1YYY1

Trypsin inhibitors with rigid tripeptidyl aldehydes
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Highly selective mechanism-based thrombin inhibitors: structures of thrombin and trypsin inhibited with rigid peptidyl aldehydes.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yyy101
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1yyy102
3SV6A 1YPHE 3M3VA 3NKKA 1GHYH 5EQSA 5C1UA 2XWAA 3LGUA 1NFXA 2G8TA 3ESTA 2FX6A 1DWEH 2ZG0H 2TRMA 2A5IA 4Y0YE 2BB4A 2A4OA 3GYMA 5GWZA 2XXLA 3UPEA 4NWLA 1YPGH 4X8TH 5FHTA 2BLVA 2R0KA 1PPGE 4DW2U 1GJ4H 3RXCA 4FU9A 3L33A 4NA9H 1EPTB 1O5GH 2RA0A 4DG4A 1DS2E 1TPOA 4WXVA 1CA8B 1MUEB 1ZYOA 4YT6H 2P3FH 3JZ1B 3H7TA 2EI8A 3PV4A 2J92A 1PPZA 4U2WA 1JMOH 1MH0A 1ARCA 1ZHMA 1O2TA 4X6OA 2FOBA 3P17H 3F9FA 4BAOB 3SU2A 2I6QA 2RDLA 4JYUH 2ZDKA 3OY6U 4Y6DA 2XRCA 1Z6EA 3EE0B 2WPKS 3ZV9A 1EOLA 2O8WA 3RXMA 5JDUB 4XBBA 2GT8A 1OWHA 1V2ST 1GCTC 1MKXH 3A87A 1RJXB 2BY5X 2Z9IA 1LHFH 4Q7ZA 2ZIQH 4D76A 1WSSH 1MBMA 1QBVH 3OTJE 4WH8A 3SJ8A 3RXLA 1O3JA 2JH0D 4X1RU 3A84A 5AF9H 3T62A 1H1BA 3GDVA 1W7XH 4SGBE 2DUCA 1PQ8A 5EW2H 4UD9H 3RMLH 1BRUP 1GDUA 2XBWA 2BOHB 2JKHA 4FU7A 4ZUHA 2QY0B 2ZTXA 1ANBA 2FI5E 4CR5A 2VH6A 2FOGA 1OWEA 4Z0KA 4JZDH 4PROA 2FTMA 4DT7B 1CT0E 3KIDU 2B0FA 4UE7H 4HTCH 2Q6GA 4A1TA 1K9OE 4MPVA 2ANKH 6CHAB 1QY6A 2NU1E 4IMZA 3H5CB 3MU4A 2SGPE 2ZDLA 1G2MA 2EEKA 2OC8A 1A61H 1ZOMA 4A7IB 1SGPE 8GCHF 1O36A 1SPJA 4Y71A 3S9AA 4NA7A 1TFXA 1C5YB 2G5NA 1EP6A 1TAWA 1IQMA 2UUKB 2ZF0H 5T6FA 5C1XA 2JETC 2PR3A 4RSPA 3PTBA 2GMTB 1C2KA 1F92A 1QBNA 2ZGCA 2HGTH 3M7UA 3SHAH 1SBWA 4FUCA 4AB8A 2BYAX 2HLCA 1UK3A 1DE7H 3PMAB 2BXTH 2BOKA 1QQUA 5J4QA 1Y5UT 1TYNA 3FANA 1XMNB 1O2XA 4GVUA 4NFFA 4E05H 1OXGA 1AFEH 1OX1A 1MZDA 5GXPA 2GDEH 3Q3YA 1O5DH 1ORFA 4FVDA 2PV9B 3EGKH 3RXSA 2ZFRH 4IC5A 2FOHA 5C2ZA 1C2FA 4HGCA 1TX6A 3ZYDA 4RKJB 1DWDH 1CHGA 1K1OA 1W14U 2FYRA 1G3CA 4BXSA 4BANB 2FOCA 3EQ0H 3Q3KA 3I77A 1HPGA 2Z94A 2OQ5A 2F9PA 3GY4A 3FVFB 5DPAA 1Z1IA 1T31A 4ABFA 3QDZB 3SNDA 3QO6A 2P93A 2ZHQH 1FQ3A 2Y80A 1GI6A 1MBQA 5GPIB 1ELEE 1O2SA 3MOCA 1OWKA 1CU1A 4GCHF 1FPHH 1BBRE 3A8DA 3V7TA 2OC1A 