  2ZUP A;  9GSS A;  1YF1 A;  2VCQ A;  5H5S A;  4N30 A;  1TKD B;  3M0F A;  1PL2 A;  5IMZ A;  3EMX A;  1PKZ A;  1DUG A;  2JZS A;  4IHU A;  2XPD A;  4G0K A;  1U87 A;  2PN8 A;  2LS5 A;  1EGR A;  3BCK A;  1SJZ A;  3IE3 A;  5GSS A;  5D8I A;  1F3A A;  3MIX A;  5B7C A;  4EXJ A;  3WGE A;  3QFA C;  4HQZ A;  2L4C A;  2CAI A;  2VCZ A;  1UVZ A;  4XS4 B;  4IS0 A;  4HS1 A;  1PMT A;  4L5O A;  2IIY A;  1NM3 A;  2VLU A;  2ALB A;  2LRT A;  4MZB A;  1AUC A;  2GDR A;  4D73 A;  3GTU A;  3WT2 A;  4POM A;  3HDC A;  2V41 A;  3A2W A;  2I1U A;  2QKE A;  1SK0 A;  3P7X A;  2MMO A;  3VPQ A;  4JRR A;  2WUL A;  5KOW A;  3LOR A;  1AC1 A;  2CX3 A;  1TTZ A;  3GFK A;  5AIX A;  2ON7 A;  1XW9 A;  1UN2 A;  3UVT A;  5IMA A;  2B5E A;  3ME8 A;  5DQY A;  2B3S A;  1QK8 A;  3P90 A;  1S3C A;  2A2P A;  4AJ6 A;  5BMU A;  2H6X A;  2IN3 A;  3UJ1 A;  1PFO A;  2NBS A;  3MNG A;  5DVB A;  3HZ4 A;  3TCO A;  5DCH A;  3IDV A;  3J7Y b;  2DBC A;  2GVP A;  4ECJ A;  1BED A;  2LRC A;  6GSV A;  2B5Y A;  4GF0 A;  3FZ4 A;  5D93 A;  1R7H A;  4TXO A;  1T1V A;  2O7K A;  2R3X A;  7GSS A;  1PA3 A;  1T00 A;  2IL3 A;  1ZMA A;  4I8B A;  1ZL9 A;  5DCG A;  3ZZX A;  4J2F A;  4OFM A;  3S9F A;  1GNE A;  3G9B A;  1OC9 A;  3HVS A;  4KA0 A;  1TRS A;  2KP1 A;  2C1Y A;  5ECL B;  1GSD A;  1XFL A;  3KXO A;  3G7J A;  2HNL A;  3C73 A;  2FY6 A;  2OBK A;  4K8M A;  3KTL A;  4I6X A;  2X64 A;  4YAV A;  1PN9 A;  5JCU A;  1E2Y A;  2XHF A;  4X4J A;  4JBB A;  3GKK A;  3GNJ A;  1XOA A;  1O6J A;  1XW6 A;  2CVB A;  2PVQ A;  3GL5 A;  4I2U A;  4KCE A;  1F3B A;  3HVX A;  4AF2 A;  3IAM 2;  3F6D A;  4Q5R A;  3ZRE A;  1AAZ A;  1JZW A;  2HI7 A;  2C0F A;  1QFN A;  1GSS A;  1F9M A;  2V6K A;  3KTB A;  1JHB A;  2D2Z A;  4JE1 A;  5IIZ A;  19GS A;  4PQ1 A;  3FRC A;  4Q5F A;  2VCT A;  2VL2 C;  3A2V A;  3TRX A;  5DJL A;  1PKW A;  3FZ5 A;  3D0Z A;  2K9F A;  2I3Y A;  1MDJ A;  5DBQ A;  4V2N A;  2G0F A;  4O32 A;  1JFU A;  4MH2 A;  1TRV A;  2DLX A;  3IHG A;  1JZD A;  3HJM A;  1QQ2 A;  1NHY A;  5A5K A;  2V1M A;  3H4K A;  2JAD A;  3UMA A;  1RW1 A;  1CQH A;  2DML A;  3L9S A;  2VIM A;  5CYY A;  5EY6 A;  4ZBB A;  3ZVJ A;  4CY8 A;  4FH8 A;  3QCP A;  4KE3 A;  5J9B A;  5H5R A;  4KUN A;  4E8E A;  1TXX A;  3IV4 A;  4EVM A;  3VWU A;  2WB9 A;  3CTG A;  5DDL A;  4EO3 A;  5D9X A;  3ZFB A;  3GKN A;  4XHM A;  4MF6 A;  4MZC A;  5DJM A;  1HYU A;  5JWO B;  2EC4 A;  2KP2 A;  2AV4 A;  2FUG 2;  2GGT A;  4LMW A;  3TDG A;  4WBJ A;  3VK9 A;  1SK1 A;  5C04 A;  5KEJ A;  3ZIJ A;  2C3N A;  4Z2R A;  3BJ5 A;  4YH2 A;  4MJA A;  1XOB A;  1TI1 A;  4KDX A;  3HJP A;  4XS6 A;  2H6Y A;  2DJ3 A;  1ERV A;  1TRW A;  2R37 A;  3MAK A;  4DSS A;  4EDY A;  1ZGN A;  2N5A A;  3V1W A;  2IMK A;  3KGK A;  1XW5 A;  4GRF A;  1GTB A;  4V2M A;  5ECQ B;  3TKQ A;  1Z9H A;  5B8B A;  12GS A;  2HRK A;  4PX1 A;  2VAF A;  4GSN A;  1M7T A;  1R5P A;  3M8N A;  1U6T A;  3MDK A;  4K9Z A;  3O6T A;  3IPZ A;  1Z6M A;  4PUA A;  1VF4 A;  4TR1 B;  2F8A A;  4O5Q A;  4RI7 A;  1LJR A;  1OC3 A;  1DE2 A;  4L8E A;  1W89 A;  2CZ3 A;  1PRX A;  1I5G A;  5F07 A;  1B8X A;  2DKI A;  2YN1 A;  3GIX A;  4CDO A;  1YEX A;  1G7E A;  4GXZ A;  1XWK A;  3QFB C;  2WRT A;  3F4R A;  3VI7 A;  3KH9 A;  5D9W A;  3GHA A;  1K0N