1JHBA

Human glutaredoxin in fully reduced form, nmr, 20 structures
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
AQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structure of human glutaredoxin in the fully reduced form.
pubmed doi rcsb
molecule keywords GLUTAREDOXIN
molecule tags Electron transport
source organism Homo sapiens
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1998-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1jhbA00
2B1LA 2LKUA 5KEJA 1XVWA 2DBCA 3UIWA 1X5EA 2IMFA 4RQXA 3KD0A 2J9HA 3KTLA 4IW9A 4TN8A 3ZLPA 4IJ3A 2K9FA 2R4VA 2VO4A 3TJBA 1GUKA 1K0BA 4HU7A 5G5FA 1BAYA 1QGVA 4CDOA 5D9XA 2X8GA 5C04A 2E7PA 4O32A 3TKSA 2LNSA 4MJCA 5AISA 1EEMA 3DYRA 4ZL7A 1YDKA 2MMNA 3KTBA 1QK8A 4BVYA 1PQNA 4K7OA 4MP4A 5ECKB 1XOBA 2M72A 3PR8A 3ERWA 2B5XA 3TGZA 4V2MA 2WGRA 1JZDA 2JSZA 2H19A 1SENA 3QMXA 3CTGA 2AJQB 1RK4A 3HKRA 1OVNA 1G6YA 1DBYA 2YP6A 1PN9A 4HJ2A 3EU3A 4PUAA 2DLXA 5JWRB 2H71A 4KAEA 5AIVA 1GULA 4IGJA 1PSQA 1YEXA 1SD8A 3DEXA 3BJ5A 1UVZA 3GKMA 2XC2A 5G5EA 1X9SB 4WR4A 3N5OA 3GKXA 4F0CA 2PVQA 1VF4A 2GZYA 2VAFA 2IFQB 2DJJA 2C80A 2R37A 2OBKA 4G10A 4K0GA 2VL2A 1U3AA 2VCQA 1TRVA 2IMEA 3ZZXA 4EKZA 1V9WA 1A8LA 4L5OA 1HYUA 2LEGA 3DVXA 3HJPA 1B8XA 4Q5FA 1GRXA 2GZZA 1GL8A 3H8QA 5DVBA 3M9JA 3TKRA 4MMMA 3FYGA 4L0WA 5ECOB 4KE3A 1EGOA 2CVBA 1TK5B 1AAZA 3Q74A 1BG5A 2N5BA 1YQ1A 2XBQA 1XBSA 2VCVA 3U5RE 1QUWA 3F6DA 4MF6A 1T7PB 1FAAA 3UBLA 5HR2A 5JWOB 2TRXA 1BQ7A 5IM9A 4XHMA 1Z7PA 5ECRB 2GQLA 1FHEA 4MCUA 1R4WA 3O6TA 3GKKA 4IQAA 1O6JA 2GTUA 3LEFA 2I81A 5ECLB 4V2LA 3LGCA 1ACVA 3U6VA 1ZYQB 3P90A 5LCZA 1ERVA 3UVHA 6GSTA 4LMWA 3VWXA 3IPZA 4TXOB 1QQ2A 5HR1A 1A2LA 4V1Ap 2DIYA 2YJ7A 3GKNA 2C3TA 2X8HA 4TR1B 3TCOA 2L4CA 2P5QA 1TRUA 3DXBA 3LYPA 1TRWA 1OE8A 3IK9A 5DAKA 3P7XA 2WRTA 2L6CA 1ZL9A 3VI5A 2YWNA 2JZTA 3CBUA 1R7HA 3GMFA 3CMIA 1S3DA 1U87A 3DWVA 4BA7A 1WOUA 3IXRA 5IMVA 1KBNA 1KNGA 5ECQB 2K8VA 2PN8A 3C8EA 5DQYA 2KUCA 1K0OA 4ACSA 2N5AA 1A2MA 1SKSB 1WE0A 2DMLA 1DE2A 3PINA 2LJKA 4KDYA 20GSA 3WGEA 5HR3A 4GCIA 4EVMA 4ZIJA 2B7JA 1AQXA 2JACA 2O7KA 3ME8A 1F37A 1EOHA 1EEJA 2LQOA 2X99A 5E59A 3CRUA 17GSA 2A2SA 2LNTA 1G7EA 4OCEA 4OFTA 1FOVA 3IDVA 1Z5YE 1TI1A 2RIIA 3F3QA 5HQPA 5ECIB 4DSSA 4IN0A 1K0DA 4HU9A 2QKEA 3DVWA 3GX8A 22GSA 1FG4A 2DJ0A 4POLA 5AIXA 1EGRA 4POBA 4O92A 2BJXA 4ML6A 5IPHA 5J5NA 2YZUA 4D73B 1YF0A 4XS4A 1URMA 3W6GA 4Q5NA 2YNXA 2FD3A 1MD4A 2OE0A 3A3TA 3KM6A 4TRXA 1SL2B 2I1UA 2XPEA 1K3LA 3ZFBA 5ECMB 2V41A 5CRDA 3ZFLA 5ID2A 4YH2A 4EF0A 4O5RA 1KEBA 1SKWB 3E0UA 4E8EA 3HVSA 2HXKA 1XOAA 2C0EA 2FCHA 3VFIA 4I97A 3FW2A 9GSSA 5G1KA 1OC9B 2YWOA 3MWHA 1RW1A 2GQMA 2IJYA 2GSSA 2ON7A 2DJ3A 2O87A 3Q6OA 1BX9A 2E0QA 2DMMA 1EP8A 1XXUA 5D9TA 4TVEA 3D21A 3VURA 4HDEA 2RM5A 2NVLA 3TB2A 4N0VA 3GUSA 3APSA 1GSQA 1A23A 2XBIA 2O8VB 5CRHA 16GSA 1JLVA 3GV1A 1ZOFA 1V2AA 2O89A 3KJYA 1RQMA 1U6TA 2TIRA 4TR4A 2HSYA 3LSZA 2HE3A 2CA8A 3IC4A 6GSXA 3HZ4A 1IYIA 3TKPA 3KEBA 2GDRA 4PQ1A 3GIXA 1XIYA 1AQWA 2NPBA 1SYRA 2GT5A 3IAS2 4QQ7A 3GL3A 2PPTA 2GSQA 4WETA 3W8JA 4HQSA 3GA4A 1AQVA 5A4VA 2FWEA 1USBA 3FR3A 4KDXA 1B4QA 1EV9A 3GFKA 1BYEA 1BJXA 4RQRA 4F2IA 4HZ2A 2ALBA 2F8FA 3C1SA 4Q5RA 4ID0A 4BVXA 5H5SA 1TP9A 1XW9A 3KGKA 4KA0A 2VLUA 4N30A 5GZZB 5HFGA 4J2FA 5LD0A 2L6DA 2LS5A 3TRXA 5KN2A 3EINA 4OO5A 3TDGA 3DMLA 2OKAA 2N5FA 4MPGA 4YAVA 5HFIA 3M1GA 4MH2A 5D93A 1XWKA 3IRAA 2YN1A 3D6IA 4IQ1A 4J57E 1GWCA 2HYXA 2LSTA 2PERA 5IIZA 5CP1A 4FYCA 5JCUA 3FHKA 4MLYA 1R5AA 5COHA 3UOMA 1SD9A 1N2AA 2OE3A 2VUPA 2YV7A 2F51A 1SK1A 2CVDA 4LLRA 5CREA 1EWXA 2L59A 3F3RA 3NOFA 3D4TA 1PGTA 4JBBA 4JU5A 3TKSC 1V40A 4ZILA 1OC3A 2MMAA 4F03A 2Z9SA 3L9SA 4NHWA 1ZCPA 4N11A 3UMAA 11GSA 5ECPB 5B8AA 3LXTA 4JR6A 1FVKA 5F07A 3UVTA 2VL3A 5DALA 1HNAA 2HZFA 3TRQA 4GTUA 4WF5A 3TOTA 3EMPA 5IOWA 3GRXA 5IOXA 1Y25A 3NZNA 1K0CA 3GTUB 1TU7A 1VGLA 3OR5A 2LRCA 1VF2A 3F4RA 2YOIA 3L9VA 1ILOA 5ECSA 4L0UA 4XS1A 3WT1A 2IMDA 2WCIA 3FR6A 4K6XA 3VPTA 1ZGNA 3UBKA 4BL7A 2GLRA 3KZQA 2YJHA 1FW1A 3Q19A 1M2AA 4WEYA 4LL4B 1Z9HA 3ZVJD 2VL2C 2F3MA 3SWLA 1F9MA 4DSSB 3HVXA 1I5GA 2VLTA 5JCGA 4OMVA 2HZEB 2HFDA 4EO3A 5ECHB 1YJ6A 5GSSA 2CZ2A 5HFKA 5CAXA 3V1WA 2XPDA 4JR4A 3G9BA 4XIHA 4ECJA 1Q98A 3IAM2 3VI7A 4G2EA 2FA8A 3EU4A 5F05A 2KLXA 3EE2A 1JZRA 3LG6A 4WKWA 3FRCA 5ID2B 1PMTA 4MJEA 4YQVA 4G9HA 1SL0B 4IS0A 2H76A 3QPMA 4KCAA 4EXJA 1TW9A 4I2TA 1SL1B 2H73A 2RLIA 3TJGA 3QFAC 4ZXGA 1J08A 2KP2A 4TOPA 4JEDA 1XWBA 1XWAA 3ME7A 3HYPA 3ZMLA 3UEMA 3GHAA 3UAPA 1DE1A 4K9ZA 4GWRA 4P3YB 1WJKA 2NTOA 2FWGA 5J9CA 3ISOA 5A4WA 3TOUA 3EURA 1LU4A 3F63A 3IV4A 4X1UA 1TKDB 5IO2A 1T1VA 5IO0A 2LUSA 4IJIA 2IL3A 3DGQA 4HJMA 5AN1A 3APOA 1JFUA 4KDUA 3APQA 1LBKA 5IMDA 5D8IA 3IR4A 3RAZA 2JADA 1G7OA 3F9UA 5J41A 1ERTA 3MNGA 1EZKA 1J9BA 2H0GA 2P5RA 3CTFA 3E3EA 2H1AA 4K8MA 2L4QA 1GSEA 2LQQA 3EMXA 1KTEA 4BWSA 1EV4A 3LJRA 2HI7A 4PNFA 10GSA 4IELA 1T4YA 3ZMKA 4F0BA 3PGTA 3H79A 4QL7A 1N8JA 3G7JA 3I6AA 4OFMA 4PQHA 3BD2A 4IBPA 3UJ1A 1A8YA 4X43A 5IMFA 1AW9A 1ERUA 3FK8A 1B48A 7GSSA 4QL9A 3LFLA 1X9WB 2JU5A 1AUCA 3DIEA 3FY7A 4F82A 3QR6A 18GSA 1JZWA 2GGTA 3MDKA 2H1BA 2P0GA 4IHUA 4BWQA 3S9FA 5EVOA 4WBJA 2HSHA 3ZITA 1SYXA 1M2BA 4NPBA 3I9V2 3J7Yk 1U3IA 2O85A 4MJAA 3D5JA 4ZL9A 3FZAA 3RBTA 2MMZA 4JE1A 4ECBA 2HRFA 1X0RA 5ELAA 3F4TA 2I4AA 4ZBAA 3WGDA 3WYWA 2YANA 4I8BA 4KX4A 1GP1A 1E2YA 5IMAA 2GQKA 4PXOA 1NM3A 2HLSA 1H4OA 1GUMA 4IKHA 4EUYA 4MZWA 4XCSA 3ZRDA 2IPAA 4NAXA 5E4WA 1ZYEA 3IOSA 4KSOA 4KSMA 5ECNB 3ZVJA 1E6BA 1V58A 4MPFA 4TXVA 3Q18A 2CX3A 4HZ4A 3O76A 1K3OA 8GSSA 3C71A 1XCCA 2CVKA 2FY6A 6GSVA 5B8BA 2WDUA 2H30A 4BPYA 2PBJA 4HUAA 1XZOA 3HVVA 2AHEA 3L9UA 1YEPA 1GSFA 2HT9A 2ZNMA 5GSTA 5ENUA 4K2DA 3QFBC 2L5LA 3ZTLA 4KUNA 3GH6A 1GSSA 3KIJA 1MEKA 4XS6A 4DSQA 4EC0A 5J3RA 4EDYA 2F8AA 4MABA 5CNWA 3NIVA 3KP8A 3VK9A 3ERGA 3CYNA 1HNBA 3IE3A 2VCXA 1SJZA 4YQMA 2CQ9A 5INYA 3KH7A 5D9WA 1G0TA 1SKRB 2WS2A 2DJ2A 1XW5A 4NV5A 2OACA 1OC8A 4GQCA 1XW6A 4GXZA 4L8EA 3RPPA 1YY7A 2GSTA 3GN3A 2XHFA 4MZCA 1FO5A 2TRCP 3BOAA 1VRSD 4KGIA 1AXDA 1TJDA 6GSSA 1TTZA 5J9BA 1TI3A 3M0FA 3IA1A 2LJRA 2H70A 4ZB9A 2KHPA 3QAGA 3ZIJA 1M9BA 1VF1A 1OKDA 1V57A 2X64A 1THOA 2R6KA 3CXGA 1HD2A 2AUVA 3L78A 4DSRA 2CZ3A 2HNLA 3D4MA 2X8CA 1XVQA 2REMA 3FZ4A 2JL4A 4F9ZA 1GLQA 2DJ1A 3H4KA 5LNKe 2NBSA 1MTCA 4ZL8A 1F3AA 4MJBA 3A2WA 4K1FA 4EDZA 1JLWA 3G7IA 1GTUA 3KMNA 2I3YA 2OJLA 6GSWA 1SU9A 4G19A 4ISDA 2C4JA 2VCTA 4KW6A 4OD7A 3KXOA 4E8HA 1O85A 1PX6A 1SK0A 3CSHA 2VLVA 2H6YA 2H6XA 4TXOA 5DCHA 4NWYA 3A2VA 5CYYA 1GSUA 4POKA 2RUEA 3GH9A 1H75A 4N0ZA 2H0HA 5IQYA 1Z3EA 3D22A 3MSZA 2K6VA 4TR0A 1TRSA 3GSTA 2G0FA 1SK2A 2H6ZA 5DAKB 2H01A 4HOJA 2QC7A 2H1GA 3LQ7A 1PKWA 1O73A 1M9AA 4TKYA 1XFLA 1BEDA 1W89A 4WXTA 2C3QA 2YV9A 3L0HA 3GURA 2VM1A 3CSJA 1Q4JA 2VCWA 3CRTA 3RHBA 5EPFA 1ZMAA 2GSRA 3E9JB 4MK3A 4TW5A 2KOKA 4MH3A 4PUFC 5D9VA 1R5PA 1HQOA 3PH9A 2KP1A 4Z7XA 5IPGA 14GSA 3EVIA 2YPMA 1B9YC 4Q5QA 2OE1A 4AGSA 2CV4A 3KMOA 2IN3A 6GSUA 2DJKA 3KH9A 3KCMA 1K3YA 1M0UA 5JCWA 1SJ6A 2M80A 2D2ZA 3TKSE 2GZPA 2FA4A 5ELGA 1G6WA 5G2ZA 5FHIA 4ZBBA 3WD6A 1F3BA 1T00A 3TJJA 2OBIA 3I69A 3EYTA 4XS4B 3RHCA 1B9XC 2GVPA 4D73A 1PA3A 3FKFA 4AJ8A 13GSA 3LXZA 3AY8A 1Z6MA 2IIYA 4GF0A 2F9SA 1GNEA 3QD9A 4XRDA 2K18A 2MBSA 3IK7A 4KNDA 4K7NA 4PGTA 5J4UA 2C3NA 1AC1A 1OC9A 2V32A 3IBHA 1PL2A 2YWIA 4IP6A 5A5KA 2C0FA 1PRXA 2B3SA 1B4PA 3JCML 1T3BA 2ES7A 2WULA 2B5YA 1TOFA 5B7CA 3F6FA 1ZZYA 4AJ7A 4WF4A 1LJRA 5H5RA 4CHSA 1YZXA 6GSYA 1V98A 4XRAA 5GAPD 2GT6A 3VPQA 3UL3A 4JRRA 2VIMA 2EC4A 4IVFA 1OKTA 1A24A 5A4UA 3HCZA 1VF3A 1OAZA 1NW2A 4GLTA 2H8LA 3D0ZA 1S3CA 2V2GA 3HDCA 1A0FA 5EL8A 2AYTA 2FWFA 12GSA 1WMJA 4EE0A 1CQHA 2AB6A 4FO5A 4NV2A 2EIQA 3DD3A 1QFNA 2H75A 2VCZA 1M99A 3QDNA 2H0IA 3VWVA 3ERFA 5IMCA 2RUFA 2LTKA 5B6NA 1Y6EA 1T8EB 4PNGA 4POMA 2ZUPA 3TJFA 1ABAA 2IWTA 4NMUA 2I9HA 2YZHA 4GQFA 5F8BA 5CO3A 4DVCA 1MDKA 2R5GA 4N10A 2WJUA 3QAVA 4ML1A 3HZ8A 3G7YA 3HHVA 1XWGA 3WT2A 4DEJA 2JSYA 5DJLA 3UARA 3FZ9A 5KN0A 4L5LA 2LJAA 1GSYA 2M46A 3C1RA 3F8UA 1HNCA 1FB0A 2HRNA 3HJMA 1M7TA 1C72A 3GL5A 2AV4A 4I2UA 3M9KA 4GSTA 2VD1A 3H1NA 5G30A 5G1LA 4GSSA 3IHQA 3RPNA 4FH8A 1YKCA 3HXSA 1TK8B 2CAIA 2QSIA 2DC5A 3HY2A 3RDWA 1YF1A 3TRPA 1OE7A 1K0NA 3J7Yb 4ILFA 5FT3A 2R2JA 4MA9A 3ED3A 1ML6A 2V6OA 1UC7A 4MZBA 1JZOA 4ECCA 3FR9A 1ST9A 4WBRD 1F6MC 5DDLA 2OA7A 5DALB 3K8NA 4FYUA 1WRYA 3P8WA 1TDIA 2V6KA 1JHBA 1WWJA 3ZREA 5HR0A 5B6MA 5IMZA 2MYGA 4RI7A 1QMVA 3GTUA 3H93A 3HD5A 1M2DA 2DSAA 4CW9A 1NSWA 2B1KA 1EOGA 1O81A 4LMVA 1OYJA 5D73A 2YCDA 1K0AA 4KCEA 2C0DA 3KP9A 1EP7A 2E2GA 1U88A 5KN1A 3ZL5A 2IMKA 1GTIA 1NHOA 1TK0B 2CAQA 1R26A 1PL1A 1GTBA 4TR3A 4ZB6A 5FWGA 3BBYA 5F06A 3LWAA 3VWUA 1A0RP 4ECIA 3MAKA 1O7UA 2HZEA 3ZYWA 3W8SA 1FB6A 1PX7A 1THXA 1Z6NA 1X5DA 1A2JA 1TXXA 1X5CA 5DBQA 2B7KA 3N9JA 4FIWA 2J23A 5G31A 3ZIVA 3DKSA 5KN3A 2PGTA 2FWHA 1ERWA 2P31A 2FLSA 4ZBDA 1DUGA 3CSIA 2CT6A 4ULXA 2IMIA 2C1YA 3GYKA 5EY6A 2A2RA 2H72A 1MDIA 2ON5A 2LV3A 2PVOC 1UN2A 2C0GA 1W4VA 1NHYA 2MMOA 5CRWA 2K8SA 3I43A 3QCPA 2FHEA 2PMTA 4ZB8A 5H5QA 1F2EA 5D96A 2IFQA 5DQSA 1YKAA 1CQGA 4HEA2 2QGVA 1WIKA 3L4NA 2VL9A 1XPVA 4H86A 3C7MA 2PUKC 3BCKA 5CRGA 2PU9C 3TUEA 1UA5A 4LA1A 2R3XA 2GS3A 3GSSA 4V1Ag 2MZCA 4GSNA 3GNJA 2BMXA 2G2QA 2JZRA 1GUHA 4AF2A 3FEUA 1X9MB 4YQUA 1TU8A 1K0MA 4OO4A 5JWQB 1PD21 1XWCA 3F4SA 2ZCTA 1Z7RA 4I5QA 2WZ9A 2FGXA 1ON4A 3WGXA 2JZSA 4PURA 2EIRA 3QOUA 3TJKA 3EWLA 3M3MA 3VLNA 3A2XA 2OADA 2WFCA 4PQIA 3VWWA 2C8UA 19GSA 4RUVA 2LRTA 2H1DA 3LYKA 1AIUA 2VD0A 4KH7A 1O8WA 2VM2A 4GRFA 1T4ZA 3M8NA 3FZ5A 4NXIA 3F0IA 1GSDA 1GH2A 5C00A 1O8XA 1I9DA 5AGYA 2E2MA 1S3AA 4WR5A 2AAWA 1SJIA 4IP1A 4LL1B 2B6MA 3R2QA 3TKQA 1PKZA 4OCFA 3GX0A 2V1MA 2A4VA 4AJ6A 2NDOA 3HA9A 4TR1A 4K7IA 1IYHA 1FVJA 4KB3A 1QXHA 2L5OA 4OFNA 2L57A 2FUG2 4NHZA 4HI7A 2VOCA 4YAPA 4I6XA 1GTAA 3LORA 3SBCA 1WPIA 4OWYA 4X0XA 2PWJA 5L71A 1MDJA 1GLPA 3C73A 2LRNA 4JZQA 2H74A 5F0GA 3QAWA 3A5WA 4K0NA 5DCGA 5ABRA 4MF5A 4J56E 2CX4A 1GNWA 3BCIA 3HJOA 1J0FA 1WP0A 4MF7A 5GAND 2YWMA 4V2NA 4MDCA 2EIOA 4PX1A 4EL1A 1DSBA 3P2AA 5DJMA 4XTSA 4FYBA 4HQZA 2H66A 2DIZA 4RI6A 2BTOT 2RM6A 4O7HA 1MD3A 2MBTA 4HS1A 2FNOA 2B5EA 3EC3A 3US3A 3O3TA 3DRNA 2WB9A
