1GL8A

Solution structure of thioredoxin m from spinach, oxidized form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
VQDVNDSSWKEFVLESEVPVMVDFWAPWCGPCKLIAPVIDELAKEYSGKIAVYKLNTDEAPGIATQYNIRSIPTVLFFKNGERKESIIGAVPKSTLTDSIEKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-Dimensional Solution Structure and Stability of Thioredoxin M from Spinach.
pubmed doi rcsb
molecule keywords THIOREDOXIN
molecule tags Oxidoreductase
source organism Spinacia oleracea
total genus 26
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2001-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1gl8A00
2MYGA 1TW9A 3UEMA 2L4CA 1GULA 2JU5A 1GSFA 2E0QA 2VL2A 2WCIA 4TR3A 1LBKA 3HY2A 1XWBA 3RPPA 1TK8B 4ZBAA 2V32A 5F06A 2H30A 3GKKA 2LEGA 1SL0B 2CX3A 2LJAA 2H0GA 3U5RE 2H6YA 3WYWA 14GSA 3GH6A 3TJBA 3L0HA 1AQXA 2ON7A 1PX6A 3RDWA 2K9FA 5D9XA 4IHUA 4PNFA 1QK8A 2HE3A 2H8LA 1GTBA 1O73A 2HFDA 1JFUA 4HJMA 2DBCA 4XRAA 3RPNA 5D8IA 4ZB8A 2O85A 3VI7A 1ACVA 3ZREA 2YJ7A 3NIVA 2VL2C 3DIEA 2GZZA 2YV9A 2CX4A 1Q4JA 1YF1A 4WR5A 3UOMA 1AUCA 2FA8A 2B7KA 4ZBDA 4PGTA 3Q18A 4FH8A 3E0UA 2YZUA 4ZXGA 3TGZA 4LL1B 5IMVA 2PGTA 4L8EA 1UA5A 5ECKB 1GSQA 3QFAC 4EKZA 3TKQA 5DALA 1F9MA 2FWHA 2VCQA 3GA4A 4JEDA 3Q74A 1TI1A 4TR1B 1U3IA 5DQSA 3CSHA 1XCCA 4OD7A 3H93A 3GKMA 3VPQA 4YAPA 2FWEA 5L71A 3FW2A 4GF0A 3ZZXA 5A4UA 3CSJA 2L5OA 3FZ9A 2I3YA 5GZZB 3FZAA 2I81A 4HOJA 1Z3EA 2FLSA 3NZNA 1OVNA 3RBTA 1MTCA 1BAYA 3A5WA 3WT1A 1K0BA 3VLNA 4MF7A 5IMAA 3I69A 1J9BA 1V9WA 2ALBA 2YP6A 3CMIA 4K7NA 3HHVA 3QPMA 5DBQA 2XPEA 1K0OA 2MMOA 2DIZA 3MNGA 4N0ZA 2JZRA 2RLIA 3F4TA 3F63A 4LLRA 2GVPA 5ELAA 3ZYWA 3RHBA 3VK9A 5IOWA 1AXDA 2LSTA 4NMUA 2O8VB 4Q5NA 3SWLA 1OYJA 2X8GA 3UJ1A 3HVSA 1I5GA 4TN8A 1IYIA 4MZCA 4OO4A 1JZWA 3CRUA 2GLRA 1BG5A 4GSTA 3GH9A 1PN9A 1GP1A 3ZIVA 2VAFA 2DMMA 5ECNB 3ZL5A 2R3XA 2K8SA 4Q5RA 4YH2A 2V6KA 2CVKA 3CYNA 3UAPA 4TRXA 4WEYA 1N2AA 5IMCA 4JE1A 5H5RA 5CO3A 2FA4A 4RUVA 3U6VA 1PKWA 2WB9A 1URMA 1OC8A 2LUSA 2H75A 3ZFLA 5CRHA 2MMAA 3QCPA 2LRCA 2XBIA 3FEUA 3IK9A 5D9VA 5DAKB 4HJ2A 1SD8A 3FY7A 3G7IA 4L0WA 5CNWA 2FGXA 1MEKA 4L0UA 1HNCA 3UBLA 5FHIA 3GYKA 4BVYA 1F37A 4I97A 1R5AA 5AIXA 1TRWA 5J5NA 4XCSA 1SJ6A 3L9SA 2YN1A 3D5JA 2GSQA 1HQOA 4J2FA 3LORA 4V2LA 1BEDA 3F0IA 3BCKA 4F03A 5ID2A 1GLQA 3F6DA 6GSUA 1K0MA 1M9AA 1KTEA 1GH2A 1SKRB 2JSYA 4HI7A 4NV2A 5H5QA 5F05A 4ZBBA 3DMLA 2R37A 3D21A 1HNAA 4MH2A 4ID0A 3KGKA 3QFBC 5LNKe 2D2ZA 1KBNA 3IE3A 2B1LA 2H70A 4KDYA 2WFCA 4ULXA 4OWYA 3VPTA 1DE1A 3G7JA 5G31A 1T4YA 4F0CA 1GSEA 5G30A 2CVDA 5B8BA 1T8EB 3EYTA 2VUPA 4IJ3A 4FIWA 1SKWB 4DSSB 3TKSA 4IW9A 3D22A 2F8AA 2OADA 4L5OA 3IXRA 2IMFA 4JRRA 3GNJA 2AYTA 1TRVA 2OA7A 5GSSA 2VD1A 2HI7A 3C8EA 5ECOB 1GNWA 3TCOA 4YQMA 3W8JA 3CTGA 3HVVA 3D4TA 3GRXA 5IM9A 4V2NA 4MK3A 2GZYA 1O6JA 1OC9B 1ZOFA 3ME8A 2H74A 2CT6A 2L6DA 2H1AA 5ECSA 2DC5A 4MDCA 1GTUA 2J23A 4FYCA 4MCUA 2HZFA 4KUNA 4HZ4A 2P0GA 2WZ9A 4V1Ag 4TXOA 3IOSA 1G6WA 4JR6A 4HDEA 4PQIA 1OAZA 3LGCA 1T00A 4IKHA 3FR9A 4NAXA 3GSSA 1H4OA 3VWVA 5J3RA 2C3NA 1PA3A 2H71A 2IFQB 1PGTA 4BL7A 5HFGA 1JLVA 2QSIA 2RM6A 2BJXA 1VRSD 1LJRA 3C1RA 3P8WA 1GUMA 4RI6A 2GTUA 3TKSC 2JACA 1GSSA 5JCWA 2PMTA 2Z9SA 3M9JA 6GSWA 5ECRB 2PU9C 3HDCA 17GSA 2KUCA 4D73A 1XW6A 1BQ7A 3TOTA 3BJ5A 2QKEA 4RI7A 5IQYA 1ERWA 4J56E 3IC4A 1NSWA 2OJLA 3LJRA 1QUWA 4KSOA 1A2MA 1TK5B 3EU4A 4MZBA 1SKSB 2HRFA 5J9BA 3F4SA 3TDGA 1QQ2A 2R2JA 3J7Yk 3TJJA 3ERFA 5LD0A 3DD3A 1SYRA 2HXKA 1A8YA 1FG4A 3HKRA 5ABRA 4OFNA 5HR3A 4BVXA 1A8LA 2C4JA 2DJ0A 2FY6A 3PGTA 1UVZA 2E2MA 1EGRA 5JCGA 5G5FA 5GAND 2FUG2 1S3AA 2DJJA 1DUGA 1XZOA 1EV9A 1GLPA 2HRNA 4WXTA 4PXOA 5D96A 5IMDA 2GQKA 1OE8A 4ZB6A 2LRTA 4H86A 2BMXA 1XWAA 2H19A 5KN1A 1GUHA 2P5RA 4F0BA 4OFMA 2GS3A 2K18A 4ZL7A 3QR6A 5GSTA 4HU9A 1TTZA 1SENA 2IIYA 2ZNMA 2NPBA 4ECJA 1W4VA 5IPGA 4QQ7A 2R6KA 3QMXA 3N9JA 5F8BA 3IAS2 3VWXA 2L4QA 1KEBA 3TJFA 5D9WA 3A3TA 4KDXA 3EINA 3GX0A 3ME7A 3BBYA 3ZRDA 3GN3A 4E8EA 2XPDA 3VURA 2I9HA 1RW1A 2DSAA 2MBSA 1CQGA 2GT6A 3EU3A 1JZOA 2RUFA 2MMNA 1HD2A 1NHYA 1ZYEA 4TVEA 5KN2A 1SL2B 4GCIA 4EDZA 3H4KA 4YQVA 4LL4B 1SJIA 2AUVA 1TU8A 1QFNA 2MMZA 1QGVA 4LMWA 3IK7A 3KH9A 2NDOA 1ZL9A 4K7OA 4KAEA 2CAQA 1TU7A 1XWGA 2DJ3A 1M0UA 1M9BA 5INYA 4FYBA 4KH7A 4BWQA 4MF5A 2FHEA 3ERGA 4G19A 3F6FA 5GAPD 1U6TA 5ECMB 3GL3A 1SL1B 4ZL8A 4ML6A 3FKFA 3I6AA 4HZ2A 4P3YB 3F8UA 1A0RP 3FR3A 3E9JB 2LJRA 1V2AA 2H1DA 2PPTA 2KLXA 5DDLA 2C1YA 1SD9A 2WJUA 1VF3A 3IV4A 1RQMA 1USBA 1PSQA 1MDKA 3IRAA 4YAVA 2NTOA 1R4WA 1EZKA 2AB6A 3GKXA 3IPZA 3CTFA 1U87A 1M7TA 3M8NA 4AJ6A 20GSA 2X8CA 4XS1A 1YEXA 3KTBA 1H75A 3G7YA 4HEA2 4N0VA 5HR0A 12GSA 4O5RA 4GTUA 4K6XA 3PINA 3IHQA 2JADA 2N5AA 3QOUA 3UBKA 4PX1A 1BYEA 1VF1A 2IPAA 2FCHA 4G9HA 2DJKA 3GFKA 1QMVA 4G2EA 2QC7A 4OO5A 3HJPA 4HU7A 2VCXA 1N8JA 5DJLA 1YZXA 4KB3A 1DE2A 3UL3A 3I43A 1K0NA 2OE1A 2GQMA 2DJ1A 5AGYA 16GSA 5D73A 4LMVA 3A2VA 3ZTLA 3H8QA 4KE3A 1WE0A 1AAZA 4F2IA 2H01A 1SJZA 4IQ1A 3EC3A 1V58A 2L59A 2EC4A 2C0DA 1XVWA 4RQRA 1T3BA 4I5QA 10GSA 1XVQA 5ECLB 13GSA 1ZMAA 2IMKA 5HR1A 2G0FA 4ML1A 1EEJA 3LYPA 2EIQA 3A2WA 2RM5A 3LQ7A 3I9V2 1OE7A 1EOGA 1X9SB 4O7HA 3R2QA 1KNGA 4HQSA 3H79A 4PQHA 1V98A 1PD21 1RK4A 3L78A 5EVOA 6GSVA 2YPMA 4OCFA 5B6MA 1A2LA 2CAIA 2H73A 3LXTA 5A5KA 4N11A 2H6XA 3UVHA 3C1SA 4AJ7A 3KP8A 3JCML 4KGIA 4TXOB 1GSDA 4EL1A 2ZCTA 4TR1A 4DSRA 4JU5A 1AQVA 2C0GA 2VLUA 5DQYA 1UN2A 1EGOA 4AJ8A 1E2YA 3CBUA 2LNSA 4XS4B 2H76A 2L57A 1B4PA 2YJHA 3HA9A 2YWMA 3HJOA 1Z9HA 1PQNA 4K2DA 4K8MA 3V1WA 2LQQA 1S3DA 2DIYA 2HYXA 2YWOA 1AW9A 2IMDA 5EL8A 1BJXA 4JZQA 3BD2A 3F4RA 2O7KA 1DSBA 2M46A 4OCEA 2EIOA 1ZYQB 4HS1A 2KOKA 3KMOA 3ZVJA 2CVBA 5KN3A 4HQZA 11GSA 2IJYA 1S3CA 3WGXA 3UVTA 3D4MA 5ECPB 3HCZA 1I9DA 2V6OA 5AN1A 3FR6A 3LXZA 1SK2A 3GHAA 1G7OA 3KH7A 2LTKA 5DJMA 5IPHA 2DJ2A 1FAAA 4WF5A 3GTUB 2CA8A 2VL9A 2XHFA 3P7XA 4E8HA 1K3LA 4KDUA 3DWVA 3KD0A 1O85A 1PRXA 5F0GA 2IN3A 4K1FA 4IBPA 2RIIA 2P31A 2KHPA 4MF6A 2MZCA 2HLSA 1Z6MA 2K6VA 2VD0A 4WETA 5D9TA 2OKAA 1MD3A 1U3AA 3IAM2 3CSIA 2VCTA 2GT5A 1WP0A 1T7PB 1TRUA 3APQA 3MSZA 3HZ8A 1XWKA 2H1GA 4TR4A 3IDVA 1FOVA 1ML6A 2GSSA 3ZFBA 1O7UA 1UC7A 4EDYA 3GURA 4KCAA 4MPFA 2C3QA 3TKSE 2VLVA 5IO2A 5DAKA 2B5YA 2C0EA 3H1NA 4KCEA 1X5EA 4POKA 2GQLA 5JWOB 4ZILA 1YEPA 5KN0A 2X99A 1XW5A 2M72A 1V57A 1EWXA 2OE0A 2CQ9A 4IVFA 3P2AA 3CXGA 1M2DA 1TJDA 4XHMA 4POMA 1EP8A 4ACSA 3C73A 1J0FA 3KEBA 4KX4A 3M1GA 2C80A 4ILFA 2HZEA 3GKNA 1TI3A 6GSXA 2KP2A 2YV7A 1YKCA 1EOHA 3M0FA 5AISA 2F9SA 3MDKA 1ST9A 6GSSA 5CAXA 3IR4A 2YCDA 4ECCA 2FWGA 3LG6A 1XIYA 2GGTA 2YWNA 3N5OA 2HNLA 4MMMA 1PMTA 1A23A 2FWFA 5JWQB 1K0AA 1XPVA 4IGJA 5DALB 5D93A 4GRFA 3M3MA 1X5CA 3D6IA 3Q6OA 4PURA 5DVBA 2V41A 5HQPA 4DSSA 5HR2A 2G2QA 4GXZA 3ZMKA 4O32A 5FWGA 2I1UA 3BOAA 3APOA 1B9XC 2BTOT 4GQFA 5A4WA 2LNTA 3FYGA 4QL9A 1WIKA 1JLWA 1OC9A 1YJ6A 1VGLA 2IMEA 4PUAA 3VWUA 1A2JA 1PX7A 3O3TA 4OFTA 1O8XA 3US3A 2WRTA 1J08A 1ERTA 2X64A 2TIRA 3F9UA 5CRDA 5E4WA 5G1LA 3K8NA 2FNOA 2LRNA 5COHA 2B7JA 2YWIA 4GSNA 3MAKA 1MDIA 4JR4A 3DYRA 2WS2A 3TUEA 4LA1A 2X8HA 2IFQA 1WJKA 3AY8A 3ZMLA 1XWCA 4CDOA 1ERUA 2VO4A 1TXXA 3BCIA 5H5SA 2DMLA 2F8FA 4WBRD 2RUEA 3KM6A 3NOFA 3APSA 4YQUA 3HD5A 4XRDA 4IP1A 4WKWA 4F9ZA 2YNXA 3EVIA 4AF2A 2L6CA 1M99A 2L5LA 3UARA 1XBSA 4IS0A 1ZGNA 2JL4A 2CZ2A 4IELA 5CP1A 1Z6NA 2H1BA 3UIWA 1WMJA 2IMIA 4G10A 3GMFA 3TOUA 1GSYA 5G5EA 2YZHA 2VCVA 4EC0A 3QD9A 3HYPA 2AHEA 3F3QA 3FK8A 5AIVA 3RAZA 3O76A 3EE2A 4PUFC 1AIUA 1HNBA 1CQHA 22GSA 5G1KA 1A0FA 1M2BA 1MD4A 1TDIA 2TRXA 3C7MA 2LJKA 2VM1A 1X9WB 4L5LA 4NHZA 1THOA 1A24A 5CREA 3DXBA 18GSA 2OACA 4NHWA 4K0GA 3CRTA 4MJEA 4GQCA 2PVQA 5LCZA 4MJBA 2GDRA 2PERA 1F2EA 1OKDA 1F6MC 4XTSA 2E2GA 1SK0A 1X0RA 2GZPA 3GUSA 1R7HA 3IBHA 2ON5A 4MJAA 1VF2A 1B48A 3TB2A 1O81A 2C3TA 2EIRA 4KSMA 3FZ5A 2C8UA 5ID2B 4IN0A 4X43A 1X9MB 1ILOA 1WWJA 4POBA 4FO5A 4EUYA 3RHCA 4K0NA 2YANA 4ZB9A 4AGSA 2GSRA 1R5PA 2CZ3A 2O87A 4EE0A 4EVMA 2OBKA 3L4NA 2XBQA 2N5BA 1U88A 5FT3A 4IJIA 3GIXA 5G2ZA 4MZWA 4BPYA 2O89A 5IMFA 5IMZA 3PH9A 5E59A 2H72A 3E3EA 3ZIJA 4XS6A 1HYUA 1K0DA 4Q5QA 4MA9A 1LU4A 3LEFA 1OC3A 4MJCA 2VM2A 1K0CA 4CHSA 3G9BA 2REMA 5ECHB 4K7IA 9GSSA 2B5XA 3UMAA 1FW1A 2ES7A 3M9KA 1GSUA 3W8SA 1W89A 4I6XA 3EWLA 1Y25A 1WOUA 5B7CA 2AJQB 1ERVA 1NM3A 3MWHA 3LSZA 5EPFA 1WPIA 1E6BA 1GWCA 4GSSA 1K3OA 5EY6A 4MP4A 2P5QA 4DEJA 3TJKA 4ZL9A 3KZQA 2DLXA 3DVXA 4TW5A 5IIZA 3HVXA 4TOPA 5CYYA 1BX9A 2PBJA 1M2AA 5ELGA 4DVCA 1TP9A 4K9ZA 1GTIA 3TRQA 1G0TA 4NV5A 3IA1A 1YDKA 1B4QA 4MPGA 4NWYA 2B5EA 1JZRA 1DBYA 1GNEA 2WULA 3L9VA 3PR8A 2HT9A 1F3BA 3DGQA 4ZIJA 5DCHA 2H6ZA 3W6GA 1T4ZA 2K8VA 1NW2A 2AAWA 1Z7PA 4X0XA 2A2SA 2QGVA 2PN8A 1IYHA 3QDNA 3EMPA 3TJGA 8GSSA 5A4VA 4MH3A 1VF4A 4Z7XA 3VWWA 2JSZA 3D0ZA 3FZ4A 1R26A 1GL8A 3KCMA 2JZSA 2I4AA 4D73B 3WGEA 19GSA 3P90A 2AV4A 3DEXA 3DKSA 2B1KA 4PQ1A 3ED3A 1SK1A 1C72A 1GRXA 1WRYA 4F82A 2HZEB 2IL3A 1EV4A 1JZDA 1TRSA 3J7Yb 1FHEA 4BA7A 1PKZA 1ZZYA 2N5FA 4JBBA 1MDJA 2HSHA 1SU9A 4V2MA 1YF0A 3QAWA 2XC2A 5IOXA 2A2RA 2ZUPA 1FVJA 1QXHA 3FRCA 5ECIB 3HZ4A 3DVWA 3EURA 3A2XA 1ON4A 4EF0A 3VI5A 2VCWA 3KP9A 3HXSA 5CRGA 3F3RA 1FB0A 4KW6A 5ENUA 4Q5FA 1Y6EA 4WR4A 1GTAA 3ZLPA 4WF4A 2F3MA 5JWRB 1V40A 1XW9A 7GSSA 3TKPA 2TRCP 2A4VA 2V1MA 1EEMA 2JZTA 2PUKC 4EO3A 4POLA 2LKUA 2GSTA 4OMVA 5C04A 5B6NA 1XOBA 4BWSA 2PWJA 3GL5A 4DSQA 4ECIA 3C71A 2KP1A 4QL7A 4XIHA 1B8XA 1GUKA 1Z5YE 3DRNA 3FHKA 2H0IA 3KJYA 3LYKA 5B8AA 1XOAA 1NHOA 3ISOA 3ZVJD 5J41A 2VOCA 4FYUA 5KEJA 1O8WA 1EP7A 5ECQB 5CRWA 1Q98A 1FB6A 1XXUA 2LS5A 2VIMA 1FVKA 2WGRA 2HSYA 2WDUA 2B6MA 4MLYA 3SBCA 2MBTA 1AC1A 1FO5A 1THXA 1X5DA 3KIJA 2J9HA 4XS4A 4X1UA 5IO0A 3TRPA 2VCZA 1JHBA 4N30A 3ZITA 2VL3A 4V1Ap 3S9FA 4I2UA 2F51A 5DCGA 6GSYA 5F07A 3TRXA 4TXVA 5HFKA 3GV1A 1G6YA 4EXJA 1F3AA 1XFLA 2NBSA 4TKYA 1AQWA 3TKRA 4PNGA 2V2GA 4I2TA 4GLTA 2R5GA 3WD6A 3WGDA 3OR5A 1TK0B 4NXIA 1SYXA 3QAGA 1T1VA 2OBIA 3GSTA 5HFIA 1YY7A 4ECBA 2YOIA 4NPBA 3KMNA 4KNDA 1YKAA 2IWTA 1YQ1A 4IP6A 3LFLA 5J9CA 2H0HA 3KXOA 3LWAA 4MABA 5J4UA 3Q19A 2H66A 3L9UA 1K3YA 3HJMA 4I8BA 1Z7RA 6GSTA 3EMXA 2B3SA 2LQOA 1PL2A 4J57E 2LV3A 3GTUA 3QAVA 4IQAA 4ISDA 5C00A 3WT2A 1OKTA 1ABAA 1TOFA 3GX8A 4HUAA 4TR0A 3ERWA 4CW9A 2NVLA 3KTLA 4RQXA 2M80A 2E7PA 2FD3A 4WBJA 1B9YC 2OE3A 3VFIA 1TKDB 3O6TA 1PL1A 2CV4A 2R4VA 4KA0A 2C0FA 4N10A 1ZCPA 1G7EA 2VLTA 4O92A 4GWRA 5JCUA 2PVOC