A;  3F4T A;  3FK8 A;  2VM1 A;  4HU7 A;  1TW9 A;  2VD0 A;  5IPG A;  4OD7 A;  1IYH A;  2HRN A;  3HCZ A;  5FHI A;  3FHK A;  1F2E A;  1WMJ A;  3F9U A;  1TP9 A;  3DRN A;  3IR4 A;  3DEX A;  1X5D A;  4MH3 A;  1TJD A;  2M72 A;  1V2A A;  2WFC A;  3FW2 A;  1FVK A;  3CSH A;  2K18 A;  2H1B A;  4KDY A;  3A5W A;  4I5Q A;  2B5X A;  3QAW A;  2PU9 C;  4TW5 A;  3DD3 A;  4YKG A;  1WWJ A;  2AUV A;  4K2X A;  3FR6 A;  2L6C A;  4E8H A;  2FA8 A;  2PGT A;  1GUH A;  2JAC A;  2F51 A;  4ID0 A;  3GH6 A;  1MDI A;  3ZFL A;  5ECS A;  3CRT A;  1SL1 B;  2BMX A;  1HNB A;  5ECR B;  4J57 E;  2H6Z A;  2VD1 A;  1TOF A;  2AYT A;  4LL4 B;  2CT6 A;  1OE7 A;  5J4U A;  1XBS A;  3U5R E;  3VI5 A;  2K8V A;  4BVY B;  1VRS D;  2H0G A;  2FNO A;  2C0D A;  2X99 A;  1PQN A;  4N0Z A;  4OO4 A;  5ECP B;  4HJM A;  4BL7 A;  1GTU A;  1BYE A;  5CRH A;  4GQC A;  1SJ6 A;  2LTK A;  2LRN A;  3PGT A;  2LEG A;  2IMD A;  4G9H A;  1XPV A;  4FYC A;  4IGJ A;  2L59 A;  2PER A;  3D22 A;  1FOH A;  1GUM A;  2MZC A;  4N0V A;  2YCD A;  1OKD A;  2OA7 A;  2VL2 A;  4BIK A;  4KND A;  3Q74 A;  1HNA A;  4MLY A;  1J9B A;  4G10 A;  4TKY A;  1TDI A;  2IMI A;  2A2R A;  4KSO A;  1ZYQ B;  5C00 A;  1ST9 A;  2A4V A;  3EU3 A;  4PTS A;  5D9V A;  2JZT A;  5J9C A;  1OAZ A;  1GNW A;  2NVL A;  4X1U A;  3TB2 A;  3KMN A;  1J0F A;  1XVW A;  1SJI A;  4ECB A;  3A5I A;  20GS A;  3LXT A;  2R0C A;  1Z6N A;  4MPF A;  4KSM A;  1GP1 A;  2GS3 A;  4FQU A;  5CAX A;  1ERW A;  3DVW A;  3GRX A;  4O5R A;  2H76 A;  2XPE A;  6GSS A;  1FW1 A;  1SL2 B;  5IMD A;  2X8G A;  2CAQ A;  1A0F A;  3TOU A;  3AY8 A;  3GUR A;  2L5L A;  2B7J A;  3KCM A;  3PIN A;  4HI7 A;  3DWV A;  4AJ8 A;  5JCW A;  3CTF A;  3DVX A;  4GCI A;  4IJI A;  4DEJ A;  2MBT A;  3MWH A;  4N10 A;  5KN1 A;  4TXV A;  4TR3 A;  5HFI A;  4GQF A;  1MDK A;  1FOV A;  3ZL5 A;  4OCF A;  1V57 A;  5IQY A;  1EZK A;  2HRF A;  2PWJ A;  2GST A;  5IOX A;  2E7P A;  4K7O A;  1AW9 A;  3ED3 A;  4AGS A;  1ZYE A;  2E0Q A;  4KDU A;  4PQI A;  4TRX A;  5D9T A;  1FHE A;  3E9J B;  3D4M A;  3C1R A;  3HHV A;  1FVJ A;  5IMF A;  3O76 A;  2MMA A;  2TRX A;  3TJG A;  2HSH A;  1O85 A;  3C8E A;  5ID2 A;  3QAG A;  1X9M B;  4JU5 A;  2X8H A;  3FR3 A;  2JU5 A;  1M9B A;  4MJE A;  1U3A A;  2XBI A;  4V1A g;  2NPB A;  4ML1 A;  4O5U A;  3IAS 2;  3BOA A;  1V58 A;  2IWT A;  2N5B A;  1QMV A;  2LJA A;  4PUF C;  1PN0 A;  3LYP A;  2R4V A;  4YQU A;  2VM2 A;  1V40 A;  2HT9 A;  3LJR A;  2E2M A;  3ZIT A;  3H1N A;  3GKX A;  2VO4 A;  4DSR A;  1RK4 A;  3KJY A;  1WE0 A;  3FZ9 A;  1USB A;  3DXB A;  3ERW A;  4JR6 A;  4F9Z A;  4NAX A;  4MJB A;  5LD0 A;  3QPM A;  3TJK A;  4V2L A;  2GT5 A;  4JR4 A;  3I6A A;  3CXG A;  4TR0 A;  2I9H A;  2IME A;  3LEF A;  4HU9 A;  3ZMK A;  4ACS A;  5GAN D;  4P3Y B;  2OE0 A;  1TU8 A;  2C80 A;  3KP8 A;  3ZVJ D;  3VPT A;  1M2B A;  3UBK A;  1ACV A;  2CA8 A;  4G19 A;  5ECH B;  3N5O A;  3F3Q A;  3H93 A;  1B48 A;  3IHQ A;  1Y25 A;  4IW9 A;  3W8S A;  1CQG A;  1Y6E A;  4IEL A;  4HZ2 A;  4HUA A;  4OFN A;  5B6M A;  3FZA A;  3LQ7 A;  3F3R A;  4EC0 A;  2V6O A;  3DYR A;  1K0D A;  4TR4 A;  1VF1 A;  2ON5 A;  1VF3 A;  2QC7 A;  1XWA A;  1YEP A;  1S3A A;  2GTU A;  4EKZ A;  4BWQ A;  4A5P A;  3W6G A;  1AQW A;  2VUP A;  2IFQ B;  1GWC A;  5ELA A;  4IVF A;  2FWG A;  2GQL A;  1T4Y A;  2MYG A;  1WJK A;  3RHB A;  2YNX A;  1KBN A;  1GLQ A;  1JZR A;  2DJJ A;  3ZRD A;  1X0R A;  3SWL A;  5DAL B;  1XXU A;  4Q5N A;  4V1A p;  5ECO B;  5ECI B;  4GTU A;  1YQ1 A;  4MNN A;  2PUK C;  4F82 A;  3I43 A;  4BA7 A;  2JSY A;  3WGD A;  1YDK A;  4MPG A;  3US3 A;  4PQH A;  3GSS A;  4ML6 A;  2YAN A;  2VL3 A;  1DSB A;  3O3T A;  4XTS A;  2ZCT A;  5G31 A;  1QXH A;  3MSZ A;  2V2G A;  3QR6 A;  5JWQ B;  5G5E A;  5CRD A;  3KZQ A;  5INY A;  2AJQ B;  4USS A;  2J9H A;  1ABA A;  1YKC A;  3ZML A;  1J08 A;  1EEM A;  1AIU A;  2FHE A;  1EP7 A;  3KH7 A;  1TK0 B;  2LQO A;  1TI3 A;  3A3T A;  2TIR A;  1H4O A;  2RM6 A;  2C4J A;  4MF5 A;  2DIY A;  2GSR A;  1T4Z A;  1BX9 A;  3ISO A;  5COH A;  4ZIJ A;  1SKR B;  1O8W A;  2O8V B;  4FO5 A;  5DAK B;  3TJB A;  4ZL9 A;  3KMO A;  1SK2 A;  5AGY A;  2YJ7 A;  2B1K A;  5JWR B;  1Z7R A;  14GS A;  3A2X A;  3LFL A;  3LGC A;  3UIW A;  4GST A;  2AHE A;  3TRP A;  3ZLP A;  1ERT A;  5H5Q A;  1GUK A;  4KF9 A;  3E3E A;  2IMF A;  5J41 A;  4NWY A;  3CQF A;  3TKS C;  3PH9 A;  2PVO C;  2C8U A;  1GSY A;  1R26 A;  2RM5 A;  4F2I A;  2YZU A;  1JZO A;  4WKW A;  1R4W A;  3TOT A;  1T8E B;  1JLW A;  3UVH A;  4ULX A;  2HZE B;  2G2Q A;  3PR8 A;  3BBY A;  5G1L A;  2LJK A;  5ECK B;  2A4H A;  5GST A;  4I97 A;  4KCA A;  18GS A;  1FAA A;  2WDU A;  3TKP A;  5EPF A;  3LXZ A;  3APS A;  4XIH A;  2MMZ A;  4ICY A;  1SYX A;  3D6I A;  4NV2 A;  1OE8 A;  11GS A;  3I69 A;  4PNG A;  5EVO A;  3DGQ A;  4G0L A;  2XBQ A;  4TVE A;  2HYX A;  3KM6 A;  1ZCP A;  3UAP A;  3CSJ A;  1AQV A;  3EC3 A;  2MBS A;  3M9J A;  1WRY A;  1S3D A;  1WIK A;  1KEB A;  2JSZ A;  2H1A A;  2DJ0 A;  2LJR A;  2OJL A;  5IO0 A;  4F0B A;  5KOX A;  5FWG A;  4MAB A;  3QMX A;  1K0A A;  3HA9 A;  5G1K A;  3FR9 A;  3L4N A;  3C1S A;  2FCH A;  4N11 A;  3IXR A;  1THX A;  1YZX A;  1EOG A;  2C3T A;  4H86 A;  6GSW A;  1DE1 A;  5G30 A;  5HFG A;  2M80 A;  1K0M A;  2H01 A;  4ISD A;  4BVX B;  1K3O A;  1FB0 A;  2HXK A;  4G0I A;  5LCZ A;  4WR4 A;  2H72 A;  2LNT A;  3J7Y k;  2H73 A;  2F9S A;  3N9J A;  3EWL A;  3HJO A;  3D21 A;  4YQM A;  1SL0 B;  2H74 A;  2YJH A;  4LMV A;  1K3L A;  2EIQ A;  3H79 A;  1B9X C;  2GT6 A;  1XG8 A;  4WBR D;  4MF7 A;  1IYI A;  4XS1 A;  3F8U A;  4G2E A;  4NMU A;  3BCI A;  5ECM B;  4DVC A;  2M46 A;  3CMI A;  1EOH A;  3TKS E;  3VWW A;  5G5F A;  1M2A A;  3FKF A;  3HY2 A;  1A8Y A;  3KIJ A;  5F0G A;  2H8L A;  2QGV A;  3QD9 A;  1GTA A;  1QUW A;  2H0H A;  2DC5 A;  1AXD A;  1MD3 A;  2HRA A;  4HEA 2;  2NDO A;  1BQ7 A;  3U6V A;  3D5J A;  2OBI A;  1GSQ A;  1QGV A;  5IO2 A;  5D96 A;  1SU9 A;  2GQK A;  4RQX A;  5EL8 A;  1M9A A;  4MCU A;  4D73 B;  1Q4J A;  3GTU B;  3GKM A;  2WCI A;  3M1G A;  5E59 A;  1T7P B;  3BD2 A;  2TRC P;  1WPI A;  3GMF A;  2O89 A;  5FT3 A;  3CBU A;  5IMC A;  1SKW B;  4TR1 A;  2F3M A;  5HR3 A;  1O8X A;  1SD9 A;  1PD2 1;  2EIO A;  3IC4 A;  3QOU A;  5LNK e;  2WS2 A;  3TJJ A;  4F0C A;  4XRD A;  1M3I A;  1I9D A;  1GTI A;  3F0I A;  3RAZ A;  3VFI A;  3C71 A;  2V32 A;  2CVK A;  4KB3 A;  4MK3 A;  2RLI A;  3APO A;  3L9V A;  1A23 A;  3RPP A;  2OE3 A;  5CRE A;  2FLS A;  2GLR A;  2H19 A;  3FY7 A;  4YQV A;  6GST A;  4MA9 