chains in the Genus database with same CATH superfamily
2B1LA 2LKUA 5KEJA 1XVWA 2DBCA 3UIWA 1X5EA 2IMFA 4RQXA 3KD0A 2J9HA 3KTLA 4IW9A 4TN8A 3ZLPA 4IJ3A 2K9FA 2R4VA 2VO4A 3TJBA 1GUKA 1K0BA 3PPUA 4HU7A 5G5FA 1BAYA 1QGVA 4CDOA 5D9XA 2X8GA 5C04A 2E7PA 4O32A 3TKSA 2LNSA 4MJCA 5AISA 1EEMA 3DYRA 4ZL7A 1YDKA 2MMNA 3KTBA 1QK8A 4BVYA 1PQNA 4K7OA 4MP4A 5ECKB 1XOBA 2M72A 3PR8A 3ERWA 2B5XA 3TGZA 4V2MA 2WGRA 1JZDA 2JSZA 2H19A 1SENA 3QMXA 3CTGA 2AJQB 1RK4A 3HKRA 1OVNA 1G6YA 1DBYA 2YP6A 1PN9A 4HJ2A 3EU3A 4PUAA 2DLXA 5JWRB 2H71A 4KAEA 5AIVA 1GULA 4IGJA 1PSQA 1YEXA 1SD8A 3DEXA 3BJ5A 1UVZA 3GKMA 2XC2A 5G5EA 1X9SB 4WR4A 3N5OA 3GKXA 4F0CA 2PVQA 1VF4A 2GZYA 2VAFA 2IFQB 2DJJA 2C80A 2R37A 2OBKA 4G10A 4K0GA 2VL2A 1U3AA 2VCQA 1TRVA 2IMEA 3ZZXA 4EKZA 1V9WA 1A8LA 4L5OA 1HYUA 2LEGA 3DVXA 3HJPA 1B8XA 4Q5FA 1GRXA 2GZZA 1GL8A 3H8QA 5DVBA 3M9JA 3TKRA 4MMMA 3FYGA 1S3RA 4YKGA 4L0WA 5ECOB 4KE3A 1EGOA 2CVBA 1TK5B 1AAZA 3Q74A 1BG5A 2N5BA 1YQ1A 2XBQA 1XBSA 2VCVA 3U5RE 1QUWA 1M3IA 3F6DA 4MF6A 1FAAA 3UBLA 1T7PB 5HR2A 5JWOB 2TRXA 4Z2RA 1BQ7A 5IM9A 4XHMA 1Z7PA 5ECRB 2GQLA 1FHEA 4MCUA 1R4WA 3O6TA 3GKKA 4IQAA 1O6JA 2GTUA 3LEFA 2I81A 5ECLB 4V2LA 3LGCA 1ACVA 3U6VA 1ZYQB 3P90A 5LCZA 1ERVA 3UVHA 6GSTA 4LMWA 3VWXA 3IPZA 4TXOB 1QQ2A 5HR1A 1A2LA 4V1Ap 2DIYA 2YJ7A 3GKNA 2C3TA 2X8HA 4TR1B 3TCOA 2L4CA 2P5QA 1TRUA 3DXBA 3IC8A 3LYPA 1TRWA 1OE8A 3EPTA 3IK9A 5DAKA 3P7XA 2WRTA 2L6CA 1ZL9A 3VI5A 2YWNA 2JZTA 3CBUA 1R7HA 3GMFA 3CMIA 1S3DA 1U87A 3DWVA 4YKFA 4BA7A 1WOUA 3IXRA 5IMVA 1KBNA 1KNGA 5ECQB 4O5QA 2K8VA 2PN8A 3C8EA 5DQYA 2KUCA 1K0OA 4ACSA 2N5AA 1A2MA 1SKSB 1WE0A 2DMLA 1DE2A 3FMWA 3PINA 2LJKA 4KDYA 20GSA 3WGEA 5HR3A 4GCIA 4EVMA 4ZIJA 2B7JA 1AQXA 2JACA 2O7KA 3ME8A 1F37A 1EOHA 1EEJA 2LQOA 2X99A 5E59A 3CRUA 17GSA 2A2SA 2LNTA 1G7EA 4OCEA 4OFTA 1FOVA 3IDVA 1Z5YE 1TI1A 2RIIA 3F3QA 5HQPA 5ECIB 4DSSA 4IN0A 1K0DA 4HU9A 2QKEA 2A4HA 3DVWA 3GX8A 22GSA 1FG4A 2DJ0A 4POLA 5AIXA 1EGRA 4POBA 4O92A 2BJXA 4ML6A 5IPHA 5J5NA 2YZUA 4D73B 1YF0A 4XS4A 1URMA 3W6GA 4Q5NA 2YNXA 2FD3A 1MD4A 2OE0A 3A3TA 3KM6A 4TRXA 1SL2B 2I1UA 2XPEA 1K3LA 3ZFBA 5ECMB 2V41A 5CRDA 3ZFLA 5ID2A 4YH2A 4EF0A 4O5RA 1KEBA 1SKWB 3E0UA 4E8EA 3HVSA 2HXKA 1XOAA 2C0EA 2FCHA 3VFIA 4I97A 3FW2A 9GSSA 5G1KA 1OC9B 2YWOA 3MWHA 1RW1A 2GQMA 2IJYA 2GSSA 2ON7A 2DJ3A 2O87A 3Q6OA 1BX9A 2E0QA 2DMMA 1EP8A 1XXUA 5D9TA 4TVEA 3D21A 3VURA 4HDEA 2RM5A 2NVLA 3TB2A 4N0VA 3GUSA 3APSA 1GSQA 1A23A 2XBIA 2O8VB 5CRHA 1M3JA 16GSA 1JLVA 3GV1A 1ZOFA 5KOXA 1V2AA 2O89A 3KJYA 1RQMA 1U6TA 2TIRA 4TR4A 2HSYA 3LSZA 2HE3A 2CA8A 3IC4A 6GSXA 3HZ4A 1IYIA 3TKPA 3KEBA 2GDRA 4PQ1A 3GIXA 1XIYA 1AQWA 2NPBA 2R0GA 4Z2UA 1SYRA 2GT5A 3IAS2 4QQ7A 3GL3A 2PPTA 2GSQA 4WETA 3W8JA 4HQSA 3GA4A 1AQVA 5A4VA 2FWEA 1USBA 3FR3A 4KDXA 1B4QA 1EV9A 3GFKA 1BYEA 1BJXA 4RQRA 4F2IA 4HZ2A 2ALBA 2F8FA 3C1SA 4Q5RA 4ID0A 4BVXA 5H5SA 3IHGA 1TP9A 1XW9A 3KGKA 4KA0A 2VLUA 4N30A 5GZZB 5HFGA 4J2FA 5LD0A 2L6DA 2LS5A 3TRXA 5KN2A 3EINA 4OO5A 3TDGA 3DMLA 2OKAA 2N5FA 4MPGA 4YAVA 5HFIA 3M1GA 4MH2A 5D93A 1XWKA 3IRAA 2YN1A 3D6IA 4IQ1A 4J57E 1GWCA 2HYXA 2LSTA 2PERA 5IIZA 5CP1A 4FYCA 5JCUA 3FHKA 4MLYA 1R5AA 5COHA 3UOMA 1SD9A 1N2AA 2OE3A 2VUPA 2YV7A 2F51A 4G0IA 1SK1A 2CVDA 4LLRA 5CREA 1EWXA 2L59A 3F3RA 3NOFA 3D4TA 1PGTA 4JBBA 4JU5A 3TKSC 1V40A 5KOWA 4ZILA 1OC3A 2MMAA 4F03A 2Z9SA 3L9SA 4NHWA 1ZCPA 4N11A 3UMAA 11GSA 5ECPB 5B8AA 3LXTA 4JR6A 1FVKA 3A5IA 5F07A 3UVTA 2VL3A 5DALA 1HNAA 2HZFA 3TRQA 4GTUA 4WF5A 3TOTA 3EMPA 5IOWA 3GRXA 5IOXA 1Y25A 3NZNA 1K0CA 3GTUB 1TU7A 1VGLA 3OR5A 2LRCA 1VF2A 3F4RA 2YOIA 3L9VA 1ILOA 5ECSA 4L0UA 4XS1A 3WT1A 2IMDA 2WCIA 3CQFA 3FR6A 4K6XA 3VPTA 1ZGNA 3UBKA 4BL7A 2GLRA 3KZQA 2YJHA 1FW1A 3Q19A 1M2AA 4WEYA 4LL4B 1Z9HA 3ZVJD 2VL2C 2F3MA 3SWLA 1F9MA 4DSSB 3HVXA 1I5GA 2VLTA 5JCGA 4OMVA 2HZEB 2HFDA 4EO3A 5ECHB 1YJ6A 5GSSA 2CZ2A 5HFKA 5CAXA 3V1WA 2XPDA 4JR4A 3G9BA 4XIHA 4ECJA 1Q98A 3IAM2 3VI7A 4G2EA 2FA8A 3EU4A 5F05A 2KLXA 3EE2A 1JZRA 3LG6A 4WKWA 3FRCA 5ID2B 1PMTA 4MJEA 4YQVA 4G9HA 1SL0B 4IS0A 2H76A 3QPMA 4KCAA 4EXJA 4KF9A 1TW9A 4I2TA 1SL1B 2H73A 2RLIA 3TJGA 3QFAC 4ZXGA 1J08A 2KP2A 4TOPA 4JEDA 1XWBA 1XWAA 3ME7A 3HYPA 3ZMLA 3UEMA 3GHAA 3UAPA 1DE1A 4K9ZA 4GWRA 4P3YB 1WJKA 2NTOA 2FWGA 5J9CA 3ISOA 5A4WA 3TOUA 4BIKA 3EURA 3R3EA 1LU4A 3F63A 3IV4A 4X1UA 1TKDB 5IO2A 1T1VA 5IO0A 2LUSA 4IJIA 2IL3A 3DGQA 4HJMA 5AN1A 3APOA 1JFUA 4KDUA 3APQA 1LBKA 5IMDA 5D8IA 3IR4A 3RAZA 2JADA 1G7OA 3F9UA 5J41A 1ERTA 3MNGA 1EZKA 1J9BA 2H0GA 2P5RA 2DKHA 3CTFA 3E3EA 2H1AA 4K8MA 2L4QA 1GSEA 2LQQA 3EMXA 1KTEA 4BWSA 1EV4A 4K5RA 2UZ8A 3LJRA 2HI7A 4PNFA 10GSA 4IELA 1T4YA 3ZMKA 4F0BA 4K2XA 3PGTA 3H79A 4QL7A 1N8JA 3G7JA 3I6AA 4OFMA 4PQHA 3BD2A 4IBPA 3UJ1A 1A8YA 4X43A 5IMFA 1AW9A 1ERUA 3FK8A 1B48A 7GSSA 4QL9A 3LFLA 1X9WB 2JU5A 1AUCA 3DIEA 3FY7A 4F82A 3QR6A 18GSA 1JZWA 2GGTA 3MDKA 2H1BA 2P0GA 4IHUA 4BWQA 3S9FA 5EVOA 4WBJA 2HSHA 3ZITA 1SYXA 1M2BA 4NPBA 3I9V2 3J7Yk 1U3IA 2O85A 4MJAA 3D5JA 4ZL9A 3FZAA 3RBTA 2HSMA 2MMZA 4JE1A 4ECBA 2HRFA 1X0RA 5ELAA 3F4TA 2I4AA 4ZBAA 3WGDA 3WYWA 2YANA 4I8BA 4KX4A 1GP1A 1E2YA 5IMAA 2GQKA 4PXOA 1NM3A 2HLSA 1H4OA 1GUMA 4IKHA 4EUYA 4MZWA 4XCSA 3ZRDA 2IPAA 4NAXA 5E4WA 1ZYEA 3IOSA 4KSOA 4KSMA 5ECNB 3ZVJA 1E6BA 1V58A 4MPFA 4TXVA 4PTSA 2CX3A 3Q18A 4HZ4A 3O76A 2X49A 1K3OA 8GSSA 3C71A 4BL7B 1XCCA 2CVKA 2FY6A 6GSVA 5B8BA 2WDUA 2H30A 4BPYA 4HSCX 2PBJA 4HUAA 1XZOA 3HVVA 2AHEA 3L9UA 1YEPA 1GSFA 2HT9A 2ZNMA 5GSTA 5ENUA 4K2DA 3QFBC 2L5LA 3ZTLA 4KUNA 3GH6A 1GSSA 3KIJA 1MEKA 4XS6A 4BVYB 4DSQA 4EC0A 5J3RA 4EDYA 2F8AA 4MABA 3MYDA 5CNWA 3NIVA 3KP8A 3VK9A 3ERGA 3CYNA 1HNBA 3IE3A 2VCXA 1SJZA 4YQMA 2CQ9A 5INYA 3KH7A 5D9WA 1G0TA 1SKRB 2WS2A 2DJ2A 1FOHA 1XW5A 4NV5A 2OACA 1OC8A 4GQCA 1XW6A 4GXZA 4L8EA 3RPPA 1YY7A 2GSTA 3GN3A 4Z2TA 2XHFA 4MZCA 1FO5A 2TRCP 3BOAA 1VRSD 4KGIA 1AXDA 1TJDA 6GSSA 1TTZA 5J9BA 1TI3A 3M0FA 3IA1A 2LJRA 2H70A 2DKIA 4ZB9A 2KHPA 3QAGA 3ZIJA 1M9BA 1VF1A 1OKDA 1V57A 2X64A 1THOA 2R6KA 3CXGA 1HD2A 2AUVA 3L78A 4DSRA 2CZ3A 2HNLA 3D4MA 2X8CA 1XVQA 2REMA 3FZ4A 2JL4A 3HVNA 4F9ZA 1GLQA 2DJ1A 3H4KA 5LNKe 2NBSA 1MTCA 4ZL8A 1F3AA 4MJBA 3A2WA 4K1FA 4EDZA 1JLWA 3G7IA 1GTUA 3KMNA 2I3YA 4EIQA 2OJLA 6GSWA 1SU9A 4G19A 4ISDA 2C4JA 2VCTA 4KW6A 4OD7A 3KXOA 4E8HA 1O85A 1PX6A 1SK0A 2X4AA 3CSHA 2VLVA 2H6YA 2H6XA 4TXOA 5DCHA 4NWYA 3A2VA 5CYYA 1GSUA 4POKA 2RUEA 3GH9A 1H75A 4N0ZA 2H0HA 5IQYA 1Z3EA 3D22A 3MSZA 2K6VA 4TR0A 1TRSA 3GSTA 2G0FA 1SK2A 2H6ZA 5DAKB 3LW9A 4X4JA 2H01A 4HOJA 2QC7A 2H1GA 3LQ7A 1PKWA 1O73A 1M9AA 4TKYA 1XFLA 1BEDA 1W89A 4WXTA 2C3QA 2YV9A 3L0HA 3GURA 2VM1A 4FQUA 3CSJA 2R0CA 1Q4JA 2VCWA 3CRTA 3RHBA 5EPFA 5BRTA 1ZMAA 2GSRA 3E9JB 4MK3A 4TW5A 2KOKA 4MH3A 4PUFC 5D9VA 1R5PA 1HQOA 3PH9A 2KP1A 4Z7XA 1PN0A 4CY6A 5IPGA 14GSA 3EVIA 2YPMA 1B9YC 4Q5QA 2OE1A 4AGSA 2CV4A 3KMOA 2IN3A 6GSUA 2DJKA 3KH9A 3KCMA 1K3YA 1M0UA 5JCWA 1SJ6A 2M80A 2D2ZA 3TKSE 2GZPA 2FA4A 5ELGA 1G6WA 5G2ZA 5FHIA 4ZBBA 3WD6A 1F3BA 1T00A 2QA1A 3TJJA 2OBIA 3I69A 3EYTA 4XS4B 3RHCA 1B9XC 2GVPA 4D73A 1PA3A 3FKFA 4AJ8A 13GSA 3LXZA 2HRKA 3AY8A 1Z6MA 2IIYA 4GF0A 2F9SA 1GNEA 3QD9A 4XRDA 2K18A 2MBSA 3IK7A 4KNDA 4K7NA 4PGTA 5J4UA 2C3NA 1AC1A 1OC9A 2V32A 3IBHA 1PL2A 2YWIA 5BMUA 4IP6A 5A5KA 2C0FA 1PRXA 2B3SA 1B4PA 3JCML 1T3BA 2ES7A 2WULA 2B5YA 1TOFA 5B7CA 3F6FA 1ZZYA 4AJ7A 4WF4A 1LJRA 5H5RA 4CHSA 1YZXA 6GSYA 1V98A 4XRAA 5GAPD 2GT6A 3VPQA 3UL3A 4JRRA 2VIMA 2EC4A 4IVFA 1OKTA 1A24A 5A4UA 3HCZA 1VF3A 1OAZA 2QA2A 1NW2A 4GLTA 2H8LA 3D0ZA 1S3CA 2V2GA 3HDCA 1A0FA 5EL8A 2AYTA 2FWFA 12GSA 1WMJA 4EE0A 1CQHA 2AB6A 4FO5A 1ZYNA 4NV2A 2EIQA 3DD3A 2R0PA 1QFNA 2H75A 2VCZA 1M99A 3QDNA 2H0IA 3VWVA 3ERFA 5IMCA 4BVXB 2RUFA 2LTKA 5B6NA 1Y6EA 1T8EB 4PNGA 4POMA 2ZUPA 3TJFA 1ABAA 2IWTA 4NMUA 2I9HA 2YZHA 4GQFA 5F8BA 5CO3A 4DVCA 1MDKA 2R5GA 4N10A 2WJUA 3QAVA 4ML1A 3HZ8A 3G7YA 3HHVA 1XWGA 3WT2A 4DEJA 2JSYA 5DJLA 3UARA 3FZ9A 5KN0A 4L5LA 2LJAA 1GSYA 2M46A 3C1RA 3F8UA 1HNCA 1FB0A 2HRNA 3HJMA 1M7TA 4G0KA 1C72A 3GL5A 2AV4A 4I2UA 3M9KA 4GSTA 4MNNA 2VD1A 3H1NA 5G30A 5G1LA 4GSSA 3IHQA 3RPNA 4FH8A 1YKCA 3HXSA 1TK8B 2CAIA 2QSIA 2DC5A 3HY2A 3RDWA 1YF1A 3TRPA 1OE7A 1K0NA 3J7Yb 4ILFA 5FT3A 2R2JA 4MA9A 3ED3A 1ML6A 2V6OA 1UC7A 4MZBA 1JZOA 4ECCA 3FR9A 1ST9A 4WBRD 1F6MC 5DDLA 2OA7A 5DALB 3K8NA 4FYUA 1WRYA 3P8WA 1TDIA 2V6KA 1JHBA 1WWJA 3ZREA 5HR0A 5B6MA 5IMZA 2MYGA 4RI7A 1QMVA 3GTUA 1PFOA 3H93A 3HD5A 1M2DA 2DSAA 4CW9A 1NSWA 2B1KA 1EOGA 1O81A 4LMVA 1OYJA 5D73A 2YCDA 1K0AA 4KCEA 2C0DA 3KP9A 1EP7A 2E2GA 1U88A 5KN1A 3ZL5A 2IMKA 1GTIA 1NHOA 1TK0B 2CAQA 1R26A 1PL1A 1GTBA 4TR3A 4ZB6A 5FWGA 3BBYA 4ICYA 5F06A 3LWAA 3VWUA 1A0RP 4ECIA 3MAKA 1O7UA 2HZEA 3ZYWA 3W8SA 1FB6A 1PX7A 1THXA 1Z6NA 1X5DA 1A2JA 1TXXA 1X5CA 