chains in the Genus database with same CATH superfamily
2MYGA 1TW9A 3UEMA 2L4CA 1GULA 2JU5A 1GSFA 2E0QA 2VL2A 2WCIA 4TR3A 1LBKA 3HY2A 1XWBA 3RPPA 1TK8B 4ZBAA 2V32A 5F06A 4USSA 2H30A 3GKKA 2LEGA 1SL0B 2CX3A 2LJAA 2H0GA 3U5RE 2H6YA 3WYWA 14GSA 3GH6A 3TJBA 3L0HA 1AQXA 2ON7A 4PTSA 1PX6A 3RDWA 2K9FA 5D9XA 4IHUA 4PNFA 1QK8A 2HE3A 2H8LA 1GTBA 1O73A 2HFDA 1JFUA 4HJMA 2DBCA 4G0LA 4XRAA 3RPNA 5D8IA 4ZB8A 2O85A 3VI7A 1ACVA 3ZREA 2YJ7A 3NIVA 2VL2C 3DIEA 2GZZA 2YV9A 2CX4A 1Q4JA 1YF1A 4WR5A 3UOMA 1AUCA 2FA8A 2B7KA 4ZBDA 4PGTA 3Q18A 4FH8A 3E0UA 2YZUA 4EIPA 4ZXGA 3TGZA 4LL1B 5IMVA 2PGTA 4L8EA 1UA5A 5ECKB 1GSQA 3QFAC 4EKZA 3TKQA 5DALA 1F9MA 2FWHA 2VCQA 3GA4A 4JEDA 3Q74A 1TI1A 4TR1B 1U3IA 5DQSA 4K5RA 3CSHA 1XCCA 4OD7A 2X4AA 3H93A 3GKMA 3VPQA 4YAPA 2FWEA 5L71A 3FW2A 4GF0A 3ZZXA 5A4UA 3CSJA 2L5OA 2R0CA 3FZ9A 2I3YA 5GZZB 3FZAA 2I81A 4HOJA 1Z3EA 2FLSA 3NZNA 1OVNA 3RBTA 1MTCA 1BAYA 3A5WA 3WT1A 1K0BA 3VLNA 4MF7A 5IMAA 3I69A 4K5SA 1J9BA 1V9WA 2ALBA 2YP6A 3CMIA 4K7NA 3HHVA 3QPMA 5DBQA 2XPEA 1K0OA 2MMOA 2DIZA 3MNGA 1PN0A 4N0ZA 2JZRA 2RLIA 3F4TA 3F63A 4LLRA 2GVPA 5ELAA 3ZYWA 3RHBA 3VK9A 5IOWA 1AXDA 2LSTA 4K2XA 2O8VB 4NMUA 4Q5NA 3SWLA 1OYJA 2X8GA 3UJ1A 3HVSA 1I5GA 4TN8A 1IYIA 4MZCA 4OO4A 1JZWA 3CRUA 2GLRA 1BG5A 4GSTA 3GH9A 1PN9A 1GP1A 3ZIVA 2VAFA 2DMMA 5ECNB 3ZL5A 2R3XA 2K8SA 4Q5RA 4YH2A 2V6KA 2CVKA 3CYNA 3UAPA 4TRXA 4WEYA 1N2AA 5IMCA 4JE1A 5H5RA 5CO3A 2FA4A 4RUVA 3U6VA 1PKWA 2WB9A 1URMA 1OC8A 2LUSA 2H75A 3ZFLA 5CRHA 2MMAA 3QCPA 2LRCA 2XBIA 3FEUA 3IK9A 3R3EA 5D9VA 5DAKB 4HJ2A 1SD8A 3FY7A 3G7IA 4L0WA 5CNWA 2FGXA 1MEKA 4L0UA 1HNCA 3UBLA 5FHIA 3GYKA 4BVYA 1F37A 1FOHA 4I97A 1R5AA 5AIXA 1TRWA 5J5NA 4XCSA 1SJ6A 3L9SA 2YN1A 3D5JA 2GSQA 1HQOA 4J2FA 3LORA 4V2LA 1BEDA 3F0IA 3BCKA 1ZYNA 4F03A 5ID2A 4G0IA 1GLQA 3F6DA 6GSUA 1K0MA 1M9AA 1KTEA 1GH2A 1SKRB 2JSYA 4HI7A 4NV2A 4MNNA 5H5QA 5F05A 4ZBBA 3DMLA 2R37A 3D21A 1HNAA 4MH2A 4ID0A 3KGKA 3QFBC 5LNKe 2D2ZA 1KBNA 3IE3A 2X49A 2B1LA 2H70A 4KDYA 2WFCA 4ULXA 4OWYA 3VPTA 1DE1A 3G7JA 4EIQA 5G31A 1T4YA 4F0CA 1GSEA 5G30A 2CVDA 5B8BA 1T8EB 3EYTA 2VUPA 4IJ3A 4FIWA 1SKWB 4DSSB 3TKSA 4IW9A 3D22A 2F8AA 2OADA 4L5OA 3IXRA 2IMFA 4JRRA 3GNJA 2AYTA 1TRVA 2OA7A 5GSSA 2VD1A 2HI7A 3C8EA 5ECOB 1GNWA 3TCOA 4YQMA 3W8JA 3CTGA 3HVVA 3D4TA 3GRXA 5IM9A 4V2NA 4MK3A 2GZYA 1O6JA 1OC9B 1ZOFA 3ME8A 2H74A 2CT6A 2L6DA 2H1AA 5ECSA 2DC5A 4MDCA 1GTUA 2J23A 4FYCA 4MCUA 2HZFA 4KUNA 4HZ4A 2P0GA 2WZ9A 4V1Ag 4TXOA 3IOSA 1G6WA 4JR6A 4HDEA 4PQIA 1OAZA 3LGCA 1T00A 4IKHA 3FR9A 4NAXA 3GSSA 1H4OA 3VWVA 5J3RA 2C3NA 1PA3A 2H71A 2IFQB 1PGTA 4BL7A 5HFGA 1JLVA 2QSIA 2RM6A 2BJXA 1VRSD 1LJRA 3C1RA 3P8WA 1GUMA 4RI6A 2GTUA 3TKSC 2JACA 1GSSA 5JCWA 2PMTA 2Z9SA 3M9JA 6GSWA 5ECRB 2PU9C 3HDCA 17GSA 2KUCA 4D73A 1XW6A 1BQ7A 3TOTA 3BJ5A 2QKEA 4RI7A 5IQYA 1ERWA 4J56E 4Z2RA 3IC4A 1NSWA 2OJLA 3LJRA 1QUWA 4KSOA 1A2MA 1TK5B 3EU4A 4MZBA 1SKSB 2HRFA 5J9BA 3F4SA 3TDGA 1QQ2A 2R2JA 3J7Yk 3TJJA 3ERFA 5LD0A 3DD3A 4ICYA 1SYRA 2HXKA 1A8YA 1FG4A 3HKRA 5ABRA 4OFNA 5HR3A 4BVXA 1A8LA 2C4JA 2DJ0A 2FY6A 3PGTA 1UVZA 2E2MA 1EGRA 5JCGA 5G5FA 5GAND 2FUG2 1S3AA 2DJJA 1DUGA 1XZOA 1EV9A 1GLPA 2HRNA 4WXTA 4PXOA 5D96A 5IMDA 2GQKA 1OE8A 4CY6A 4ZB6A 2LRTA 4H86A 2BMXA 1XWAA 2H19A 5KN1A 1GUHA 2P5RA 4F0BA 4OFMA 2GS3A 2K18A 4ZL7A 3QR6A 5GSTA 4HU9A 1TTZA 4O5UA 1SENA 2IIYA 2ZNMA 2NPBA 4ECJA 1W4VA 5IPGA 4QQ7A 2R6KA 3QMXA 3CQFA 3N9JA 5F8BA 3IAS2 3VWXA 2L4QA 1KEBA 3TJFA 5D9WA 3A3TA 4KDXA 3EINA 5KOXA 3GX0A 3ME7A 3BBYA 3ZRDA 3GN3A 4E8EA 2XPDA 3VURA 2I9HA 1RW1A 2DSAA 2MBSA 1CQGA 2GT6A 3EU3A 1JZOA 2RUFA 2MMNA 1HD2A 1NHYA 1ZYEA 4TVEA 1XG8A 5KN2A 1SL2B 4GCIA 4EDZA 3H4KA 4YQVA 4LL4B 1SJIA 2AUVA 1TU8A 1QFNA 2MMZA 1QGVA 4LMWA 3IK7A 3KH9A 2NDOA 1ZL9A 4K7OA 4KAEA 2CAQA 1TU7A 1XWGA 2DJ3A 1M0UA 1M9BA 5INYA 4FYBA 4KH7A 4BWQA 2DKHA 4MF5A 2FHEA 3ERGA 4G19A 3F6FA 5GAPD 1U6TA 5ECMB 3GL3A 1SL1B 4ZL8A 4ML6A 3FKFA 1M3JA 3I6AA 4HZ2A 4P3YB 3F8UA 1A0RP 3FR3A 3E9JB 2LJRA 1V2AA 2H1DA 2PPTA 2KLXA 5DDLA 2C1YA 1SD9A 2WJUA 1VF3A 4X4JA 4G0KA 3IV4A 1RQMA 2R0GA 1USBA 1PSQA 1MDKA 3IRAA 4YAVA 2NTOA 3MYDA 1R4WA 1EZKA 2AB6A 3GKXA 3IPZA 3CTFA 1U87A 1M7TA 3M8NA 4AJ6A 20GSA 2X8CA 4XS1A 1YEXA 3KTBA 1H75A 3G7YA 4HEA2 4N0VA 5HR0A 12GSA 4O5RA 4GTUA 4K6XA 3PINA 3IHQA 2JADA 2N5AA 3QOUA 3UBKA 4PX1A 1BYEA 1VF1A 2IPAA 2FCHA 4G9HA 2DJKA 3GFKA 1QMVA 4G2EA 2QC7A 3HVNA 4OO5A 3HJPA 4HU7A 2VCXA 1N8JA 5DJLA 1YZXA 4KB3A 1DE2A 3UL3A 3I43A 1K0NA 2OE1A 2GQMA 2DJ1A 5AGYA 16GSA 5D73A 4LMVA 3A2VA 3ZTLA 4KF9A 3H8QA 4KE3A 1WE0A 1AAZA 4F2IA 2H01A 1SJZA 4IQ1A 3EC3A 1V58A 2L59A 2EC4A 2C0DA 1XVWA 4RQRA 1T3BA 4I5QA 10GSA 1XVQA 5ECLB 13GSA 1ZMAA 4YKGA 2IMKA 5HR1A 2G0FA 4ML1A 1EEJA 3LYPA 2EIQA 3A2WA 2RM5A 3LQ7A 3I9V2 1OE7A 1EOGA 1X9SB 4O7HA 3R2QA 1KNGA 4HQSA 3H79A 4PQHA 1V98A 4HSCX 1PD21 1RK4A 3L78A 5EVOA 6GSVA 2YPMA 4OCFA 5B6MA 1A2LA 2CAIA 2H73A 3LXTA 5A5KA 4N11A 2H6XA 3UVHA 3C1SA 4AJ7A 3KP8A 3JCML 2QA1A 4KGIA 4TXOB 1GSDA 4EL1A 2ZCTA 4TR1A 4DSRA 4JU5A 1AQVA 2C0GA 2VLUA 5DQYA 1UN2A 1EGOA 4AJ8A 1E2YA 2A2PA 3CBUA 2LNSA 4XS4B 2H76A 2L57A 1B4PA 2YJHA 3HA9A 2YWMA 3HJOA 1Z9HA 1PQNA 4K2DA 4K8MA 3V1WA 5KOWA 2LQQA 1S3DA 2DIYA 2HYXA 2YWOA 1AW9A 2IMDA 5EL8A 1BJXA 4JZQA 3BD2A 3F4RA 2O7KA 1DSBA 2M46A 4OCEA 2EIOA 1ZYQB 4HS1A 3FMWA 2KOKA 3KMOA 3ZVJA 2CVBA 5KN3A 4HQZA 11GSA 2IJYA 1S3CA 3WGXA 3UVTA 3D4MA 5ECPB 3HCZA 1I9DA 2V6OA 5AN1A 3FR6A 3LXZA 1SK2A 3GHAA 1G7OA 3KH7A 2LTKA 3EPTA 5DJMA 5IPHA 2DJ2A 1FAAA 4WF5A 3GTUB 2CA8A 2VL9A 2XHFA 3P7XA 4E8HA 1K3LA 4KDUA 3DWVA 3KD0A 1O85A 1PRXA 5F0GA 2IN3A 2HRKA 4K1FA 4IBPA 2RIIA 2P31A 2KHPA 4MF6A 2MZCA 2HLSA 1Z6MA 2K6VA 2VD0A 4WETA 3PPUA 5D9TA 2OKAA 1MD3A 1U3AA 3IAM2 3CSIA 2VCTA 2GT5A 1WP0A 1T7PB 1TRUA 3APQA 3MSZA 3HZ8A 1XWKA 2H1GA 4TR4A 3IDVA 1FOVA 1ML6A 2GSSA 3ZFBA 1O7UA 1UC7A 4EDYA 3GURA 5BRTA 4KCAA 4MPFA 2C3QA 3TKSE 2VLVA 5IO2A 5DAKA 2B5YA 3A5IA 2C0EA 3H1NA 3IC8A 4CY8A 4KCEA 1X5EA 4POKA 2GQLA 5JWOB 4ZILA 1YEPA 5KN0A 2X99A 1XW5A 2M72A 1V57A 1EWXA 2OE0A 2CQ9A 4IVFA 3P2AA 3CXGA 1M2DA 1TJDA 4XHMA 4POMA 1EP8A 4ACSA 3C73A 1J0FA 3KEBA 4KX4A 3M1GA 2C80A 4ILFA 2HZEA 3GKNA 3MIXA 1TI3A 6GSXA 2KP2A 2YV7A 4A5PA 1YKCA 1EOHA 3M0FA 5AISA 2F9SA 3MDKA 1ST9A 6GSSA 5CAXA 3IR4A 2YCDA 3IHGA 4ECCA 2FWGA 3LG6A 1XIYA 2GGTA 2YWNA 3N5OA 2HNLA 4MMMA 1PMTA 3LW9A 4Z2UA 1A23A 2FWFA 5JWQB 1K0AA 1XPVA 4IGJA 5DALB 5D93A 4GRFA 3M3MA 1X5CA 3D6IA 3Q6OA 4PURA 5DVBA 2V41A 5HQPA 4DSSA 1PFOA 5HR2A 2G2QA 4GXZA 2DKIA 3ZMKA 4O32A 5FWGA 2I1UA 3BOAA 3APOA 4YKFA 1B9XC 2BTOT 4GQFA 5A4WA 2LNTA 3FYGA 4QL9A 1WIKA 1JLWA 1OC9A 1YJ6A 1VGLA 2IMEA 4PUAA 3VWUA 1A2JA 1PX7A 3O3TA 4OFTA 1O8XA 3US3A 2WRTA 1J08A 1ERTA 2X64A 2TIRA 3F9UA 5CRDA 5E4WA 5G1LA 3K8NA 2FNOA 2LRNA 5COHA 2B7JA 2YWIA 4GSNA 3MAKA 1MDIA 4JR4A 3DYRA 2WS2A 3TUEA 4LA1A 2X8HA 2IFQA 1WJKA 3AY8A 3ZMLA 1XWCA 4CDOA 1ERUA 2VO4A 1TXXA 3BCIA 5H5SA 2DMLA 2F8FA 4WBRD 5BMUA 2RUEA 3KM6A 3NOFA 3APSA 4YQUA 3HD5A 4XRDA 4IP1A 4WKWA 4F9ZA 2YNXA 3EVIA 4AF2A 2L6CA 1M99A 2L5LA 3UARA 1XBSA 4IS0A 1ZGNA 2JL4A 2CZ2A 4IELA 5CP1A 1Z6NA 2H1BA 3UIWA 1WMJA 2IMIA 4G10A 3GMFA 3TOUA 1GSYA 5G5EA 2YZHA 2VCVA 4EC0A 3QD9A 3HYPA 2AHEA 2QA2A 3F3QA 3FK8A 5AIVA 3RAZA 3O76A 3EE2A 4PUFC 1AIUA 1HNBA 1CQHA 22GSA 5G1KA 1A0FA 1M2BA 1MD4A 1TDIA 2TRXA 3C7MA 2LJKA 2VM1A 1X9WB 4L5LA 4NHZA 1THOA 1A24A 5CREA 3DXBA 18GSA 2OACA 4NHWA 4K0GA 3CRTA 4MJEA 4GQCA 2PVQA 5LCZA 4MJBA 2GDRA 2PERA 1F2EA 1M3IA 1OKDA 1F6MC 4XTSA 2E2GA 1SK0A 1X0RA 4BVYB 2GZPA 3GUSA 1R7HA 3IBHA 2ON5A 4MJAA 1VF2A 1B48A 3TB2A 1O81A 2C3TA 2EIRA 4KSMA 3FZ5A 2C8UA 5ID2B 4IN0A 4X43A 1X9MB 1ILOA 1WWJA 4POBA 2UZ8A 4FO5A 4EUYA 3RHCA 4K0NA 2YANA 4ZB9A 4AGSA 2GSRA 1R5PA 2CZ3A 2O87A 4EE0A 4EVMA 2OBKA 3L4NA 2XBQA 2N5BA 1U88A 5FT3A 4IJIA 3GIXA 5G2ZA 4MZWA 4BPYA 2O89A 5IMFA 5IMZA 3PH9A 5E59A 2H72A 3E3EA 3ZIJA 4XS6A 1HYUA 1K0DA 4Q5QA 4MA9A 1LU4A 1S3RA 3LEFA 1OC3A 4MJCA 2VM2A 1K0CA 4CHSA 3G9BA 2REMA 5ECHB 4K7IA 2A4HA 9GSSA 2B5XA 3UMAA 1FW1A 2ES7A 3M9KA 1GSUA 3W8SA 1W89A 4I6XA 3EWLA 1Y25A 1WOUA 5B7CA 2AJQB 1ERVA 1NM3A 3MWHA 3LSZA 5EPFA 1WPIA 1E6BA 1GWCA 2HSMA 4GSSA 2HRAA 1K3OA 5EY6A 4Z2TA 4MP4A 2P5QA 4DEJA 3TJKA 4ZL9A 3KZQA 2DLXA 3DVXA 4TW5A 5IIZA 3HVXA 4TOPA 5CYYA 1BX9A 2PBJA 1M2AA 5ELGA 4DVCA 1TP9A 4K9ZA 1GTIA 3TRQA 1G0TA 4NV5A 3IA1A 1YDKA 1B4QA 4MPGA 4NWYA 2B5EA 1JZRA 1DBYA 1GNEA 2WULA 3L9VA 3PR8A 2HT9A 1F3BA 3DGQA 4ZIJA 5DCHA 2H6ZA 3W6GA 1T4ZA 2K8VA 4BL7B 1NW2A 2AAWA 1Z7PA 4X0XA 2A2SA 2QGVA 2PN8A 1IYHA 3QDNA 4O5QA 3EMPA 3TJGA 8GSSA 5A4VA 4MH3A 1VF4A 4Z7XA 3VWWA 2JSZA 4BIKA 3D0ZA 3FZ4A 1R26A 1GL8A 3KCMA 2JZSA 2I4AA 4D73B 