2PLXA 1K21H 3FAOA 5EXLA 5I46H 2J95A 1O2KA 1ZPZA 2CN0H 2PUXB 3M37A 3BG4C 3LDXH 1TGNA 1O3KA 3CS0A 1P2QA 2STBE 1HFDA 1E35B 1GJ8B 4B76A 3RXTA 1W2KH 1BZXE 3UR6A 5F8TA 4X2YA 3SORA 3MU8A 1O3AA 3NUMA 1C5XB 1EZXC 2TGPZ 4B73A 2I6SA 1MQ6A 1UVPA 3SI4H 1EXFA 3FP8E 1FAKH 1TNLA 2ZPQA 2Q6FA 2FS8A 2GX4A 4B1TA 1SGCA 1TE0A 2HWLB 1MTUA 1YF4A 3MH4A 2FWWA 4CRCA 1S84A 1O2RA 1A46H 1TNIA 4FXGH 3BTQE 1UTOA 1ZR0A 2F9BH 3MFJA 1C2DA 1UTJA 1LMWB 3S0NA 4ZXYH 1NT1A 1W3CA 4JZFH 4UDWH 4NSVA 1FDPA 1A5IA 4SGAE 1F0SA 1BIOA 1P09A 1YCPH 1DFPA 3W95A 1WUNH 2P8OB 5A2MH 3U1JB 4AOQA 3TIUA 5HYOA 2ZFPH 1A0JA 1FY1A 3FP6E 1BRCE 1C1NA 3QZQA 1SHHB 5E2PA 1P2IA 2A0QB 1GJCB 1VJAU 3FP7E 1NFYA 1O3HA 1GJ6A 1ID5H 1T8MA 3BEIB 5GDSH 4I31A 2UUYA 1C2LA 1BT7A 3ZZ8A 1H9HE 1GI5A 1E37B 4CHAB 5A8ZA 2R0LA 3ZZ7A 4KELA 1KIGH 2GTBA 2O8UA 2ZHWH 1PPBH 1HJ8A 1GHVH 1O2LA 5A8XA 2FEQH 1C1UH 1BA8B 2GVFA 1EQ9A 2Q1JA 2Y5HA 3DFJA 1CA0B 2KAIB 2W3KA 2ZDAH 2VVCA 1LKBA 1O30A 3MU0A 2IN2A 1WU1A 3UUZA 1GHAF 3V0XA 3S9CA 2Y82A 5C5NA 1PJPA 3KQCA 1DT2A 3ATWA 5TJXA 1S81A 1FPCH 4X1SU 5B6OA 1SHYA 1CHOF 4NIVA 3HATH 1FN6A 2HNTE 1GDNA 3ZVEA 1BRAA 4ZKNU 1WTGH 4ZXXH 3M5LA 3OY5U 1NU9A 1YBWA 3SI3H 1J8AA 2Y81A 4WY3A 1P2KA 3KQDA 4OS2A 1O39A 4E06H 1GI8B 1SGIB 1AVGH 2F83A 1FIZA 2VVVA 4X6NA 3RXFA 4B75A 2QA9E 8GCHG 5F6MA 2CHAC 1DANH 2WPLS 3B9FH 3S69A 2AYWA 1V2NT 2BXUH 2BDCA 2FI4E 2R9PA 1HGTH 1DY8A 4MDSA 3BTDE 3U9AH 3OX7U 5JBTA 4A1VA 3O8CA 1SMFE 1O2JA 1BMNH 1DUAA 1ZMNA 1DXPA 3IITA 1UK4A 1V2QT 4H4FA 4UFFH 1UTQA 2PGQB 1LCYA 2BLWA 2WUBA 3ZVBA 3A7XA 1ZJKA 1KDQA 1O5AB 1JOUB 3P8OA 4X2WA 3MH6A 5LPEA 3QGJA 5DP5A 3TITA 3UNQA 1Y3YA 2AERH 1V3XA 1SGNE 4YO9A 2OC7A 3BTWE 2ZDMA 1DWBH 4H42U 2PSYA 4R8TB 1HBTH 1TX8A 1C5OH 2O8MA 3ZVDA 1QJ1B 4KP0A 1PPHE 1HYLA 4HI3A 5E0GA 1TRMA 4IS5A 1KYNA 1HAGE 1Y59T 3ATIA 3SQEE 1TA2A 3LJOA 1HAXB 1AWFH 4UEHH 3QWCH 4OS7A 4Y8YA 5H4IB 1O2WA 2BDAA 2ZU4A 3HGPA 4I33A 2TPIZ 1O2YA 1SGEE 2SNVA 1K2I1 3MU1A 1F0TA 4VGCB 2H1UA 2ULLA 3IWMA 3E1XB 4F49A 2NU0E 2PHBA 2CJIA 5LH8A 2DE9A 1ZHRA 3A82A 1E0FD 1RRKA 4MNWA 3SU0A 1LPKB 4OGXA 1O3LA 4B2BA 1T8OA 4KGAA 4WMEA 6LPRA 1AUJA 3QGNB 3MNXA 1Z6JH 1W11U 