5DBQA 2B7KA 3N9JA 4FIWA 2J23A 5G31A 3ZIVA 3DKSA 5KN3A 2PGTA 2FWHA 1ERWA 2P31A 2FLSA 4ZBDA 1DUGA 3CSIA 2CT6A 4ULXA 2IMIA 2C1YA 3GYKA 5EY6A 2A2RA 2H72A 1MDIA 2ON5A 2LV3A 2PVOC 1UN2A 2C0GA 1W4VA 1NHYA 2MMOA 5CRWA 2K8SA 3I43A 3QCPA 2FHEA 2PMTA 4ZB8A 5H5QA 1F2EA 5D96A 2IFQA 5DQSA 1YKAA 1CQGA 4HEA2 2QGVA 1WIKA 3L4NA 2VL9A 1XPVA 4H86A 3C7MA 2PUKC 3BCKA 4CY8A 5CRGA 2PU9C 3TUEA 1UA5A 4LA1A 2R3XA 2GS3A 1ZYPA 3GSSA 4V1Ag 2MZCA 4GSNA 3GNJA 2BMXA 2G2QA 2JZRA 1GUHA 4AF2A 3FEUA 1X9MB 4YQUA 1TU8A 1K0MA 4OO4A 5JWQB 1PD21 1XWCA 3F4SA 2ZCTA 1Z7RA 4I5QA 2WZ9A 2FGXA 1ON4A 3WGXA 2JZSA 4PURA 2EIRA 3QOUA 2HRAA 3TJKA 3EWLA 3M3MA 3VLNA 3A2XA 2OADA 2WFCA 4PQIA 3VWWA 2C8UA 19GSA 4RUVA 2LRTA 2H1DA 3LYKA 1AIUA 2VD0A 4KH7A 1O8WA 2VM2A 4GRFA 1T4ZA 3M8NA 3FZ5A 4NXIA 3F0IA 1GSDA 1GH2A 4A5PA 5C00A 1O8XA 1I9DA 5AGYA 2E2MA 1XG8A 1S3AA 4WR5A 2AAWA 1SJIA 4IP1A 4LL1B 2B6MA 3R2QA 3TKQA 1PKZA 4OCFA 4EIPA 3GX0A 2V1MA 2A4VA 4AJ6A 2NDOA 3HA9A 4TR1A 4K7IA 1IYHA 1FVJA 4KB3A 1QXHA 2L5OA 4OFNA 2L57A 2FUG2 4NHZA 4HI7A 2A2PA 2VOCA 4YAPA 4I6XA 1GTAA 3LORA 3SBCA 1WPIA 4OWYA 4X0XA 2PWJA 5L71A 1MDJA 1GLPA 3C73A 2LRNA 4JZQA 2H74A 5F0GA 3QAWA 3A5WA 4K0NA 5DCGA 5ABRA 4MF5A 4J56E 2CX4A 1GNWA 3BCIA 3HJOA 1J0FA 1WP0A 4MF7A 5GAND 2YWMA 4V2NA 4MDCA 2EIOA 4PX1A 4EL1A 4G0LA 1DSBA 3P2AA 5DJMA 4USSA 4XTSA 4FYBA 4HQZA 2H66A 2DIZA 4RI6A 2BTOT 2RM6A 4O7HA 1MD3A 2MBTA 3MIXA 2FNOA 4HS1A 2B5EA 4K5SA 3EC3A 3US3A 3O3TA 4O5UA 3DRNA 2WB9A
chains in the Genus database with same CATH topology
2B1LA 2LKUA 5KEJA 1XVWA 2DBCA 3UIWA 1X5EA 2IMFA 4RQXA 3KD0A 2J9HA 3KTLA 4IW9A 4TN8A 3ZLPA 4IJ3A 2K9FA 2R4VA 2VO4A 3TJBA 1GUKA 1K0BA 3PPUA 4HU7A 5G5FA 1BAYA 1QGVA 4CDOA 5D9XA 2X8GA 5C04A 2E7PA 4O32A 3TKSA 2LNSA 4MJCA 5AISA 1EEMA 3DYRA 4ZL7A 1YDKA 2MMNA 3KTBA 1QK8A 4BVYA 1PQNA 4K7OA 4MP4A 5ECKB 1XOBA 2M72A 3PR8A 3ERWA 2B5XA 3TGZA 4V2MA 2WGRA 1JZDA 2JSZA 2H19A 1SENA 3QMXA 3CTGA 2AJQB 1RK4A 3HKRA 1OVNA 1G6YA 1DBYA 2YP6A 1PN9A 4HJ2A 3EU3A 4PUAA 2DLXA 5JWRB 2H71A 4KAEA 5AIVA 1GULA 4IGJA 1PSQA 1YEXA 1SD8A 3DEXA 3BJ5A 1UVZA 3GKMA 2XC2A 5G5EA 1X9SB 4WR4A 3N5OA 3GKXA 4F0CA 2PVQA 1VF4A 2GZYA 2VAFA 2IFQB 2DJJA 2C80A 2R37A 2OBKA 4G10A 4K0GA 2VL2A 1U3AA 2VCQA 1TRVA 2IMEA 3ZZXA 4EKZA 1V9WA 1A8LA 4L5OA 1HYUA 2LEGA 3DVXA 3HJPA 1B8XA 4Q5FA 1GRXA 2GZZA 1GL8A 3H8QA 5DVBA 3M9JA 3TKRA 4MMMA 3FYGA 4YKGA 4L0WA 5ECOB 4KE3A 1EGOA 2CVBA 1TK5B 1AAZA 3Q74A 1BG5A 2N5BA 1YQ1A 2XBQA 1XBSA 2VCVA 3U5RE 1QUWA 3F6DA 4MF6A 1T7PB 1FAAA 3UBLA 5HR2A 5JWOB 2TRXA 4Z2RA 1BQ7A 5IM9A 4XHMA 1Z7PA 5ECRB 2GQLA 1FHEA 4MCUA 1R4WA 3O6TA 3GKKA 4IQAA 1O6JA 2GTUA 3LEFA 2I81A 5ECLB 4V2LA 3LGCA 1ACVA 3U6VA 1ZYQB 3P90A 5LCZA 1ERVA 3UVHA 6GSTA 4LMWA 3VWXA 3IPZA 4TXOB 1QQ2A 5HR1A 1A2LA 4V1Ap 2DIYA 2YJ7A 3GKNA 2C3TA 2X8HA 4TR1B 3TCOA 2L4CA 2P5QA 1TRUA 3DXBA 3IC8A 3LYPA 1TRWA 1OE8A 3EPTA 3IK9A 5DAKA 3P7XA 2WRTA 2L6CA 1ZL9A 3VI5A 2YWNA 2JZTA 3CBUA 1R7HA 3GMFA 3CMIA 1S3DA 1U87A 3DWVA 4YKFA 4BA7A 1WOUA 3IXRA 5IMVA 1KBNA 1KNGA 5ECQB 4O5QA 2K8VA 2PN8A 3C8EA 5DQYA 2KUCA 1K0OA 4ACSA 2N5AA 1A2MA 1SKSB 1WE0A 2DMLA 1DE2A 3FMWA 3PINA 2LJKA 4KDYA 20GSA 3WGEA 5HR3A 4GCIA 4EVMA 4ZIJA 2B7JA 1AQXA 2JACA 2O7KA 3ME8A 1F37A 1EOHA 1EEJA 2LQOA 2X99A 5E59A 3CRUA 17GSA 2A2SA 2LNTA 1G7EA 4OCEA 4OFTA 1FOVA 3IDVA 1Z5YE 1TI1A 2RIIA 3F3QA 5HQPA 5ECIB 4DSSA 4IN0A 1K0DA 4HU9A 2QKEA 2A4HA 3DVWA 3GX8A 22GSA 1FG4A 2DJ0A 4POLA 5AIXA 1EGRA 4POBA 4O92A 2BJXA 4ML6A 5IPHA 5J5NA 2YZUA 4D73B 1YF0A 4XS4A 1URMA 3W6GA 4Q5NA 2YNXA 2FD3A 1MD4A 2OE0A 3A3TA 3KM6A 4TRXA 1SL2B 2I1UA 2XPEA 1K3LA 3ZFBA 5ECMB 2V41A 5CRDA 3ZFLA 5ID2A 4YH2A 4EF0A 4O5RA 1KEBA 1SKWB 3E0UA 4E8EA 3HVSA 2HXKA 1XOAA 2C0EA 2FCHA 3VFIA 4I97A 3FW2A 9GSSA 5G1KA 1OC9B 2YWOA 3MWHA 1RW1A 2GQMA 2IJYA 2GSSA 2ON7A 2DJ3A 2O87A 3Q6OA 1BX9A 2E0QA 2DMMA 1EP8A 1XXUA 5D9TA 4TVEA 3D21A 3VURA 4HDEA 2RM5A 2NVLA 3TB2A 4N0VA 3GUSA 3APSA 1GSQA 1A23A 2XBIA 2O8VB 5CRHA 16GSA 1JLVA 3GV1A 1ZOFA 5KOXA 1V2AA 2O89A 3KJYA 1RQMA 1U6TA 2TIRA 4TR4A 2HSYA 3LSZA 2HE3A 2CA8A 3IC4A 6GSXA 3HZ4A 1IYIA 3TKPA 3KEBA 2GDRA 4PQ1A 3GIXA 1XIYA 1AQWA 2NPBA 2R0GA 4Z2UA 1SYRA 2GT5A 3IAS2 4QQ7A 3GL3A 2PPTA 2GSQA 4WETA 3W8JA 4HQSA 3GA4A 1AQVA 5A4VA 2FWEA 1USBA 3FR3A 4KDXA 1B4QA 1EV9A 3GFKA 1BYEA 1BJXA 4RQRA 4F2IA 4HZ2A 2ALBA 2F8FA 3C1SA 4Q5RA 4ID0A 4BVXA 5H5SA 3IHGA 1TP9A 1XW9A 3KGKA 4KA0A 2VLUA 4N30A 5GZZB 5HFGA 4J2FA 5LD0A 2L6DA 2LS5A 3TRXA 5KN2A 3EINA 4OO5A 3TDGA 3DMLA 2OKAA 2N5FA 4MPGA 4YAVA 5HFIA 3M1GA 4MH2A 5D93A 1XWKA 3IRAA 2YN1A 3D6IA 4IQ1A 4J57E 1GWCA 2HYXA 2LSTA 2PERA 5IIZA 5CP1A 4FYCA 5JCUA 3FHKA 4MLYA 1R5AA 5COHA 3UOMA 1SD9A 1N2AA 2OE3A 2VUPA 2YV7A 2F51A 4G0IA 1SK1A 2CVDA 4LLRA 5CREA 1EWXA 2L59A 3F3RA 3NOFA 3D4TA 1PGTA 4JBBA 4JU5A 3TKSC 1V40A 5KOWA 4ZILA 1OC3A 2MMAA 4F03A 2Z9SA 3L9SA 4NHWA 1ZCPA 4N11A 3UMAA 11GSA 5ECPB 5B8AA 3LXTA 4JR6A 1FVKA 3A5IA 5F07A 3UVTA 2VL3A 5DALA 1HNAA 2HZFA 3TRQA 4GTUA 4WF5A 3TOTA 3EMPA 5IOWA 3GRXA 5IOXA 1Y25A 3NZNA 1K0CA 3GTUB 1TU7A 1VGLA 3OR5A 2LRCA 1VF2A 3F4RA 2YOIA 3L9VA 1ILOA 5ECSA 4L0UA 4XS1A 3WT1A 2IMDA 2WCIA 3FR6A 4K6XA 3VPTA 1ZGNA 3UBKA 4BL7A 2GLRA 3KZQA 2YJHA 1FW1A 3Q19A 1M2AA 4WEYA 4LL4B 1Z9HA 3ZVJD 2VL2C 2F3MA 3SWLA 1F9MA 4DSSB 3HVXA 1I5GA 2VLTA 5JCGA 4OMVA 2HZEB 2HFDA 4EO3A 5ECHB 1YJ6A 5GSSA 2CZ2A 5HFKA 5CAXA 3V1WA 2XPDA 4JR4A 3G9BA 4XIHA 4ECJA 1Q98A 3IAM2 3VI7A 4G2EA 2FA8A 3EU4A 5F05A 2KLXA 3EE2A 1JZRA 3LG6A 4WKWA 3FRCA 5ID2B 1PMTA 4MJEA 4YQVA 4G9HA 1SL0B 4IS0A 2H76A 3QPMA 4KCAA 4EXJA 4KF9A 1TW9A 4I2TA 1SL1B 2H73A 2RLIA 3TJGA 3QFAC 4ZXGA 1J08A 2KP2A 4TOPA 4JEDA 1XWBA 1XWAA 3ME7A 3HYPA 3ZMLA 3UEMA 3GHAA 3UAPA 1DE1A 4K9ZA 4GWRA 4P3YB 1WJKA 2NTOA 2FWGA 5J9CA 3ISOA 5A4WA 3TOUA 3EURA 3R3EA 1LU4A 3F63A 3IV4A 4X1UA 1TKDB 5IO2A 1T1VA 5IO0A 2LUSA 4IJIA 2IL3A 3DGQA 4HJMA 5AN1A 3APOA 1JFUA 4KDUA 3APQA 1LBKA 5IMDA 5D8IA 3IR4A 3RAZA 2JADA 1G7OA 3F9UA 5J41A 1ERTA 3MNGA 1EZKA 1J9BA 2H0GA 2P5RA 2DKHA 3CTFA 3E3EA 2H1AA 4K8MA 2L4QA 1GSEA 2LQQA 3EMXA 1KTEA 4BWSA 1EV4A 4K5RA 2UZ8A 3LJRA 2HI7A 4PNFA 10GSA 4IELA 1T4YA 3ZMKA 4F0BA 4K2XA 3PGTA 3H79A 4QL7A 1N8JA 3G7JA 3I6AA 4OFMA 4PQHA 3BD2A 4IBPA 3UJ1A 1A8YA 4X43A 5IMFA 1AW9A 1ERUA 3FK8A 1B48A 7GSSA 4QL9A 3LFLA 1X9WB 2JU5A 1AUCA 3DIEA 3FY7A 4F82A 3QR6A 18GSA 1JZWA 2GGTA 3MDKA 2H1BA 2P0GA 4IHUA 4BWQA 3S9FA 5EVOA 4WBJA 2HSHA 3ZITA 1SYXA 1M2BA 4NPBA 3I9V2 3J7Yk 1U3IA 2O85A 4MJAA 3D5JA 4ZL9A 3FZAA 3RBTA 2HSMA 2MMZA 4JE1A 4ECBA 2HRFA 1X0RA 5ELAA 3F4TA 2I4AA 4ZBAA 3WGDA 3WYWA 2YANA 4I8BA 4KX4A 1GP1A 1E2YA 5IMAA 2GQKA 4PXOA 1NM3A 2HLSA 1H4OA 1GUMA 4IKHA 4EUYA 4MZWA 4XCSA 3ZRDA 2IPAA 4NAXA 5E4WA 1ZYEA 3IOSA 4KSOA 4KSMA 5ECNB 3ZVJA 1E6BA 1V58A 4MPFA 4TXVA 4PTSA 2CX3A 3Q18A 4HZ4A 3O76A 2X49A 1K3OA 8GSSA 3C71A 4BL7B 1XCCA 2CVKA 2FY6A 6GSVA 5B8BA 2WDUA 2H30A 4BPYA 2PBJA 4HUAA 1XZOA 3HVVA 2AHEA 3L9UA 1YEPA 1GSFA 2HT9A 2ZNMA 5GSTA 5ENUA 4K2DA 3QFBC 2L5LA 3ZTLA 4KUNA 3GH6A 1GSSA 3KIJA 1MEKA 4XS6A 4BVYB 4DSQA 4EC0A 5J3RA 4EDYA 2F8AA 4MABA 3MYDA 5CNWA 3NIVA 3KP8A 3VK9A 3ERGA 3CYNA 1HNBA 3IE3A 2VCXA 1SJZA 4YQMA 2CQ9A 5INYA 3KH7A 5D9WA 1G0TA 1SKRB 2WS2A 2DJ2A 1FOHA 1XW5A 4NV5A 2OACA 1OC8A 4GQCA 1XW6A 4GXZA 4L8EA 3RPPA 1YY7A 2GSTA 3GN3A 4Z2TA 2XHFA 4MZCA 1FO5A 2TRCP 3BOAA 1VRSD 4KGIA 1AXDA 1TJDA 6GSSA 1TTZA 5J9BA 1TI3A 3M0FA 3IA1A 2LJRA 2H70A 2DKIA 4ZB9A 2KHPA 3QAGA 3ZIJA 1M9BA 1VF1A 1OKDA 1V57A 2X64A 1THOA 2R6KA 3CXGA 1HD2A 2AUVA 3L78A 4DSRA 2CZ3A 2HNLA 3D4MA 2X8CA 1XVQA 2REMA 3FZ4A 2JL4A 4F9ZA 1GLQA 2DJ1A 3H4KA 5LNKe 2NBSA 1MTCA 4ZL8A 1F3AA 4MJBA 3A2WA 4K1FA 4EDZA 1JLWA 3G7IA 1GTUA 3KMNA 2I3YA 4EIQA 2OJLA 6GSWA 1SU9A 4G19A 4ISDA 2C4JA 2VCTA 4KW6A 4OD7A 3KXOA 4E8HA 1O85A 1PX6A 1SK0A 2X4AA 3CSHA 2VLVA 2H6YA 2H6XA 4TXOA 5DCHA 4NWYA 3A2VA 5CYYA 1GSUA 4POKA 2RUEA 3GH9A 1H75A 4N0ZA 2H0HA 5IQYA 1Z3EA 3D22A 3MSZA 2K6VA 4TR0A 1TRSA 3GSTA 2G0FA 1SK2A 2H6ZA 5DAKB 3LW9A 4X4JA 2H01A 4HOJA 2QC7A 2H1GA 3LQ7A 1PKWA 1O73A 1M9AA 4TKYA 1XFLA 1BEDA 1W89A 4WXTA 2C3QA 2YV9A 3L0HA 3GURA 2VM1A 4FQUA 3CSJA 2R0CA 1Q4JA 2VCWA 3CRTA 3RHBA 5EPFA 5BRTA 1ZMAA 2GSRA 3E9JB 4MK3A 4TW5A 2KOKA 4MH3A 4PUFC 5D9VA 1R5PA 1HQOA 3PH9A 2KP1A 4Z7XA 1PN0A 4CY6A 5IPGA 14GSA 3EVIA 2YPMA 1B9YC 4Q5QA 2OE1A 4AGSA 2CV4A 3KMOA 2IN3A 6GSUA 2DJKA 3KH9A 3KCMA 1K3YA 1M0UA 5JCWA 1SJ6A 2M80A 2D2ZA 3TKSE 2GZPA 2FA4A 5ELGA 1G6WA 5G2ZA 5FHIA 4ZBBA 3WD6A 1F3BA 1T00A 2QA1A 3TJJA 2OBIA 3I69A 3EYTA 4XS4B 3RHCA 1B9XC 2GVPA 4D73A 1PA3A 3FKFA 4AJ8A 13GSA 3LXZA 2HRKA 3AY8A 1Z6MA 2IIYA 4GF0A 2F9SA 1GNEA 3QD9A 4XRDA 2K18A 2MBSA 3IK7A 4KNDA 4K7NA 4PGTA 5J4UA 2C3NA 1AC1A 1OC9A 2V32A 3IBHA 1PL2A 2YWIA 5BMUA 4IP6A 5A5KA 2C0FA 1PRXA 2B3SA 1B4PA 3JCML 1T3BA 2ES7A 2WULA 2B5YA 1TOFA 5B7CA 3F6FA 1ZZYA 4AJ7A 4WF4A 1LJRA 5H5RA 4CHSA 1YZXA 6GSYA 1V98A 4XRAA 5GAPD 2GT6A 3VPQA 3UL3A 4JRRA 2VIMA 2EC4A 4IVFA 1OKTA 1A24A 5A4UA 3HCZA 1VF3A 1OAZA 2QA2A 1NW2A 4GLTA 2H8LA 3D0ZA 1S3CA 2V2GA 3HDCA 1A0FA 5EL8A 2AYTA 2FWFA 12GSA 1WMJA 4EE0A 1CQHA 2AB6A 4FO5A 1ZYNA 4NV2A 2EIQA 3DD3A 2R0PA 1QFNA 2H75A 2VCZA 1M99A 3QDNA 2H0IA 3VWVA 3ERFA 5IMCA 4BVXB 2RUFA 2LTKA 5B6NA 1Y6EA 1T8EB 4PNGA 4POMA 2ZUPA 3TJFA 1ABAA 2IWTA 4NMUA 2I9HA 2YZHA 4GQFA 5F8BA 5CO3A 4DVCA 1MDKA 2R5GA 4N10A 2WJUA 3QAVA 4ML1A 3HZ8A 3G7YA 3HHVA 1XWGA 3WT2A 4DEJA 2JSYA 5DJLA 3UARA 3FZ9A 5KN0A 4L5LA 2LJAA 1GSYA 2M46A 3C1RA 3F8UA 1HNCA 1FB0A 2HRNA 3HJMA 1M7TA 4G0KA 1C72A 3GL5A 2AV4A 4I2UA 3M9KA 4GSTA 4MNNA 