3WGEA 19GSA 3P90A 2AV4A 3DEXA 3DKSA 2B1KA 4PQ1A 3ED3A 1SK1A 1C72A 1GRXA 1WRYA 4F82A 2HZEB 2IL3A 1EV4A 1JZDA 1TRSA 3J7Yb 1FHEA 4BA7A 1PKZA 1ZZYA 2N5FA 4JBBA 1MDJA 2HSHA 1SU9A 4V2MA 1YF0A 3QAWA 2XC2A 5IOXA 2A2RA 2ZUPA 1FVJA 1QXHA 3FRCA 5ECIB 3HZ4A 3DVWA 3EURA 3A2XA 1ON4A 4EF0A 3VI5A 2VCWA 3KP9A 3HXSA 4BVXB 5CRGA 3F3RA 1FB0A 4KW6A 5ENUA 4Q5FA 1Y6EA 4WR4A 1GTAA 3ZLPA 4WF4A 2F3MA 5JWRB 1V40A 1XW9A 7GSSA 3TKPA 2TRCP 2A4VA 2V1MA 1EEMA 2JZTA 2PUKC 4EO3A 4POLA 2LKUA 2GSTA 4OMVA 5C04A 5B6NA 1XOBA 4BWSA 2PWJA 3GL5A 4DSQA 4ECIA 3C71A 2KP1A 4QL7A 4XIHA 1B8XA 1GUKA 1Z5YE 3DRNA 3FHKA 2H0IA 3KJYA 3LYKA 5B8AA 1XOAA 1NHOA 3ISOA 3ZVJD 5J41A 2VOCA 4FYUA 5KEJA 1O8WA 1EP7A 5ECQB 5CRWA 1Q98A 1FB6A 1XXUA 2LS5A 2VIMA 1FVKA 2R0PA 2WGRA 2HSYA 2WDUA 2B6MA 4MLYA 3SBCA 2MBTA 1AC1A 1FO5A 1THXA 1X5DA 3KIJA 2J9HA 4FQUA 4XS4A 4X1UA 5IO0A 3TRPA 2VCZA 1JHBA 4N30A 3ZITA 2VL3A 4V1Ap 3S9FA 4I2UA 2F51A 5DCGA 6GSYA 5F07A 3TRXA 4TXVA 5HFKA 3GV1A 1G6YA 4EXJA 1F3AA 1XFLA 1ZYPA 2NBSA 4TKYA 1AQWA 3TKRA 4PNGA 2V2GA 4I2TA 4GLTA 2R5GA 3WD6A 3WGDA 3OR5A 1TK0B 4NXIA 1SYXA 3QAGA 1T1VA 2OBIA 3GSTA 5HFIA 1YY7A 4ECBA 2YOIA 4NPBA 3KMNA 4KNDA 1YKAA 2IWTA 1YQ1A 4IP6A 3LFLA 5J9CA 2H0HA 3KXOA 3LWAA 4MABA 5J4UA 3Q19A 2H66A 3L9UA 1K3YA 3HJMA 4I8BA 1Z7RA 6GSTA 3EMXA 2B3SA 2LQOA 1PL2A 4J57E 2LV3A 3GTUA 3QAVA 4IQAA 4ISDA 5C00A 3WT2A 1OKTA 1ABAA 1TOFA 3GX8A 4HUAA 4TR0A 3ERWA 4CW9A 2NVLA 3KTLA 4RQXA 2M80A 2E7PA 2FD3A 4WBJA 1B9YC 2OE3A 3VFIA 1TKDB 3O6TA 1PL1A 2CV4A 2R4VA 4KA0A 2C0FA 4N10A 1ZCPA 1G7EA 2VLTA 4O92A 4GWRA 5JCUA 2PVOC
chains in the Genus database with same CATH topology
2MYGA 1TW9A 3UEMA 2L4CA 1GULA 2JU5A 1GSFA 2E0QA 2VL2A 2WCIA 4TR3A 1LBKA 3HY2A 1XWBA 3RPPA 1TK8B 4ZBAA 2V32A 5F06A 4USSA 2H30A 3GKKA 2LEGA 1SL0B 2CX3A 2LJAA 2H0GA 3U5RE 2H6YA 3WYWA 14GSA 3GH6A 3TJBA 3L0HA 1AQXA 2ON7A 4PTSA 1PX6A 3RDWA 2K9FA 5D9XA 4IHUA 4PNFA 1QK8A 2HE3A 2H8LA 1GTBA 1O73A 2HFDA 1JFUA 4HJMA 2DBCA 4G0LA 4XRAA 3RPNA 5D8IA 4ZB8A 2O85A 3VI7A 1ACVA 3ZREA 2YJ7A 3NIVA 2VL2C 3DIEA 2GZZA 2YV9A 2CX4A 1Q4JA 1YF1A 4WR5A 3UOMA 1AUCA 2FA8A 2B7KA 4ZBDA 4PGTA 3Q18A 4FH8A 3E0UA 2YZUA 4EIPA 4ZXGA 3TGZA 4LL1B 5IMVA 2PGTA 4L8EA 1UA5A 5ECKB 1GSQA 3QFAC 4EKZA 3TKQA 5DALA 1F9MA 2FWHA 2VCQA 3GA4A 4JEDA 3Q74A 1TI1A 4TR1B 1U3IA 5DQSA 4K5RA 3CSHA 1XCCA 4OD7A 2X4AA 3H93A 3GKMA 3VPQA 4YAPA 2FWEA 5L71A 3FW2A 4GF0A 3ZZXA 5A4UA 3CSJA 2L5OA 2R0CA 3FZ9A 2I3YA 5GZZB 3FZAA 2I81A 4HOJA 1Z3EA 2FLSA 3NZNA 1OVNA 3RBTA 1MTCA 1BAYA 3A5WA 3WT1A 1K0BA 3VLNA 4MF7A 5IMAA 3I69A 4K5SA 1J9BA 1V9WA 2ALBA 2YP6A 3CMIA 4K7NA 3HHVA 3QPMA 5DBQA 2XPEA 1K0OA 2MMOA 2DIZA 3MNGA 1PN0A 4N0ZA 2JZRA 2RLIA 3F4TA 3F63A 4LLRA 2GVPA 5ELAA 3ZYWA 3RHBA 3VK9A 5IOWA 1AXDA 2LSTA 4K2XA 2O8VB 4NMUA 4Q5NA 3SWLA 1OYJA 2X8GA 3UJ1A 3HVSA 1I5GA 4TN8A 1IYIA 4MZCA 4OO4A 1JZWA 3CRUA 2GLRA 1BG5A 4GSTA 3GH9A 1PN9A 1GP1A 3ZIVA 2VAFA 2DMMA 5ECNB 3ZL5A 2R3XA 2K8SA 4Q5RA 4YH2A 2V6KA 2CVKA 3CYNA 3UAPA 4TRXA 4WEYA 1N2AA 5IMCA 4JE1A 5H5RA 5CO3A 2FA4A 4RUVA 3U6VA 1PKWA 2WB9A 1URMA 1OC8A 2LUSA 2H75A 3ZFLA 5CRHA 2MMAA 3QCPA 2LRCA 2XBIA 3FEUA 3IK9A 3R3EA 5D9VA 5DAKB 4HJ2A 1SD8A 3FY7A 3G7IA 4L0WA 5CNWA 2FGXA 1MEKA 4L0UA 1HNCA 3UBLA 5FHIA 3GYKA 4BVYA 1F37A 1FOHA 4I97A 1R5AA 5AIXA 1TRWA 5J5NA 4XCSA 1SJ6A 3L9SA 2YN1A 3D5JA 2GSQA 1HQOA 4J2FA 3LORA 4V2LA 1BEDA 3F0IA 3BCKA 1ZYNA 4F03A 5ID2A 4G0IA 1GLQA 3F6DA 6GSUA 1K0MA 1M9AA 1KTEA 1GH2A 1SKRB 2JSYA 4HI7A 4NV2A 4MNNA 5H5QA 5F05A 4ZBBA 3DMLA 2R37A 3D21A 1HNAA 4MH2A 4ID0A 3KGKA 3QFBC 5LNKe 2D2ZA 1KBNA 3IE3A 2X49A 2B1LA 2H70A 4KDYA 2WFCA 4ULXA 4OWYA 3VPTA 1DE1A 3G7JA 4EIQA 5G31A 1T4YA 4F0CA 1GSEA 5G30A 2CVDA 5B8BA 1T8EB 3EYTA 2VUPA 4IJ3A 4FIWA 1SKWB 4DSSB 3TKSA 4IW9A 3D22A 2F8AA 2OADA 4L5OA 3IXRA 2IMFA 4JRRA 3GNJA 2AYTA 1TRVA 2OA7A 5GSSA 2VD1A 2HI7A 3C8EA 5ECOB 1GNWA 3TCOA 4YQMA 3W8JA 3CTGA 3HVVA 3D4TA 3GRXA 5IM9A 4V2NA 4MK3A 2GZYA 1O6JA 1OC9B 1ZOFA 3ME8A 2H74A 2CT6A 2L6DA 2H1AA 5ECSA 2DC5A 4MDCA 1GTUA 2J23A 4FYCA 4MCUA 2HZFA 4KUNA 4HZ4A 2P0GA 2WZ9A 4V1Ag 4TXOA 3IOSA 1G6WA 4JR6A 4HDEA 4PQIA 1OAZA 3LGCA 1T00A 4IKHA 3FR9A 4NAXA 3GSSA 1H4OA 3VWVA 5J3RA 2C3NA 1PA3A 2H71A 2IFQB 1PGTA 4BL7A 5HFGA 1JLVA 2QSIA 2RM6A 2BJXA 1VRSD 1LJRA 3C1RA 3P8WA 1GUMA 4RI6A 2GTUA 3TKSC 2JACA 1GSSA 5JCWA 2PMTA 2Z9SA 3M9JA 6GSWA 5ECRB 2PU9C 3HDCA 17GSA 2KUCA 4D73A 1XW6A 1BQ7A 3TOTA 3BJ5A 2QKEA 4RI7A 5IQYA 1ERWA 4J56E 4Z2RA 3IC4A 1NSWA 2OJLA 3LJRA 1QUWA 4KSOA 1A2MA 1TK5B 3EU4A 4MZBA 1SKSB 2HRFA 5J9BA 3F4SA 3TDGA 1QQ2A 2R2JA 3J7Yk 3TJJA 3ERFA 5LD0A 3DD3A 4ICYA 1SYRA 2HXKA 1A8YA 1FG4A 3HKRA 5ABRA 4OFNA 5HR3A 4BVXA 1A8LA 2C4JA 2DJ0A 2FY6A 3PGTA 1UVZA 2E2MA 1EGRA 5JCGA 5G5FA 5GAND 2FUG2 1S3AA 2DJJA 1DUGA 1XZOA 1EV9A 1GLPA 2HRNA 4WXTA 4PXOA 5D96A 5IMDA 2GQKA 1OE8A 4CY6A 4ZB6A 2LRTA 4H86A 2BMXA 1XWAA 2H19A 5KN1A 1GUHA 2P5RA 4F0BA 4OFMA 2GS3A 2K18A 4ZL7A 3QR6A 5GSTA 4HU9A 1TTZA 4O5UA 1SENA 2IIYA 2ZNMA 2NPBA 4ECJA 1W4VA 5IPGA 4QQ7A 2R6KA 3QMXA 3N9JA 5F8BA 3IAS2 3VWXA 2L4QA 1KEBA 3TJFA 5D9WA 3A3TA 4KDXA 3EINA 5KOXA 3GX0A 3ME7A 3BBYA 3ZRDA 3GN3A 4E8EA 2XPDA 3VURA 2I9HA 1RW1A 2DSAA 2MBSA 1CQGA 2GT6A 3EU3A 1JZOA 2RUFA 2MMNA 1HD2A 1NHYA 1ZYEA 4TVEA 5KN2A 1SL2B 4GCIA 4EDZA 3H4KA 4YQVA 4LL4B 1SJIA 2AUVA 1TU8A 1QFNA 2MMZA 1QGVA 4LMWA 3IK7A 3KH9A 2NDOA 1ZL9A 4K7OA 4KAEA 2CAQA 1TU7A 1XWGA 2DJ3A 1M0UA 1M9BA 5INYA 4FYBA 4KH7A 4BWQA 2DKHA 4MF5A 2FHEA 3ERGA 4G19A 3F6FA 5GAPD 1U6TA 5ECMB 3GL3A 1SL1B 4ZL8A 4ML6A 3FKFA 3I6AA 4HZ2A 4P3YB 3F8UA 1A0RP 3FR3A 3E9JB 2LJRA 1V2AA 2H1DA 2PPTA 2KLXA 5DDLA 2C1YA 1SD9A 2WJUA 1VF3A 4X4JA 4G0KA 3IV4A 1RQMA 2R0GA 1USBA 1PSQA 1MDKA 3IRAA 4YAVA 2NTOA 3MYDA 1R4WA 1EZKA 2AB6A 3GKXA 3IPZA 3CTFA 1U87A 1M7TA 3M8NA 4AJ6A 20GSA 2X8CA 4XS1A 1YEXA 3KTBA 1H75A 3G7YA 4HEA2 4N0VA 5HR0A 12GSA 4O5RA 4GTUA 4K6XA 3PINA 3IHQA 2JADA 2N5AA 3QOUA 3UBKA 4PX1A 1BYEA 1VF1A 2IPAA 2FCHA 4G9HA 2DJKA 3GFKA 1QMVA 4G2EA 2QC7A 4OO5A 3HJPA 4HU7A 2VCXA 1N8JA 5DJLA 1YZXA 4KB3A 1DE2A 3UL3A 3I43A 1K0NA 2OE1A 2GQMA 2DJ1A 5AGYA 16GSA 5D73A 4LMVA 3A2VA 3ZTLA 4KF9A 3H8QA 4KE3A 1WE0A 1AAZA 4F2IA 2H01A 1SJZA 4IQ1A 3EC3A 1V58A 2L59A 2EC4A 2C0DA 1XVWA 4RQRA 1T3BA 4I5QA 10GSA 1XVQA 5ECLB 13GSA 1ZMAA 4YKGA 2IMKA 5HR1A 2G0FA 4ML1A 1EEJA 3LYPA 2EIQA 3A2WA 2RM5A 3LQ7A 3I9V2 1OE7A 1EOGA 1X9SB 4O7HA 3R2QA 1KNGA 4HQSA 3H79A 4PQHA 1V98A 1PD21 1RK4A 3L78A 5EVOA 6GSVA 2YPMA 4OCFA 5B6MA 1A2LA 2CAIA 2H73A 3LXTA 5A5KA 4N11A 2H6XA 3UVHA 3C1SA 4AJ7A 3KP8A 3JCML 2QA1A 4KGIA 4TXOB 1GSDA 4EL1A 2ZCTA 4TR1A 4DSRA 4JU5A 1AQVA 2C0GA 2VLUA 5DQYA 1UN2A 1EGOA 4AJ8A 1E2YA 2A2PA 3CBUA 2LNSA 4XS4B 2H76A 2L57A 1B4PA 2YJHA 3HA9A 2YWMA 3HJOA 1Z9HA 1PQNA 4K2DA 4K8MA 3V1WA 5KOWA 2LQQA 1S3DA 2DIYA 2HYXA 2YWOA 1AW9A 2IMDA 5EL8A 1BJXA 4JZQA 3BD2A 3F4RA 2O7KA 1DSBA 2M46A 4OCEA 2EIOA 1ZYQB 4HS1A 3FMWA 2KOKA 3KMOA 3ZVJA 2CVBA 5KN3A 4HQZA 11GSA 2IJYA 1S3CA 3WGXA 3UVTA 3D4MA 5ECPB 3HCZA 1I9DA 2V6OA 5AN1A 3FR6A 3LXZA 1SK2A 3GHAA 1G7OA 3KH7A 2LTKA 3EPTA 5DJMA 5IPHA 2DJ2A 1FAAA 4WF5A 3GTUB 2CA8A 2VL9A 2XHFA 3P7XA 4E8HA 1K3LA 4KDUA 3DWVA 3KD0A 1O85A 1PRXA 5F0GA 2IN3A 2HRKA 4K1FA 4IBPA 2RIIA 2P31A 2KHPA 4MF6A 2MZCA 2HLSA 1Z6MA 2K6VA 2VD0A 4WETA 3PPUA 5D9TA 2OKAA 1MD3A 1U3AA 3IAM2 3CSIA 2VCTA 2GT5A 1WP0A 1T7PB 1TRUA 3APQA 3MSZA 3HZ8A 1XWKA 2H1GA 4TR4A 3IDVA 1FOVA 1ML6A 2GSSA 3ZFBA 1O7UA 1UC7A 4EDYA 3GURA 5BRTA 4KCAA 4MPFA 2C3QA 3TKSE 2VLVA 5IO2A 5DAKA 2B5YA 3A5IA 2C0EA 3H1NA 3IC8A 4CY8A 4KCEA 1X5EA 4POKA 2GQLA 5JWOB 4ZILA 1YEPA 5KN0A 2X99A 1XW5A 2M72A 1V57A 1EWXA 2OE0A 2CQ9A 4IVFA 3P2AA 3CXGA 1M2DA 1TJDA 4XHMA 4POMA 1EP8A 4ACSA 3C73A 1J0FA 3KEBA 4KX4A 3M1GA 2C80A 4ILFA 2HZEA 3GKNA 3MIXA 1TI3A 6GSXA 2KP2A 2YV7A 4A5PA 1YKCA 1EOHA 3M0FA 5AISA 2F9SA 3MDKA 1ST9A 6GSSA 5CAXA 3IR4A 2YCDA 3IHGA 4ECCA 2FWGA 3LG6A 1XIYA 2GGTA 2YWNA 3N5OA 2HNLA 4MMMA 1PMTA 3LW9A 4Z2UA 1A23A 2FWFA 5JWQB 1K0AA 1XPVA 4IGJA 5DALB 5D93A 4GRFA 3M3MA 1X5CA 3D6IA 3Q6OA 4PURA 5DVBA 2V41A 5HQPA 4DSSA 5HR2A 2G2QA 4GXZA 2DKIA 3ZMKA 4O32A 5FWGA 2I1UA 3BOAA 3APOA 4YKFA 1B9XC 2BTOT 4GQFA 5A4WA 2LNTA 3FYGA 4QL9A 1WIKA 1JLWA 1OC9A 1YJ6A 1VGLA 2IMEA 4PUAA 3VWUA 1A2JA 1PX7A 3O3TA 4OFTA 1O8XA 3US3A 2WRTA 1J08A 1ERTA 2X64A 2TIRA 3F9UA 5CRDA 5E4WA 5G1LA 3K8NA 2FNOA 2LRNA 5COHA 2B7JA 2YWIA 4GSNA 3MAKA 1MDIA 4JR4A 3DYRA 2WS2A 3TUEA 4LA1A 2X8HA 2IFQA 1WJKA 3AY8A 3ZMLA 1XWCA 4CDOA 1ERUA 2VO4A 1TXXA 3BCIA 5H5SA 2DMLA 2F8FA 4WBRD 5BMUA 2RUEA 3KM6A 3NOFA 3APSA 4YQUA 3HD5A 4XRDA 4IP1A 4WKWA 4F9ZA 2YNXA 3EVIA 4AF2A 2L6CA 1M99A 2L5LA 3UARA 1XBSA 4IS0A 1ZGNA 2JL4A 2CZ2A 4IELA 5CP1A 1Z6NA 2H1BA 3UIWA 1WMJA 2IMIA 4G10A 3GMFA 3TOUA 1GSYA 5G5EA 2YZHA 2VCVA 4EC0A 3QD9A 3HYPA 2AHEA 2QA2A 3F3QA 3FK8A 5AIVA 3RAZA 3O76A 3EE2A 4PUFC 1AIUA 1HNBA 1CQHA 22GSA 5G1KA 1A0FA 1M2BA 1MD4A 1TDIA 2TRXA 3C7MA 2LJKA 2VM1A 1X9WB 4L5LA 4NHZA 1THOA 1A24A 5CREA 3DXBA 18GSA 2OACA 4NHWA 4K0GA 3CRTA 4MJEA 4GQCA 2PVQA 5LCZA 4MJBA 2GDRA 2PERA 1F2EA 1OKDA 1F6MC 4XTSA 2E2GA 1SK0A 1X0RA 4BVYB 2GZPA 3GUSA 1R7HA 3IBHA 2ON5A 4MJAA 1VF2A 1B48A 3TB2A 1O81A 2C3TA 2EIRA 4KSMA 3FZ5A 2C8UA 5ID2B 4IN0A 4X43A 1X9MB 1ILOA 1WWJA 4POBA 2UZ8A 4FO5A 4EUYA 3RHCA 4K0NA 2YANA 4ZB9A 4AGSA 2GSRA 1R5PA 2CZ3A 2O87A 4EE0A 4EVMA 2OBKA 3L4NA 2XBQA 2N5BA 1U88A 5FT3A 4IJIA 3GIXA 5G2ZA 4MZWA 4BPYA 2O89A 5IMFA 5IMZA 3PH9A 5E59A 2H72A 3E3EA 3ZIJA 4XS6A 1HYUA 1K0DA 4Q5QA 4MA9A 1LU4A 3LEFA 1OC3A 4MJCA 2VM2A 1K0CA 4CHSA 3G9BA 2REMA 5ECHB 4K7IA 2A4HA 9GSSA 2B5XA 3UMAA 1FW1A 2ES7A 3M9KA 1GSUA 3W8SA 1W89A 4I6XA 3EWLA 1Y25A 1WOUA 5B7CA 2AJQB 1ERVA 1NM3A 3MWHA 3LSZA 5EPFA 1WPIA 1E6BA 1GWCA 2HSMA 4GSSA 2HRAA 1K3OA 5EY6A 4Z2TA 4MP4A 2P5QA 4DEJA 3TJKA 4ZL9A 3KZQA 2DLXA 3DVXA 4TW5A 5IIZA 3HVXA 4TOPA 5CYYA 1BX9A 2PBJA 1M2AA 5ELGA 4DVCA 1TP9A 4K9ZA 1GTIA 3TRQA 1G0TA 4NV5A 3IA1A 1YDKA 1B4QA 4MPGA 4NWYA 2B5EA 1JZRA 1DBYA 1GNEA 2WULA 3L9VA 3PR8A 2HT9A 1F3BA 3DGQA 4ZIJA 5DCHA 2H6ZA 3W6GA 1T4ZA 2K8VA 4BL7B 1NW2A 2AAWA 1Z7PA 4X0XA 2A2SA 2QGVA 2PN8A 1IYHA 3QDNA 4O5QA 3EMPA 3TJGA 8GSSA 5A4VA 4MH3A 1VF4A 4Z7XA 3VWWA 2JSZA 3D0ZA 3FZ4A 1R26A 1GL8A 3KCMA 2JZSA 2I4AA 4D73B 3WGEA 19GSA 3P90A 2AV4A 3DEXA 3DKSA 2B1KA 4PQ1A 3ED3A 1SK1A 1C72A 1GRXA 1WRYA 4F82A 2HZEB 2IL3A 1EV4A 1JZDA 1TRSA 3J7Yb 1FHEA 4BA7A 1PKZA 1ZZYA 2N5FA 4JBBA 1MDJA 2HSHA 1SU9A 4V2MA 1YF0A 3QAWA 2XC2A 5IOXA 2A2RA 2ZUPA 1FVJA 1QXHA 3FRCA 5ECIB 3HZ4A 3DVWA 3EURA 3A2XA 1ON4A 4EF0A 3VI5A 2VCWA 3KP9A 3HXSA 4BVXB 5CRGA 3F3RA 1FB0A 4KW6A 5ENUA 4Q5FA 1Y6EA 4WR4A 1GTAA 3ZLPA 4WF4A 2F3MA 5JWRB 1V40A 1XW9A 7GSSA 3TKPA 2TRCP 2A4VA 2V1MA 1EEMA 2JZTA 2PUKC 4EO3A 4POLA 2LKUA 2GSTA 4OMVA 5C04A 5B6NA 1XOBA 4BWSA 2PWJA 3GL5A 4DSQA 4ECIA 3C71A 2KP1A 4QL7A 4XIHA 1B8XA 1GUKA 1Z5YE 3DRNA 3FHKA 2H0IA 3KJYA 3LYKA 5B8AA 1XOAA 1NHOA 3ISOA 3ZVJD 5J41A 2VOCA 4FYUA 5KEJA 1O8WA 1EP7A 5ECQB 5CRWA 1Q98A 1FB6A 1XXUA 2LS5A 2VIMA 1FVKA 2R0PA 2WGRA 2HSYA 2WDUA 2B6MA 4MLYA 3SBCA 2MBTA 1AC1A 1FO5A 1THXA 1X5DA 3KIJA 2J9HA 4FQUA 4XS4A 4X1UA 5IO0A 3TRPA 2VCZA 1JHBA 4N30A 3ZITA 2VL3A 4V1Ap 3S9FA 4I2UA 2F51A 5DCGA 6GSYA 5F07A 3TRXA 4TXVA 5HFKA 3GV1A 1G6YA 4EXJA 1F3AA 1XFLA 1ZYPA 2NBSA 4TKYA 1AQWA 3TKRA 4PNGA 2V2GA 4I2TA 4GLTA 2R5GA 3WD6A 3WGDA 3OR5A 1TK0B 4NXIA 1SYXA 3QAGA 1T1VA 2OBIA 3GSTA 5HFIA 1YY7A 4ECBA 2YOIA 4NPBA 3KMNA 4KNDA 1YKAA 2IWTA 1YQ1A 4IP6A 3LFLA 5J9CA 2H0HA 3KXOA 3LWAA 4MABA 5J4UA 3Q19A 2H66A 3L9UA 1K3YA 3HJMA 4I8BA 1Z7RA 6GSTA 3EMXA 2B3SA 2LQOA 1PL2A 4J57E 2LV3A 3GTUA 3QAVA 4IQAA 4ISDA 5C00A 3WT2A 1OKTA 1ABAA 1TOFA 3GX8A 4HUAA 4TR0A 3ERWA 4CW9A 2NVLA 3KTLA 4RQXA 2M80A 2E7PA 2FD3A 4WBJA 1B9YC 2OE3A 3VFIA 1TKDB 3O6TA 1PL1A 2CV4A 2R4VA 4KA0A 2C0FA 4N10A 1ZCPA 1G7EA 2VLTA 4O92A 4GWRA 5JCUA 2PVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MYG A;  1TW9 A;  3UEM A;  2L4C A;  1GUL A;  2JU5 A;  1GSF A;  2E0Q A;  2VL2 A;  2WCI A;  4TR3 A;  1LBK A;  3HY2 A;  1XWB A;  3RPP A;  1TK8 B;  4ZBA A;  2V32 A;  5F06 A;  2H30 A;  3GKK A;  2LEG A;  1SL0 B;  2CX3 A;  2LJA A;  2H0G A;  3U5R E;  2H6Y A;  3WYW A;  14GS A;  3GH6 A;  3TJB A;  3L0H A;  1AQX A;  2ON7 A;  1PX6 A;  3RDW A;  2K9F A;  5D9X A;  4IHU A;  4PNF A;  1QK8 A;  2HE3 A;  2H8L A;  1GTB A;  1O73 A;  2HFD A;  1JFU A;  4HJM A;  2DBC A;  4XRA A;  3RPN A;  5D8I A;  4ZB8 A;  2O85 A;  3VI7 A;  1ACV A;  3ZRE A;  2YJ7 A;  3NIV A;  2VL2 C;  3DIE A;  2GZZ A;  2YV9 A;  2CX4 A;  1Q4J A;  1YF1 A;  4WR5 A;  3UOM A;  1AUC A;  2FA8 A;  2B7K A;  4ZBD A;  4PGT A;  3Q18 A;  4FH8 A;  3E0U A;  2YZU A;  4ZXG A;  3TGZ A;  4LL1 B;  5IMV A;  2PGT A;  4L8E A;  1UA5 A;  5ECK B;  1GSQ A;  3QFA C;  4EKZ A;  3TKQ A;  5DAL A;  1F9M A;  2FWH A;  2VCQ A;  3GA4 A;  4JED A;  3Q74 A;  1TI1 A;  4TR1 B;  1U3I A;  5DQS A;  3CSH A;  1XCC A;  4OD7 A;  3H93 A;  3GKM A;  3VPQ A;  4YAP A;  2FWE A;  5L71 A;  3FW2 A;  4GF0 A;  3ZZX A;  5A4U A;  3CSJ A;  2L5O A;  3FZ9 A;  2I3Y A;  5GZZ B;  3FZA A;  2I81 A;  4HOJ A;  1Z3E A;  2FLS A;  3NZN A;  1OVN A;  3RBT A;  1MTC A;  1BAY A;  3A5W A;  3WT1 A;  1K0B A;  3VLN A;  4MF7 A;  5IMA A;  3I69 A;  1J9B A;  1V9W A;  2ALB A;  2YP6 A;  3CMI A;  4K7N A;  3HHV A;  3QPM A;  5DBQ A;  2XPE A;  1K0O A;  2MMO A;  2DIZ A;  3MNG A;  4N0Z A;  2JZR A;  2RLI A;  3F4T A;  3F63 A;  4LLR A;  2GVP A;  5ELA A;  3ZYW A;  3RHB A;  3VK9 A;  5IOW A;  1AXD A;  2LST A;  4NMU A;  2O8V B;  4Q5N A;  3SWL A;  1OYJ A;  2X8G A;  3UJ1 A;  3HVS A;  1I5G A;  4TN8 A;  1IYI A;  4MZC A;  4OO4 A;  1JZW A;  3CRU A;  2GLR A;  1BG5 A;  4GST A;  3GH9 A;  1PN9 A;  1GP1 A;  3ZIV A;  2VAF A;  2DMM A;  5ECN B;  3ZL5 A;  2R3X A;  2K8S A;  4Q5R A;  4YH2 A;  2V6K A;  2CVK A;  3CYN A;  3UAP A;  4TRX A;  4WEY A;  1N2A A;  5IMC A;  4JE1 A;  5H5R A;  5CO3 A;  2FA4 A;  4RUV A;  3U6V A;  1PKW A;  2WB9 A;  1URM A;  1OC8 A;  2LUS A;  2H75 A;  3ZFL A;  5CRH A;  2MMA A;  3QCP A;  2LRC A;  2XBI A;  3FEU A;  3IK9 A;  5D9V A;  5DAK B;  4HJ2 A;  1SD8 A;  3FY7 A;  3G7I A;  4L0W A;  5CNW A;  2FGX A;  1MEK A;  4L0U A;  1HNC A;  3UBL A;  5FHI A;  3GYK A;  4BVY A;  1F37 A;  4I97 A;  1R5A A;  5AIX A;  1TRW A;  5J5N A;  4XCS A;  1SJ6 A;  3L9S A;  2YN1 A;  3D5J A;  2GSQ A;  1HQO A;  4J2F A;  3LOR A;  4V2L A;  1BED A;  3F0I A;  3BCK A;  4F03 A;  5ID2 A;  1GLQ A;  3F6D A;  6GSU A;  1K0M A;  1M9A A;  1KTE A;  1GH2 A;  1SKR B;  2JSY A;  4HI7 A;  4NV2 A;  5H5Q A;  5F05 A;  4ZBB A;  3DML A;  2R37 A;  3D21 A;  1HNA A;  4MH2 A;  4ID0 A;  3KGK A;  3QFB C;  5LNK e;  2D2Z A;  1KBN A;  3IE3 A;  2B1L A;  2H70 A;  4KDY A;  2WFC A;  4ULX A;  4OWY A;  3VPT A;  1DE1 A;  3G7J A;  5G31 A;  1T4Y A;  4F0C A;  1GSE A;  5G30 A;  2CVD A;  5B8B A;  1T8E B;  3EYT A;  2VUP A;  4IJ3 A;  4FIW A;  1SKW B;  4DSS B;  3TKS A;  4IW9 A;  3D22 A;  2F8A A;  2OAD A;  4L5O A;  3IXR A;  2IMF A;  4JRR A;  3GNJ A;  2AYT A;  1TRV A;  2OA7 A;  5GSS A;  2VD1 A;  2HI7 A;  3C8E A;  5ECO B;  1GNW A;  3TCO A;  4YQM A;  3W8J A;  3CTG A;  3HVV A;  3D4T A;  3GRX A;  5IM9 A;  4V2N A;  4MK3 A;  2GZY A;  1O6J A;  1OC9 B;  1ZOF A;  3ME8 A;  2H74 A;  2CT6 A;  2L6D A;  2H1A A;  5ECS A;  2DC5 A;  4MDC A;  1GTU A;  2J23 A;  4FYC A;  4MCU A;  2HZF A;  4KUN A;  4HZ4 A;  2P0G A;  2WZ9 A;  4V1A g;  4TXO A;  3IOS A;  1G6W A;  4JR6 A;  4HDE A;  4PQI A;  1OAZ A;  3LGC A;  1T00 A;  4IKH A;  3FR9 A;  4NAX A;  3GSS A;  1H4O A;  3VWV A;  5J3R A;  2C3N A;  1PA3 A;  2H71 A;  2IFQ B;  1PGT A;  4BL7 A;  5HFG A;  1JLV A;  2QSI A;  2RM6 A;  2BJX A;  1VRS D;  1LJR A;  3C1R A;  3P8W A;  1GUM A;  4RI6 A;  2GTU A;  3TKS C;  2JAC A;  1GSS A;  5JCW A;  2PMT A;  2Z9S A;  3M9J A;  6GSW A;  5ECR B;  2PU9 C;  3HDC A;  17GS A;  2KUC A;  4D73 A;  1XW6 A;  1BQ7 A;  3TOT A;  3BJ5 A;  2QKE A;  4RI7 A;  5IQY A;  1ERW A;  4J56 E;  3IC4 A;  1NSW A;  2OJL A;  3LJR A;  1QUW A;  4KSO A;  1A2M A;  1TK5 B;  3EU4 A;  4MZB A;  1SKS B;  2HRF A;  5J9B A;  3F4S A;  3TDG A;  1QQ2 A;  2R2J A;  3J7Y k;  3TJJ A;  3ERF A;  5LD0 A;  3DD3 A;  1SYR A;  2HXK A;  1A8Y A;  1FG4 A;  3HKR A;  5ABR A;  4OFN A;  5HR3 A;  4BVX A;  1A8L A;  2C4J A;  2DJ0 A;  2FY6 A;  3PGT A;  1UVZ A;  2E2M A;  1EGR A;  5JCG A;  5G5F A;  5GAN D;  2FUG 2;  1S3A A;  2DJJ A;  1DUG A;  1XZO A;  1EV9 A;  1GLP A;  2HRN A;  4WXT A;  4PXO A;  5D96 A;  5IMD A;  2GQK A;  1OE8 A;  4ZB6 A;  2LRT A;  4H86 A;  2BMX A;  1XWA A;  2H19 A;  5KN1 A;  1GUH A;  2P5R A;  4F0B A;  4OFM A;  2GS3 A;  2K18 A;  4ZL7 A;  3QR6 A;  5GST A;  4HU9 A;  1TTZ A;  1SEN A;  2IIY A;  2ZNM A;  2NPB A;  4ECJ A;  1W4V A;  5IPG A;  4QQ7 A;  2R6K A;  3QMX A;  3N9J A;  5F8B A;  3IAS 2;  3VWX A;  2L4Q A;  1KEB A;  3TJF A;  5D9W A;  3A3T A;  4KDX A;  3EIN A;  3GX0 A;  3ME7 A;  3BBY A;  3ZRD A;  3GN3 A;  4E8E A;  2XPD A;  3VUR A;  2I9H A;  1RW1 A;  2DSA A;  2MBS A;  1CQG A;  2GT6 A;  3EU3 A;  1JZO A;  2RUF A;  2MMN A;  1HD2 A;  1NHY A;  1ZYE A;  4TVE A;  5KN2 A;  1SL2 B;  4GCI A;  4EDZ A;  3H4K A;  4YQV A;  4LL4 B;  1SJI A;  2AUV A;  1TU8 A;  1QFN A;  2MMZ A;  1QGV A;  4LMW A;  3IK7 A;  3KH9 A;  2NDO A;  1ZL9 A;  4K7O A;  4KAE A;  2CAQ A;  1TU7 A;  1XWG A;  2DJ3 A;  1M0U A;  1M9B A;  5INY A;  4FYB A;  4KH7 A;  4BWQ A;  4MF5 A;  2FHE A;  3ERG A;  4G19 A;  3F6F A;  5GAP D;  1U6T A;  5ECM B;  3GL3 A;  1SL1 B;  4ZL8 A;  4ML6 A;  3FKF A;  3I6A A;  4HZ2 A;  4P3Y B;  3F8U A;  1A0R P;  3FR3 A;  3E9J B;  2LJR A;  1V2A A;  2H1D A;  2PPT A;  2KLX A;  5DDL A;  2C1Y A;  1SD9 A;  2WJU A;  1VF3 A;  3IV4 A;  1RQM A;  1USB A;  1PSQ A;  1MDK A;  3IRA A;  4YAV A;  2NTO A;  1R4W A;  1EZK A;  2AB6 A;  3GKX A;  3IPZ A;  3CTF A;  1U87 A;  1M7T A;  3M8N A;  4AJ6 A;  20GS A;  2X8C A;  4XS1 A;  1YEX A;  3KTB A;  1H75 A;  3G7Y A;  4HEA 2;  4N0V A;  5HR0 A;  12GS A;  4O5R A;  4GTU A;  4K6X A;  3PIN A;  3IHQ A;  2JAD A;  2N5A A;  3QOU A;  3UBK A;  4PX1 A;  1BYE A;  1VF1 A;  2IPA A;  2FCH A;  4G9H A;  2DJK A;  3GFK A;  1QMV A;  4G2E A;  2QC7 A;  4OO5 A;  3HJP A;  4HU7 A;  2VCX A;  1N8J A;  5DJL A;  1YZX A;  4KB3 A;  1DE2 A;  3UL3 A;  3I43 A;  1K0N A;  2OE1 A;  2GQM A;  2DJ1 A;  5AGY A;  16GS A;  5D73 A;  4LMV A;  3A2V A;  3ZTL A;  3H8Q A;  4KE3 A;  1WE0 A;  1AAZ A;  4F2I A;  2H01 A;  1SJZ A;  4IQ1 A;  3EC3 A;  1V58 A;  2L59 A;  2EC4 A;  2C0D A;  1XVW A;  4RQR A;  1T3B A;  4I5Q A;  10GS A;  1XVQ A;  5ECL B;  13GS A;  1ZMA A;  2IMK A;  5HR1 A;  2G0F A;  4ML1 A;  1EEJ A;  3LYP A;  2EIQ A;  3A2W A;  2RM5 A;  3LQ7 A;  3I9V 2;  1OE7 A;  1EOG A;  1X9S B;  4O7H A;  3R2Q A;  1KNG A;  4HQS A;  3H79 A;  4PQH A;  1V98 A;  1PD2 1;  1RK4 A;  3L78 A;  5EVO A;  6GSV A;  2YPM A;  4OCF A;  5B6M A;  1A2L A;  2CAI A;  2H73 A;  3LXT A;  5A5K A;  4N11 A;  2H6X A;  3UVH A;  3C1S A;  4AJ7 A;  3KP8 A;  3JCM L;  4KGI A;  4TXO B;  1GSD A;  4EL1 A;  2ZCT A;  4TR1 A;  4DSR A;  4JU5 A;  1AQV A;  2C0G A;  2VLU A;  5DQY A;  1UN2 A;  1EGO A;  4AJ8 A;  1E2Y A;  3CBU