2ODQA 1D9IA 2NWNA 1SLWB 1D4PB 1AKSB 3QTOH 2PTNA 3BTGE 1C5SA 3GCHB 2GDDA 4U32A 4ZKOU 2O8LA 4BTIB 1TRYA 4CREA 1ELAA 1NRPH 5EW1H 2AEIH 3QUMP 2ZFFH 3K2UA 3M7QA 1CT2E 4X8VH 2B7DH 2PKAA 4AG1A 3LGWA 2QAAA 3DT0H 4WF8A 1KY9A 1UTKA 4O3TA 2BD3A 3ZZ9A 4BXWA 1OPHB 1WQVH 1YPKH 3KHVA 3RXIA 2ZTYA 8LPRA 4ABGA 1P2MA 1A5GH 2D1JA 2VIOA 2ZGHA 3RM0H 2A2QH 1O3IA 1DOJA 1SLUB 1BTXA 3VGCB 4DIIH 1P2NA 1UJ1A 1MU8B 1P3EA 1SOTA 1MCTA 1LPZB 5EXMA 2WYJA 4TPYA 3DD2H 3MNCA 5SGAE 2TIOA 1GMHF 5DP3A 1DSTA 3WY8A 4IC6A 2UWLA 1W0ZU 5E0HA 2NU2E 3OSYA 3A81A 2RCEA 2VIQA 3BTFE 1BTWA 3BN9A 4FUEA 2OUAA 3VB7A 1BUIA 5F03A 1QRWA 1EZQA 2QXGA 4MTBA 2Z9GA 2UUJB 3TJNA 1AE8H 1ZSLA 1ZSKA 2ALPA 4KTSA 4Y7AA 1MTSA 1GHAG 3VEQB 4BOHA 2AH4X 4MNXA 1UVOA 3RXAA 1AUTC 4OS6A 2GMTC 4ABBA 1UTPA 2D8WA 3PTNA 3TJVA 5A09A 1HXFH 1MQ5A 2HRVA 1F0UA 1TNJA 2PTCE 1CHOG 1CGHA 5T3HA 1KTSB 1S0RA 2WUCA 1SGYE 3A85A 2YOLA 1HLTH 3SU3A 1C1PA 4IW4E 1MKWK 3QZRA 5EG4A 1KXAA 4ZHLU 3SV9A 1GVLA 2ZCLP 1O5EH 8ESTE 2V6NA 4GUXA 2FS9A 5L30H 3BTME 3BTHE 3MU5A 2ZO3H 4AZ2B 1GL1A 2FESH 2Y5FA 1QBOA 1QGFA 3ODDA 4AFSA 3QX5H 3UREA 3A83A 4D7GA 1EB2A 3ATKA 2QYIA 3RXBA 1A0HB 1OS8A 1GBDA 2ZPSA 3U1IB 2ZQ2A 1E34B 1C5TA 3E8LA 3M3SA 3F9HA 1VCQA 1GJ5H 2FX4A 4NIWA 1Z71A 1QJ7B 1N1LA 4AFUA 3P8GA 4CH8B 1GBEA 5EOKA 1D6RA 2UUFB 3BG8A 3ZZ4A 1FZZA 2OXSA 1OWJA 5GJ4B 1GBBA 2FTLE 3M3TA 3ZZCA 2AMQA 3A7VA 4X0WU 3AAVA 3HKJB 2FP7B 2A7JA 1KTTB 3HGNA 1M9UA 1HAPH 3K6ZA 1BRBE 4LK4A 4JYVH 8KME2 3KQBA 1BBRK 4ABDA 2GKVE 2FI3E 1JRSA 1UCYK 1FLEE 1C5ZB 4AG2A 3JZ2B 1TOMH 1FNIA 3SUDA 5DO4H 2GGVB 2WINI 1NRQH 5AHGH 5T6DA 5FX5A 1D3TB 4ZROA 7KMEH 3O8RA 3HKIB 3KN2A 1DXWA 2ANMH 2VVUA 2W3IA 1AU8A 3UNSA 5C3NA 1KLJH 2J94A 1UVSH 1CGJE 1A0LA 5DK1A 4JK5A 2R2WU 1LVOA 4NFEA 1F7ZA 1WTHD 2VIDA 3LKWA 2ZC9H 1TNHA 1QB6A 2TGDA 4K1TA 1C2HA 1XX9A 1PPEE 2Y5GA 1EZSC 2BDIA 2TGAA 1G32B 1EJMA 1IHTH 4XE4A 3UOPA 1RD3B 1C9TA 4Q2KA 2A4QA 2OC0A 1Y8TA 4Q7XA 1LHCH 1ZPBA 1Z1JA 1SI5H 2P8OC 1GI9B 4YOJA 1SVPA 5EU8A 2R3UA 2FLRH 4MPUA 1VR1H 1TMUH 3BSQA 2B8OH 3RLYH 1QNJA 3G01A 5A0BA 4CHAC 3ZZ3A 2FIRH 4IBLH 2P3TB 1TGSZ 1ZMJA 3I78A 2QN5T 2WV4A 3A8BA 3E0PB 6ESTA 