2VD1A 3H1NA 5G30A 5G1LA 4GSSA 3IHQA 3RPNA 4FH8A 1YKCA 3HXSA 1TK8B 2CAIA 2QSIA 2DC5A 3HY2A 3RDWA 1YF1A 3TRPA 1OE7A 1K0NA 3J7Yb 4ILFA 5FT3A 2R2JA 4MA9A 3ED3A 1ML6A 2V6OA 1UC7A 4MZBA 1JZOA 4ECCA 3FR9A 1ST9A 4WBRD 1F6MC 5DDLA 2OA7A 5DALB 3K8NA 4FYUA 1WRYA 3P8WA 1TDIA 2V6KA 1JHBA 1WWJA 3ZREA 5HR0A 5B6MA 5IMZA 2MYGA 4RI7A 1QMVA 3GTUA 3H93A 3HD5A 1M2DA 2DSAA 4CW9A 1NSWA 2B1KA 1EOGA 1O81A 4LMVA 1OYJA 5D73A 2YCDA 1K0AA 4KCEA 2C0DA 3KP9A 1EP7A 2E2GA 1U88A 5KN1A 3ZL5A 2IMKA 1GTIA 1NHOA 1TK0B 2CAQA 1R26A 1PL1A 1GTBA 4TR3A 4ZB6A 5FWGA 3BBYA 4ICYA 5F06A 3LWAA 3VWUA 1A0RP 4ECIA 3MAKA 1O7UA 2HZEA 3ZYWA 3W8SA 1FB6A 1PX7A 1THXA 1Z6NA 1X5DA 1A2JA 1TXXA 1X5CA 5DBQA 2B7KA 3N9JA 4FIWA 2J23A 5G31A 3ZIVA 3DKSA 5KN3A 2PGTA 2FWHA 1ERWA 2P31A 2FLSA 4ZBDA 1DUGA 3CSIA 2CT6A 4ULXA 2IMIA 2C1YA 3GYKA 5EY6A 2A2RA 2H72A 1MDIA 2ON5A 2LV3A 2PVOC 1UN2A 2C0GA 1W4VA 1NHYA 2MMOA 5CRWA 2K8SA 3I43A 3QCPA 2FHEA 2PMTA 4ZB8A 5H5QA 1F2EA 5D96A 2IFQA 5DQSA 1YKAA 1CQGA 4HEA2 2QGVA 1WIKA 3L4NA 2VL9A 1XPVA 4H86A 3C7MA 2PUKC 3BCKA 4CY8A 5CRGA 2PU9C 3TUEA 1UA5A 4LA1A 2R3XA 2GS3A 1ZYPA 3GSSA 4V1Ag 2MZCA 4GSNA 3GNJA 2BMXA 2G2QA 2JZRA 1GUHA 4AF2A 3FEUA 1X9MB 4YQUA 1TU8A 1K0MA 4OO4A 5JWQB 1PD21 1XWCA 3F4SA 2ZCTA 1Z7RA 4I5QA 2WZ9A 2FGXA 1ON4A 3WGXA 2JZSA 4PURA 2EIRA 3QOUA 2HRAA 3TJKA 3EWLA 3M3MA 3VLNA 3A2XA 2OADA 2WFCA 4PQIA 3VWWA 2C8UA 19GSA 4RUVA 2LRTA 2H1DA 3LYKA 1AIUA 2VD0A 4KH7A 1O8WA 2VM2A 4GRFA 1T4ZA 3M8NA 3FZ5A 4NXIA 3F0IA 1GSDA 1GH2A 4A5PA 5C00A 1O8XA 1I9DA 5AGYA 2E2MA 1S3AA 4WR5A 2AAWA 1SJIA 4IP1A 4LL1B 2B6MA 3R2QA 3TKQA 1PKZA 4OCFA 4EIPA 3GX0A 2V1MA 2A4VA 4AJ6A 2NDOA 3HA9A 4TR1A 4K7IA 1IYHA 1FVJA 4KB3A 1QXHA 2L5OA 4OFNA 2L57A 2FUG2 4NHZA 4HI7A 2A2PA 2VOCA 4YAPA 4I6XA 1GTAA 3LORA 3SBCA 1WPIA 4OWYA 4X0XA 2PWJA 5L71A 1MDJA 1GLPA 3C73A 2LRNA 4JZQA 2H74A 5F0GA 3QAWA 3A5WA 4K0NA 5DCGA 5ABRA 4MF5A 4J56E 2CX4A 1GNWA 3BCIA 3HJOA 1J0FA 1WP0A 4MF7A 5GAND 2YWMA 4V2NA 4MDCA 2EIOA 4PX1A 4EL1A 4G0LA 1DSBA 3P2AA 5DJMA 4USSA 4XTSA 4FYBA 4HQZA 2H66A 2DIZA 4RI6A 2BTOT 2RM6A 4O7HA 1MD3A 2MBTA 3MIXA 2FNOA 4HS1A 2B5EA 4K5SA 3EC3A 3US3A 3O3TA 4O5UA 3DRNA 2WB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B1L A;  2LKU A;  5KEJ A;  1XVW A;  2DBC A;  3UIW A;  1X5E A;  2IMF A;  4RQX A;  3KD0 A;  2J9H A;  3KTL A;  4IW9 A;  4TN8 A;  3ZLP A;  4IJ3 A;  2K9F A;  2R4V A;  2VO4 A;  3TJB A;  1GUK A;  1K0B A;  4HU7 A;  5G5F A;  1BAY A;  1QGV A;  4CDO A;  5D9X A;  2X8G A;  5C04 A;  2E7P A;  4O32 A;  3TKS A;  2LNS A;  4MJC A;  5AIS A;  1EEM A;  3DYR A;  4ZL7 A;  1YDK A;  2MMN A;  3KTB A;  1QK8 A;  4BVY A;  1PQN A;  4K7O A;  4MP4 A;  5ECK B;  1XOB A;  2M72 A;  3PR8 A;  3ERW A;  2B5X A;  3TGZ A;  4V2M A;  2WGR A;  1JZD A;  2JSZ A;  2H19 A;  1SEN A;  3QMX A;  3CTG A;  2AJQ B;  1RK4 A;  3HKR A;  1OVN A;  1G6Y A;  1DBY A;  2YP6 A;  1PN9 A;  4HJ2 A;  3EU3 A;  4PUA A;  2DLX A;  5JWR B;  2H71 A;  4KAE A;  5AIV A;  1GUL A;  4IGJ A;  1PSQ A;  1YEX A;  1SD8 A;  3DEX A;  3BJ5 A;  1UVZ A;  3GKM A;  2XC2 A;  5G5E A;  1X9S B;  4WR4 A;  3N5O A;  3GKX A;  4F0C A;  2PVQ A;  1VF4 A;  2GZY A;  2VAF A;  2IFQ B;  2DJJ A;  2C80 A;  2R37 A;  2OBK A;  4G10 A;  4K0G A;  2VL2 A;  1U3A A;  2VCQ A;  1TRV A;  2IME A;  3ZZX A;  4EKZ A;  1V9W A;  1A8L A;  4L5O A;  1HYU A;  2LEG A;  3DVX A;  3HJP A;  1B8X A;  4Q5F A;  1GRX A;  2GZZ A;  1GL8 A;  3H8Q A;  5DVB A;  3M9J A;  3TKR A;  4MMM A;  3FYG A;  4L0W A;  5ECO B;  4KE3 A;  1EGO A;  2CVB A;  1TK5 B;  1AAZ A;  3Q74 A;  1BG5 A;  2N5B A;  1YQ1 A;  2XBQ A;  1XBS A;  2VCV A;  3U5R E;  1QUW A;  3F6D A;  4MF6 A;  1T7P B;  1FAA A;  3UBL A;  5HR2 A;  5JWO B;  2TRX A;  1BQ7 A;  5IM9 A;  4XHM A;  1Z7P A;  5ECR B;  2GQL A;  1FHE A;  4MCU A;  1R4W A;  3O6T A;  3GKK A;  4IQA A;  1O6J A;  2GTU A;  3LEF A;  2I81 A;  5ECL B;  4V2L A;  3LGC A;  1ACV A;  3U6V A;  1ZYQ B;  3P90 A;  5LCZ A;  1ERV A;  3UVH A;  6GST A;  4LMW A;  3VWX A;  3IPZ A;  4TXO B;  1QQ2 A;  5HR1 A;  1A2L A;  4V1A p;  2DIY A;  2YJ7 A;  3GKN A;  2C3T A;  2X8H A;  4TR1 B;  3TCO A;  2L4C A;  2P5Q A;  1TRU A;  3DXB A;  3LYP A;  1TRW A;  1OE8 A;  3IK9 A;  5DAK A;  3P7X A;  2WRT A;  2L6C A;  1ZL9 A;  3VI5 A;  2YWN A;  2JZT A;  3CBU A;  1R7H A;  3GMF A;  3CMI A;  1S3D A;  1U87 A;  3DWV A;  4BA7 A;  1WOU A;  3IXR A;  5IMV A;  1KBN A;  1KNG A;  5ECQ B;  2K8V A;  2PN8 A;  3C8E A;  5DQY A;  2KUC A;  1K0O A;  4ACS A;  2N5A A;  1A2M A;  1SKS B;  1WE0 A;  2DML A;  1DE2 A;  3PIN A;  2LJK A;  4KDY A;  20GS A;  3WGE A;  5HR3 A;  4GCI A;  4EVM A;  4ZIJ A;  2B7J A;  1AQX A;  2JAC A;  2O7K A;  3ME8 A;  1F37 A;  1EOH A;  1EEJ A;  2LQO A;  2X99 A;  5E59 A;  3CRU A;  17GS A;  2A2S A;  2LNT A;  1G7E A;  4OCE A;  4OFT A;  1FOV A;  3IDV A;  1Z5Y E;  1TI1 A;  2RII A;  3F3Q A;  5HQP A;  5ECI B;  4DSS A;  4IN0 A;  1K0D A;  4HU9 A;  2QKE A;  3DVW A;  3GX8 A;  22GS A;  1FG4 A;  2DJ0 A;  4POL A;  5AIX A;  1EGR A;  4POB A;  4O92 A;  2BJX A;  4ML6 A;  5IPH A;  5J5N A;  2YZU A;  4D73 B;  1YF0 A;  4XS4 A;  1URM A;  3W6G A;  4Q5N A;  2YNX A;  2FD3 A;  1MD4 A;  2OE0 A;  3A3T A;  3KM6 A;  4TRX A;  1SL2 B;  2I1U A;  2XPE A;  1K3L A;  3ZFB A;  5ECM B;  2V41 A;  5CRD A;  3ZFL A;  5ID2 A;  4YH2 A;  4EF0 A;  4O5R A;  1KEB A;  1SKW B;  3E0U A;  4E8E A;  3HVS A;  2HXK A;  1XOA A;  2C0E A;  2FCH A;  3VFI A;  4I97 A;  3FW2 A;  9GSS A;  5G1K A;  1OC9 B;  2YWO A;  3MWH A;  1RW1 A;  2GQM A;  2IJY A;  2GSS A;  2ON7 A;  2DJ3 A;  2O87 A;  3Q6O A;  1BX9 A;  2E0Q A;  2DMM A;  1EP8 A;  1XXU A;  5D9T A;  4TVE A;  3D21 A;  3VUR A;  4HDE A;  2RM5 A;  2NVL A;  3TB2 A;  4N0V A;  3GUS A;  3APS A;  1GSQ A;  1A23 A;  2XBI A;  2O8V B;  5CRH A;  16GS A;  1JLV A;  3GV1 A;  1ZOF A;  1V2A A;  2O89 A;  3KJY A;  1RQM A;  1U6T A;  2TIR A;  4TR4 A;  2HSY A;  3LSZ A;  2HE3 A;  2CA8 A;  3IC4 A;  6GSX A;  3HZ4 A;  1IYI A;  3TKP A;  3KEB A;  2GDR A;  4PQ1 A;  3GIX A;  1XIY A;  1AQW A;  2NPB A;  1SYR A;  2GT5 A;  3IAS 2;  4QQ7 A;  3GL3 A;  2PPT A;  2GSQ A;  4WET A;  3W8J A;  4HQS A;  3GA4 A;  1AQV A;  5A4V A;  2FWE A;  1USB A;  3FR3 A;  4KDX A;  1B4Q A;  1EV9 A;  3GFK A;  1BYE A;  1BJX A;  4RQR A;  4F2I A;  4HZ2 A;  2ALB A;  2F8F A;  3C1S A;  4Q5R A;  4ID0 A;  4BVX A;  5H5S A;  1TP9 A;  1XW9 A;  3KGK A;  4KA0 A;  2VLU A;  4N30 A;  5GZZ B;  5HFG A;  4J2F A;  5LD0 A;  2L6D A;  2LS5 A;  3TRX A;  5KN2 A;  3EIN A;  4OO5 A;  3TDG A;  3DML A;  2OKA A;  2N5F A;  4MPG A;  4YAV A;  5HFI A;  3M1G A;  4MH2 A;  5D93 A;  1XWK A;  3IRA A;  2YN1 A;  3D6I A;  4IQ1 A;  4J57 E;  1GWC A;  2HYX A;  2LST A;  2PER A;  5IIZ A;  5CP1 A;  4FYC A;  5JCU A;  3FHK A;  4MLY A;  1R5A A;  5COH A;  3UOM A;  1SD9 A;  1N2A A;  2OE3 A;  2VUP A;  2YV7 A;  2F51 A;  1SK1 A;  2CVD A;  4LLR A;  5CRE A;  1EWX A;  2L59 A;  3F3R A;  3NOF A;  3D4T A;  1PGT A;  4JBB A;  4JU5 A;  3TKS C;  1V40 A;  4ZIL A;  1OC3 A;  2MMA A;  4F03 A;  2Z9S A;  3L9S A;  4NHW A;  1ZCP A;  4N11 A;  3UMA A;  11GS A;  5ECP B;  5B8A A;  3LXT A;  4JR6 A;  1FVK A;  5F07 A;  3UVT A;  2VL3 A;  5DAL A;  1HNA A;  2HZF A;  3TRQ A;  4GTU A;  4WF5 A;  3TOT A;  3EMP A;  5IOW A;  3GRX A;  5IOX A;  1Y25 A;  3NZN A;  1K0C A;  3GTU B;  1TU7 A;  1VGL A;  3OR5 A;  2LRC A;  1VF2 A;  3F4R A;  2YOI A;  3L9V A;  1ILO A;  5ECS A;  4L0U A;  4XS1 A;  3WT1 A;  2IMD A;  2WCI A;  3FR6 A;  4K6X A;  3VPT A;  1ZGN A;  3UBK A;  4BL7 A;  2GLR A;  3KZQ A;  2YJH A;  1FW1 A;  3Q19 A;  1M2A A;  4WEY A;  4LL4 B;  1Z9H A;  3ZVJ D;  2VL2 C;  2F3M A;  3SWL A;  1F9M A;  4DSS B;  3HVX A;  1I5G A;  2VLT A;  5JCG A;  4OMV A;  2HZE B;  2HFD A;  4EO3 A;  5ECH B;  1YJ6 A;  5GSS A;  2CZ2 A;  5HFK A;  5CAX A;  3V1W A;  2XPD A;  4JR4 A;  3G9B A;  4XIH A;  4ECJ A;  1Q98 A;  3IAM 2;  3VI7 A;  4G2E A;  2FA8 A;  3EU4 A;  5F05 A;  2KLX A;  3EE2 A;  1JZR A;  3LG6 A;  4WKW A;  3FRC A;  5ID2 B;  1PMT A;  4MJE A;  4YQV A;  4G9H A;  1SL0 B;  4IS0 A;  2H76 A;  3QPM A;  4KCA A;  4EXJ A;  1TW9 A;  4I2T A;  1SL1 B;  2H73 A;  2RLI A;  3TJG A;  3QFA C;  4ZXG A;  1J08 A;  2KP2 A;  4TOP A;  4JED A;  1XWB A;  1XWA A;  3ME7 A;  3HYP A;  3ZML A;  3UEM A;  3GHA A;  3UAP A;  1DE1 A;  4K9Z A;  4GWR A;  4P3Y B;  1WJK A;  2NTO A;  2FWG A;  5J9C A;  3ISO A;  5A4W A;  3TOU A;  3EUR A;  1LU4 A;  3F63 A;  3IV4 A;  4X1U A;  1TKD B;  5IO2 A;  1T1V A;  5IO0 A;  2LUS A;  4IJI A;  2IL3 A;  3DGQ A;  4HJM A;  5AN1 A;  3APO A;  1JFU A;  4KDU A;  3APQ A;  1LBK A;  5IMD A;  5D8I A;  3IR4 A;  3RAZ A;  2JAD A;  1G7O A;  3F9U A;  5J41 A;  1ERT A;  3MNG A;  1EZK A;  1J9B A;  2H0G A;  2P5R A;  3CTF A;  3E3E A;  2H1A A;  4K8M A;  2L4Q A;  1GSE A;  2LQQ A;  3EMX A;  1KTE A;  4BWS A;  1EV4 A;  3LJR A;  2HI7 A;  4PNF A;  10GS A;  4IEL A;  1T4Y A;  3ZMK A;  4F0B A;  3PGT A;  3H79 A;  4QL7 A;  1N8J A;  3G7J A;  3I6A A;  4OFM A;  4PQH A;  3BD2 A;  4IBP A;  3UJ1 A;  1A8Y A;  4X43 A;  5IMF A;  1AW9 A;  1ERU A;  3FK8 A;  1B48 A;  7GSS A;  4QL9 A;  3LFL A;  1X9W B;  2JU5 A;  1AUC A;  3DIE A;  3FY7 A;  4F82 A;  3QR6 A;  18GS A;  1JZW A;  2GGT A;  3MDK A;  2H1B A;  2P0G A;  4IHU A;  4BWQ A;  3S9F A;  5EVO A;  4WBJ A;  2HSH A;  3ZIT A;  1SYX A;  1M2B A;  4NPB A;  3I9V 2;  3J7Y k;  1U3I A;  2O85 A;  4MJA A;  3D5J A;  4ZL9 A;  3FZA A;  3RBT A;  2MMZ A;  4JE1 A;  4ECB A;  2HRF A;  1X0R A;  5ELA A;  3F4T A;  2I4A A;  4ZBA A;  