A;  2LNS A;  4XS4 B;  2H76 A;  2L57 A;  1B4P A;  2YJH A;  3HA9 A;  2YWM A;  3HJO A;  1Z9H A;  1PQN A;  4K2D A;  4K8M A;  3V1W A;  2LQQ A;  1S3D A;  2DIY A;  2HYX A;  2YWO A;  1AW9 A;  2IMD A;  5EL8 A;  1BJX A;  4JZQ A;  3BD2 A;  3F4R A;  2O7K A;  1DSB A;  2M46 A;  4OCE A;  2EIO A;  1ZYQ B;  4HS1 A;  2KOK A;  3KMO A;  3ZVJ A;  2CVB A;  5KN3 A;  4HQZ A;  11GS A;  2IJY A;  1S3C A;  3WGX A;  3UVT A;  3D4M A;  5ECP B;  3HCZ A;  1I9D A;  2V6O A;  5AN1 A;  3FR6 A;  3LXZ A;  1SK2 A;  3GHA A;  1G7O A;  3KH7 A;  2LTK A;  5DJM A;  5IPH A;  2DJ2 A;  1FAA A;  4WF5 A;  3GTU B;  2CA8 A;  2VL9 A;  2XHF A;  3P7X A;  4E8H A;  1K3L A;  4KDU A;  3DWV A;  3KD0 A;  1O85 A;  1PRX A;  5F0G A;  2IN3 A;  4K1F A;  4IBP A;  2RII A;  2P31 A;  2KHP A;  4MF6 A;  2MZC A;  2HLS A;  1Z6M A;  2K6V A;  2VD0 A;  4WET A;  5D9T A;  2OKA A;  1MD3 A;  1U3A A;  3IAM 2;  3CSI A;  2VCT A;  2GT5 A;  1WP0 A;  1T7P B;  1TRU A;  3APQ A;  3MSZ A;  3HZ8 A;  1XWK A;  2H1G A;  4TR4 A;  3IDV A;  1FOV A;  1ML6 A;  2GSS A;  3ZFB A;  1O7U A;  1UC7 A;  4EDY A;  3GUR A;  4KCA A;  4MPF A;  2C3Q A;  3TKS E;  2VLV A;  5IO2 A;  5DAK A;  2B5Y A;  2C0E A;  3H1N A;  4KCE A;  1X5E A;  4POK A;  2GQL A;  5JWO B;  4ZIL A;  1YEP A;  5KN0 A;  2X99 A;  1XW5 A;  2M72 A;  1V57 A;  1EWX A;  2OE0 A;  2CQ9 A;  4IVF A;  3P2A A;  3CXG A;  1M2D A;  1TJD A;  4XHM A;  4POM A;  1EP8 A;  4ACS A;  3C73 A;  1J0F A;  3KEB A;  4KX4 A;  3M1G A;  2C80 A;  4ILF A;  2HZE A;  3GKN A;  1TI3 A;  6GSX A;  2KP2 A;  2YV7 A;  1YKC A;  1EOH A;  3M0F A;  5AIS A;  2F9S A;  3MDK A;  1ST9 A;  6GSS A;  5CAX A;  3IR4 A;  2YCD A;  4ECC A;  2FWG A;  3LG6 A;  1XIY A;  2GGT A;  2YWN A;  3N5O A;  2HNL A;  4MMM A;  1PMT A;  1A23 A;  2FWF A;  5JWQ B;  1K0A A;  1XPV A;  4IGJ A;  5DAL B;  5D93 A;  4GRF A;  3M3M A;  1X5C A;  3D6I A;  3Q6O A;  4PUR A;  5DVB A;  2V41 A;  5HQP A;  4DSS A;  5HR2 A;  2G2Q A;  4GXZ A;  3ZMK A;  4O32 A;  5FWG A;  2I1U A;  3BOA A;  3APO A;  1B9X C;  2BTO T;  4GQF A;  5A4W A;  2LNT A;  3FYG A;  4QL9 A;  1WIK A;  1JLW A;  1OC9 A;  1YJ6 A;  1VGL A;  2IME A;  4PUA A;  3VWU A;  1A2J A;  1PX7 A;  3O3T A;  4OFT A;  1O8X A;  3US3 A;  2WRT A;  1J08 A;  1ERT A;  2X64 A;  2TIR A;  3F9U A;  5CRD A;  5E4W A;  5G1L A;  3K8N A;  2FNO A;  2LRN A;  5COH A;  2B7J A;  2YWI A;  4GSN A;  3MAK A;  1MDI A;  4JR4 A;  3DYR A;  2WS2 A;  3TUE A;  4LA1 A;  2X8H A;  2IFQ A;  1WJK A;  3AY8 A;  3ZML A;  1XWC A;  4CDO A;  1ERU A;  2VO4 A;  1TXX A;  3BCI A;  5H5S A;  2DML A;  2F8F A;  4WBR D;  2RUE A;  3KM6 A;  3NOF A;  3APS A;  4YQU A;  3HD5 A;  4XRD A;  4IP1 A;  4WKW A;  4F9Z A;  2YNX A;  3EVI A;  4AF2 A;  2L6C A;  1M99 A;  2L5L A;  3UAR A;  1XBS A;  4IS0 A;  1ZGN A;  2JL4 A;  2CZ2 A;  4IEL A;  5CP1 A;  1Z6N A;  2H1B A;  3UIW A;  1WMJ A;  2IMI A;  4G10 A;  3GMF A;  3TOU A;  1GSY A;  5G5E A;  2YZH A;  2VCV A;  4EC0 A;  3QD9 A;  3HYP A;  2AHE A;  3F3Q A;  3FK8 A;  5AIV A;  3RAZ A;  3O76 A;  3EE2 A;  4PUF C;  1AIU A;  1HNB A;  1CQH A;  22GS A;  5G1K A;  1A0F A;  1M2B A;  1MD4 A;  1TDI A;  2TRX A;  3C7M A;  2LJK A;  2VM1 A;  1X9W B;  4L5L A;  4NHZ A;  1THO A;  1A24 A;  5CRE A;  3DXB A;  18GS A;  2OAC A;  4NHW A;  4K0G A;  3CRT A;  4MJE A;  4GQC A;  2PVQ A;  5LCZ A;  4MJB A;  2GDR A;  2PER A;  1F2E A;  1OKD A;  1F6M C;  4XTS A;  2E2G A;  1SK0 A;  1X0R A;  2GZP A;  3GUS A;  1R7H A;  3IBH A;  2ON5 A;  4MJA A;  1VF2 A;  1B48 A;  3TB2 A;  1O81 A;  2C3T A;  2EIR A;  4KSM A;  3FZ5 A;  2C8U A;  5ID2 B;  4IN0 A;  4X43 A;  1X9M B;  1ILO A;  1WWJ A;  4POB A;  4FO5 A;  4EUY A;  3RHC A;  4K0N A;  2YAN A;  4ZB9 A;  4AGS A;  2GSR A;  1R5P A;  2CZ3 A;  2O87 A;  4EE0 A;  4EVM A;  2OBK A;  3L4N A;  2XBQ A;  2N5B A;  1U88 A;  5FT3 A;  4IJI A;  3GIX A;  5G2Z A;  4MZW A;  4BPY A;  2O89 A;  5IMF A;  5IMZ A;  3PH9 A;  5E59 A;  2H72 A;  3E3E A;  3ZIJ A;  4XS6 A;  1HYU A;  1K0D A;  4Q5Q A;  4MA9 A;  1LU4 A;  3LEF A;  1OC3 A;  4MJC A;  2VM2 A;  1K0C A;  4CHS A;  3G9B A;  2REM A;  5ECH B;  4K7I A;  9GSS A;  2B5X A;  3UMA A;  1FW1 A;  2ES7 A;  3M9K A;  1GSU A;  3W8S A;  1W89 A;  4I6X A;  3EWL A;  1Y25 A;  1WOU A;  5B7C A;  2AJQ B;  1ERV A;  1NM3 A;  3MWH A;  3LSZ A;  5EPF A;  1WPI A;  1E6B A;  1GWC A;  4GSS A;  1K3O A;  5EY6 A;  4MP4 A;  2P5Q A;  4DEJ A;  3TJK A;  4ZL9 A;  3KZQ A;  2DLX A;  3DVX A;  4TW5 A;  5IIZ A;  3HVX A;  4TOP A;  5CYY A;  1BX9 A;  2PBJ A;  1M2A A;  5ELG A;  4DVC A;  1TP9 A;  4K9Z A;  1GTI A;  3TRQ A;  1G0T A;  4NV5 A;  3IA1 A;  1YDK A;  1B4Q A;  4MPG A;  4NWY A;  2B5E A;  1JZR A;  1DBY A;  1GNE A;  2WUL A;  3L9V A;  3PR8 A;  2HT9 A;  1F3B A;  3DGQ A;  4ZIJ A;  5DCH A;  2H6Z A;  3W6G A;  1T4Z A;  2K8V A;  1NW2 A;  2AAW A;  1Z7P A;  4X0X A;  2A2S A;  2QGV A;  2PN8 A;  1IYH A;  3QDN A;  3EMP A;  3TJG A;  8GSS A;  5A4V A;  4MH3 A;  1VF4 A;  4Z7X A;  3VWW A;  2JSZ A;  3D0Z A;  3FZ4 A;  1R26 A;  1GL8 A;  3KCM A;  2JZS A;  2I4A A;  4D73 B;  3WGE A;  19GS A;  3P90 A;  2AV4 A;  3DEX A;  3DKS A;  2B1K A;  4PQ1 A;  3ED3 A;  1SK1 A;  1C72 A;  1GRX A;  1WRY A;  4F82 A;  2HZE B;  2IL3 A;  1EV4 A;  1JZD A;  1TRS A;  3J7Y b;  1FHE A;  4BA7 A;  1PKZ A;  1ZZY A;  2N5F A;  4JBB A;  1MDJ A;  2HSH A;  1SU9 A;  4V2M A;  1YF0 A;  3QAW A;  2XC2 A;  5IOX A;  2A2R A;  2ZUP A;  1FVJ A;  1QXH A;  3FRC A;  5ECI B;  3HZ4 A;  3DVW A;  3EUR A;  3A2X A;  1ON4 A;  4EF0 A;  3VI5 A;  2VCW A;  3KP9 A;  3HXS A;  5CRG A;  3F3R A;  1FB0 A;  4KW6 A;  5ENU A;  4Q5F A;  1Y6E A;  4WR4 A;  1GTA A;  3ZLP A;  4WF4 A;  2F3M A;  5JWR B;  1V40 A;  1XW9 A;  7GSS A;  3TKP A;  2TRC P;  2A4V A;  2V1M A;  1EEM A;  2JZT A;  2PUK C;  4EO3 A;  4POL A;  2LKU A;  2GST A;  4OMV A;  5C04 A;  5B6N A;  1XOB A;  4BWS A;  2PWJ A;  3GL5 A;  4DSQ A;  4ECI A;  3C71 A;  2KP1 A;  4QL7 A;  4XIH A;  1B8X A;  1GUK A;  1Z5Y E;  3DRN A;  3FHK A;  2H0I A;  3KJY A;  3LYK A;  5B8A A;  1XOA A;  1NHO A;  3ISO A;  3ZVJ D;  5J41 A;  2VOC A;  4FYU A;  5KEJ A;  1O8W A;  1EP7 A;  5ECQ B;  5CRW A;  1Q98 A;  1FB6 A;  1XXU A;  2LS5 A;  2VIM A;  1FVK A;  2WGR A;  2HSY A;  2WDU A;  2B6M A;  4MLY A;  3SBC A;  2MBT A;  1AC1 A;  1FO5 A;  1THX A;  1X5D A;  3KIJ A;  2J9H A;  4XS4 A;  4X1U A;  5IO0 A;  3TRP A;  2VCZ A;  1JHB A;  4N30 A;  3ZIT A;  2VL3 A;  4V1A p;  3S9F A;  4I2U A;  2F51 A;  5DCG A;  6GSY A;  5F07 A;  3TRX A;  4TXV A;  5HFK A;  3GV1 A;  1G6Y A;  4EXJ A;  1F3A A;  1XFL A;  2NBS A;  4TKY A;  1AQW A;  3TKR A;  4PNG A;  2V2G A;  4I2T A;  4GLT A;  2R5G A;  3WD6 A;  3WGD A;  3OR5 A;  1TK0 B;  4NXI A;  1SYX A;  3QAG A;  1T1V A;  2OBI A;  3GST A;  5HFI A;  1YY7 A;  4ECB A;  2YOI A;  4NPB A;  3KMN A;  4KND A;  1YKA A;  2IWT A;  1YQ1 A;  4IP6 A;  3LFL A;  5J9C A;  2H0H A;  3KXO A;  3LWA A;  4MAB A;  5J4U A;  3Q19 A;  2H66 A;  3L9U A;  1K3Y A;  3HJM A;  4I8B A;  1Z7R A;  6GST A;  3EMX A;  2B3S A;  2LQO A;  1PL2 A;  4J57 E;  2LV3 A;  3GTU A;  3QAV A;  4IQA A;  4ISD A;  5C00 A;  3WT2 A;  1OKT A;  1ABA A;  1TOF A;  3GX8 A;  4HUA A;  4TR0 A;  3ERW A;  4CW9 A;  2NVL A;  3KTL A;  4RQX A;  2M80 A;  2E7P A;  2FD3 A;  4WBJ A;  1B9Y C;  2OE3 A;  3VFI A;  1TKD B;  3O6T A;  1PL1 A;  2CV4 A;  2R4V A;  4KA0 A;  2C0F A;  4N10 A;  1ZCP A;  1G7E A;  2VLT A;  4O92 A;  4GWR A;  5JCU A;  2PVO C; 
#chains in the Genus database with same CATH topology
 2MYG A;  1TW9 A;  3UEM A;  2L4C A;  1GUL A;  2JU5 A;  1GSF A;  2E0Q A;  2VL2 A;  2WCI A;  4TR3 A;  1LBK A;  3HY2 A;  1XWB A;  3RPP A;  1TK8 B;  4ZBA A;  2V32 A;  5F06 A;  4USS A;  2H30 A;  3GKK A;  2LEG A;  1SL0 B;  2CX3 A;  2LJA A;  2H0G A;  3U5R E;  2H6Y A;  3WYW A;  14GS A;  3GH6 A;  3TJB A;  3L0H A;  1AQX A;  2ON7 A;  4PTS A;  1PX6 A;  3RDW A;  2K9F A;  5D9X A;  4IHU A;  4PNF A;  1QK8 A;  2HE3 A;  2H8L A;  1GTB A;  1O73 A;  2HFD A;  1JFU A;  4HJM A;  2DBC A;  4G0L A;  4XRA A;  3RPN A;  5D8I A;  4ZB8 A;  2O85 A;  3VI7 A;  1ACV A;  3ZRE A;  2YJ7 A;  3NIV A;  2VL2 C;  3DIE A;  2GZZ A;  2YV9 A;  2CX4 A;  1Q4J A;  1YF1 A;  4WR5 A;  3UOM A;  1AUC A;  2FA8 A;  2B7K A;  4ZBD A;  4PGT A;  3Q18 A;  4FH8 A;  3E0U A;  2YZU A;  4EIP A;  4ZXG A;  3TGZ A;  4LL1 B;  5IMV A;  2PGT A;  4L8E A;  1UA5 A;  5ECK B;  1GSQ A;  3QFA C;  4EKZ A;  3TKQ A;  5DAL A;  1F9M A;  2FWH A;  2VCQ A;  3GA4 A;  4JED A;  3Q74 A;  1TI1 A;  4TR1 B;  1U3I A;  5DQS A;  4K5R A;  3CSH A;  1XCC A;  4OD7 A;  2X4A A;  3H93 A;  3GKM A;  3VPQ A;  4YAP A;  2FWE A;  5L71 A;  3FW2 A;  4GF0 A;  3ZZX A;  5A4U A;  3CSJ A;  2L5O A;  2R0C A;  3FZ9 A;  2I3Y A;  5GZZ B;  3FZA A;  2I81 A;  4HOJ A;  1Z3E A;  2FLS A;  3NZN A;  1OVN A;  3RBT A;  1MTC A;  1BAY A;  3A5W A;  3WT1 A;  1K0B A;  3VLN A;  4MF7 A;  5IMA A;  3I69 A;  4K5S A;  1J9B A;  1V9W A;  2ALB A;  2YP6 A;  3CMI A;  4K7N A;  3HHV A;  3QPM A;  5DBQ A;  2XPE A;  1K0O A;  2MMO A;  2DIZ A;  3MNG A;  1PN0 A;  4N0Z A;  2JZR A;  2RLI A;  3F4T A;  3F63 A;  4LLR A;  2GVP A;  5ELA A;  3ZYW A;  3RHB A;  3VK9 A;  5IOW A;  1AXD A;  2LST A;  4K2X A;  2O8V B;  4NMU A;  4Q5N A;  3SWL A;  1OYJ A;  2X8G A;  3UJ1 A;  3HVS A;  1I5G A;  4TN8 A;  1IYI A;  4MZC A;  4OO4 A;  1JZW A;  3CRU A;  2GLR A;  1BG5 A;  4GST A;  3GH9 A;  1PN9 A;  1GP1 A;  3ZIV A;  2VAF A;  2DMM A;  5ECN B;  3ZL5 A;  2R3X A;  2K8S A;  4Q5R A;  4YH2 A;  2V6K A;  2CVK A;  3CYN A;  3UAP A;  4TRX A;  4WEY A;  1N2A A;  