A;  3P2A A;  2H0I A;  3HYP A;  3CRU A;  6GSY A;  1ILO A;  3L78 A;  1EWX A;  3RDW A;  4PXO A;  4LA1 A;  3EIN A;  4TXO B;  5A4V A;  1HQO A;  2GZZ A;  2CV4 A;  4ZBA A;  1WP0 A;  3W8J A;  3RPN A;  2B6M A;  5HR0 A;  1W4V A;  5CO3 A;  4WF4 A;  4K5S A;  4NHZ A;  1O7U A;  3GX0 A;  3HZ8 A;  1OC9 B;  1EGO A;  3VWV A;  2PMT A;  4QL9 A;  1K0O A;  3TKS A;  1GSF A;  4L0U A;  2A2S A;  4O7H A;  1O81 A;  1X5C A;  1FO5 A;  4KW6 A;  2JZR A;  4WEY A;  4K2D A;  1X9S B;  1LU4 A;  4BVY A;  1B9Y C;  4Q5Q A;  2FWH A;  1JLV A;  1XCC A;  5CRW A;  1M99 A;  3LYK A;  1NW2 A;  4EE0 A;  3IK7 A;  3HD5 A;  4GWR A;  2DKH A;  1N8J A;  3APQ A;  2DJK A;  5ENU A;  1ZZY A;  2RII A;  4EDZ A;  4DSQ A;  2BJX A;  1OKT A;  4NXI A;  3LW9 A;  3RHC A;  2AAW A;  2E2G A;  1DBY A;  5ABR A;  4K7N A;  3DML A;  5CNW A;  1SKS B;  2VCW A;  3Q19 A;  6GSU A;  1ZYN A;  2K8S A;  3FEU A;  5IOW A;  4IJ3 A;  1S3R A;  1UC7 A;  3WT1 A;  1EP8 A;  4YAP A;  1YF0 A;  13GS A;  2P5R A;  2C3Q A;  3Q18 A;  1X5E A;  4ILF A;  1U3I A;  3P8W A;  5HQP A;  2HLS A;  1BG5 A;  3EPT A;  4BPY A;  2ZNM A;  2ES7 A;  1PL1 A;  2FD3 A;  2YV9 A;  4WF5 A;  3GH9 A;  3GYK A;  1YY7 A; 
#chains in the Genus database with same CATH homology
 4X43 A;  2QA1 A;  2H1G A;  1XIY A;  1Z7P A;  1UA5 A;  2HSY A;  2FGX A;  2JL4 A;  2B1L A;  1YKA A;  5D73 A;  3IA1 A;  3GL3 A;  2H75 A;  2HE3 A;  2OE1 A;  2WGR A;  4OO5 A;  1OVN A;  1A2L A;  1G0T A;  2KUC A;  3LWA A;  5KN3 A;  3IBH A;  1AQX A;  5IMV A;  1VF2 A;  2FWE A;  4MP4 A;  3GN3 A;  4ZL8 A;  2HSM A;  4WXT A;  2C0E A;  3L9U A;  5J3R A;  2LST A;  1FB6 A;  3ZYW A;  2DMM A;  2GSQ A;  4FIW A;  4PNF A;  4K0G A;  3DKS A;  4RUV A;  4XCS A;  3IRA A;  3GX8 A;  3QAV A;  4L0W A;  4O92 A;  2LKU A;  1ML6 A;  4OFT A;  4K1F A;  4ZB8 A;  1HD2 A;  4DSS B;  4L5L A;  1V98 A;  4XS4 A;  2FWF A;  2Z9S A;  3IC8 A;  2CZ2 A;  1A2J A;  3IK9 A;  2NTO A;  4HZ4 A;  3F4S A;  4OCE A;  3CYN A;  2GQM A;  2YP6 A;  3TGZ A;  1OC8 A;  1HNC A;  1A0R P;  3C7M A;  2LUS A;  4Z7X A;  2L57 A;  3ERG A;  2B7K A;  1MEK A;  4IBP A;  1BJX A;  2L5O A;  5ELG A;  1PX6 A;  2YPM A;  3EVI A;  1TU7 A;  2WJU A;  2R0G A;  3EU4 A;  4ZBD A;  3HKR A;  3KEB A;  17GS A;  3HVV A;  3G7Y A;  1XZO A;  4KH7 A;  4LL1 B;  4WET A;  5J5N A;  3G7I A;  1URM A;  22GS A;  4RI6 A;  3CSI A;  3Q6O A;  4K5R A;  1MD4 A;  4JED A;  1K0C A;  2P0G A;  4YKF A;  1KTE A;  1SYR A;  2RUF A;  5KN2 A;  2I4A A;  3E0U A;  1F6M C;  3FMW A;  5DQS A;  1B4Q A;  3UOM A;  2OKA A;  1B4P A;  3NIV A;  3KD0 A;  4HJ2 A;  3OR5 A;  4NHW A;  1U88 A;  3TKR A;  4OMV A;  4TOP A;  4MMM A;  2WZ9 A;  1RQM A;  3IOS A;  2DIZ A;  2R2J A;  2L4Q A;  2GSS A;  1O73 A;  5A4W A;  3EE2 A;  4EUY A;  3MYD A;  3GST A;  2CQ9 A;  1GH2 A;  4KAE A;  1FG4 A;  1PSQ A;  2O87 A;  2H71 A;  1M2D A;  2AB6 A;  4XRA A;  4QL7 A;  4IN0 A;  5HR1 A;  2YWI A;  1ZYP A;  4WR5 A;  2X8C A;  5E4W A;  1XWG A;  1F37 A;  4PGT A;  1GL8 A;  4HDE A;  3R2Q A;  2P5Q A;  4EF0 A;  2CX4 A;  1Z5Y E;  2REM A;  5BRT A;  1NSW A;  5GZZ B;  4ZXG A;  2J23 A;  2KLX A;  2H70 A;  1XWB A;  3RBT A;  4JZQ A;  4POB A;  1THO A;  4BL7 B;  4KGI A;  2IFQ A;  1Z3E A;  3LSZ A;  5JCG A;  8GSS A;  3TJF A;  2X49 A;  4GSS A;  4IQA A;  5B6N A;  