3WGD A;  3WYW A;  2YAN A;  4I8B A;  4KX4 A;  1GP1 A;  1E2Y A;  5IMA A;  2GQK A;  4PXO A;  1NM3 A;  2HLS A;  1H4O A;  1GUM A;  4IKH A;  4EUY A;  4MZW A;  4XCS A;  3ZRD A;  2IPA A;  4NAX A;  5E4W A;  1ZYE A;  3IOS A;  4KSO A;  4KSM A;  5ECN B;  3ZVJ A;  1E6B A;  1V58 A;  4MPF A;  4TXV A;  3Q18 A;  2CX3 A;  4HZ4 A;  3O76 A;  1K3O A;  8GSS A;  3C71 A;  1XCC A;  2CVK A;  2FY6 A;  6GSV A;  5B8B A;  2WDU A;  2H30 A;  4BPY A;  2PBJ A;  4HUA A;  1XZO A;  3HVV A;  2AHE A;  3L9U A;  1YEP A;  1GSF A;  2HT9 A;  2ZNM A;  5GST A;  5ENU A;  4K2D A;  3QFB C;  2L5L A;  3ZTL A;  4KUN A;  3GH6 A;  1GSS A;  3KIJ A;  1MEK A;  4XS6 A;  4DSQ A;  4EC0 A;  5J3R A;  4EDY A;  2F8A A;  4MAB A;  5CNW A;  3NIV A;  3KP8 A;  3VK9 A;  3ERG A;  3CYN A;  1HNB A;  3IE3 A;  2VCX A;  1SJZ A;  4YQM A;  2CQ9 A;  5INY A;  3KH7 A;  5D9W A;  1G0T A;  1SKR B;  2WS2 A;  2DJ2 A;  1XW5 A;  4NV5 A;  2OAC A;  1OC8 A;  4GQC A;  1XW6 A;  4GXZ A;  4L8E A;  3RPP A;  1YY7 A;  2GST A;  3GN3 A;  2XHF A;  4MZC A;  1FO5 A;  2TRC P;  3BOA A;  1VRS D;  4KGI A;  1AXD A;  1TJD A;  6GSS A;  1TTZ A;  5J9B A;  1TI3 A;  3M0F A;  3IA1 A;  2LJR A;  2H70 A;  4ZB9 A;  2KHP A;  3QAG A;  3ZIJ A;  1M9B A;  1VF1 A;  1OKD A;  1V57 A;  2X64 A;  1THO A;  2R6K A;  3CXG A;  1HD2 A;  2AUV A;  3L78 A;  4DSR A;  2CZ3 A;  2HNL A;  3D4M A;  2X8C A;  1XVQ A;  2REM A;  3FZ4 A;  2JL4 A;  4F9Z A;  1GLQ A;  2DJ1 A;  3H4K A;  5LNK e;  2NBS A;  1MTC A;  4ZL8 A;  1F3A A;  4MJB A;  3A2W A;  4K1F A;  4EDZ A;  1JLW A;  3G7I A;  1GTU A;  3KMN A;  2I3Y A;  2OJL A;  6GSW A;  1SU9 A;  4G19 A;  4ISD A;  2C4J A;  2VCT A;  4KW6 A;  4OD7 A;  3KXO A;  4E8H A;  1O85 A;  1PX6 A;  1SK0 A;  3CSH A;  2VLV A;  2H6Y A;  2H6X A;  4TXO A;  5DCH A;  4NWY A;  3A2V A;  5CYY A;  1GSU A;  4POK A;  2RUE A;  3GH9 A;  1H75 A;  4N0Z A;  2H0H A;  5IQY A;  1Z3E A;  3D22 A;  3MSZ A;  2K6V A;  4TR0 A;  1TRS A;  3GST A;  2G0F A;  1SK2 A;  2H6Z A;  5DAK B;  2H01 A;  4HOJ A;  2QC7 A;  2H1G A;  3LQ7 A;  1PKW A;  1O73 A;  1M9A A;  4TKY A;  1XFL A;  1BED A;  1W89 A;  4WXT A;  2C3Q A;  2YV9 A;  3L0H A;  3GUR A;  2VM1 A;  3CSJ A;  1Q4J A;  2VCW A;  3CRT A;  3RHB A;  5EPF A;  1ZMA A;  2GSR A;  3E9J B;  4MK3 A;  4TW5 A;  2KOK A;  4MH3 A;  4PUF C;  5D9V A;  1R5P A;  1HQO A;  3PH9 A;  2KP1 A;  4Z7X A;  5IPG A;  14GS A;  3EVI A;  2YPM A;  1B9Y C;  4Q5Q A;  2OE1 A;  4AGS A;  2CV4 A;  3KMO A;  2IN3 A;  6GSU A;  2DJK A;  3KH9 A;  3KCM A;  1K3Y A;  1M0U A;  5JCW A;  1SJ6 A;  2M80 A;  2D2Z A;  3TKS E;  2GZP A;  2FA4 A;  5ELG A;  1G6W A;  5G2Z A;  5FHI A;  4ZBB A;  3WD6 A;  1F3B A;  1T00 A;  3TJJ A;  2OBI A;  3I69 A;  3EYT A;  4XS4 B;  3RHC A;  1B9X C;  2GVP A;  4D73 A;  1PA3 A;  3FKF A;  4AJ8 A;  13GS A;  3LXZ A;  3AY8 A;  1Z6M A;  2IIY A;  4GF0 A;  2F9S A;  1GNE A;  3QD9 A;  4XRD A;  2K18 A;  2MBS A;  3IK7 A;  4KND A;  4K7N A;  4PGT A;  5J4U A;  2C3N A;  1AC1 A;  1OC9 A;  2V32 A;  3IBH A;  1PL2 A;  2YWI A;  4IP6 A;  5A5K A;  2C0F A;  1PRX A;  2B3S A;  1B4P A;  3JCM L;  1T3B A;  2ES7 A;  2WUL A;  2B5Y A;  1TOF A;  5B7C A;  3F6F A;  1ZZY A;  4AJ7 A;  4WF4 A;  1LJR A;  5H5R A;  4CHS A;  1YZX A;  6GSY A;  1V98 A;  4XRA A;  5GAP D;  2GT6 A;  3VPQ A;  3UL3 A;  4JRR A;  2VIM A;  2EC4 A;  4IVF A;  1OKT A;  1A24 A;  5A4U A;  3HCZ A;  1VF3 A;  1OAZ A;  1NW2 A;  4GLT A;  2H8L A;  3D0Z A;  1S3C A;  2V2G A;  3HDC A;  1A0F A;  5EL8 A;  2AYT A;  2FWF A;  12GS A;  1WMJ A;  4EE0 A;  1CQH A;  2AB6 A;  4FO5 A;  4NV2 A;  2EIQ A;  3DD3 A;  1QFN A;  2H75 A;  2VCZ A;  1M99 A;  3QDN A;  2H0I A;  3VWV A;  3ERF A;  5IMC A;  2RUF A;  2LTK A;  5B6N A;  1Y6E A;  1T8E B;  4PNG A;  4POM A;  2ZUP A;  3TJF A;  1ABA A;  2IWT A;  4NMU A;  2I9H A;  2YZH A;  4GQF A;  5F8B A;  5CO3 A;  4DVC A;  1MDK A;  2R5G A;  4N10 A;  2WJU A;  3QAV A;  4ML1 A;  3HZ8 A;  3G7Y A;  3HHV A;  1XWG A;  3WT2 A;  4DEJ A;  2JSY A;  5DJL A;  3UAR A;  3FZ9 A;  5KN0 A;  4L5L A;  2LJA A;  1GSY A;  2M46 A;  3C1R A;  3F8U A;  1HNC A;  1FB0 A;  2HRN A;  3HJM A;  1M7T A;  1C72 A;  3GL5 A;  2AV4 A;  4I2U A;  3M9K A;  4GST A;  2VD1 A;  3H1N A;  5G30 A;  5G1L A;  4GSS A;  3IHQ A;  3RPN A;  4FH8 A;  1YKC A;  3HXS A;  1TK8 B;  2CAI A;  2QSI A;  2DC5 A;  3HY2 A;  3RDW A;  1YF1 A;  3TRP A;  1OE7 A;  1K0N A;  3J7Y b;  4ILF A;  5FT3 A;  2R2J A;  4MA9 A;  3ED3 A;  1ML6 A;  2V6O A;  1UC7 A;  4MZB A;  1JZO A;  4ECC A;  3FR9 A;  1ST9 A;  4WBR D;  1F6M C;  5DDL A;  2OA7 A;  5DAL B;  3K8N A;  4FYU A;  1WRY A;  3P8W A;  1TDI A;  2V6K A;  1JHB A;  1WWJ A;  3ZRE A;  5HR0 A;  5B6M A;  5IMZ A;  2MYG A;  4RI7 A;  1QMV A;  3GTU A;  3H93 A;  3HD5 A;  1M2D A;  2DSA A;  4CW9 A;  1NSW A;  2B1K A;  1EOG A;  1O81 A;  4LMV A;  1OYJ A;  5D73 A;  2YCD A;  1K0A A;  4KCE A;  2C0D A;  3KP9 A;  1EP7 A;  2E2G A;  1U88 A;  5KN1 A;  3ZL5 A;  2IMK A;  1GTI A;  1NHO A;  1TK0 B;  2CAQ A;  1R26 A;  1PL1 A;  1GTB A;  4TR3 A;  4ZB6 A;  5FWG A;  3BBY A;  5F06 A;  3LWA A;  3VWU A;  1A0R P;  4ECI A;  3MAK A;  1O7U A;  2HZE A;  3ZYW A;  3W8S A;  1FB6 A;  1PX7 A;  1THX A;  1Z6N A;  1X5D A;  1A2J A;  1TXX A;  1X5C A;  5DBQ A;  2B7K A;  3N9J A;  4FIW A;  2J23 A;  5G31 A;  3ZIV A;  3DKS A;  5KN3 A;  2PGT A;  2FWH A;  1ERW A;  2P31 A;  2FLS A;  4ZBD A;  1DUG A;  3CSI A;  2CT6 A;  4ULX A;  2IMI A;  2C1Y A;  3GYK A;  5EY6 A;  2A2R A;  2H72 A;  1MDI A;  2ON5 A;  2LV3 A;  2PVO C;  1UN2 A;  2C0G A;  1W4V A;  1NHY A;  2MMO A;  5CRW A;  2K8S A;  3I43 A;  3QCP A;  2FHE A;  2PMT A;  4ZB8 A;  5H5Q A;  1F2E A;  5D96 A;  2IFQ A;  5DQS A;  1YKA A;  1CQG A;  4HEA 2;  2QGV A;  1WIK A;  3L4N A;  2VL9 A;  1XPV A;  4H86 A;  3C7M A;  2PUK C;  3BCK A;  5CRG A;  2PU9 C;  3TUE A;  1UA5 A;  4LA1 A;  2R3X A;  2GS3 A;  3GSS A;  4V1A g;  2MZC A;  4GSN A;  3GNJ A;  2BMX A;  2G2Q A;  2JZR A;  1GUH A;  4AF2 A;  3FEU A;  1X9M B;  4YQU A;  1TU8 A;  1K0M A;  4OO4 A;  5JWQ B;  1PD2 1;  1XWC A;  3F4S A;  2ZCT A;  1Z7R A;  4I5Q A;  2WZ9 A;  2FGX A;  1ON4 A;  3WGX A;  2JZS A;  4PUR A;  2EIR A;  3QOU A;  3TJK A;  3EWL A;  3M3M A;  3VLN A;  3A2X A;  2OAD A;  2WFC A;  4PQI A;  3VWW A;  2C8U A;  19GS A;  4RUV A;  2LRT A;  2H1D A;  3LYK A;  1AIU A;  2VD0 A;  4KH7 A;  1O8W A;  2VM2 A;  4GRF A;  1T4Z A;  3M8N A;  3FZ5 A;  4NXI A;  3F0I A;  1GSD A;  1GH2 A;  5C00 A;  1O8X A;  1I9D A;  5AGY A;  2E2M A;  1S3A A;  4WR5 A;  2AAW A;  1SJI A;  4IP1 A;  4LL1 B;  2B6M A;  3R2Q A;  3TKQ A;  1PKZ A;  4OCF A;  3GX0 A;  2V1M A;  2A4V A;  4AJ6 A;  2NDO A;  3HA9 A;  4TR1 A;  4K7I A;  1IYH A;  1FVJ A;  4KB3 A;  1QXH A;  2L5O A;  4OFN A;  2L57 A;  2FUG 2;  4NHZ A;  4HI7 A;  2VOC A;  4YAP A;  4I6X A;  1GTA A;  3LOR A;  3SBC A;  1WPI A;  4OWY A;  4X0X A;  2PWJ A;  5L71 A;  1MDJ A;  1GLP A;  3C73 A;  2LRN A;  4JZQ A;  2H74 A;  5F0G A;  3QAW A;  3A5W A;  4K0N A;  5DCG A;  5ABR A;  4MF5 A;  4J56 E;  2CX4 A;  1GNW A;  3BCI A;  3HJO A;  1J0F A;  1WP0 A;  4MF7 A;  5GAN D;  2YWM A;  4V2N A;  4MDC A;  2EIO A;  4PX1 A;  4EL1 A;  1DSB A;  3P2A A;  5DJM A;  4XTS A;  4FYB A;  4HQZ A;  2H66 A;  2DIZ A;  4RI6 A;  2BTO T;  2RM6 A;  4O7H A;  1MD3 A;  2MBT A;  4HS1 A;  2FNO A;  2B5E A;  3EC3 A;  3US3 A;  3O3T A;  3DRN A;  2WB9 A; 
#chains in the Genus database with same CATH topology
 2B1L A;  2LKU A;  5KEJ A;  1XVW A;  2DBC A;  3UIW A;  1X5E A;  2IMF A;  4RQX A;  3KD0 A;  2J9H A;  3KTL A;  4IW9 A;  4TN8 A;  3ZLP A;  4IJ3 A;  2K9F A;  2R4V A;  2VO4 A;  3TJB A;  1GUK A;  1K0B A;  3PPU A;  4HU7 A;  5G5F A;  1BAY A;  1QGV A;  4CDO A;  5D9X A;  2X8G A;  5C04 A;  2E7P A;  4O32 A;  3TKS A;  2LNS A;  4MJC A;  5AIS A;  1EEM A;  3DYR A;  4ZL7 A;  1YDK A;  2MMN A;  3KTB A;  1QK8 A;  4BVY A;  1PQN A;  4K7O A;  4MP4 A;  5ECK B;  1XOB A;  2M72 A;  3PR8 A;  3ERW A;  2B5X A;  3TGZ A;  4V2M A;  2WGR A;  1JZD A;  2JSZ A;  2H19 A;  1SEN A;  3QMX A;  3CTG A;  2AJQ B;  1RK4 A;  3HKR A;  1OVN A;  1G6Y A;  1DBY A;  2YP6 A;  1PN9 A;  4HJ2 A;  3EU3 A;  4PUA A;  2DLX A;  5JWR B;  2H71 A;  4KAE A;  5AIV A;  1GUL A;  4IGJ A;  1PSQ A;  1YEX A;  1SD8 A;  3DEX A;  3BJ5 A;  1UVZ A;  3GKM A;  2XC2 A;  5G5E A;  1X9S B;  4WR4 A;  3N5O A;  3GKX A;  4F0C A;  2PVQ A;  1VF4 A;  2GZY A;  2VAF A;  2IFQ B;  2DJJ A;  2C80 A;  2R37 A;  2OBK A;  4G10 A;  4K0G A;  2VL2 A;  1U3A A;  2VCQ A;  1TRV A;  2IME A;  3ZZX A;  4EKZ A;  1V9W A;  1A8L A;  4L5O A;  1HYU A;  2LEG A;  3DVX A;  3HJP A;  1B8X A;  4Q5F A;  1GRX A;  2GZZ A;  1GL8 A;  3H8Q A;  5DVB A;  3M9J A;  3TKR A;  4MMM A;  3FYG A;  1S3R A;  4YKG A;  4L0W A;  5ECO B;  4KE3 A;  1EGO A;  2CVB A;  1TK5 B;  1AAZ A;  3Q74 A;  1BG5 A;  2N5B A;  1YQ1 A;  2XBQ A;  1XBS A;  2VCV A;  3U5R E;  1QUW A;  1M3I A;  3F6D A;  4MF6 A;  1FAA A;  3UBL A;  1T7P B;  5HR2 A;  5JWO B;  2TRX A;  4Z2R A;  1BQ7 A;  5IM9 A;  4XHM A;  1Z7P A;  5ECR B;  2GQL A;  1FHE A;  4MCU A;  1R4W A;  3O6T A;  3GKK A;  4IQA A;  1O6J A;  2GTU A;  3LEF A;  2I81 A;  5ECL B;  4V2L A;  3LGC A;  1ACV A;  3U6V A;  1ZYQ B;  3P90 A;  5LCZ A;  1ERV A;  3UVH A;  6GST A;  4LMW A;  3VWX A;  3IPZ A;  4TXO B;  1QQ2 A;  5HR1 A;  1A2L A;  4V1A p;  2DIY A;  2YJ7 A;  3GKN A;  2C3T A;  2X8H A;  4TR1 B;  3TCO A;  2L4C A;  2P5Q A;  1TRU A;  3DXB A;  3IC8 A;  3LYP A;  1TRW A;  1OE8 A;  3EPT A;  3IK9 A;  5DAK A;  3P7X A;  2WRT A;  2L6C A;  1ZL9 A;  3VI5 