5IMC A;  4JE1 A;  5H5R A;  5CO3 A;  2FA4 A;  4RUV A;  3U6V A;  1PKW A;  2WB9 A;  1URM A;  1OC8 A;  2LUS A;  2H75 A;  3ZFL A;  5CRH A;  2MMA A;  3QCP A;  2LRC A;  2XBI A;  3FEU A;  3IK9 A;  3R3E A;  5D9V A;  5DAK B;  4HJ2 A;  1SD8 A;  3FY7 A;  3G7I A;  4L0W A;  5CNW A;  2FGX A;  1MEK A;  4L0U A;  1HNC A;  3UBL A;  5FHI A;  3GYK A;  4BVY A;  1F37 A;  1FOH A;  4I97 A;  1R5A A;  5AIX A;  1TRW A;  5J5N A;  4XCS A;  1SJ6 A;  3L9S A;  2YN1 A;  3D5J A;  2GSQ A;  1HQO A;  4J2F A;  3LOR A;  4V2L A;  1BED A;  3F0I A;  3BCK A;  1ZYN A;  4F03 A;  5ID2 A;  4G0I A;  1GLQ A;  3F6D A;  6GSU A;  1K0M A;  1M9A A;  1KTE A;  1GH2 A;  1SKR B;  2JSY A;  4HI7 A;  4NV2 A;  4MNN A;  5H5Q A;  5F05 A;  4ZBB A;  3DML A;  2R37 A;  3D21 A;  1HNA A;  4MH2 A;  4ID0 A;  3KGK A;  3QFB C;  5LNK e;  2D2Z A;  1KBN A;  3IE3 A;  2X49 A;  2B1L A;  2H70 A;  4KDY A;  2WFC A;  4ULX A;  4OWY A;  3VPT A;  1DE1 A;  3G7J A;  4EIQ A;  5G31 A;  1T4Y A;  4F0C A;  1GSE A;  5G30 A;  2CVD A;  5B8B A;  1T8E B;  3EYT A;  2VUP A;  4IJ3 A;  4FIW A;  1SKW B;  4DSS B;  3TKS A;  4IW9 A;  3D22 A;  2F8A A;  2OAD A;  4L5O A;  3IXR A;  2IMF A;  4JRR A;  3GNJ A;  2AYT A;  1TRV A;  2OA7 A;  5GSS A;  2VD1 A;  2HI7 A;  3C8E A;  5ECO B;  1GNW A;  3TCO A;  4YQM A;  3W8J A;  3CTG A;  3HVV A;  3D4T A;  3GRX A;  5IM9 A;  4V2N A;  4MK3 A;  2GZY A;  1O6J A;  1OC9 B;  1ZOF A;  3ME8 A;  2H74 A;  2CT6 A;  2L6D A;  2H1A A;  5ECS A;  2DC5 A;  4MDC A;  1GTU A;  2J23 A;  4FYC A;  4MCU A;  2HZF A;  4KUN A;  4HZ4 A;  2P0G A;  2WZ9 A;  4V1A g;  4TXO A;  3IOS A;  1G6W A;  4JR6 A;  4HDE A;  4PQI A;  1OAZ A;  3LGC A;  1T00 A;  4IKH A;  3FR9 A;  4NAX A;  3GSS A;  1H4O A;  3VWV A;  5J3R A;  2C3N A;  1PA3 A;  2H71 A;  2IFQ B;  1PGT A;  4BL7 A;  5HFG A;  1JLV A;  2QSI A;  2RM6 A;  2BJX A;  1VRS D;  1LJR A;  3C1R A;  3P8W A;  1GUM A;  4RI6 A;  2GTU A;  3TKS C;  2JAC A;  1GSS A;  5JCW A;  2PMT A;  2Z9S A;  3M9J A;  6GSW A;  5ECR B;  2PU9 C;  3HDC A;  17GS A;  2KUC A;  4D73 A;  1XW6 A;  1BQ7 A;  3TOT A;  3BJ5 A;  2QKE A;  4RI7 A;  5IQY A;  1ERW A;  4J56 E;  4Z2R A;  3IC4 A;  1NSW A;  2OJL A;  3LJR A;  1QUW A;  4KSO A;  1A2M A;  1TK5 B;  3EU4 A;  4MZB A;  1SKS B;  2HRF A;  5J9B A;  3F4S A;  3TDG A;  1QQ2 A;  2R2J A;  3J7Y k;  3TJJ A;  3ERF A;  5LD0 A;  3DD3 A;  4ICY A;  1SYR A;  2HXK A;  1A8Y A;  1FG4 A;  3HKR A;  5ABR A;  4OFN A;  5HR3 A;  4BVX A;  1A8L A;  2C4J A;  2DJ0 A;  2FY6 A;  3PGT A;  1UVZ A;  2E2M A;  1EGR A;  5JCG A;  5G5F A;  5GAN D;  2FUG 2;  1S3A A;  2DJJ A;  1DUG A;  1XZO A;  1EV9 A;  1GLP A;  2HRN A;  4WXT A;  4PXO A;  5D96 A;  5IMD A;  2GQK A;  1OE8 A;  4CY6 A;  4ZB6 A;  2LRT A;  4H86 A;  2BMX A;  1XWA A;  2H19 A;  5KN1 A;  1GUH A;  2P5R A;  4F0B A;  4OFM A;  2GS3 A;  2K18 A;  4ZL7 A;  3QR6 A;  5GST A;  4HU9 A;  1TTZ A;  4O5U A;  1SEN A;  2IIY A;  2ZNM A;  2NPB A;  4ECJ A;  1W4V A;  5IPG A;  4QQ7 A;  2R6K A;  3QMX A;  3CQF A;  3N9J A;  5F8B A;  3IAS 2;  3VWX A;  2L4Q A;  1KEB A;  3TJF A;  5D9W A;  3A3T A;  4KDX A;  3EIN A;  5KOX A;  3GX0 A;  3ME7 A;  3BBY A;  3ZRD A;  3GN3 A;  4E8E A;  2XPD A;  3VUR A;  2I9H A;  1RW1 A;  2DSA A;  2MBS A;  1CQG A;  2GT6 A;  3EU3 A;  1JZO A;  2RUF A;  2MMN A;  1HD2 A;  1NHY A;  1ZYE A;  4TVE A;  1XG8 A;  5KN2 A;  1SL2 B;  4GCI A;  4EDZ A;  3H4K A;  4YQV A;  4LL4 B;  1SJI A;  2AUV A;  1TU8 A;  1QFN A;  2MMZ A;  1QGV A;  4LMW A;  3IK7 A;  3KH9 A;  2NDO A;  1ZL9 A;  4K7O A;  4KAE A;  2CAQ A;  1TU7 A;  1XWG A;  2DJ3 A;  1M0U A;  1M9B A;  5INY A;  4FYB A;  4KH7 A;  4BWQ A;  2DKH A;  4MF5 A;  2FHE A;  3ERG A;  4G19 A;  3F6F A;  5GAP D;  1U6T A;  5ECM B;  3GL3 A;  1SL1 B;  4ZL8 A;  4ML6 A;  3FKF A;  1M3J A;  3I6A A;  4HZ2 A;  4P3Y B;  3F8U A;  1A0R P;  3FR3 A;  3E9J B;  2LJR A;  1V2A A;  2H1D A;  2PPT A;  2KLX A;  5DDL A;  2C1Y A;  1SD9 A;  2WJU A;  1VF3 A;  4X4J A;  4G0K A;  3IV4 A;  1RQM A;  2R0G A;  1USB A;  1PSQ A;  1MDK A;  3IRA A;  4YAV A;  2NTO A;  3MYD A;  1R4W A;  1EZK A;  2AB6 A;  3GKX A;  3IPZ A;  3CTF A;  1U87 A;  1M7T A;  3M8N A;  4AJ6 A;  20GS A;  2X8C A;  4XS1 A;  1YEX A;  3KTB A;  1H75 A;  3G7Y A;  4HEA 2;  4N0V A;  5HR0 A;  12GS A;  4O5R A;  4GTU A;  4K6X A;  3PIN A;  3IHQ A;  2JAD A;  2N5A A;  3QOU A;  3UBK A;  4PX1 A;  1BYE A;  1VF1 A;  2IPA A;  2FCH A;  4G9H A;  2DJK A;  3GFK A;  1QMV A;  4G2E A;  2QC7 A;  3HVN A;  4OO5 A;  3HJP A;  4HU7 A;  2VCX A;  1N8J A;  5DJL A;  1YZX A;  4KB3 A;  1DE2 A;  3UL3 A;  3I43 A;  1K0N A;  2OE1 A;  2GQM A;  2DJ1 A;  5AGY A;  16GS A;  5D73 A;  4LMV A;  3A2V A;  3ZTL A;  4KF9 A;  3H8Q A;  4KE3 A;  1WE0 A;  1AAZ A;  4F2I A;  2H01 A;  1SJZ A;  4IQ1 A;  3EC3 A;  1V58 A;  2L59 A;  2EC4 A;  2C0D A;  1XVW A;  4RQR A;  1T3B A;  4I5Q A;  10GS A;  1XVQ A;  5ECL B;  13GS A;  1ZMA A;  4YKG A;  2IMK A;  5HR1 A;  2G0F A;  4ML1 A;  1EEJ A;  3LYP A;  2EIQ A;  3A2W A;  2RM5 A;  3LQ7 A;  3I9V 2;  1OE7 A;  1EOG A;  1X9S B;  4O7H A;  3R2Q A;  1KNG A;  4HQS A;  3H79 A;  4PQH A;  1V98 A;  4HSC X;  1PD2 1;  1RK4 A;  3L78 A;  5EVO A;  6GSV A;  2YPM A;  4OCF A;  5B6M A;  1A2L A;  2CAI A;  2H73 A;  3LXT A;  5A5K A;  4N11 A;  2H6X A;  3UVH A;  3C1S A;  4AJ7 A;  3KP8 A;  3JCM L;  2QA1 A;  4KGI A;  4TXO B;  1GSD A;  4EL1 A;  2ZCT A;  4TR1 A;  4DSR A;  4JU5 A;  1AQV A;  2C0G A;  2VLU A;  5DQY A;  1UN2 A;  1EGO A;  4AJ8 A;  1E2Y A;  2A2P A;  3CBU A;  2LNS A;  4XS4 B;  2H76 A;  2L57 A;  1B4P A;  2YJH A;  3HA9 A;  2YWM A;  3HJO A;  1Z9H A;  1PQN A;  4K2D A;  4K8M A;  3V1W A;  5KOW A;  2LQQ A;  1S3D A;  2DIY A;  2HYX A;  2YWO A;  1AW9 A;  2IMD A;  5EL8 A;  1BJX A;  4JZQ A;  3BD2 A;  3F4R A;  2O7K A;  1DSB A;  2M46 A;  4OCE A;  2EIO A;  1ZYQ B;  4HS1 A;  3FMW A;  2KOK A;  3KMO A;  3ZVJ A;  2CVB A;  5KN3 A;  4HQZ A;  11GS A;  2IJY A;  1S3C A;  3WGX A;  3UVT A;  3D4M A;  5ECP B;  3HCZ A;  1I9D A;  2V6O A;  5AN1 A;  3FR6 A;  3LXZ A;  1SK2 A;  3GHA A;  1G7O A;  3KH7 A;  2LTK A;  3EPT A;  5DJM A;  5IPH A;  2DJ2 A;  1FAA A;  4WF5 A;  3GTU B;  2CA8 A;  2VL9 A;  2XHF A;  3P7X A;  4E8H A;  1K3L A;  4KDU A;  3DWV A;  3KD0 A;  1O85 A;  1PRX A;  5F0G A;  2IN3 A;  2HRK A;  4K1F A;  4IBP A;  2RII A;  2P31 A;  2KHP A;  4MF6 A;  2MZC A;  2HLS A;  1Z6M A;  2K6V A;  2VD0 A;  4WET A;  3PPU A;  5D9T A;  2OKA A;  1MD3 A;  1U3A A;  3IAM 2;  3CSI A;  2VCT A;  2GT5 A;  1WP0 A;  1T7P B;  1TRU A;  3APQ A;  3MSZ A;  3HZ8 A;  1XWK A;  2H1G A;  4TR4 A;  3IDV A;  1FOV A;  1ML6 A;  2GSS A;  3ZFB A;  1O7U A;  1UC7 A;  4EDY A;  3GUR A;  5BRT A;  4KCA A;  4MPF A;  2C3Q A;  3TKS E;  2VLV A;  5IO2 A;  5DAK A;  2B5Y A;  3A5I A;  2C0E A;  3H1N A;  3IC8 A;  4CY8 A;  4KCE A;  1X5E A;  4POK A;  2GQL A;  5JWO B;  4ZIL A;  1YEP A;  5KN0 A;  2X99 A;  1XW5 A;  2M72 A;  1V57 A;  1EWX A;  2OE0 A;  2CQ9 A;  4IVF A;  3P2A A;  3CXG A;  1M2D A;  1TJD A;  4XHM A;  4POM A;  1EP8 A;  4ACS A;  3C73 A;  1J0F A;  3KEB A;  4KX4 A;  3M1G A;  2C80 A;  4ILF A;  2HZE A;  3GKN A;  3MIX A;  1TI3 A;  6GSX A;  2KP2 A;  2YV7 A;  4A5P A;  1YKC A;  1EOH A;  3M0F A;  5AIS A;  2F9S A;  3MDK A;  1ST9 A;  6GSS A;  5CAX A;  3IR4 A;  2YCD A;  3IHG A;  4ECC A;  2FWG A;  3LG6 A;  1XIY A;  2GGT A;  2YWN A;  3N5O A;  2HNL A;  4MMM A;  1PMT A;  3LW9 A;  4Z2U A;  1A23 A;  2FWF A;  5JWQ B;  1K0A A;  1XPV A;  4IGJ A;  5DAL B;  5D93 A;  4GRF A;  3M3M A;  1X5C A;  3D6I A;  3Q6O A;  4PUR A;  5DVB A;  2V41 A;  5HQP A;  4DSS A;  1PFO A;  5HR2 A;  2G2Q A;  4GXZ A;  2DKI A;  3ZMK A;  4O32 A;  5FWG A;  2I1U A;  3BOA A;  3APO A;  4YKF A;  1B9X C;  2BTO T;  4GQF A;  5A4W A;  2LNT A;  3FYG A;  4QL9 A;  1WIK A;  1JLW A;  1OC9 A;  1YJ6 A;  1VGL A;  2IME A;  4PUA A;  3VWU A;  1A2J A;  1PX7 A;  3O3T A;  4OFT A;  1O8X A;  3US3 A;  2WRT A;  1J08 A;  1ERT A;  2X64 A;  2TIR A;  3F9U A;  5CRD A;  5E4W A;  5G1L A;  3K8N A;  2FNO A;  2LRN A;  5COH A;  2B7J A;  2YWI A;  4GSN A;  3MAK A;  1MDI A;  4JR4 A;  3DYR A;  2WS2 A;  3TUE A;  4LA1 A;  2X8H A;  2IFQ A;  1WJK A;  3AY8 A;  3ZML A;  1XWC A;  4CDO A;  1ERU A;  2VO4 A;  1TXX A;  3BCI A;  5H5S A;  2DML A;  2F8F A;  4WBR D;  5BMU A;  2RUE A;  3KM6 A;  3NOF A;  3APS A;  4YQU A;  3HD5 A;  4XRD A;  4IP1 A;  4WKW A;  4F9Z A;  2YNX A;  3EVI A;  4AF2 A;  2L6C A;  1M99 A;  2L5L A;  3UAR A;  1XBS A;  4IS0 A;  1ZGN A;  2JL4 A;  2CZ2 A;  4IEL A;  5CP1 A;  1Z6N A;  2H1B A;  3UIW A;  1WMJ A;  2IMI A;  4G10 A;  3GMF A;  3TOU A;  1GSY A;  5G5E A;  2YZH A;  2VCV A;  4EC0 A;  3QD9 A;  3HYP A;  2AHE A;  2QA2 A;  3F3Q A;  3FK8 A;  5AIV A;  3RAZ A;  3O76 A;  3EE2 A;  4PUF C;  1AIU A;  1HNB A;  1CQH A;  22GS A;  5G1K A;  1A0F A;  1M2B A;  1MD4 A;  1TDI A;  2TRX A;  3C7M A;  2LJK A;  2VM1 A;  1X9W B;  4L5L A;  4NHZ A;  1THO A;  1A24 A;  5CRE A;  3DXB A;  18GS A;  2OAC A;  4NHW A;  4K0G A;  3CRT A;  4MJE A;  4GQC A;  2PVQ A;  5LCZ A;  4MJB A;  2GDR A;  2PER A;  1F2E A;  1M3I A;  1OKD A;  1F6M C;  4XTS A;  2E2G A;  1SK0 A;  1X0R A;  4BVY B;  2GZP A;  3GUS A;  1R7H A;  3IBH A;  2ON5 A;  4MJA A;  1VF2 A;  1B48 A;  3TB2 A;  1O81 A;  2C3T A;  2EIR A;  4KSM A;  3FZ5 A;  2C8U A;  5ID2 B;  4IN0 A;  4X43 A;  1X9M B;  1ILO A;  1WWJ A;  4POB A;  2UZ8 A;  4FO5 A;  4EUY A;  3RHC A;  4K0N A;  2YAN A;  4ZB9 A;  4AGS A;  2GSR A;  1R5P A;  2CZ3 A;  2O87 A;  4EE0 A;  4EVM A;  2OBK A;  3L4N A;  2XBQ A;  2N5B