1K0B A;  3H8Q A;  1EV9 A;  3ZTL A;  5G2Z A;  5DAL A;  2OAC A;  4POK A;  3KP9 A;  2PBJ A;  2MMN A;  3EMP A;  5AN1 A;  4POL A;  1E6B A;  2H66 A;  2HFD A;  3WYW A;  3WD6 A;  3R3E A;  4RQR A;  2H30 A;  2KHP A;  4K6X A;  4HOJ A;  2VL9 A;  4MDC A;  1N2A A;  3VLN A;  2C0G A;  1R5A A;  2QA2 A;  2VLV A;  4MJC A;  4EIQ A;  1SD8 A;  2R0P A;  4KX4 A;  4OWY A;  1A8L A;  2EIR A;  4MZW A;  4QQ7 A;  5ECN B;  3SBC A;  4Z2U A;  3ME7 A;  5F05 A;  2LNS A;  1ERU A;  4CY6 A;  3L0H A;  1YJ6 A;  4CW9 A;  2IPA A;  5A4U A;  4FYB A;  4GLT A;  2YWO A;  5IM9 A;  3NZN A;  2F8F A;  3GUS A;  4HQS A;  1MTC A;  2P31 A;  2XC2 A;  2R5G A;  1Q98 A;  2I81 A;  1XWC A;  4IQ1 A;  1ZOF A;  1TRU A;  3QDN A;  2H1D A;  2X4A A;  1G7O A;  3UAR A;  3FYG A;  3GV1 A;  4K0N A;  1PGT A;  5DAK A;  3TRQ A;  1C72 A;  3NOF A;  4FYU A;  2BTO T;  3TUE A;  4Z2T A;  4K7I A;  1G6Y A;  1NHO A;  1GSU A;  1WOU A;  3PPU A;  2YWN A;  4IP1 A;  1A24 A;  3LG6 A;  4ZB6 A;  4AJ7 A;  1TK8 B;  1A2M A;  1GRX A;  4ECC A;  3F6F A;  2YV7 A;  1GUL A;  2CVD A;  2YZH A;  4F03 A;  3M9K A;  4ZB9 A;  3K8N A;  3UL3 A;  2LV3 A;  2L6D A;  2R6K A;  3GA4 A;  4I2T A;  4LLR A;  2HZE A;  5IPH A;  3D4T A;  5CP1 A;  4CHS A;  4IP6 A;  2K6V A;  2FA4 A;  2GZP A;  4PUR A;  5F06 A;  2LQQ A;  3ERF A;  5KN0 A;  1G6W A;  4EIP A;  5ID2 B;  1H75 A;  1BAY A;  2YWM A;  5F8B A;  4ECI A;  4NPB A;  4X0X A;  4ZL7 A;  1EEJ A;  2O85 A;  1TK5 B;  1KNG A;  5CRG A;  1EV4 A;  2VCV A;  1GSE A;  5AIV A;  1GLP A;  3EYT A;  2QSI A;  2OAD A;  3UBL A;  1M0U A;  2VLT A;  5B8A A;  1PX7 A;  3WGX A;  5L71 A;  5HR2 A;  1SEN A;  1LBK A;  3ZIV A;  2N5F A;  2RUE A;  2VCX A;  5HFK A;  1K3Y A;  3JCM L;  4J56 E;  2DJ1 A;  3UEM A;  4BWS A;  2HZF A;  10GS A;  3DIE A;  3HXS A;  3I9V 2;  4ZIL A;  2DJ2 A;  5GAP D;  1ON4 A;  2KOK A;  3EUR A;  4BVX A;  4NV5 A;  2PPT A;  2VOC A;  2YOI A;  4IKH A;  3F63 A;  1XVQ A;  1OYJ A;  1VGL A;  3VUR A;  3VWX A;  3M3M A;  4EL1 A;  1V9W A;  4TN8 A;  1X9W B;  16GS A;  2DSA A;  2UZ8 A;  2GZY A;  2IJY A;  1T3B A;  6GSX A;  5AIS A;  2ZUP A;  9GSS A;  1YF1 A;  2VCQ A;  5H5S A;  4N30 A;  1TKD B;  3M0F A;  1PL2 A;  5IMZ A;  3EMX A;  1PKZ A;  1DUG A;  2JZS A;  4IHU A;  2XPD A;  4G0K A;  1U87 A;  2PN8 A;  2LS5 A;  1EGR A;  3BCK A;  1SJZ A;  3IE3 A;  5GSS A;  5D8I A;  1F3A A;  3MIX A;  5B7C A;  4EXJ A;  3WGE A;  3QFA C;  4HQZ A;  2L4C A;  2CAI A;  2VCZ A;  1UVZ A;  4XS4 B;  4IS0 A;  4HS1 A;  1PMT A;  4L5O A;  2IIY A;  1NM3 A;  2VLU A;  2ALB A;  2LRT A;  4MZB A;  1AUC A;  2GDR A;  4D73 A;  3GTU A;  3WT2 A;  4POM A;  3HDC A;  2V41 A;  3A2W A;  2I1U A;  2QKE A;  1SK0 A;  3P7X A;  2MMO A;  3VPQ A;  4JRR A;  2WUL A;  5KOW A;  3LOR A;  1AC1 A;  2CX3 A;  1TTZ A;  3GFK A;  5AIX A;  2ON7 A;  1XW9 A;  1UN2 A;  3UVT A;  5IMA A;  2B5E A;  3ME8 A;  5DQY A;  2B3S A;  1QK8 A;  3P90 A;  1S3C A;  2A2P A;  4AJ6 A;  5BMU A;  2H6X A;  2IN3 A;  3UJ1 A;  2NBS A;  3MNG A;  5DVB A;  3HZ4 A;  3TCO A;  5DCH A;  3IDV A;  3J7Y b;  2DBC A;  2GVP A;  4ECJ A;  1BED A;  2LRC A;  6GSV A;  2B5Y A;  4GF0 A;  3FZ4 A;  5D93 A;  1R7H A;  4TXO A;  1T1V A;  2O7K A;  2R3X A;  7GSS A;  1PA3 A;  1T00 A;  2IL3 A;  1ZMA A;  4I8B A;  1ZL9 A;  5DCG A;  3ZZX A;  4J2F A;  