3RC6A 5A0AE 3E3TA 1O2MA 1D3DB 1SGFA 1DDJA 2ZGBH 3IG6B 1C2MA 1T4UH 3A7ZA 3PMHB 1CA0C 1H8IH 1LKAA 4A92A 1NPMA 2V3OH 5E2OA 5FBIA 1GBLA 1P9SA 1XM1A 3BEFB 4K60A 1G3BA 1K1MA 4X1PU 5T6GA 5HM2A 2AGEX 4MNYA 5DP8A 4YLUA 1EATA 5L2YH 2PW8H 4NIXA 1O34A 1DX5M 2QGRA 2FXRA 3BEUA 1EPTA 2ZU3A 1GMHG 1UTLM 1LO6A 4WMDA 4F4OC 3TH3H 1FY5A 3NZIA 2BX3A 4X1QU 1O2PA 2H5DA 1PQAA 2ZA5A 1DITH 2OBQA 5HGGA 4FUJA 5C20A 1YCPM 2C3SA 1Q31A 4X8UH 2AIQA 1YPEH 1RGQA 3QTVH 2F9VA 1PPFE 1H4WA 3PB1E 1Q2WA 4B71A 1WBGB 3UIRA 2FOEA 3MYWA 4IN2A 5EQRA 2Y7XA 1WV7H 1NU7B 4WXIA 1ANDA 5C5OA 4FUHA 4ZAEA 3Q77A 1O2IA 3RXEA 2G51A 4I7YH 2BDYA 1HJAB 1TOCB 2WPJS 3LT3A 4ZHMU 2EC9H 2XBYA 2R3YA 2FZZA 1K1PA 1LVMA 4OS1A 3TGJE 4AFQA 3SU4A 2ZU5A 3SNCA 5FCRA 1ZRBA 3SGAE 2FOMB 1GBAA 1SLXB 4MQAA 5L6NH 1C1RA 1A7SA 2F91A 1WAYB 4ZMAH 1TA6A 3SV2H 1OYTH 1XXDA 2A45B 1UCYE 1KXFA 2CF8H 1O3FA 4J1YA 1CSOE 3A88A 4AN7A 5DJ7A 1U6QA 2BD2A 2GZ9A 3PO1C 4ABAA 2B5TB 3MH5A 1EOJA 2ZP0H 1O38A 2TBSA 6GCHF 1TPSA 2CGAA 3LIWA 4Y79A 1LVBA 2P94A 1ACBE 3VB3A 2ZEBA 1G36A 3I29A 1A3BH 3VPKA 2F3CE 1C5RA 1OP0A 4D9RA 4VGCC 1OSSA 1Z8IB 1ZPCA 3UOUA 2A2XH 4NZLA 2PWXA 1P01A 3LONA 2ZGXH 1NESE 3PWBA 2Z9LA 1AI8H 4D8NA 4WH6A 4FUBA 3NCLA 1H9IE 2BZAA 1MKXK 2FMJA 1V2UT 3O8DA 1J16A 1XUJA 2HPPH 1OWDA 1YPLH 1GGDC 2Z9KA 3D65E 4B2CA 5A8YA 4I32A 3GCHC 3T5FH 1HNEE 1YPHC 4B2AA 4BAHB 1A5HA 1V2PT 2EI6A 2H9HA 2ZI2H 2ZGJA 3A86A 1GMCF 4CRAA 2QXHA 1O2GH 1PFXC 1QL9A 1HIAB 1QRZA 2M5TA 2AS9A 1QB9A 1HAVA 1JWTA 3D49H 1HCGA 2C90B 1EAIA 4BNRA 2K1QA 1VGCB 1THPB 3E91A 2G81E 1MD7A 3SW2B 3RC5A 2BD7A 2F9UA 1BMLA 5AFZH 3T28A 1KDQB 1HUTH 1MMJN 1WQSA 2W7SA 1BHXF 1EZUC 3F9EA 1KXCA 1NTPA 3VGCC 4AORA 1AQ7A 2QV1A 4CRGA 1MTNB 4JZEH 1ZJDA 1LDTT 4K8BA 1FY8E 3HPTB 4K69A 1SGQE 5ESTE 3TNSA 2GV6A 1JIRA 3QLPH 5EXNA 3GOVB 1VITF 1C1QA 3D23A 2NU4E 4MPWA 1LQDB 3SJKA 2AFQB 1NS3A 2BY8X 3P70B 3DA9B 3URCA 1AIXH 2Z9JA 2BLQA 3VB4A 2GZ7A 2ZFQH 4KKDA 3UY9A 1QR3E 2CV3A 1V2KT 3GCOA 1P05A 3EYDA 4CBOA 3VFEA 1P10A 3EA9A 4K5ZA 4O3UA 1ELVA 1YLDA 1LPGB 2C8WB 2W7UA 1G2LA 4AYVB 3RC4A 3URDA 1T7CA 5DKMA 3F68H 4AGKA 4ISIH 1DM4B 2GZ8A 1UO6A 1QRXA 3UR9A 1Z8JB 1GVKB 