A;  1U88 A;  5FT3 A;  4IJI A;  3GIX A;  5G2Z A;  4MZW A;  4BPY A;  2O89 A;  5IMF A;  5IMZ A;  3PH9 A;  5E59 A;  2H72 A;  3E3E A;  3ZIJ A;  4XS6 A;  1HYU A;  1K0D A;  4Q5Q A;  4MA9 A;  1LU4 A;  1S3R A;  3LEF A;  1OC3 A;  4MJC A;  2VM2 A;  1K0C A;  4CHS A;  3G9B A;  2REM A;  5ECH B;  4K7I A;  2A4H A;  9GSS A;  2B5X A;  3UMA A;  1FW1 A;  2ES7 A;  3M9K A;  1GSU A;  3W8S A;  1W89 A;  4I6X A;  3EWL A;  1Y25 A;  1WOU A;  5B7C A;  2AJQ B;  1ERV A;  1NM3 A;  3MWH A;  3LSZ A;  5EPF A;  1WPI A;  1E6B A;  1GWC A;  2HSM A;  4GSS A;  2HRA A;  1K3O A;  5EY6 A;  4Z2T A;  4MP4 A;  2P5Q A;  4DEJ A;  3TJK A;  4ZL9 A;  3KZQ A;  2DLX A;  3DVX A;  4TW5 A;  5IIZ A;  3HVX A;  4TOP A;  5CYY A;  1BX9 A;  2PBJ A;  1M2A A;  5ELG A;  4DVC A;  1TP9 A;  4K9Z A;  1GTI A;  3TRQ A;  1G0T A;  4NV5 A;  3IA1 A;  1YDK A;  1B4Q A;  4MPG A;  4NWY A;  2B5E A;  1JZR A;  1DBY A;  1GNE A;  2WUL A;  3L9V A;  3PR8 A;  2HT9 A;  1F3B A;  3DGQ A;  4ZIJ A;  5DCH A;  2H6Z A;  3W6G A;  1T4Z A;  2K8V A;  4BL7 B;  1NW2 A;  2AAW A;  1Z7P A;  4X0X A;  2A2S A;  2QGV A;  2PN8 A;  1IYH A;  3QDN A;  4O5Q A;  3EMP A;  3TJG A;  8GSS A;  5A4V A;  4MH3 A;  1VF4 A;  4Z7X A;  3VWW A;  2JSZ A;  4BIK A;  3D0Z A;  3FZ4 A;  1R26 A;  1GL8 A;  3KCM A;  2JZS A;  2I4A A;  4D73 B;  3WGE A;  19GS A;  3P90 A;  2AV4 A;  3DEX A;  3DKS A;  2B1K A;  4PQ1 A;  3ED3 A;  1SK1 A;  1C72 A;  1GRX A;  1WRY A;  4F82 A;  2HZE B;  2IL3 A;  1EV4 A;  1JZD A;  1TRS A;  3J7Y b;  1FHE A;  4BA7 A;  1PKZ A;  1ZZY A;  2N5F A;  4JBB A;  1MDJ A;  2HSH A;  1SU9 A;  4V2M A;  1YF0 A;  3QAW A;  2XC2 A;  5IOX A;  2A2R A;  2ZUP A;  1FVJ A;  1QXH A;  3FRC A;  5ECI B;  3HZ4 A;  3DVW A;  3EUR A;  3A2X A;  1ON4 A;  4EF0 A;  3VI5 A;  2VCW A;  3KP9 A;  3HXS A;  4BVX B;  5CRG A;  3F3R A;  1FB0 A;  4KW6 A;  5ENU A;  4Q5F A;  1Y6E A;  4WR4 A;  1GTA A;  3ZLP A;  4WF4 A;  2F3M A;  5JWR B;  1V40 A;  1XW9 A;  7GSS A;  3TKP A;  2TRC P;  2A4V A;  2V1M A;  1EEM A;  2JZT A;  2PUK C;  4EO3 A;  4POL A;  2LKU A;  2GST A;  4OMV A;  5C04 A;  5B6N A;  1XOB A;  4BWS A;  2PWJ A;  3GL5 A;  4DSQ A;  4ECI A;  3C71 A;  2KP1 A;  4QL7 A;  4XIH A;  1B8X A;  1GUK A;  1Z5Y E;  3DRN A;  3FHK A;  2H0I A;  3KJY A;  3LYK A;  5B8A A;  1XOA A;  1NHO A;  3ISO A;  3ZVJ D;  5J41 A;  2VOC A;  4FYU A;  5KEJ A;  1O8W A;  1EP7 A;  5ECQ B;  5CRW A;  1Q98 A;  1FB6 A;  1XXU A;  2LS5 A;  2VIM A;  1FVK A;  2R0P A;  2WGR A;  2HSY A;  2WDU A;  2B6M A;  4MLY A;  3SBC A;  2MBT A;  1AC1 A;  1FO5 A;  1THX A;  1X5D A;  3KIJ A;  2J9H A;  4FQU A;  4XS4 A;  4X1U A;  5IO0 A;  3TRP A;  2VCZ A;  1JHB A;  4N30 A;  3ZIT A;  2VL3 A;  4V1A p;  3S9F A;  4I2U A;  2F51 A;  5DCG A;  6GSY A;  5F07 A;  3TRX A;  4TXV A;  5HFK A;  3GV1 A;  1G6Y A;  4EXJ A;  1F3A A;  1XFL A;  1ZYP A;  2NBS A;  4TKY A;  1AQW A;  3TKR A;  4PNG A;  2V2G A;  4I2T A;  4GLT A;  2R5G A;  3WD6 A;  3WGD A;  3OR5 A;  1TK0 B;  4NXI A;  1SYX A;  3QAG A;  1T1V A;  2OBI A;  3GST A;  5HFI A;  1YY7 A;  4ECB A;  2YOI A;  4NPB A;  3KMN A;  4KND A;  1YKA A;  2IWT A;  1YQ1 A;  4IP6 A;  3LFL A;  5J9C A;  2H0H A;  3KXO A;  3LWA A;  4MAB A;  5J4U A;  3Q19 A;  2H66 A;  3L9U A;  1K3Y A;  3HJM A;  4I8B A;  1Z7R A;  6GST A;  3EMX A;  2B3S A;  2LQO A;  1PL2 A;  4J57 E;  2LV3 A;  3GTU A;  3QAV A;  4IQA A;  4ISD A;  5C00 A;  3WT2 A;  1OKT A;  1ABA A;  1TOF A;  3GX8 A;  4HUA A;  4TR0 A;  3ERW A;  4CW9 A;  2NVL A;  3KTL A;  4RQX A;  2M80 A;  2E7P A;  2FD3 A;  4WBJ A;  1B9Y C;  2OE3 A;  3VFI A;  1TKD B;  3O6T A;  1PL1 A;  2CV4 A;  2R4V A;  4KA0 A;  2C0F A;  4N10 A;  1ZCP A;  1G7E A;  2VLT A;  4O92 A;  4GWR A;  5JCU A;  2PVO C; 
#chains in the Genus database with same CATH homology
 2MYG A;  1TW9 A;  3UEM A;  2L4C A;  1GUL A;  2JU5 A;  1GSF A;  2E0Q A;  2VL2 A;  2WCI A;  4TR3 A;  1LBK A;  3HY2 A;  1XWB A;  3RPP A;  1TK8 B;  4ZBA A;  2V32 A;  5F06 A;  4USS A;  2H30 A;  3GKK A;  2LEG A;  1SL0 B;  2CX3 A;  2LJA A;  2H0G A;  3U5R E;  2H6Y A;  3WYW A;  14GS A;  3GH6 A;  3TJB A;  3L0H A;  1AQX A;  2ON7 A;  4PTS A;  1PX6 A;  3RDW A;  2K9F A;  5D9X A;  4IHU A;  4PNF A;  1QK8 A;  2HE3 A;  2H8L A;  1GTB A;  1O73 A;  2HFD A;  1JFU A;  4HJM A;  2DBC A;  4G0L A;  4XRA A;  3RPN A;  5D8I A;  4ZB8 A;  2O85 A;  3VI7 A;  1ACV A;  3ZRE A;  2YJ7 A;  3NIV A;  2VL2 C;  3DIE A;  2GZZ A;  2YV9 A;  2CX4 A;  1Q4J A;  1YF1 A;  4WR5 A;  3UOM A;  1AUC A;  2FA8 A;  2B7K A;  4ZBD A;  4PGT A;  3Q18 A;  4FH8 A;  3E0U A;  2YZU A;  4EIP A;  4ZXG A;  3TGZ A;  4LL1 B;  5IMV A;  2PGT A;  4L8E A;  1UA5 A;  5ECK B;  1GSQ A;  3QFA C;  4EKZ A;  3TKQ A;  5DAL A;  1F9M A;  2FWH A;  2VCQ A;  3GA4 A;  4JED A;  3Q74 A;  1TI1 A;  4TR1 B;  1U3I A;  5DQS A;  4K5R A;  3CSH A;  1XCC A;  4OD7 A;  2X4A A;  3H93 A;  3GKM A;  3VPQ A;  4YAP A;  2FWE A;  5L71 A;  3FW2 A;  4GF0 A;  3ZZX A;  5A4U A;  3CSJ A;  2L5O A;  2R0C A;  3FZ9 A;  2I3Y A;  5GZZ B;  3FZA A;  2I81 A;  4HOJ A;  1Z3E A;  2FLS A;  3NZN A;  1OVN A;  3RBT A;  1MTC A;  1BAY A;  3A5W A;  3WT1 A;  1K0B A;  3VLN A;  4MF7 A;  5IMA A;  3I69 A;  4K5S A;  1J9B A;  1V9W A;  2ALB A;  2YP6 A;  3CMI A;  4K7N A;  3HHV A;  3QPM A;  5DBQ A;  2XPE A;  1K0O A;  2MMO A;  2DIZ A;  3MNG A;  1PN0 A;  4N0Z A;  2JZR A;  2RLI A;  3F4T A;  3F63 A;  4LLR A;  2GVP A;  5ELA A;  3ZYW A;  3RHB A;  3VK9 A;  5IOW A;  1AXD A;  2LST A;  4K2X A;  2O8V B;  4NMU A;  4Q5N A;  3SWL A;  1OYJ A;  2X8G A;  3UJ1 A;  3HVS A;  1I5G A;  4TN8 A;  1IYI A;  4MZC A;  4OO4 A;  1JZW A;  3CRU A;  2GLR A;  1BG5 A;  4GST A;  3GH9 A;  1PN9 A;  1GP1 A;  3ZIV A;  2VAF A;  2DMM A;  5ECN B;  3ZL5 A;  2R3X A;  2K8S A;  4Q5R A;  4YH2 A;  2V6K A;  2CVK A;  3CYN A;  3UAP A;  4TRX A;  4WEY A;  1N2A A;  5IMC A;  4JE1 A;  5H5R A;  5CO3 A;  2FA4 A;  4RUV A;  3U6V A;  1PKW A;  2WB9 A;  1URM A;  1OC8 A;  2LUS A;  2H75 A;  3ZFL A;  5CRH A;  2MMA A;  3QCP A;  2LRC A;  2XBI A;  3FEU A;  3IK9 A;  3R3E A;  5D9V A;  5DAK B;  4HJ2 A;  1SD8 A;  3FY7 A;  3G7I A;  4L0W A;  5CNW A;  2FGX A;  1MEK A;  4L0U A;  1HNC A;  3UBL A;  5FHI A;  3GYK A;  4BVY A;  1F37 A;  1FOH A;  4I97 A;  1R5A A;  5AIX A;  1TRW A;  5J5N A;  4XCS A;  1SJ6 A;  3L9S A;  2YN1 A;  3D5J A;  2GSQ A;  1HQO A;  4J2F A;  3LOR A;  4V2L A;  1BED A;  3F0I A;  3BCK A;  1ZYN A;  4F03 A;  5ID2 A;  4G0I A;  1GLQ A;  3F6D A;  6GSU A;  1K0M A;  1M9A A;  1KTE A;  1GH2 A;  1SKR B;  2JSY A;  4HI7 A;  4NV2 A;  4MNN A;  5H5Q A;  5F05 A;  4ZBB A;  3DML A;  2R37 A;  3D21 A;  1HNA A;  4MH2 A;  4ID0 A;  3KGK A;  3QFB C;  5LNK e;  2D2Z A;  1KBN A;  3IE3 A;  2X49 A;  2B1L A;  2H70 A;  4KDY A;  2WFC A;  4ULX A;  4OWY A;  3VPT A;  1DE1 A;  3G7J A;  4EIQ A;  5G31 A;  1T4Y A;  4F0C A;  1GSE A;  5G30 A;  2CVD A;  5B8B A;  1T8E B;  3EYT A;  2VUP A;  4IJ3 A;  4FIW A;  1SKW B;  4DSS B;  3TKS A;  4IW9 A;  3D22 A;  2F8A A;  2OAD A;  4L5O A;  3IXR A;  2IMF A;  4JRR A;  3GNJ A;  2AYT A;  1TRV A;  2OA7 A;  5GSS A;  2VD1 A;  2HI7 A;  3C8E A;  5ECO B;  1GNW A;  3TCO A;  4YQM A;  3W8J A;  3CTG A;  3HVV A;  3D4T A;  3GRX A;  5IM9 A;  4V2N A;  4MK3 A;  2GZY A;  1O6J A;  1OC9 B;  1ZOF A;  3ME8 A;  2H74 A;  2CT6 A;  2L6D A;  2H1A A;  5ECS A;  2DC5 A;  4MDC A;  1GTU A;  2J23 A;  4FYC A;  4MCU A;  2HZF A;  4KUN A;  4HZ4 A;  2P0G A;  2WZ9 A;  4V1A g;  4TXO A;  3IOS A;  1G6W A;  4JR6 A;  4HDE A;  4PQI A;  1OAZ A;  3LGC A;  1T00 A;  4IKH A;  3FR9 A;  4NAX A;  3GSS A;  1H4O A;  3VWV A;  5J3R A;  2C3N A;  1PA3 A;  2H71 A;  2IFQ B;  1PGT A;  4BL7 A;  5HFG A;  1JLV A;  2QSI A;  2RM6 A;  2BJX A;  1VRS D;  1LJR A;  3C1R A;  3P8W A;  1GUM A;  4RI6 A;  2GTU A;  3TKS C;  2JAC A;  1GSS A;  5JCW A;  2PMT A;  2Z9S A;  3M9J A;  6GSW A;  5ECR B;  2PU9 C;  3HDC A;  17GS A;  2KUC A;  4D73 A;  1XW6 A;  1BQ7 A;  3TOT A;  3BJ5 A;  2QKE A;  4RI7 A;  5IQY A;  1ERW A;  4J56 E;  4Z2R A;  3IC4 A;  1NSW A;  2OJL A;  3LJR A;  1QUW A;  4KSO A;  1A2M A;  1TK5 B;  3EU4 A;  4MZB A;  1SKS B;  2HRF A;  5J9B A;  3F4S A;  3TDG A;  1QQ2 A;  2R2J A;  3J7Y k;  3TJJ A;  3ERF A;  5LD0 A;  3DD3 A;  4ICY A;  1SYR A;  2HXK A;  1A8Y A;  1FG4 A;  3HKR A;  5ABR A;  4OFN A;  5HR3 A;  4BVX A;  1A8L A;  2C4J A;  2DJ0 A;  2FY6 A;  3PGT A;  1UVZ A;  2E2M A;  1EGR A;  5JCG A;  5G5F A;  5GAN D;  2FUG 2;  1S3A A;  2DJJ A;  1DUG A;  1XZO A;  1EV9 A;  1GLP A;  2HRN A;  4WXT A;  4PXO A;  5D96 A;  5IMD A;  2GQK A;  1OE8 A;  4CY6 A;  4ZB6 A;  2LRT A;  4H86 A;  2BMX A;  1XWA A;  2H19 A;  5KN1 A;  1GUH A;  2P5R A;  4F0B A;  4OFM A;  2GS3 A;  2K18 A;  4ZL7 A;  3QR6 A;  5GST A;  4HU9 A;  1TTZ A;  4O5U A;  1SEN A;  2IIY A;  2ZNM A;  2NPB A;  4ECJ A;  1W4V A;  5IPG A;  4QQ7 A;  2R6K A;  3QMX A;  3N9J A;  5F8B A;  3IAS 2;  3VWX A;  2L4Q A;  1KEB A;  3TJF A;  5D9W A;  3A3T A;  4KDX A;  3EIN A;  5KOX A;  3GX0 A;  3ME7 A;  3BBY A;  3ZRD A;  3GN3 A;  4E8E A;  2XPD A;  3VUR A;  2I9H A;  1RW1 A;  2DSA A;  2MBS A;  1CQG A;  2GT6 A;  3EU3 A;  1JZO A;  2RUF A;  2MMN A;  1HD2 A;  1NHY A;  1ZYE A;  4TVE A;  5KN2 A;  1SL2 B;  4GCI A;  4EDZ A;  3H4K A;  4YQV A;  4LL4 B;  1SJI A;  2AUV A;  1TU8 A;  1QFN A;  2MMZ A;  1QGV A;  4LMW A;  3IK7 A;  3KH9 A;  2NDO A;  1ZL9 A;  4K7O A;  4KAE A;  2CAQ A;  1TU7 A;  1XWG A;  2DJ3 A;  1M0U A;  1M9B A;  5INY A;  4FYB A;  4KH7 A;  4BWQ A;  2DKH A;  4MF5 A;  2FHE A;  3ERG A;  4G19 A;  3F6F A;  5GAP D;  