A;  2YWN A;  2JZT A;  3CBU A;  1R7H A;  3GMF A;  3CMI A;  1S3D A;  1U87 A;  3DWV A;  4YKF A;  4BA7 A;  1WOU A;  3IXR A;  5IMV A;  1KBN A;  1KNG A;  5ECQ B;  4O5Q A;  2K8V A;  2PN8 A;  3C8E A;  5DQY A;  2KUC A;  1K0O A;  4ACS A;  2N5A A;  1A2M A;  1SKS B;  1WE0 A;  2DML A;  1DE2 A;  3FMW A;  3PIN A;  2LJK A;  4KDY A;  20GS A;  3WGE A;  5HR3 A;  4GCI A;  4EVM A;  4ZIJ A;  2B7J A;  1AQX A;  2JAC A;  2O7K A;  3ME8 A;  1F37 A;  1EOH A;  1EEJ A;  2LQO A;  2X99 A;  5E59 A;  3CRU A;  17GS A;  2A2S A;  2LNT A;  1G7E A;  4OCE A;  4OFT A;  1FOV A;  3IDV A;  1Z5Y E;  1TI1 A;  2RII A;  3F3Q A;  5HQP A;  5ECI B;  4DSS A;  4IN0 A;  1K0D A;  4HU9 A;  2QKE A;  2A4H A;  3DVW A;  3GX8 A;  22GS A;  1FG4 A;  2DJ0 A;  4POL A;  5AIX A;  1EGR A;  4POB A;  4O92 A;  2BJX A;  4ML6 A;  5IPH A;  5J5N A;  2YZU A;  4D73 B;  1YF0 A;  4XS4 A;  1URM A;  3W6G A;  4Q5N A;  2YNX A;  2FD3 A;  1MD4 A;  2OE0 A;  3A3T A;  3KM6 A;  4TRX A;  1SL2 B;  2I1U A;  2XPE A;  1K3L A;  3ZFB A;  5ECM B;  2V41 A;  5CRD A;  3ZFL A;  5ID2 A;  4YH2 A;  4EF0 A;  4O5R A;  1KEB A;  1SKW B;  3E0U A;  4E8E A;  3HVS A;  2HXK A;  1XOA A;  2C0E A;  2FCH A;  3VFI A;  4I97 A;  3FW2 A;  9GSS A;  5G1K A;  1OC9 B;  2YWO A;  3MWH A;  1RW1 A;  2GQM A;  2IJY A;  2GSS A;  2ON7 A;  2DJ3 A;  2O87 A;  3Q6O A;  1BX9 A;  2E0Q A;  2DMM A;  1EP8 A;  1XXU A;  5D9T A;  4TVE A;  3D21 A;  3VUR A;  4HDE A;  2RM5 A;  2NVL A;  3TB2 A;  4N0V A;  3GUS A;  3APS A;  1GSQ A;  1A23 A;  2XBI A;  2O8V B;  5CRH A;  1M3J A;  16GS A;  1JLV A;  3GV1 A;  1ZOF A;  5KOX A;  1V2A A;  2O89 A;  3KJY A;  1RQM A;  1U6T A;  2TIR A;  4TR4 A;  2HSY A;  3LSZ A;  2HE3 A;  2CA8 A;  3IC4 A;  6GSX A;  3HZ4 A;  1IYI A;  3TKP A;  3KEB A;  2GDR A;  4PQ1 A;  3GIX A;  1XIY A;  1AQW A;  2NPB A;  2R0G A;  4Z2U A;  1SYR A;  2GT5 A;  3IAS 2;  4QQ7 A;  3GL3 A;  2PPT A;  2GSQ A;  4WET A;  3W8J A;  4HQS A;  3GA4 A;  1AQV A;  5A4V A;  2FWE A;  1USB A;  3FR3 A;  4KDX A;  1B4Q A;  1EV9 A;  3GFK A;  1BYE A;  1BJX A;  4RQR A;  4F2I A;  4HZ2 A;  2ALB A;  2F8F A;  3C1S A;  4Q5R A;  4ID0 A;  4BVX A;  5H5S A;  3IHG A;  1TP9 A;  1XW9 A;  3KGK A;  4KA0 A;  2VLU A;  4N30 A;  5GZZ B;  5HFG A;  4J2F A;  5LD0 A;  2L6D A;  2LS5 A;  3TRX A;  5KN2 A;  3EIN A;  4OO5 A;  3TDG A;  3DML A;  2OKA A;  2N5F A;  4MPG A;  4YAV A;  5HFI A;  3M1G A;  4MH2 A;  5D93 A;  1XWK A;  3IRA A;  2YN1 A;  3D6I A;  4IQ1 A;  4J57 E;  1GWC A;  2HYX A;  2LST A;  2PER A;  5IIZ A;  5CP1 A;  4FYC A;  5JCU A;  3FHK A;  4MLY A;  1R5A A;  5COH A;  3UOM A;  1SD9 A;  1N2A A;  2OE3 A;  2VUP A;  2YV7 A;  2F51 A;  4G0I A;  1SK1 A;  2CVD A;  4LLR A;  5CRE A;  1EWX A;  2L59 A;  3F3R A;  3NOF A;  3D4T A;  1PGT A;  4JBB A;  4JU5 A;  3TKS C;  1V40 A;  5KOW A;  4ZIL A;  1OC3 A;  2MMA A;  4F03 A;  2Z9S A;  3L9S A;  4NHW A;  1ZCP A;  4N11 A;  3UMA A;  11GS A;  5ECP B;  5B8A A;  3LXT A;  4JR6 A;  1FVK A;  3A5I A;  5F07 A;  3UVT A;  2VL3 A;  5DAL A;  1HNA A;  2HZF A;  3TRQ A;  4GTU A;  4WF5 A;  3TOT A;  3EMP A;  5IOW A;  3GRX A;  5IOX A;  1Y25 A;  3NZN A;  1K0C A;  3GTU B;  1TU7 A;  1VGL A;  3OR5 A;  2LRC A;  1VF2 A;  3F4R A;  2YOI A;  3L9V A;  1ILO A;  5ECS A;  4L0U A;  4XS1 A;  3WT1 A;  2IMD A;  2WCI A;  3CQF A;  3FR6 A;  4K6X A;  3VPT A;  1ZGN A;  3UBK A;  4BL7 A;  2GLR A;  3KZQ A;  2YJH A;  1FW1 A;  3Q19 A;  1M2A A;  4WEY A;  4LL4 B;  1Z9H A;  3ZVJ D;  2VL2 C;  2F3M A;  3SWL A;  1F9M A;  4DSS B;  3HVX A;  1I5G A;  2VLT A;  5JCG A;  4OMV A;  2HZE B;  2HFD A;  4EO3 A;  5ECH B;  1YJ6 A;  5GSS A;  2CZ2 A;  5HFK A;  5CAX A;  3V1W A;  2XPD A;  4JR4 A;  3G9B A;  4XIH A;  4ECJ A;  1Q98 A;  3IAM 2;  3VI7 A;  4G2E A;  2FA8 A;  3EU4 A;  5F05 A;  2KLX A;  3EE2 A;  1JZR A;  3LG6 A;  4WKW A;  3FRC A;  5ID2 B;  1PMT A;  4MJE A;  4YQV A;  4G9H A;  1SL0 B;  4IS0 A;  2H76 A;  3QPM A;  4KCA A;  4EXJ A;  4KF9 A;  1TW9 A;  4I2T A;  1SL1 B;  2H73 A;  2RLI A;  3TJG A;  3QFA C;  4ZXG A;  1J08 A;  2KP2 A;  4TOP A;  4JED A;  1XWB A;  1XWA A;  3ME7 A;  3HYP A;  3ZML A;  3UEM A;  3GHA A;  3UAP A;  1DE1 A;  4K9Z A;  4GWR A;  4P3Y B;  1WJK A;  2NTO A;  2FWG A;  5J9C A;  3ISO A;  5A4W A;  3TOU A;  4BIK A;  3EUR A;  3R3E A;  1LU4 A;  3F63 A;  3IV4 A;  4X1U A;  1TKD B;  5IO2 A;  1T1V A;  5IO0 A;  2LUS A;  4IJI A;  2IL3 A;  3DGQ A;  4HJM A;  5AN1 A;  3APO A;  1JFU A;  4KDU A;  3APQ A;  1LBK A;  5IMD A;  5D8I A;  3IR4 A;  3RAZ A;  2JAD A;  1G7O A;  3F9U A;  5J41 A;  1ERT A;  3MNG A;  1EZK A;  1J9B A;  2H0G A;  2P5R A;  2DKH A;  3CTF A;  3E3E A;  2H1A A;  4K8M A;  2L4Q A;  1GSE A;  2LQQ A;  3EMX A;  1KTE A;  4BWS A;  1EV4 A;  4K5R A;  2UZ8 A;  3LJR A;  2HI7 A;  4PNF A;  10GS A;  4IEL A;  1T4Y A;  3ZMK A;  4F0B A;  4K2X A;  3PGT A;  3H79 A;  4QL7 A;  1N8J A;  3G7J A;  3I6A A;  4OFM A;  4PQH A;  3BD2 A;  4IBP A;  3UJ1 A;  1A8Y A;  4X43 A;  5IMF A;  1AW9 A;  1ERU A;  3FK8 A;  1B48 A;  7GSS A;  4QL9 A;  3LFL A;  1X9W B;  2JU5 A;  1AUC A;  3DIE A;  3FY7 A;  4F82 A;  3QR6 A;  18GS A;  1JZW A;  2GGT A;  3MDK A;  2H1B A;  2P0G A;  4IHU A;  4BWQ A;  3S9F A;  5EVO A;  4WBJ A;  2HSH A;  3ZIT A;  1SYX A;  1M2B A;  4NPB A;  3I9V 2;  3J7Y k;  1U3I A;  2O85 A;  4MJA A;  3D5J A;  4ZL9 A;  3FZA A;  3RBT A;  2HSM A;  2MMZ A;  4JE1 A;  4ECB A;  2HRF A;  1X0R A;  5ELA A;  3F4T A;  2I4A A;  4ZBA A;  3WGD A;  3WYW A;  2YAN A;  4I8B A;  4KX4 A;  1GP1 A;  1E2Y A;  5IMA A;  2GQK A;  4PXO A;  1NM3 A;  2HLS A;  1H4O A;  1GUM A;  4IKH A;  4EUY A;  4MZW A;  4XCS A;  3ZRD A;  2IPA A;  4NAX A;  5E4W A;  1ZYE A;  3IOS A;  4KSO A;  4KSM A;  5ECN B;  3ZVJ A;  1E6B A;  1V58 A;  4MPF A;  4TXV A;  4PTS A;  2CX3 A;  3Q18 A;  4HZ4 A;  3O76 A;  2X49 A;  1K3O A;  8GSS A;  3C71 A;  4BL7 B;  1XCC A;  2CVK A;  2FY6 A;  6GSV A;  5B8B A;  2WDU A;  2H30 A;  4BPY A;  4HSC X;  2PBJ A;  4HUA A;  1XZO A;  3HVV A;  2AHE A;  3L9U A;  1YEP A;  1GSF A;  2HT9 A;  2ZNM A;  5GST A;  5ENU A;  4K2D A;  3QFB C;  2L5L A;  3ZTL A;  4KUN A;  3GH6 A;  1GSS A;  3KIJ A;  1MEK A;  4XS6 A;  4BVY B;  4DSQ A;  4EC0 A;  5J3R A;  4EDY A;  2F8A A;  4MAB A;  3MYD A;  5CNW A;  3NIV A;  3KP8 A;  3VK9 A;  3ERG A;  3CYN A;  1HNB A;  3IE3 A;  2VCX A;  1SJZ A;  4YQM A;  2CQ9 A;  5INY A;  3KH7 A;  5D9W A;  1G0T A;  1SKR B;  2WS2 A;  2DJ2 A;  1FOH A;  1XW5 A;  4NV5 A;  2OAC A;  1OC8 A;  4GQC A;  1XW6 A;  4GXZ A;  4L8E A;  3RPP A;  1YY7 A;  2GST A;  3GN3 A;  4Z2T A;  2XHF A;  4MZC A;  1FO5 A;  2TRC P;  3BOA A;  1VRS D;  4KGI A;  1AXD A;  1TJD A;  6GSS A;  1TTZ A;  5J9B A;  1TI3 A;  3M0F A;  3IA1 A;  2LJR A;  2H70 A;  2DKI A;  4ZB9 A;  2KHP A;  3QAG A;  3ZIJ A;  1M9B A;  1VF1 A;  1OKD A;  1V57 A;  2X64 A;  1THO A;  2R6K A;  3CXG A;  1HD2 A;  2AUV A;  3L78 A;  4DSR A;  2CZ3 A;  2HNL A;  3D4M A;  2X8C A;  1XVQ A;  2REM A;  3FZ4 A;  2JL4 A;  3HVN A;  4F9Z A;  1GLQ A;  2DJ1 A;  3H4K A;  5LNK e;  2NBS A;  1MTC A;  4ZL8 A;  1F3A A;  4MJB A;  3A2W A;  4K1F A;  4EDZ A;  1JLW A;  3G7I A;  1GTU A;  3KMN A;  2I3Y A;  4EIQ A;  2OJL A;  6GSW A;  1SU9 A;  4G19 A;  4ISD A;  2C4J A;  2VCT A;  4KW6 A;  4OD7 A;  3KXO A;  4E8H A;  1O85 A;  1PX6 A;  1SK0 A;  2X4A A;  3CSH A;  2VLV A;  2H6Y A;  2H6X A;  4TXO A;  5DCH A;  4NWY A;  3A2V A;  5CYY A;  1GSU A;  4POK A;  2RUE A;  3GH9 A;  1H75 A;  4N0Z A;  2H0H A;  5IQY A;  1Z3E A;  3D22 A;  3MSZ A;  2K6V A;  4TR0 A;  1TRS A;  3GST A;  2G0F A;  1SK2 A;  2H6Z A;  5DAK B;  3LW9 A;  4X4J A;  2H01 A;  4HOJ A;  2QC7 A;  2H1G A;  3LQ7 A;  1PKW A;  1O73 A;  1M9A A;  4TKY A;  1XFL A;  1BED A;  1W89 A;  4WXT A;  2C3Q A;  2YV9 A;  3L0H A;  3GUR A;  2VM1 A;  4FQU A;  3CSJ A;  2R0C A;  1Q4J A;  2VCW A;  3CRT A;  3RHB A;  5EPF A;  5BRT A;  1ZMA A;  2GSR A;  3E9J B;  4MK3 A;  4TW5 A;  2KOK A;  4MH3 A;  4PUF C;  5D9V A;  1R5P A;  1HQO A;  3PH9 A;  2KP1 A;  4Z7X A;  1PN0 A;  4CY6 A;  5IPG A;  14GS A;  3EVI A;  2YPM A;  1B9Y C;  4Q5Q A;  2OE1 A;  4AGS A;  2CV4 A;  3KMO A;  2IN3 A;  6GSU A;  2DJK A;  3KH9 A;  3KCM A;  1K3Y A;  1M0U A;  5JCW A;  1SJ6 A;  2M80 A;  2D2Z A;  3TKS E;  2GZP A;  2FA4 A;  5ELG A;  1G6W A;  5G2Z A;  5FHI A;  4ZBB A;  3WD6 A;  1F3B A;  1T00 A;  2QA1 A;  3TJJ A;  2OBI A;  3I69 A;  3EYT A;  4XS4 B;  3RHC A;  1B9X C;  2GVP A;  4D73 A;  1PA3 A;  3FKF A;  4AJ8 A;  13GS A;  3LXZ A;  2HRK A;  3AY8 A;  1Z6M A;  2IIY A;  4GF0 A;  2F9S A;  1GNE A;  3QD9 A;  4XRD A;  2K18 A;  2MBS A;  3IK7 A;  4KND A;  4K7N A;  4PGT A;  5J4U A;  2C3N A;  1AC1 A;  1OC9 A;  2V32 A;  3IBH A;  1PL2 A;  2YWI A;  5BMU A;  4IP6 A;  5A5K A;  2C0F A;  1PRX A;  2B3S A;  1B4P A;  3JCM L;  1T3B A;  2ES7 A;  2WUL A;  2B5Y A;  1TOF A;  5B7C A;  3F6F A;  1ZZY A;  4AJ7 A;  4WF4 A;  1LJR A;  5H5R A;  4CHS A;  1YZX A;  6GSY A;  1V98 A;  4XRA A;  5GAP D;  2GT6 A;  3VPQ A;  3UL3 A;  4JRR A;  2VIM A;  2EC4 A;  4IVF A;  1OKT A;  1A24 A;  5A4U A;  3HCZ A;  1VF3 A;  1OAZ A;  2QA2 A;  1NW2 A;  4GLT A;  2H8L A;  3D0Z A;  1S3C A;  2V2G A;  3HDC A;  1A0F A;  5EL8 A;  2AYT A;  2FWF A;  12GS A;  1WMJ A;  4EE0 A;  1CQH A;  2AB6 A;  4FO5 A;  1ZYN A;  4NV2 A;  2EIQ A;  3DD3 A;  2R0P A;  1QFN A;  2H75 A;  2VCZ A;  1M99 A;  3QDN A;  2H0I A;  3VWV A;  3ERF A;  5IMC A;  4BVX B;  2RUF A;  2LTK A;  5B6N A;  1Y6E A;  1T8E B;  4PNG A;  4POM A;  2ZUP A;  3TJF A;  1ABA A;  2IWT A;  4NMU A;  2I9H A;  2YZH