2J4IA 9ESTA 2HNTF 3FZZA 4DIHH 3T26A 1DLEA 2GD4B 1XUKA 4I8HA 2FOAA 2FM2A 2BLOA 4THNH 5F8XA 1P06A 5DP4A 2BDHA 4INLA 4MLFB 1W10U 3TH4H 2Y7ZA 1C1TA 2CXVA 1ELGA 1WOFA 1IQHA 1C2IA 1WYKA 5JB9S 1C5UA 3N7OA 3EAJA 3KNXA 1P03A 3M5MA 4M7GA 1CE5A 1C5MD 1QA0A 1BMMH 1ZLRA 3MNSA 1JXPA 4MPXA 4X2VA 1DICA 2ZCHP 1J14A 4D7FA 9LPRA 2XTTB 4X2XA 1GI1A 2H2ZA 1O2UA 2VH0A 3GDSA 2BDGA 1L1GA 1GG6C 1QIXB 3KF2A 5IDKA 1BJVA 1GI7B 2ODPA 3TJUA 1RIWB 1C5QA 3TPIZ 3ATMA 2FOFA 1L4ZA 1C5WB 3ELAH 2XNIA 1F5KU 4YESB 2J2UA 4FUGA 7LPRA 3A80A 3PO1B 2V0BA 4Y7BA 4DGJA 3RXUA 1GL0E 4X6MA 1Z7KA 4Z6AH 1O2VA 1G3DA 4NIYA 1BB0B 1CGIE 1BOQA 1P11E 2G00A 4ABJA 1S0QA 1SR5C 4D9QA 3ZZ6A 1LVYA 1SQTA 1YM0A 1O33A 1AN1E 3P8FA 4GHTA 3DFLA 5DP7A 5DG6A 3MMGA 1OP2A 1O3GA 1D6WA 1V2LT 3AVZA 6GCHG 1ELBA 1TX7A 3MWIU 1CVWH 1LHDH 1AGJA 4JCNA 3E6PH 1YP9A 1BBRH 1VZQH 1HAYB 2W5EA 3CENA 5A0CA 3ZVFA 3VXFH 1SG8B 1YCPK 1EJNA 4WJG2 1P12E 5BPEA 3U8TH 1GGDB 1ZTJA 1IQGA 4YLQH 3S9BA 4AB9A 1FXYA 1AFQB 2XC5A 1O3DA 1P2OA 1SC8U 2VGCC 1UVTH 5FXLA 3SUGA 1IQIA 2P3UB 2WYGA 1SFIA 7ESTE 2P16A 5K0HA 1QJ6B 2G5VA 1CBWC 4GSOA 2A7HA 4YT7H 1ZZZA 4NCYA 4ZH8A 3RXHA 1S85A 2B9LA 1PPCE 1GMCG 1TRNA 2G55A 2SGAA 2OD3B 3KEEA 5JYIA 4DJZB 1UHBA 4K2YA 4DCDA 2BY9X 3TLOA 1AZ8A 1SFQB 2SGFE 1FMGA 1FY4A 1TABE 4KTCA 2ESTE 4I8JA 1W13U 1MU6B 3SQHE 4TPIZ 4MG3A 3GDUA 2PFEA 3RXOA 3SZNA 3F9GA 3RDZA 2R2MB 2PUQH 2ZTZA 1HAOH 1GBCA 1FI8A 1KXEA 5CHAB 1O2OA 1VITG 5DP9A 3LGIA 4TWWA 2AGGX 1VITH 1RFNA 1ZHPA 2BQ6B 4Y8ZA 1DVAH 4X6PA 2V35A 2VIWA 4YTAA 2GP9B 1TNGA 3P6ZB 2ZFSA 2BVSH 2P59A 3LGTA 3M5OA 1NZQH 3ENSB 1TBQH 1OP8A 1D3QB 2CF9H 3MHWU 1KLIH 3PROA 2IPHA 1GI3A 3A7YA 4YZUA 3S7HB 1GDQA 2J34A 3STIA 1QCPA 2C8YB 1IOEA 3M36A 2OCVB 1HJAC 4ZHAA 2DE8A 1EJAA 1DPOA 5FPTA 2ZDVH 3M5NA 1QURH 1CT4E 1XUHA 3EDXB 4NZQA 1O5CB 3RM2H 2PKSC 3TH2H 1QA7A 2HNTC 5CE1A 1GG6B 1W8BH 2SGQE 2JH6D 1O5BB 2Y6TA 3GY8A 1MTWA 2ODYB 1A2CH 3RXRA 3TGIE 2BD9A 3SNEA 3ZZDA 1XVOA 1GJBB 1FUJA 4OGYA 1Y5BT 1Z8GA 4A6LA 1GI0A 3M35A 4CRDA 5FAHA 3F6UH 4KTUA 1V2VT 1NN6A 3AASA 1NFUA 1ZTLA 3PYHA 3RU4E 2SGEE 5IYTA 1O37A 1DY9A 2OLGA 1A4WH 1MD8A 1SQOA 2QXJA 3SV7A 2Z3EA 3P92A 