4OFM A;  3S9F A;  1GNE A;  3G9B A;  1OC9 A;  3HVS A;  4KA0 A;  1TRS A;  2KP1 A;  2C1Y A;  5ECL B;  1GSD A;  1XFL A;  3KXO A;  3G7J A;  2HNL A;  3C73 A;  2FY6 A;  2OBK A;  4K8M A;  3KTL A;  4I6X A;  2X64 A;  4YAV A;  1PN9 A;  5JCU A;  1E2Y A;  2XHF A;  4X4J A;  4JBB A;  3GKK A;  3GNJ A;  1XOA A;  1O6J A;  1XW6 A;  2CVB A;  2PVQ A;  3GL5 A;  4I2U A;  4KCE A;  1F3B A;  3HVX A;  4AF2 A;  3IAM 2;  3F6D A;  4Q5R A;  3ZRE A;  1AAZ A;  1JZW A;  2HI7 A;  2C0F A;  1QFN A;  1GSS A;  1F9M A;  2V6K A;  3KTB A;  1JHB A;  2D2Z A;  4JE1 A;  5IIZ A;  19GS A;  4PQ1 A;  3FRC A;  4Q5F A;  2VCT A;  2VL2 C;  3A2V A;  3TRX A;  5DJL A;  1PKW A;  3FZ5 A;  3D0Z A;  2K9F A;  2I3Y A;  1MDJ A;  5DBQ A;  4V2N A;  2G0F A;  4O32 A;  1JFU A;  4MH2 A;  1TRV A;  2DLX A;  3IHG A;  1JZD A;  3HJM A;  1QQ2 A;  1NHY A;  5A5K A;  2V1M A;  3H4K A;  2JAD A;  3UMA A;  1RW1 A;  1CQH A;  2DML A;  3L9S A;  2VIM A;  5CYY A;  5EY6 A;  4ZBB A;  3ZVJ A;  4CY8 A;  4FH8 A;  3QCP A;  4KE3 A;  5J9B A;  5H5R A;  4KUN A;  4E8E A;  1TXX A;  3IV4 A;  4EVM A;  3VWU A;  2WB9 A;  3CTG A;  5DDL A;  4EO3 A;  5D9X A;  3ZFB A;  3GKN A;  4XHM A;  4MF6 A;  4MZC A;  5DJM A;  1HYU A;  5JWO B;  2EC4 A;  2KP2 A;  2AV4 A;  2FUG 2;  2GGT A;  4LMW A;  3TDG A;  4WBJ A;  3VK9 A;  1SK1 A;  5C04 A;  5KEJ A;  3ZIJ A;  2C3N A;  4Z2R A;  3BJ5 A;  4YH2 A;  4MJA A;  1XOB A;  1TI1 A;  4KDX A;  3HJP A;  4XS6 A;  2H6Y A;  2DJ3 A;  1ERV A;  1TRW A;  2R37 A;  3MAK A;  4DSS A;  4EDY A;  1ZGN A;  2N5A A;  3V1W A;  2IMK A;  3KGK A;  1XW5 A;  4GRF A;  1GTB A;  4V2M A;  5ECQ B;  3TKQ A;  1Z9H A;  5B8B A;  12GS A;  2HRK A;  4PX1 A;  2VAF A;  4GSN A;  1M7T A;  1R5P A;  3M8N A;  1U6T A;  3MDK A;  4K9Z A;  3O6T A;  3IPZ A;  1Z6M A;  4PUA A;  1VF4 A;  4TR1 B;  2F8A A;  4O5Q A;  4RI7 A;  1LJR A;  1OC3 A;  1DE2 A;  4L8E A;  1W89 A;  2CZ3 A;  1PRX A;  1I5G A;  5F07 A;  1B8X A;  2DKI A;  2YN1 A;  3GIX A;  4CDO A;  1YEX A;  1G7E A;  4GXZ A;  1XWK A;  3QFB C;  2WRT A;  3F4R A;  3VI7 A;  3KH9 A;  5D9W A;  3GHA A;  1K0N A;  3F4T A;  3FK8 A;  2VM1 A;  4HU7 A;  1TW9 A;  2VD0 A;  5IPG A;  4OD7 A;  1IYH A;  2HRN A;  3HCZ A;  5FHI A;  3FHK A;  1F2E A;  1WMJ A;  3F9U A;  1TP9 A;  3DRN A;  3IR4 A;  3DEX A;  1X5D A;  4MH3 A;  1TJD A;  2M72 A;  1V2A A;  2WFC A;  3FW2 A;  1FVK A;  3CSH A;  2K18 A;  2H1B A;  4KDY A;  3A5W A;  4I5Q A;  2B5X A;  3QAW A;  2PU9 C;  4TW5 A;  3DD3 A;  4YKG A;  1WWJ A;  2AUV A;  4K2X A;  3FR6 A;  2L6C A;  4E8H A;  2FA8 A;  2PGT A;  1GUH A;  2JAC A;  2F51 A;  4ID0 A;  3GH6 A;  1MDI A;  3ZFL A;  5ECS A;  3CRT A;  1SL1 B;  2BMX A;  1HNB A;  5ECR B;  4J57 E;  2H6Z A;  2VD1 A;  1TOF A;  2AYT A;  4LL4 B;  2CT6 A;  1OE7 A;  5J4U A;  1XBS A;  3U5R E;  3VI5 A;  2K8V A;  4BVY B;  1VRS D;  2H0G A;  2FNO A;  2C0D A;  2X99 A;  1PQN A;  4N0Z A;  4OO4 A;  5ECP B;  4HJM A;  4BL7 A;  1GTU A;  1BYE A;  5CRH A;  4GQC A;  1SJ6 A;  2LTK A;  2LRN A;  3PGT A;  2LEG A;  2IMD A;  4G9H A;  1XPV A;  4FYC A;  4IGJ A;  2L59 A;  2PER A;  3D22 A;  1FOH A;  1GUM A;  2MZC A;  4N0V A;  2YCD A;  1OKD A;  2OA7 A;  2VL2 A;  4KND A;  3Q74 A;  1HNA A;  4MLY A;  1J9B A;  4G10 A;  4TKY A;  1TDI A;  2IMI A;  2A2R A;  4KSO A;  1ZYQ B;  5C00 A;  