A;  4GQF A;  5F8B A;  5CO3 A;  4DVC A;  1MDK A;  2R5G A;  4N10 A;  2WJU A;  3QAV A;  4ML1 A;  3HZ8 A;  3G7Y A;  3HHV A;  1XWG A;  3WT2 A;  4DEJ A;  2JSY A;  5DJL A;  3UAR A;  3FZ9 A;  5KN0 A;  4L5L A;  2LJA A;  1GSY A;  2M46 A;  3C1R A;  3F8U A;  1HNC A;  1FB0 A;  2HRN A;  3HJM A;  1M7T A;  4G0K A;  1C72 A;  3GL5 A;  2AV4 A;  4I2U A;  3M9K A;  4GST A;  4MNN A;  2VD1 A;  3H1N A;  5G30 A;  5G1L A;  4GSS A;  3IHQ A;  3RPN A;  4FH8 A;  1YKC A;  3HXS A;  1TK8 B;  2CAI A;  2QSI A;  2DC5 A;  3HY2 A;  3RDW A;  1YF1 A;  3TRP A;  1OE7 A;  1K0N A;  3J7Y b;  4ILF A;  5FT3 A;  2R2J A;  4MA9 A;  3ED3 A;  1ML6 A;  2V6O A;  1UC7 A;  4MZB A;  1JZO A;  4ECC A;  3FR9 A;  1ST9 A;  4WBR D;  1F6M C;  5DDL A;  2OA7 A;  5DAL B;  3K8N A;  4FYU A;  1WRY A;  3P8W A;  1TDI A;  2V6K A;  1JHB A;  1WWJ A;  3ZRE A;  5HR0 A;  5B6M A;  5IMZ A;  2MYG A;  4RI7 A;  1QMV A;  3GTU A;  1PFO A;  3H93 A;  3HD5 A;  1M2D A;  2DSA A;  4CW9 A;  1NSW A;  2B1K A;  1EOG A;  1O81 A;  4LMV A;  1OYJ A;  5D73 A;  2YCD A;  1K0A A;  4KCE A;  2C0D A;  3KP9 A;  1EP7 A;  2E2G A;  1U88 A;  5KN1 A;  3ZL5 A;  2IMK A;  1GTI A;  1NHO A;  1TK0 B;  2CAQ A;  1R26 A;  1PL1 A;  1GTB A;  4TR3 A;  4ZB6 A;  5FWG A;  3BBY A;  4ICY A;  5F06 A;  3LWA A;  3VWU A;  1A0R P;  4ECI A;  3MAK A;  1O7U A;  2HZE A;  3ZYW A;  3W8S A;  1FB6 A;  1PX7 A;  1THX A;  1Z6N A;  1X5D A;  1A2J A;  1TXX A;  1X5C A;  5DBQ A;  2B7K A;  3N9J A;  4FIW A;  2J23 A;  5G31 A;  3ZIV A;  3DKS A;  5KN3 A;  2PGT A;  2FWH A;  1ERW A;  2P31 A;  2FLS A;  4ZBD A;  1DUG A;  3CSI A;  2CT6 A;  4ULX A;  2IMI A;  2C1Y A;  3GYK A;  5EY6 A;  2A2R A;  2H72 A;  1MDI A;  2ON5 A;  2LV3 A;  2PVO C;  1UN2 A;  2C0G A;  1W4V A;  1NHY A;  2MMO A;  5CRW A;  2K8S A;  3I43 A;  3QCP A;  2FHE A;  2PMT A;  4ZB8 A;  5H5Q A;  1F2E A;  5D96 A;  2IFQ A;  5DQS A;  1YKA A;  1CQG A;  4HEA 2;  2QGV A;  1WIK A;  3L4N A;  2VL9 A;  1XPV A;  4H86 A;  3C7M A;  2PUK C;  3BCK A;  4CY8 A;  5CRG A;  2PU9 C;  3TUE A;  1UA5 A;  4LA1 A;  2R3X A;  2GS3 A;  1ZYP A;  3GSS A;  4V1A g;  2MZC A;  4GSN A;  3GNJ A;  2BMX A;  2G2Q A;  2JZR A;  1GUH A;  4AF2 A;  3FEU A;  1X9M B;  4YQU A;  1TU8 A;  1K0M A;  4OO4 A;  5JWQ B;  1PD2 1;  1XWC A;  3F4S A;  2ZCT A;  1Z7R A;  4I5Q A;  2WZ9 A;  2FGX A;  1ON4 A;  3WGX A;  2JZS A;  4PUR A;  2EIR A;  3QOU A;  2HRA A;  3TJK A;  3EWL A;  3M3M A;  3VLN A;  3A2X A;  2OAD A;  2WFC A;  4PQI A;  3VWW A;  2C8U A;  19GS A;  4RUV A;  2LRT A;  2H1D A;  3LYK A;  1AIU A;  2VD0 A;  4KH7 A;  1O8W A;  2VM2 A;  4GRF A;  1T4Z A;  3M8N A;  3FZ5 A;  4NXI A;  3F0I A;  1GSD A;  1GH2 A;  4A5P A;  5C00 A;  1O8X A;  1I9D A;  5AGY A;  2E2M A;  1XG8 A;  1S3A A;  4WR5 A;  2AAW A;  1SJI A;  4IP1 A;  4LL1 B;  2B6M A;  3R2Q A;  3TKQ A;  1PKZ A;  4OCF A;  4EIP A;  3GX0 A;  2V1M A;  2A4V A;  4AJ6 A;  2NDO A;  3HA9 A;  4TR1 A;  4K7I A;  1IYH A;  1FVJ A;  4KB3 A;  1QXH A;  2L5O A;  4OFN A;  2L57 A;  2FUG 2;  4NHZ A;  4HI7 A;  2A2P A;  2VOC A;  4YAP A;  4I6X A;  1GTA A;  3LOR A;  3SBC A;  1WPI A;  4OWY A;  4X0X A;  2PWJ A;  5L71 A;  1MDJ A;  1GLP A;  3C73 A;  2LRN A;  4JZQ A;  2H74 A;  5F0G A;  3QAW A;  3A5W A;  4K0N A;  5DCG A;  5ABR A;  4MF5 A;  4J56 E;  2CX4 A;  1GNW A;  3BCI A;  3HJO A;  1J0F A;  1WP0 A;  4MF7 A;  5GAN D;  2YWM A;  4V2N A;  4MDC A;  2EIO A;  4PX1 A;  4EL1 A;  4G0L A;  1DSB A;  3P2A A;  5DJM A;  4USS A;  4XTS A;  4FYB A;  4HQZ A;  2H66 A;  2DIZ A;  4RI6 A;  2BTO T;  2RM6 A;  4O7H A;  1MD3 A;  2MBT A;  3MIX A;  2FNO A;  4HS1 A;  2B5E A;  4K5S A;  3EC3 A;  3US3 A;  3O3T A;  4O5U A;  3DRN A;  2WB9 A; 
#chains in the Genus database with same CATH homology
 2B1L A;  2LKU A;  5KEJ A;  1XVW A;  2DBC A;  3UIW A;  1X5E A;  2IMF A;  4RQX A;  3KD0 A;  2J9H A;  3KTL A;  4IW9 A;  4TN8 A;  3ZLP A;  4IJ3 A;  2K9F A;  2R4V A;  2VO4 A;  3TJB A;  1GUK A;  1K0B A;  3PPU A;  4HU7 A;  5G5F A;  1BAY A;  1QGV A;  4CDO A;  5D9X A;  2X8G A;  5C04 A;  2E7P A;  4O32 A;  3TKS A;  2LNS A;  4MJC A;  5AIS A;  1EEM A;  3DYR A;  4ZL7 A;  1YDK A;  2MMN A;  3KTB A;  1QK8 A;  4BVY A;  1PQN A;  4K7O A;  4MP4 A;  5ECK B;  1XOB A;  2M72 A;  3PR8 A;  3ERW A;  2B5X A;  3TGZ A;  4V2M A;  2WGR A;  1JZD A;  2JSZ A;  2H19 A;  1SEN A;  3QMX A;  3CTG A;  2AJQ B;  1RK4 A;  3HKR A;  1OVN A;  1G6Y A;  1DBY A;  2YP6 A;  1PN9 A;  4HJ2 A;  3EU3 A;  4PUA A;  2DLX A;  5JWR B;  2H71 A;  4KAE A;  5AIV A;  1GUL A;  4IGJ A;  1PSQ A;  1YEX A;  1SD8 A;  3DEX A;  3BJ5 A;  1UVZ A;  3GKM A;  2XC2 A;  5G5E A;  1X9S B;  4WR4 A;  3N5O A;  3GKX A;  4F0C A;  2PVQ A;  1VF4 A;  2GZY A;  2VAF A;  2IFQ B;  2DJJ A;  2C80 A;  2R37 A;  2OBK A;  4G10 A;  4K0G A;  2VL2 A;  1U3A A;  2VCQ A;  1TRV A;  2IME A;  3ZZX A;  4EKZ A;  1V9W A;  1A8L A;  4L5O A;  1HYU A;  2LEG A;  3DVX A;  3HJP A;  1B8X A;  4Q5F A;  1GRX A;  2GZZ A;  1GL8 A;  3H8Q A;  5DVB A;  3M9J A;  3TKR A;  4MMM A;  3FYG A;  4YKG A;  4L0W A;  5ECO B;  4KE3 A;  1EGO A;  2CVB A;  1TK5 B;  1AAZ A;  3Q74 A;  1BG5 A;  2N5B A;  1YQ1 A;  2XBQ A;  1XBS A;  2VCV A;  3U5R E;  1QUW A;  3F6D A;  4MF6 A;  1T7P B;  1FAA A;  3UBL A;  5HR2 A;  5JWO B;  2TRX A;  4Z2R A;  1BQ7 A;  5IM9 A;  4XHM A;  1Z7P A;  5ECR B;  2GQL A;  1FHE A;  4MCU A;  1R4W A;  3O6T A;  3GKK A;  4IQA A;  1O6J A;  2GTU A;  3LEF A;  2I81 A;  5ECL B;  4V2L A;  3LGC A;  1ACV A;  3U6V A;  1ZYQ B;  3P90 A;  5LCZ A;  1ERV A;  3UVH A;  6GST A;  4LMW A;  3VWX A;  3IPZ A;  4TXO B;  1QQ2 A;  5HR1 A;  1A2L A;  4V1A p;  2DIY A;  2YJ7 A;  3GKN A;  2C3T A;  2X8H A;  4TR1 B;  3TCO A;  2L4C A;  2P5Q A;  1TRU A;  3DXB A;  3IC8 A;  3LYP A;  1TRW A;  1OE8 A;  3EPT A;  3IK9 A;  5DAK A;  3P7X A;  2WRT A;  2L6C A;  1ZL9 A;  3VI5 A;  2YWN A;  2JZT A;  3CBU A;  1R7H A;  3GMF A;  3CMI A;  1S3D A;  1U87 A;  3DWV A;  4YKF A;  4BA7 A;  1WOU A;  3IXR A;  5IMV A;  1KBN A;  1KNG A;  5ECQ B;  4O5Q A;  2K8V A;  2PN8 A;  3C8E A;  5DQY A;  2KUC A;  1K0O A;  4ACS A;  2N5A A;  1A2M A;  1SKS B;  1WE0 A;  2DML A;  1DE2 A;  3FMW A;  3PIN A;  2LJK A;  4KDY A;  20GS A;  3WGE A;  5HR3 A;  4GCI A;  4EVM A;  4ZIJ A;  2B7J A;  1AQX A;  2JAC A;  2O7K A;  3ME8 A;  1F37 A;  1EOH A;  1EEJ A;  2LQO A;  2X99 A;  5E59 A;  3CRU A;  17GS A;  2A2S A;  2LNT A;  1G7E A;  4OCE A;  4OFT A;  1FOV A;  3IDV A;  1Z5Y E;  1TI1 A;  2RII A;  3F3Q A;  5HQP A;  5ECI B;  4DSS A;  4IN0 A;  1K0D A;  4HU9 A;  2QKE A;  2A4H A;  3DVW A;  3GX8 A;  22GS A;  1FG4 A;  2DJ0 A;  4POL A;  5AIX A;  1EGR A;  4POB A;  4O92 A;  2BJX A;  4ML6 A;  5IPH A;  5J5N A;  2YZU A;  4D73 B;  1YF0 A;  4XS4 A;  1URM A;  3W6G A;  4Q5N A;  2YNX A;  2FD3 A;  1MD4 A;  2OE0 A;  3A3T A;  3KM6 A;  4TRX A;  1SL2 B;  2I1U A;  2XPE A;  1K3L A;  3ZFB A;  5ECM B;  2V41 A;  5CRD A;  3ZFL A;  5ID2 A;  4YH2 A;  4EF0 A;  4O5R A;  1KEB A;  1SKW B;  3E0U A;  4E8E A;  3HVS A;  2HXK A;  1XOA A;  2C0E A;  2FCH A;  3VFI A;  4I97 A;  3FW2 A;  9GSS A;  5G1K A;  1OC9 B;  2YWO A;  3MWH A;  1RW1 A;  2GQM A;  2IJY A;  2GSS A;  2ON7 A;  2DJ3 A;  2O87 A;  3Q6O A;  1BX9 A;  2E0Q A;  2DMM A;  1EP8 A;  1XXU A;  5D9T A;  4TVE A;  3D21 A;  3VUR A;  4HDE A;  2RM5 A;  2NVL A;  3TB2 A;  4N0V A;  3GUS A;  3APS A;  1GSQ A;  1A23 A;  2XBI A;  2O8V B;  5CRH A;  16GS A;  1JLV A;  3GV1 A;  1ZOF A;  5KOX A;  1V2A A;  2O89 A;  3KJY A;  1RQM A;  1U6T A;  2TIR A;  4TR4 A;  2HSY A;  3LSZ A;  2HE3 A;  2CA8 A;  3IC4 A;  6GSX A;  3HZ4 A;  1IYI A;  3TKP A;  3KEB A;  2GDR A;  4PQ1 A;  3GIX A;  1XIY A;  1AQW A;  2NPB A;  2R0G A;  4Z2U A;  1SYR A;  2GT5 A;  3IAS 2;  4QQ7 A;  3GL3 A;  2PPT A;  2GSQ A;  4WET A;  3W8J A;  4HQS A;  3GA4 A;  1AQV A;  5A4V A;  2FWE A;  1USB A;  3FR3 A;  4KDX A;  1B4Q A;  1EV9 A;  3GFK A;  1BYE A;  1BJX A;  4RQR A;  4F2I A;  4HZ2 A;  2ALB A;  2F8F A;  3C1S A;  4Q5R A;  4ID0 A;  4BVX A;  5H5S A;  3IHG A;  1TP9 A;  1XW9 A;  3KGK A;  4KA0 A;  2VLU A;  4N30 A;  5GZZ B;  5HFG A;  4J2F A;  5LD0 A;  2L6D A;  2LS5 A;  3TRX A;  5KN2 A;  3EIN A;  4OO5 A;  3TDG A;  3DML A;  2OKA A;  2N5F A;  4MPG A;  4YAV A;  5HFI A;  3M1G A;  4MH2 A;  5D93 A;  1XWK A;  3IRA A;  2YN1 A;  3D6I A;  4IQ1 A;  4J57 E;  1GWC A;  2HYX A;  2LST A;  2PER A;  5IIZ A;  5CP1 A;  4FYC A;  5JCU A;  3FHK A;  4MLY A;  1R5A A;  5COH A;  3UOM A;  1SD9 A;  1N2A A;  2OE3 A;  2VUP A;  2YV7 A;  2F51 A;  4G0I A;  1SK1 A;  2CVD A;  4LLR A;  5CRE A;  1EWX A;  2L59 A;  3F3R A;  3NOF A;  3D4T A;  1PGT A;  4JBB A;  4JU5 A;  3TKS C;  1V40 A;  5KOW A;  4ZIL A;  1OC3 A;  2MMA A;  4F03 A;  2Z9S A;  3L9S A;  4NHW A;  1ZCP A;  4N11 A;  3UMA A;  11GS A;  5ECP B;  5B8A A;  3LXT A;  4JR6 A;  1FVK A;  3A5I A;  5F07 A;  3UVT A;  2VL3 A;  5DAL A;  1HNA A;  2HZF A;  3TRQ A;  4GTU A;  4WF5 A;  3TOT A;  3EMP A;  5IOW A;  3GRX A;  5IOX A;  1Y25 A;  3NZN A;  1K0C A;  3GTU B;  1TU7 A;  1VGL A;  3OR5 A;  2LRC A;  1VF2 A;  3F4R A;  2YOI A;  3L9V A;  1ILO A;  5ECS A;  4L0U A;  4XS1 A;  3WT1 A;  2IMD A;  2WCI A;  3FR6 A;  4K6X A;  3VPT A;  1ZGN A;  3UBK A;  4BL7 A;  2GLR A;  3KZQ A;  2YJH A;  1FW1 A;  3Q19 A;  1M2A A;  4WEY A;  4LL4 B;  1Z9H A;  3ZVJ D;  2VL2 C;  2F3M A;  3SWL A;  1F9M A;  4DSS B;  3HVX A;  1I5G A;  2VLT A;  5JCG A;  4OMV A;  2HZE B;  2HFD A;  4EO3 A;  5ECH B;  1YJ6 A;  5GSS A;  2CZ2 A;  5HFK A;  5CAX A;  3V1W A;  2XPD A;  4JR4 A;  3G9B A;  