1UTMA 5DGJA 4WVPE 2A7CA 2FDAA 1EKBB 1NRRH 4FVBA 1TWXB 2VU8E 3K6YA 3L6PA 2UWPA 1XKAC 1ZMLA 1TGTA 2GCHF 3P8NA 4O03A 3RXQA 1T8LA 3ZZAA 4Q80A 1GBKA 3U69H 2XC4A 3ZYEA 2OBOA 2GCTC 2ZHEH 1C4U2 4BTUB 1E36B 5I25A 1V2MT 1SGRE 1TONA 1HRTH 3PMJA 1FY3A 2SGDE 1F0RA 1IQJA 1BTYA 1EB1H 1YPMH 4DURA 4HFPB 1PYTC 3A89A 3K9XB 1XUIA 1J15A 1TBZH 2QIQA 3Q00A 1QB1A 4OS4A 1B5GH 1XXFA 3GY7A 1AB9B 4Q7YA 2AGIX 1L0ZA 4AYYB 2O9QA 1AVXA 2VGCB 3DUXH 3GYLB 3RP2A 2A5AA 2NU3E 2ZHFH 3LJJA 7GCHF 5J4SA 3SN8A 5LPFA 1W0YH 1ABIH 1GJDB 1JIMA 2IJOB 2XW9A 3LC5A 1NRSH 3R3GB 2VWOA 1AD8H 1GHZA 3VXEH 1P02A 5CMXH 1CBWB 4XDEA 1HAZB 5BRRE 4I8LA 3NPSA 2XC0A 1VGCC 2GV7A 3ZV8A 5FPYA 2ZCKP 1K28D 1TQ7B 3TK9A 1BQYA 4BAKB 4NA8A 1K1LA 1IQEA 3BIVH 3GCTF 1HJ9A 1TNKA 3E0NB 5LGOA 5G4BA 4DY7B 1GCDA 1ANCA 4ISHH 1XUFA 2BVRH 2G52A 4CH2B 1TPAE 3LGVA 1AE5A 1MTNC 1LTOA 5EQQA 1NO9H 1P9UA 2BTCE 1C5VA 1BDAA 1TALA 3VB6A 1K1JA 1Q3XA 5FCKA 2FO9A 1PYTD 3PLBA 1ARBA 1EP5A 1KLTA 3TU7H 4U30A 1DLKB 4O97A 3GICB 1XKBC 2OINA 4FU8A 4ASHA 1CO7E 1O3EA 3Q3XA 1O3CA 4GAWA 1BHXB 2QC2A 1F2SE 2XBVA 3A8CA 3GY6A 4ISLA 4Y11E 3H7OA 2H9TH 2ASUB 1C1WH 2WPMS 3SJ9A 1EUFA 1S82A 2FODA 1C2JA 1Y5AT 5AFYH 4MVNA 2G4TA 5EGMA 3VB5A 4RKOB 1TBRH 1C5NH 1MAXA 2HPQH 4JZ1A 1N6YA 5JBCS 3MO3A 1W12U 3E90B 4WMFA 1P57B 1C5PA 4NGAH 1NY22 1QQ4A 3STJA 1Y3VA 1O2HA 1JRTA 3R0FA 5E0JA 3LC3A 1HB0B 2ZU2A 1ETRH 3M61U 1ANEA 1HAIH 1THSH 2FLBH 4AFZA 4X1NU 2H9EH 1VJ9U 2A4RA 2PKSB 3MO9A 3RXDA 1UMAH 2BDBA 2F9NA 1HAVB 1GWAA 4I8GA 2ZKSA 1ZTKA 3B23B 1GPZA 1OOKB 1GJ9B 2P95A 3BTKE 3SJIA 1B0EA 1BMAA 2SNWA 3GCNA 1V2RT 1ESBA 1V2OT 1RIWC 1L2EA 1ZRKA 3GISB 3SBKA 1BITA 1GBMA 4YM9A 5HMAA 1ELCA 1MTVA 2F9OA 2XWBI 4AGJA 3GY5A 3SGQE 1UTNA 2YNAA 1CQQA 1KXDA 2BD5A 2ZPRA 1O35A 1XUGA 3T2NA 4TYDA 2WPIS 1H9LB 1SGDE 2C8XB 2QCYA 1T4VH 2C93B 3KL6A 2HVXA 1TGBA 1O2ZA 1YC0A 3SNAA 4H6SB 5FX6A 1NRNH 4JZIA 4R0IA 1KXBA 2GCTB 2XCNA 2D2DA 1O2QA 4JYTA 2HALA 1LQEA 1V6DA 2EI7A 1GMDF 4K3JA 1O3PB 1N8OC 3FZDA 5K7RA 3PLKA 5TCCA 4ISOA 1QFKH 1SQAA 3FFGA 2ZHDA 3KQEA 3CS7A 3TVJB 1ZGIA 2GCHG 2ZZUH 2OTVA 1G30B 3ITIA 1BTZA 4I8KA 4GLYA 4H6TA 1AVWA 3SU5A 3SV8A 3BIUH 