1ST9 A;  2A4V A;  3EU3 A;  4PTS A;  5D9V A;  2JZT A;  5J9C A;  1OAZ A;  1GNW A;  2NVL A;  4X1U A;  3TB2 A;  3KMN A;  1J0F A;  1XVW A;  1SJI A;  4ECB A;  3A5I A;  20GS A;  3LXT A;  2R0C A;  1Z6N A;  4MPF A;  4KSM A;  1GP1 A;  2GS3 A;  4FQU A;  5CAX A;  1ERW A;  3DVW A;  3GRX A;  4O5R A;  2H76 A;  2XPE A;  6GSS A;  1FW1 A;  1SL2 B;  5IMD A;  2X8G A;  2CAQ A;  1A0F A;  3TOU A;  3AY8 A;  3GUR A;  2L5L A;  2B7J A;  3KCM A;  3PIN A;  4HI7 A;  3DWV A;  4AJ8 A;  5JCW A;  3CTF A;  3DVX A;  4GCI A;  4IJI A;  4DEJ A;  2MBT A;  3MWH A;  4N10 A;  5KN1 A;  4TXV A;  4TR3 A;  5HFI A;  4GQF A;  1MDK A;  1FOV A;  3ZL5 A;  4OCF A;  1V57 A;  5IQY A;  1EZK A;  2HRF A;  2PWJ A;  2GST A;  5IOX A;  2E7P A;  4K7O A;  1AW9 A;  3ED3 A;  4AGS A;  1ZYE A;  2E0Q A;  4KDU A;  4PQI A;  4TRX A;  5D9T A;  1FHE A;  3E9J B;  3D4M A;  3C1R A;  3HHV A;  1FVJ A;  5IMF A;  3O76 A;  2MMA A;  2TRX A;  3TJG A;  2HSH A;  1O85 A;  3C8E A;  5ID2 A;  3QAG A;  1X9M B;  4JU5 A;  2X8H A;  3FR3 A;  2JU5 A;  1M9B A;  4MJE A;  1U3A A;  2XBI A;  4V1A g;  2NPB A;  4ML1 A;  4O5U A;  3IAS 2;  3BOA A;  1V58 A;  2IWT A;  2N5B A;  1QMV A;  2LJA A;  4PUF C;  1PN0 A;  3LYP A;  2R4V A;  4YQU A;  2VM2 A;  1V40 A;  2HT9 A;  3LJR A;  2E2M A;  3ZIT A;  3H1N A;  3GKX A;  2VO4 A;  4DSR A;  1RK4 A;  3KJY A;  1WE0 A;  3FZ9 A;  1USB A;  3DXB A;  3ERW A;  4JR6 A;  4F9Z A;  4NAX A;  4MJB A;  5LD0 A;  3QPM A;  3TJK A;  4V2L A;  2GT5 A;  4JR4 A;  3I6A A;  3CXG A;  4TR0 A;  2I9H A;  2IME A;  3LEF A;  4HU9 A;  3ZMK A;  4ACS A;  5GAN D;  4P3Y B;  2OE0 A;  1TU8 A;  2C80 A;  3KP8 A;  3ZVJ D;  3VPT A;  1M2B A;  3UBK A;  1ACV A;  2CA8 A;  4G19 A;  5ECH B;  3N5O A;  3F3Q A;  3H93 A;  1B48 A;  3IHQ A;  1Y25 A;  4IW9 A;  3W8S A;  1CQG A;  1Y6E A;  4IEL A;  4HZ2 A;  4HUA A;  4OFN A;  5B6M A;  3FZA A;  3LQ7 A;  3F3R A;  4EC0 A;  2V6O A;  3DYR A;  1K0D A;  4TR4 A;  1VF1 A;  2ON5 A;  1VF3 A;  2QC7 A;  1XWA A;  1YEP A;  1S3A A;  2GTU A;  4EKZ A;  4BWQ A;  4A5P A;  3W6G A;  1AQW A;  2VUP A;  2IFQ B;  1GWC A;  5ELA A;  4IVF A;  2FWG A;  2GQL A;  1T4Y A;  2MYG A;  1WJK A;  3RHB A;  2YNX A;  1KBN A;  1GLQ A;  1JZR A;  2DJJ A;  3ZRD A;  1X0R A;  3SWL A;  5DAL B;  1XXU A;  4Q5N A;  4V1A p;  5ECO B;  5ECI B;  4GTU A;  1YQ1 A;  4MNN A;  2PUK C;  4F82 A;  3I43 A;  4BA7 A;  2JSY A;  3WGD A;  1YDK A;  4MPG A;  3US3 A;  4PQH A;  3GSS A;  4ML6 A;  2YAN A;  2VL3 A;  1DSB A;  3O3T A;  4XTS A;  2ZCT A;  5G31 A;  1QXH A;  3MSZ A;  2V2G A;  3QR6 A;  5JWQ B;  5G5E A;  5CRD A;  3KZQ A;  5INY A;  2AJQ B;  4USS A;  2J9H A;  1ABA A;  1YKC A;  3ZML A;  1J08 A;  1EEM A;  1AIU A;  2FHE A;  1EP7 A;  3KH7 A;  1TK0 B;  2LQO A;  1TI3 A;  3A3T A;  2TIR A;  1H4O A;  2RM6 A;  2C4J A;  4MF5 A;  2DIY A;  2GSR A;  1T4Z A;  1BX9 A;  3ISO A;  5COH A;  4ZIJ A;  1SKR B;  1O8W A;  2O8V B;  4FO5 A;  5DAK B;  3TJB A;  4ZL9 A;  3KMO A;  1SK2 A;  5AGY A;  2YJ7 A;  2B1K A;  5JWR B;  1Z7R A;  14GS A;  3A2X A;  3LFL A;  3LGC A;  3UIW A;  4GST A;  2AHE A;  3TRP A;  3ZLP A;  1ERT A;  5H5Q A;  1GUK A;  4KF9 A;  3E3E A;  2IMF A;  5J41 A;  4NWY A;  3TKS C;  3PH9 A;  2PVO C;  2C8U A;  1GSY A;  1R26 A;  2RM5 A;  4F2I A;  2YZU A;  1JZO A;  4WKW A;  1R4W