4XIH A;  4ECJ A;  1Q98 A;  3IAM 2;  3VI7 A;  4G2E A;  2FA8 A;  3EU4 A;  5F05 A;  2KLX A;  3EE2 A;  1JZR A;  3LG6 A;  4WKW A;  3FRC A;  5ID2 B;  1PMT A;  4MJE A;  4YQV A;  4G9H A;  1SL0 B;  4IS0 A;  2H76 A;  3QPM A;  4KCA A;  4EXJ A;  4KF9 A;  1TW9 A;  4I2T A;  1SL1 B;  2H73 A;  2RLI A;  3TJG A;  3QFA C;  4ZXG A;  1J08 A;  2KP2 A;  4TOP A;  4JED A;  1XWB A;  1XWA A;  3ME7 A;  3HYP A;  3ZML A;  3UEM A;  3GHA A;  3UAP A;  1DE1 A;  4K9Z A;  4GWR A;  4P3Y B;  1WJK A;  2NTO A;  2FWG A;  5J9C A;  3ISO A;  5A4W A;  3TOU A;  3EUR A;  3R3E A;  1LU4 A;  3F63 A;  3IV4 A;  4X1U A;  1TKD B;  5IO2 A;  1T1V A;  5IO0 A;  2LUS A;  4IJI A;  2IL3 A;  3DGQ A;  4HJM A;  5AN1 A;  3APO A;  1JFU A;  4KDU A;  3APQ A;  1LBK A;  5IMD A;  5D8I A;  3IR4 A;  3RAZ A;  2JAD A;  1G7O A;  3F9U A;  5J41 A;  1ERT A;  3MNG A;  1EZK A;  1J9B A;  2H0G A;  2P5R A;  2DKH A;  3CTF A;  3E3E A;  2H1A A;  4K8M A;  2L4Q A;  1GSE A;  2LQQ A;  3EMX A;  1KTE A;  4BWS A;  1EV4 A;  4K5R A;  2UZ8 A;  3LJR A;  2HI7 A;  4PNF A;  10GS A;  4IEL A;  1T4Y A;  3ZMK A;  4F0B A;  4K2X A;  3PGT A;  3H79 A;  4QL7 A;  1N8J A;  3G7J A;  3I6A A;  4OFM A;  4PQH A;  3BD2 A;  4IBP A;  3UJ1 A;  1A8Y A;  4X43 A;  5IMF A;  1AW9 A;  1ERU A;  3FK8 A;  1B48 A;  7GSS A;  4QL9 A;  3LFL A;  1X9W B;  2JU5 A;  1AUC A;  3DIE A;  3FY7 A;  4F82 A;  3QR6 A;  18GS A;  1JZW A;  2GGT A;  3MDK A;  2H1B A;  2P0G A;  4IHU A;  4BWQ A;  3S9F A;  5EVO A;  4WBJ A;  2HSH A;  3ZIT A;  1SYX A;  1M2B A;  4NPB A;  3I9V 2;  3J7Y k;  1U3I A;  2O85 A;  4MJA A;  3D5J A;  4ZL9 A;  3FZA A;  3RBT A;  2HSM A;  2MMZ A;  4JE1 A;  4ECB A;  2HRF A;  1X0R A;  5ELA A;  3F4T A;  2I4A A;  4ZBA A;  3WGD A;  3WYW A;  2YAN A;  4I8B A;  4KX4 A;  1GP1 A;  1E2Y A;  5IMA A;  2GQK A;  4PXO A;  1NM3 A;  2HLS A;  1H4O A;  1GUM A;  4IKH A;  4EUY A;  4MZW A;  4XCS A;  3ZRD A;  2IPA A;  4NAX A;  5E4W A;  1ZYE A;  3IOS A;  4KSO A;  4KSM A;  5ECN B;  3ZVJ A;  1E6B A;  1V58 A;  4MPF A;  4TXV A;  4PTS A;  2CX3 A;  3Q18 A;  4HZ4 A;  3O76 A;  2X49 A;  1K3O A;  8GSS A;  3C71 A;  4BL7 B;  1XCC A;  2CVK A;  2FY6 A;  6GSV A;  5B8B A;  2WDU A;  2H30 A;  4BPY A;  2PBJ A;  4HUA A;  1XZO A;  3HVV A;  2AHE A;  3L9U A;  1YEP A;  1GSF A;  2HT9 A;  2ZNM A;  5GST A;  5ENU A;  4K2D A;  3QFB C;  2L5L A;  3ZTL A;  4KUN A;  3GH6 A;  1GSS A;  3KIJ A;  1MEK A;  4XS6 A;  4BVY B;  4DSQ A;  4EC0 A;  5J3R A;  4EDY A;  2F8A A;  4MAB A;  3MYD A;  5CNW A;  3NIV A;  3KP8 A;  3VK9 A;  3ERG A;  3CYN A;  1HNB A;  3IE3 A;  2VCX A;  1SJZ A;  4YQM A;  2CQ9 A;  5INY A;  3KH7 A;  5D9W A;  1G0T A;  1SKR B;  2WS2 A;  2DJ2 A;  1FOH A;  1XW5 A;  4NV5 A;  2OAC A;  1OC8 A;  4GQC A;  1XW6 A;  4GXZ A;  4L8E A;  3RPP A;  1YY7 A;  2GST A;  3GN3 A;  4Z2T A;  2XHF A;  4MZC A;  1FO5 A;  2TRC P;  3BOA A;  1VRS D;  4KGI A;  1AXD A;  1TJD A;  6GSS A;  1TTZ A;  5J9B A;  1TI3 A;  3M0F A;  3IA1 A;  2LJR A;  2H70 A;  2DKI A;  4ZB9 A;  2KHP A;  3QAG A;  3ZIJ A;  1M9B A;  1VF1 A;  1OKD A;  1V57 A;  2X64 A;  1THO A;  2R6K A;  3CXG A;  1HD2 A;  2AUV A;  3L78 A;  4DSR A;  2CZ3 A;  2HNL A;  3D4M A;  2X8C A;  1XVQ A;  2REM A;  3FZ4 A;  2JL4 A;  4F9Z A;  1GLQ A;  2DJ1 A;  3H4K A;  5LNK e;  2NBS A;  1MTC A;  4ZL8 A;  1F3A A;  4MJB A;  3A2W A;  4K1F A;  4EDZ A;  1JLW A;  3G7I A;  1GTU A;  3KMN A;  2I3Y A;  4EIQ A;  2OJL A;  6GSW A;  1SU9 A;  4G19 A;  4ISD A;  2C4J A;  2VCT A;  4KW6 A;  4OD7 A;  3KXO A;  4E8H A;  1O85 A;  1PX6 A;  1SK0 A;  2X4A A;  3CSH A;  2VLV A;  2H6Y A;  2H6X A;  4TXO A;  5DCH A;  4NWY A;  3A2V A;  5CYY A;  1GSU A;  4POK A;  2RUE A;  3GH9 A;  1H75 A;  4N0Z A;  2H0H A;  5IQY A;  1Z3E A;  3D22 A;  3MSZ A;  2K6V A;  4TR0 A;  1TRS A;  3GST A;  2G0F A;  1SK2 A;  2H6Z A;  5DAK B;  3LW9 A;  4X4J A;  2H01 A;  4HOJ A;  2QC7 A;  2H1G A;  3LQ7 A;  1PKW A;  1O73 A;  1M9A A;  4TKY A;  1XFL A;  1BED A;  1W89 A;  4WXT A;  2C3Q A;  2YV9 A;  3L0H A;  3GUR A;  2VM1 A;  4FQU A;  3CSJ A;  2R0C A;  1Q4J A;  2VCW A;  3CRT A;  3RHB A;  5EPF A;  5BRT A;  1ZMA A;  2GSR A;  3E9J B;  4MK3 A;  4TW5 A;  2KOK A;  4MH3 A;  4PUF C;  5D9V A;  1R5P A;  1HQO A;  3PH9 A;  2KP1 A;  4Z7X A;  1PN0 A;  4CY6 A;  5IPG A;  14GS A;  3EVI A;  2YPM A;  1B9Y C;  4Q5Q A;  2OE1 A;  4AGS A;  2CV4 A;  3KMO A;  2IN3 A;  6GSU A;  2DJK A;  3KH9 A;  3KCM A;  1K3Y A;  1M0U A;  5JCW A;  1SJ6 A;  2M80 A;  2D2Z A;  3TKS E;  2GZP A;  2FA4 A;  5ELG A;  1G6W A;  5G2Z A;  5FHI A;  4ZBB A;  3WD6 A;  1F3B A;  1T00 A;  2QA1 A;  3TJJ A;  2OBI A;  3I69 A;  3EYT A;  4XS4 B;  3RHC A;  1B9X C;  2GVP A;  4D73 A;  1PA3 A;  3FKF A;  4AJ8 A;  13GS A;  3LXZ A;  2HRK A;  3AY8 A;  1Z6M A;  2IIY A;  4GF0 A;  2F9S A;  1GNE A;  3QD9 A;  4XRD A;  2K18 A;  2MBS A;  3IK7 A;  4KND A;  4K7N A;  4PGT A;  5J4U A;  2C3N A;  1AC1 A;  1OC9 A;  2V32 A;  3IBH A;  1PL2 A;  2YWI A;  5BMU A;  4IP6 A;  5A5K A;  2C0F A;  1PRX A;  2B3S A;  1B4P A;  3JCM L;  1T3B A;  2ES7 A;  2WUL A;  2B5Y A;  1TOF A;  5B7C A;  3F6F A;  1ZZY A;  4AJ7 A;  4WF4 A;  1LJR A;  5H5R A;  4CHS A;  1YZX A;  6GSY A;  1V98 A;  4XRA A;  5GAP D;  2GT6 A;  3VPQ A;  3UL3 A;  4JRR A;  2VIM A;  2EC4 A;  4IVF A;  1OKT A;  1A24 A;  5A4U A;  3HCZ A;  1VF3 A;  1OAZ A;  2QA2 A;  1NW2 A;  4GLT A;  2H8L A;  3D0Z A;  1S3C A;  2V2G A;  3HDC A;  1A0F A;  5EL8 A;  2AYT A;  2FWF A;  12GS A;  1WMJ A;  4EE0 A;  1CQH A;  2AB6 A;  4FO5 A;  1ZYN A;  4NV2 A;  2EIQ A;  3DD3 A;  2R0P A;  1QFN A;  2H75 A;  2VCZ A;  1M99 A;  3QDN A;  2H0I A;  3VWV A;  3ERF A;  5IMC A;  4BVX B;  2RUF A;  2LTK A;  5B6N A;  1Y6E A;  1T8E B;  4PNG A;  4POM A;  2ZUP A;  3TJF A;  1ABA A;  2IWT A;  4NMU A;  2I9H A;  2YZH A;  4GQF A;  5F8B A;  5CO3 A;  4DVC A;  1MDK A;  2R5G A;  4N10 A;  2WJU A;  3QAV A;  4ML1 A;  3HZ8 A;  3G7Y A;  3HHV A;  1XWG A;  3WT2 A;  4DEJ A;  2JSY A;  5DJL A;  3UAR A;  3FZ9 A;  5KN0 A;  4L5L A;  2LJA A;  1GSY A;  2M46 A;  3C1R A;  3F8U A;  1HNC A;  1FB0 A;  2HRN A;  3HJM A;  1M7T A;  4G0K A;  1C72 A;  3GL5 A;  2AV4 A;  4I2U A;  3M9K A;  4GST A;  4MNN A;  2VD1 A;  3H1N A;  5G30 A;  5G1L A;  4GSS A;  3IHQ A;  3RPN A;  4FH8 A;  1YKC A;  3HXS A;  1TK8 B;  2CAI A;  2QSI A;  2DC5 A;  3HY2 A;  3RDW A;  1YF1 A;  3TRP A;  1OE7 A;  1K0N A;  3J7Y b;  4ILF A;  5FT3 A;  2R2J A;  4MA9 A;  3ED3 A;  1ML6 A;  2V6O A;  1UC7 A;  4MZB A;  1JZO A;  4ECC A;  3FR9 A;  1ST9 A;  4WBR D;  1F6M C;  5DDL A;  2OA7 A;  5DAL B;  3K8N A;  4FYU A;  1WRY A;  3P8W A;  1TDI A;  2V6K A;  1JHB A;  1WWJ A;  3ZRE A;  5HR0 A;  5B6M A;  5IMZ A;  2MYG A;  4RI7 A;  1QMV A;  3GTU A;  3H93 A;  3HD5 A;  1M2D A;  2DSA A;  4CW9 A;  1NSW A;  2B1K A;  1EOG A;  1O81 A;  4LMV A;  1OYJ A;  5D73 A;  2YCD A;  1K0A A;  4KCE A;  2C0D A;  3KP9 A;  1EP7 A;  2E2G A;  1U88 A;  5KN1 A;  3ZL5 A;  2IMK A;  1GTI A;  1NHO A;  1TK0 B;  2CAQ A;  1R26 A;  1PL1 A;  1GTB A;  4TR3 A;  4ZB6 A;  5FWG A;  3BBY A;  4ICY A;  5F06 A;  3LWA A;  3VWU A;  1A0R P;  4ECI A;  3MAK A;  1O7U A;  2HZE A;  3ZYW A;  3W8S A;  1FB6 A;  1PX7 A;  1THX A;  1Z6N A;  1X5D A;  1A2J A;  1TXX A;  1X5C A;  5DBQ A;  2B7K A;  3N9J A;  4FIW A;  2J23 A;  5G31 A;  3ZIV A;  3DKS A;  5KN3 A;  2PGT A;  2FWH A;  1ERW A;  2P31 A;  2FLS A;  4ZBD A;  1DUG A;  3CSI A;  2CT6 A;  4ULX A;  2IMI A;  2C1Y A;  3GYK A;  5EY6 A;  2A2R A;  2H72 A;  1MDI A;  2ON5 A;  2LV3 A;  2PVO C;  1UN2 A;  2C0G A;  1W4V A;  1NHY A;  2MMO A;  5CRW A;  2K8S A;  3I43 A;  3QCP A;  2FHE A;  2PMT A;  4ZB8 A;  5H5Q A;  1F2E A;  5D96 A;  2IFQ A;  5DQS A;  1YKA A;  1CQG A;  4HEA 2;  2QGV A;  1WIK A;  3L4N A;  2VL9 A;  1XPV A;  4H86 A;  3C7M A;  2PUK C;  3BCK A;  4CY8 A;  5CRG A;  2PU9 C;  3TUE A;  1UA5 A;  4LA1 A;  2R3X A;  2GS3 A;  1ZYP A;  3GSS A;  4V1A g;  2MZC A;  4GSN A;  3GNJ A;  2BMX A;  2G2Q A;  2JZR A;  1GUH A;  4AF2 A;  3FEU A;  1X9M B;  4YQU A;  1TU8 A;  1K0M A;  4OO4 A;  5JWQ B;  1PD2 1;  1XWC A;  3F4S A;  2ZCT A;  1Z7R A;  4I5Q A;  2WZ9 A;  2FGX A;  1ON4 A;  3WGX A;  2JZS A;  4PUR A;  2EIR A;  3QOU A;  2HRA A;  3TJK A;  3EWL A;  3M3M A;  3VLN A;  3A2X A;  2OAD A;  2WFC A;  4PQI A;  3VWW A;  2C8U A;  19GS A;  4RUV A;  2LRT A;  2H1D A;  3LYK A;  1AIU A;  2VD0 A;  4KH7 A;  1O8W A;  2VM2 A;  4GRF A;  1T4Z A;  3M8N A;  3FZ5 A;  4NXI A;  3F0I A;  1GSD A;  1GH2 A;  4A5P A;  5C00 A;  1O8X A;  1I9D A;  5AGY A;  2E2M A;  1S3A A;  4WR5 A;  2AAW A;  1SJI A;  4IP1 A;  4LL1 B;  2B6M A;  3R2Q A;  3TKQ A;  1PKZ A;  4OCF A;  4EIP A;  3GX0 A;  2V1M A;  2A4V A;  4AJ6 A;  2NDO A;  3HA9 A;  4TR1 A;  4K7I A;  1IYH A;  1FVJ A;  4KB3 A;  1QXH A;  2L5O A;  4OFN A;  2L57 A;  2FUG 2;  4NHZ A;  4HI7 A;  2A2P A;  2VOC A;  4YAP A;  4I6X A;  1GTA A;  3LOR A;  3SBC A;  1WPI A;  4OWY A;  4X0X A;  2PWJ A;  5L71 A;  1MDJ A;  1GLP A;  3C73 A;  2LRN A;  4JZQ A;  2H74 A;  5F0G A;  3QAW A;  3A5W A;  4K0N A;  5DCG A;  5ABR A;  4MF5 A;  4J56 E;  2CX4 A;  1GNW A;  3BCI A;  3HJO A;  1J0F A;  1WP0 A;  4MF7 A;  5GAN D;  2YWM A;  4V2N A;  4MDC A;  2EIO A;  4PX1 A;  4EL1 A;  4G0L A;  1DSB A;  3P2A A;  5DJM A;  4USS A;  4XTS A;  4FYB A;  4HQZ A;  2H66 A;  2DIZ A;  4RI6 A;  2BTO T;  2RM6 A;  4O7H A;  1MD3 A;  2MBT A;  3MIX A;  2FNO A;  4HS1 A;  2B5E A;  4K5S A;  3EC3 A;  3US3 A;  3O3T A;  4O5U A;  3DRN A;  2WB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...