3RXGA 3AW1A 4NSYA 1C1OA 1AFQC 3UQOA 1O3BA 2Z3CA 3RMOH 4E7NA 2BZ6H 1ZSJA 2XYAA 3T29A 1GBHA 3OYPA 3QK1A 3U8RH 2GT7A 1C5LH 3RU4T 1GI2A 3MTYA 1H8DH 1TPPA 4HZHA 1BCUH 1GBTA 3MO6A 3A7WA 3UFAA 1LHEH 4UONA 1GCTB 2VB0A 3RXPA 3RXKA 4A1XA 7GCHG 4IGDA 5TCAA 1TMBH 1FONA 1Y3XA 2Z3DA 4ABIA 4FUFA 3GY2A 4A5TS 2ZNKH 4AX9H 2O8TA 1C9PA 1J9CH 4LXBH 1C4V2 1FJSA 3RMNH 1FAXA 2FPZA 5HM9A 3UQVA 3SOSA 1PQ7A 1FN8A 1PQ5A 4LZ4B 1ETTH 2VNTA 2H5CA 3LGYA 1QHRB 1BTPA 3GCTG 3OU0A 4ZKRU 2ZECA 3U8OH 2D26C 4INHA 1IQKA 3UWJH 1B0FA 3GY3A 1GBFA 1L1NA 3AAUA 3F1SB 2PGBB 1C1MA 1YKTA 1K22H 2JH5D 3BTTE 4NG9H 1DWCH 1AY6H 4K1SA 1MCVA 1T8NA 4TY7A 5CHAC 5GCHF 1S83A 4BAQB 3NWUA 1GVZA 4ZKSU 1YGCH 4Y8XA 1GHXH 4GPGA 3RU4D 1ZGVA 1O31A 1P2JA 4UFDH 4IN1A 2VWLA 1INCA 4LZ1H 1S6HA 4TWYA 2BVXH 2JETB 1AHTH 1XVMA 1V2JT 1EAXA 1T32A 2BM2A 1C2EA 1P3CA 4Y76A 1MAYA 1S5SA 1GHBF 1L4DA 4LOYH 4ABEA 4Y10E 3E16B 1ELFA 1HAHH 3B8JA 3TK5A 1X7AC 1FV9A 2AIPA 2H6MA 2IOTA 3ZZBA 5E8EH 1BTUA 4J2YB 5ESBA 1EAUA 4K8YA 2VIVA 1P0SH 3SNBA 1HIAA 2QF0A 2V3HH 5AVDA 2XBXA 3MNBA 3ZVAA 3LH3A 3C1KA 3PWCA 1MKWH 5JBAS 3QN7A 1E38B 1K1NA 3HK6B 3V12A 1DSUA 3SJOA 4DOQA 1QL8A 2PKAB 3LPRA 3V13A 1SGFG 4XSKU 1TMTH 3HK3B 2LPRA 3A8AA 1C1VH 1Y3UA 2BQ7B 3A7TA 1GBIA 1IQLA 4RN6A 2A5KA 1A1RA 2OQUA 4CRFA 3RUOA 1VCWA 1NFWA 3EA7A 5ETXA 3RXJA 1OWIA 1IHSH 2KAIA 2W26A 3T25A 1UHBB 2Z6BD 1C4Y2 2YNBA 1AMHA 2OP9A 1UVUH 5EODA 5GIBA 1ESAA 1KSNA 2A31A 2ZU1A 1RTKA 1QL7A 1S6FA 1Y3WA 5JBBS 1O3OA 2WV5A 5PTPA 3SUFA 3BG4B 1F5LA 2BY6X 1IQFA 3RLWH 1O0DH 2ILNA 5EPNA 4DVAU 3MH7A 1GBJA 4TY6A 1AO5A 1WCZA 2UWOA 1J17T 4GCHG 1EAWA 2VWNA 1HV7A 2RA3A 1N8OB 1SB1H 2EA3A 1SL3A 4K1EA 1EPTC 1BTHH 2ZDNA 4CR9A 3SGBE 1UCYH 4YOGA 4XBCA 4BTTB 4ESTE 2ZFTA 2J38A 1ESTA 1OYQA 3P95A 1AB9C 2AMPA 1SLVB 1GMDG 3SHCH 1NC6A 2BX4A 3RXVA 5ABWA 3T27A 2BMGB 3SU1A 1RS0A 5F8ZA 1NROH 3L3TA 2QXIA 1F5RA 4X8SH 3M7TA 1BJUA 4UFEH 2THFB 3NK8A 4JK6A 1THRH 1G37A 5FPSA 4JMYA 1GJAB 4U01A 3PMBB 2BHGA 1O32A 1TQ0B 3ZVGA 1SOZA 1V2TT 2VINA 4CRBA 3ATLA 2FYQA 2ANWA 5JPMH 1C1SA 3KGPA 1EASA 4CBNA 2VIPA 5LPRA 4QT8C 2VWMA 1B7XB 2ANYA 1TIOA 3SUEA 3ZVCA 3EA8A 3SU6A 1LHGH 3C27B 