A;  3TOT A;  1T8E B;  1JLW A;  3UVH A;  4ULX A;  2HZE B;  2G2Q A;  3PR8 A;  3BBY A;  5G1L A;  2LJK A;  5ECK B;  2A4H A;  5GST A;  4I97 A;  4KCA A;  18GS A;  1FAA A;  2WDU A;  3TKP A;  5EPF A;  3LXZ A;  3APS A;  4XIH A;  2MMZ A;  4ICY A;  1SYX A;  3D6I A;  4NV2 A;  1OE8 A;  11GS A;  3I69 A;  4PNG A;  5EVO A;  3DGQ A;  4G0L A;  2XBQ A;  4TVE A;  2HYX A;  3KM6 A;  1ZCP A;  3UAP A;  3CSJ A;  1AQV A;  3EC3 A;  2MBS A;  3M9J A;  1WRY A;  1S3D A;  1WIK A;  1KEB A;  2JSZ A;  2H1A A;  2DJ0 A;  2LJR A;  2OJL A;  5IO0 A;  4F0B A;  5KOX A;  5FWG A;  4MAB A;  3QMX A;  1K0A A;  3HA9 A;  5G1K A;  3FR9 A;  3L4N A;  3C1S A;  2FCH A;  4N11 A;  3IXR A;  1THX A;  1YZX A;  1EOG A;  2C3T A;  4H86 A;  6GSW A;  1DE1 A;  5G30 A;  5HFG A;  2M80 A;  1K0M A;  2H01 A;  4ISD A;  4BVX B;  1K3O A;  1FB0 A;  2HXK A;  4G0I A;  5LCZ A;  4WR4 A;  2H72 A;  2LNT A;  3J7Y k;  2H73 A;  2F9S A;  3N9J A;  3EWL A;  3HJO A;  3D21 A;  4YQM A;  1SL0 B;  2H74 A;  2YJH A;  4LMV A;  1K3L A;  2EIQ A;  3H79 A;  1B9X C;  2GT6 A;  4WBR D;  4MF7 A;  1IYI A;  4XS1 A;  3F8U A;  4G2E A;  4NMU A;  3BCI A;  5ECM B;  4DVC A;  2M46 A;  3CMI A;  1EOH A;  3TKS E;  3VWW A;  5G5F A;  1M2A A;  3FKF A;  3HY2 A;  1A8Y A;  3KIJ A;  5F0G A;  2H8L A;  2QGV A;  3QD9 A;  1GTA A;  1QUW A;  2H0H A;  2DC5 A;  1AXD A;  1MD3 A;  2HRA A;  4HEA 2;  2NDO A;  1BQ7 A;  3U6V A;  3D5J A;  2OBI A;  1GSQ A;  1QGV A;  5IO2 A;  5D96 A;  1SU9 A;  2GQK A;  4RQX A;  5EL8 A;  1M9A A;  4MCU A;  4D73 B;  1Q4J A;  3GTU B;  3GKM A;  2WCI A;  3M1G A;  5E59 A;  1T7P B;  3BD2 A;  2TRC P;  1WPI A;  3GMF A;  2O89 A;  5FT3 A;  3CBU A;  5IMC A;  1SKW B;  4TR1 A;  2F3M A;  5HR3 A;  1O8X A;  1SD9 A;  1PD2 1;  2EIO A;  3IC4 A;  3QOU A;  5LNK e;  2WS2 A;  3TJJ A;  4F0C A;  4XRD A;  1I9D A;  1GTI A;  3F0I A;  3RAZ A;  3VFI A;  3C71 A;  2V32 A;  2CVK A;  4KB3 A;  4MK3 A;  2RLI A;  3APO A;  3L9V A;  1A23 A;  3RPP A;  2OE3 A;  5CRE A;  2FLS A;  2GLR A;  2H19 A;  3FY7 A;  4YQV A;  6GST A;  4MA9 A;  3P2A A;  2H0I A;  3HYP A;  3CRU A;  6GSY A;  1ILO A;  3L78 A;  1EWX A;  3RDW A;  4PXO A;  4LA1 A;  3EIN A;  4TXO B;  5A4V A;  1HQO A;  2GZZ A;  2CV4 A;  4ZBA A;  1WP0 A;  3W8J A;  3RPN A;  2B6M A;  5HR0 A;  1W4V A;  5CO3 A;  4WF4 A;  4K5S A;  4NHZ A;  1O7U A;  3GX0 A;  3HZ8 A;  1OC9 B;  1EGO A;  3VWV A;  2PMT A;  4QL9 A;  1K0O A;  3TKS A;  1GSF A;  4L0U A;  2A2S A;  4O7H A;  1O81 A;  1X5C A;  1FO5 A;  4KW6 A;  2JZR A;  4WEY A;  4K2D A;  1X9S B;  1LU4 A;  4BVY A;  1B9Y C;  4Q5Q A;  2FWH A;  1JLV A;  1XCC A;  5CRW A;  1M99 A;  3LYK A;  1NW2 A;  4EE0 A;  3IK7 A;  3HD5 A;  4GWR A;  2DKH A;  1N8J A;  3APQ A;  2DJK A;  5ENU A;  1ZZY A;  2RII A;  4EDZ A;  4DSQ A;  2BJX A;  1OKT A;  4NXI A;  3LW9 A;  3RHC A;  2AAW A;  2E2G A;  1DBY A;  5ABR A;  4K7N A;  3DML A;  5CNW A;  1SKS B;  2VCW A;  3Q19 A;  6GSU A;  1ZYN A;  2K8S A;  3FEU A;  5IOW A;  4IJ3 A;  1UC7 A;  3WT1 A;  1EP8 A;  4YAP A;  1YF0 A;  13GS A;  2P5R A;  2C3Q A;  3Q18 A;  1X5E A;  4ILF A;  1U3I A;  3P8W A;  5HQP A;  2HLS A;  1BG5 A;  3EPT A;  4BPY A;  2ZNM A;  2ES7 A;  1PL1 A;  2FD3 A;  2YV9 A;  4WF5 A;  3GH9 A;  3GYK A;  1YY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...