1U6T A;  5ECM B;  3GL3 A;  1SL1 B;  4ZL8 A;  4ML6 A;  3FKF A;  3I6A A;  4HZ2 A;  4P3Y B;  3F8U A;  1A0R P;  3FR3 A;  3E9J B;  2LJR A;  1V2A A;  2H1D A;  2PPT A;  2KLX A;  5DDL A;  2C1Y A;  1SD9 A;  2WJU A;  1VF3 A;  4X4J A;  4G0K A;  3IV4 A;  1RQM A;  2R0G A;  1USB A;  1PSQ A;  1MDK A;  3IRA A;  4YAV A;  2NTO A;  3MYD A;  1R4W A;  1EZK A;  2AB6 A;  3GKX A;  3IPZ A;  3CTF A;  1U87 A;  1M7T A;  3M8N A;  4AJ6 A;  20GS A;  2X8C A;  4XS1 A;  1YEX A;  3KTB A;  1H75 A;  3G7Y A;  4HEA 2;  4N0V A;  5HR0 A;  12GS A;  4O5R A;  4GTU A;  4K6X A;  3PIN A;  3IHQ A;  2JAD A;  2N5A A;  3QOU A;  3UBK A;  4PX1 A;  1BYE A;  1VF1 A;  2IPA A;  2FCH A;  4G9H A;  2DJK A;  3GFK A;  1QMV A;  4G2E A;  2QC7 A;  4OO5 A;  3HJP A;  4HU7 A;  2VCX A;  1N8J A;  5DJL A;  1YZX A;  4KB3 A;  1DE2 A;  3UL3 A;  3I43 A;  1K0N A;  2OE1 A;  2GQM A;  2DJ1 A;  5AGY A;  16GS A;  5D73 A;  4LMV A;  3A2V A;  3ZTL A;  4KF9 A;  3H8Q A;  4KE3 A;  1WE0 A;  1AAZ A;  4F2I A;  2H01 A;  1SJZ A;  4IQ1 A;  3EC3 A;  1V58 A;  2L59 A;  2EC4 A;  2C0D A;  1XVW A;  4RQR A;  1T3B A;  4I5Q A;  10GS A;  1XVQ A;  5ECL B;  13GS A;  1ZMA A;  4YKG A;  2IMK A;  5HR1 A;  2G0F A;  4ML1 A;  1EEJ A;  3LYP A;  2EIQ A;  3A2W A;  2RM5 A;  3LQ7 A;  3I9V 2;  1OE7 A;  1EOG A;  1X9S B;  4O7H A;  3R2Q A;  1KNG A;  4HQS A;  3H79 A;  4PQH A;  1V98 A;  1PD2 1;  1RK4 A;  3L78 A;  5EVO A;  6GSV A;  2YPM A;  4OCF A;  5B6M A;  1A2L A;  2CAI A;  2H73 A;  3LXT A;  5A5K A;  4N11 A;  2H6X A;  3UVH A;  3C1S A;  4AJ7 A;  3KP8 A;  3JCM L;  2QA1 A;  4KGI A;  4TXO B;  1GSD A;  4EL1 A;  2ZCT A;  4TR1 A;  4DSR A;  4JU5 A;  1AQV A;  2C0G A;  2VLU A;  5DQY A;  1UN2 A;  1EGO A;  4AJ8 A;  1E2Y A;  2A2P A;  3CBU A;  2LNS A;  4XS4 B;  2H76 A;  2L57 A;  1B4P A;  2YJH A;  3HA9 A;  2YWM A;  3HJO A;  1Z9H A;  1PQN A;  4K2D A;  4K8M A;  3V1W A;  5KOW A;  2LQQ A;  1S3D A;  2DIY A;  2HYX A;  2YWO A;  1AW9 A;  2IMD A;  5EL8 A;  1BJX A;  4JZQ A;  3BD2 A;  3F4R A;  2O7K A;  1DSB A;  2M46 A;  4OCE A;  2EIO A;  1ZYQ B;  4HS1 A;  3FMW A;  2KOK A;  3KMO A;  3ZVJ A;  2CVB A;  5KN3 A;  4HQZ A;  11GS A;  2IJY A;  1S3C A;  3WGX A;  3UVT A;  3D4M A;  5ECP B;  3HCZ A;  1I9D A;  2V6O A;  5AN1 A;  3FR6 A;  3LXZ A;  1SK2 A;  3GHA A;  1G7O A;  3KH7 A;  2LTK A;  3EPT A;  5DJM A;  5IPH A;  2DJ2 A;  1FAA A;  4WF5 A;  3GTU B;  2CA8 A;  2VL9 A;  2XHF A;  3P7X A;  4E8H A;  1K3L A;  4KDU A;  3DWV A;  3KD0 A;  1O85 A;  1PRX A;  5F0G A;  2IN3 A;  2HRK A;  4K1F A;  4IBP A;  2RII A;  2P31 A;  2KHP A;  4MF6 A;  2MZC A;  2HLS A;  1Z6M A;  2K6V A;  2VD0 A;  4WET A;  3PPU A;  5D9T A;  2OKA A;  1MD3 A;  1U3A A;  3IAM 2;  3CSI A;  2VCT A;  2GT5 A;  1WP0 A;  1T7P B;  1TRU A;  3APQ A;  3MSZ A;  3HZ8 A;  1XWK A;  2H1G A;  4TR4 A;  3IDV A;  1FOV A;  1ML6 A;  2GSS A;  3ZFB A;  1O7U A;  1UC7 A;  4EDY A;  3GUR A;  5BRT A;  4KCA A;  4MPF A;  2C3Q A;  3TKS E;  2VLV A;  5IO2 A;  5DAK A;  2B5Y A;  3A5I A;  2C0E A;  3H1N A;  3IC8 A;  4CY8 A;  4KCE A;  1X5E A;  4POK A;  2GQL A;  5JWO B;  4ZIL A;  1YEP A;  5KN0 A;  2X99 A;  1XW5 A;  2M72 A;  1V57 A;  1EWX A;  2OE0 A;  2CQ9 A;  4IVF A;  3P2A A;  3CXG A;  1M2D A;  1TJD A;  4XHM A;  4POM A;  1EP8 A;  4ACS A;  3C73 A;  1J0F A;  3KEB A;  4KX4 A;  3M1G A;  2C80 A;  4ILF A;  2HZE A;  3GKN A;  3MIX A;  1TI3 A;  6GSX A;  2KP2 A;  2YV7 A;  4A5P A;  1YKC A;  1EOH A;  3M0F A;  5AIS A;  2F9S A;  3MDK A;  1ST9 A;  6GSS A;  5CAX A;  3IR4 A;  2YCD A;  3IHG A;  4ECC A;  2FWG A;  3LG6 A;  1XIY A;  2GGT A;  2YWN A;  3N5O A;  2HNL A;  4MMM A;  1PMT A;  3LW9 A;  4Z2U A;  1A23 A;  2FWF A;  5JWQ B;  1K0A A;  1XPV A;  4IGJ A;  5DAL B;  5D93 A;  4GRF A;  3M3M A;  1X5C A;  3D6I A;  3Q6O A;  4PUR A;  5DVB A;  2V41 A;  5HQP A;  4DSS A;  5HR2 A;  2G2Q A;  4GXZ A;  2DKI A;  3ZMK A;  4O32 A;  5FWG A;  2I1U A;  3BOA A;  3APO A;  4YKF A;  1B9X C;  2BTO T;  4GQF A;  5A4W A;  2LNT A;  3FYG A;  4QL9 A;  1WIK A;  1JLW A;  1OC9 A;  1YJ6 A;  1VGL A;  2IME A;  4PUA A;  3VWU A;  1A2J A;  1PX7 A;  3O3T A;  4OFT A;  1O8X A;  3US3 A;  2WRT A;  1J08 A;  1ERT A;  2X64 A;  2TIR A;  3F9U A;  5CRD A;  5E4W A;  5G1L A;  3K8N A;  2FNO A;  2LRN A;  5COH A;  2B7J A;  2YWI A;  4GSN A;  3MAK A;  1MDI A;  4JR4 A;  3DYR A;  2WS2 A;  3TUE A;  4LA1 A;  2X8H A;  2IFQ A;  1WJK A;  3AY8 A;  3ZML A;  1XWC A;  4CDO A;  1ERU A;  2VO4 A;  1TXX A;  3BCI A;  5H5S A;  2DML A;  2F8F A;  4WBR D;  5BMU A;  2RUE A;  3KM6 A;  3NOF A;  3APS A;  4YQU A;  3HD5 A;  4XRD A;  4IP1 A;  4WKW A;  4F9Z A;  2YNX A;  3EVI A;  4AF2 A;  2L6C A;  1M99 A;  2L5L A;  3UAR A;  1XBS A;  4IS0 A;  1ZGN A;  2JL4 A;  2CZ2 A;  4IEL A;  5CP1 A;  1Z6N A;  2H1B A;  3UIW A;  1WMJ A;  2IMI A;  4G10 A;  3GMF A;  3TOU A;  1GSY A;  5G5E A;  2YZH A;  2VCV A;  4EC0 A;  3QD9 A;  3HYP A;  2AHE A;  2QA2 A;  3F3Q A;  3FK8 A;  5AIV A;  3RAZ A;  3O76 A;  3EE2 A;  4PUF C;  1AIU A;  1HNB A;  1CQH A;  22GS A;  5G1K A;  1A0F A;  1M2B A;  1MD4 A;  1TDI A;  2TRX A;  3C7M A;  2LJK A;  2VM1 A;  1X9W B;  4L5L A;  4NHZ A;  1THO A;  1A24 A;  5CRE A;  3DXB A;  18GS A;  2OAC A;  4NHW A;  4K0G A;  3CRT A;  4MJE A;  4GQC A;  2PVQ A;  5LCZ A;  4MJB A;  2GDR A;  2PER A;  1F2E A;  1OKD A;  1F6M C;  4XTS A;  2E2G A;  1SK0 A;  1X0R A;  4BVY B;  2GZP A;  3GUS A;  1R7H A;  3IBH A;  2ON5 A;  4MJA A;  1VF2 A;  1B48 A;  3TB2 A;  1O81 A;  2C3T A;  2EIR A;  4KSM A;  3FZ5 A;  2C8U A;  5ID2 B;  4IN0 A;  4X43 A;  1X9M B;  1ILO A;  1WWJ A;  4POB A;  2UZ8 A;  4FO5 A;  4EUY A;  3RHC A;  4K0N A;  2YAN A;  4ZB9 A;  4AGS A;  2GSR A;  1R5P A;  2CZ3 A;  2O87 A;  4EE0 A;  4EVM A;  2OBK A;  3L4N A;  2XBQ A;  2N5B A;  1U88 A;  5FT3 A;  4IJI A;  3GIX A;  5G2Z A;  4MZW A;  4BPY A;  2O89 A;  5IMF A;  5IMZ A;  3PH9 A;  5E59 A;  2H72 A;  3E3E A;  3ZIJ A;  4XS6 A;  1HYU A;  1K0D A;  4Q5Q A;  4MA9 A;  1LU4 A;  3LEF A;  1OC3 A;  4MJC A;  2VM2 A;  1K0C A;  4CHS A;  3G9B A;  2REM A;  5ECH B;  4K7I A;  2A4H A;  9GSS A;  2B5X A;  3UMA A;  1FW1 A;  2ES7 A;  3M9K A;  1GSU A;  3W8S A;  1W89 A;  4I6X A;  3EWL A;  1Y25 A;  1WOU A;  5B7C A;  2AJQ B;  1ERV A;  1NM3 A;  3MWH A;  3LSZ A;  5EPF A;  1WPI A;  1E6B A;  1GWC A;  2HSM A;  4GSS A;  2HRA A;  1K3O A;  5EY6 A;  4Z2T A;  4MP4 A;  2P5Q A;  4DEJ A;  3TJK A;  4ZL9 A;  3KZQ A;  2DLX A;  3DVX A;  4TW5 A;  5IIZ A;  3HVX A;  4TOP A;  5CYY A;  1BX9 A;  2PBJ A;  1M2A A;  5ELG A;  4DVC A;  1TP9 A;  4K9Z A;  1GTI A;  3TRQ A;  1G0T A;  4NV5 A;  3IA1 A;  1YDK A;  1B4Q A;  4MPG A;  4NWY A;  2B5E A;  1JZR A;  1DBY A;  1GNE A;  2WUL A;  3L9V A;  3PR8 A;  2HT9 A;  1F3B A;  3DGQ A;  4ZIJ A;  5DCH A;  2H6Z A;  3W6G A;  1T4Z A;  2K8V A;  4BL7 B;  1NW2 A;  2AAW A;  1Z7P A;  4X0X A;  2A2S A;  2QGV A;  2PN8 A;  1IYH A;  3QDN A;  4O5Q A;  3EMP A;  3TJG A;  8GSS A;  5A4V A;  4MH3 A;  1VF4 A;  4Z7X A;  3VWW A;  2JSZ A;  3D0Z A;  3FZ4 A;  1R26 A;  1GL8 A;  3KCM A;  2JZS A;  2I4A A;  4D73 B;  3WGE A;  19GS A;  3P90 A;  2AV4 A;  3DEX A;  3DKS A;  2B1K A;  4PQ1 A;  3ED3 A;  1SK1 A;  1C72 A;  1GRX A;  1WRY A;  4F82 A;  2HZE B;  2IL3 A;  1EV4 A;  1JZD A;  1TRS A;  3J7Y b;  1FHE A;  4BA7 A;  1PKZ A;  1ZZY A;  2N5F A;  4JBB A;  1MDJ A;  2HSH A;  1SU9 A;  4V2M A;  1YF0 A;  3QAW A;  2XC2 A;  5IOX A;  2A2R A;  2ZUP A;  1FVJ A;  1QXH A;  3FRC A;  5ECI B;  3HZ4 A;  3DVW A;  3EUR A;  3A2X A;  1ON4 A;  4EF0 A;  3VI5 A;  2VCW A;  3KP9 A;  3HXS A;  4BVX B;  5CRG A;  3F3R A;  1FB0 A;  4KW6 A;  5ENU A;  4Q5F A;  1Y6E A;  4WR4 A;  1GTA A;  3ZLP A;  4WF4 A;  2F3M A;  5JWR B;  1V40 A;  1XW9 A;  7GSS A;  3TKP A;  2TRC P;  2A4V A;  2V1M A;  1EEM A;  2JZT A;  2PUK C;  4EO3 A;  4POL A;  2LKU A;  2GST A;  4OMV A;  5C04 A;  5B6N A;  1XOB A;  4BWS A;  2PWJ A;  3GL5 A;  4DSQ A;  4ECI A;  3C71 A;  2KP1 A;  4QL7 A;  4XIH A;  1B8X A;  1GUK A;  1Z5Y E;  3DRN A;  3FHK A;  2H0I A;  3KJY A;  3LYK A;  5B8A A;  1XOA A;  1NHO A;  3ISO A;  3ZVJ D;  5J41 A;  2VOC A;  4FYU A;  5KEJ A;  1O8W A;  1EP7 A;  5ECQ B;  5CRW A;  1Q98 A;  1FB6 A;  1XXU A;  2LS5 A;  2VIM A;  1FVK A;  2R0P A;  2WGR A;  2HSY A;  2WDU A;  2B6M A;  4MLY A;  3SBC A;  2MBT A;  1AC1 A;  1FO5 A;  1THX A;  1X5D A;  3KIJ A;  2J9H A;  4FQU A;  4XS4 A;  4X1U A;  5IO0 A;  3TRP A;  2VCZ A;  1JHB A;  4N30 A;  3ZIT A;  2VL3 A;  4V1A p;  3S9F A;  4I2U A;  2F51 A;  5DCG A;  6GSY A;  5F07 A;  3TRX A;  4TXV A;  5HFK A;  3GV1 A;  1G6Y A;  4EXJ A;  1F3A A;  1XFL A;  1ZYP A;  2NBS A;  4TKY A;  1AQW A;  3TKR A;  4PNG A;  2V2G A;  4I2T A;  4GLT A;  2R5G A;  3WD6 A;  3WGD A;  3OR5 A;  1TK0 B;  4NXI A;  1SYX A;  3QAG A;  1T1V A;  2OBI A;  3GST A;  5HFI A;  1YY7 A;  4ECB A;  2YOI A;  4NPB A;  3KMN A;  4KND A;  1YKA A;  2IWT A;  1YQ1 A;  4IP6 A;  3LFL A;  5J9C A;  2H0H A;  3KXO A;  3LWA A;  4MAB A;  5J4U A;  3Q19 A;  2H66 A;  3L9U A;  1K3Y A;  3HJM A;  4I8B A;  1Z7R A;  6GST A;  3EMX A;  2B3S A;  2LQO A;  1PL2 A;  4J57 E;  2LV3 A;  3GTU A;  3QAV A;  4IQA A;  4ISD A;  5C00 A;  3WT2 A;  1OKT A;  1ABA A;  1TOF A;  3GX8 A;  4HUA A;  4TR0 A;  3ERW A;  4CW9 A;  2NVL A;  3KTL A;  4RQX A;  2M80 A;  2E7P A;  2FD3 A;  4WBJ A;  1B9Y C;  2OE3 A;  3VFI A;  1TKD B;  3O6T A;  1PL1 A;  2CV4 A;  2R4V A;  4KA0 A;  2C0F A;  4N10 A;  1ZCP A;  1G7E A;  2VLT A;  4O92 A;  4GWR A;  5JCU A;  2PVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...