4Y0ZE 3ODFA 1RTLA 2C8ZB 1YLCA 1GJ7B 3S7KB 1MZAA 3ZZ5A 5L2ZH 3U98H 2ZQ1A 4O9VA 2A32A 3W94A 2STAE 2RG3A 1GI4A 1QTFA 3NXPA 1HDTH 2TGTA 1GHWH 1HXEH 1SSXA 2BQWB 1IAUA 1TLDA 2SFAA 2XCFA 3RMMH 3Q76A 4ISNA 3TJOA 2BY7X 2PSXA 5EPYA 4BAMB 1EX3A 3K65B 1ELTA 3MI4A 6CHAC 2CMYA 5FBEA 3UNRA 3CP7A 4E7RG 1A3EH 5HXFA 3BF6H 2J9NA 1AZZA 1RXPA 1IQNA 4FUIA 1TGCA 1N6XA 1YPJH 4GHQA 1O3NA 5GCHG 1JBUH 3LOXA 2G4UA 3PLPA 4MNVA 1L1JA 3O8BA 3TGKE 2VJ1A 1AKSA 3UTUH 1O2NA 2ALVA 1P8VC 1RTFB 2BD8A 1YYY1 2A1DB 4B74A 3TK6A 2CHAB 1C2GA 3TNTA 3PM3A 3V3MA 1ABJH 3D62A 4XOJA 1ELDE 5C1YA 1FIWA 3LH1A 4YOIA 4XFQA 1D3PB 1G9IE 1GHBG 2ZWLH 2QF3A 5JB8S 1TB6H 1ETSH 3BV9B 4WWYA 1P04A 5DP6A 1O5FH 4NWKA 2A4GA 4IMQA 4UFGH 3LU9B 1AWHB 2WPHS 4FUDA 1SGTA 1K1IA 2Q6DA 1NM6A 1G3EA 3AW0A 1OKXA 3DHKH 5C67A 1Z8RA 1V2WT 4OS5A 4XBDA 2AMDA 1VCPA 3KCGH 2HOBA 1W7GH 1O3MA 2BD4A 4ABHA 1DUEA 1UK2A 3UWIA 2C4FH 2Z7FE 4INKA 3BTEE 3SO3A 2LNCA
chains in the Genus database with same CATH superfamily
1S6LA 3SV6A 1YPHE 2EY4C 3M3VA 3NKKA 1GHYH 5EQSA 5C1UA 2XWAA 3LGUA 1NFXA 2G8TA 3ESTA 2FX6A 1DWEH 2ZG0H 5CDFE 2TRMA 2A5IA 4Y0YE 2BB4A 2A4OA 3GYMA 5GWZA 2XXLA 3UPEA 4NWLA 1YPGH 4X8TH 5FHTA 2BLVA 2R0KA 1PPGE 4DW2U 1GJ4H 3RXCA 4FU9A 1SQRA 3L33A 4NA9H 1EPTB 1O5GH 2RA0A 4DG4A 1DS2E 1TPOA 2L6OA 4WXVA 1CA8B 1MUEB 1ZYOA 4YT6H 2P3FH 3JZ1B 3H7TA 2EI8A 3PV4A 2J92A 2KCAA 2KM0A 1PPZA 4U2WA 1JMOH 1MH0A 1ARCA 1ZHMA 1O2TA 4X6OA 2FOBA 3P17H 3F9FA 4BAOB 3SU2A 2I6QA 2RDLA 4JYUH 2ZDKA 3OY6U 4Y6DA 2XRCA 2YMSC 5C17A 1Z6EA 2HVYB 3EE0B 2WPKS 3ZV9A 1EOLA 2O8WA 3RXMA 5JDUB 1VKYA 4XBBA 2GT8A 1OWHA 1V2ST 1GCTC 1MKXH 3A87A 1RJXB 2BY5X 2Z9IA 1LHFH 4Q7ZA 2ZIQH 4D76A 2V7QD 1WSSH 1MBMA 1QBVH 3OTJE 4WH8A 3SJ8A 1BMFD 4DT4A 3RXLA 1O3JA 2JH0D 4X1RU 3A84A 5AF9H 3T62A 1H1BA 3GDVA 1W7XH 4SGBE 2DUCA 1PQ8A 5EW2H 4UD9H 3RMLH 1BRUP 1GDUA 2XBWA 2BOHB 3VG8A 2JKHA 4FU7A 4ZUHA 2QY0B 2ZTXA 1ANBA 2FI5E 4CR5A 2VH6A 2FOGA 1OWEA 4Z0KA 4JZDH 4PROA 2FTMA 4DT7B 1CT0E 3KIDU 2B0FA 4UE7H 4HTCH 2Q6GA 4A1TA 1K9OE 4MPVA 2ANKH 6CHAB 1QY6A 2NU1E 2JDID 4IMZA 3H5CB 3MU4A 2SGPE 2ZDLA 1G2MA 2EEKA 2OC8A 1A61H 1ZOMA 5KECA 4A7IB 1SGPE 8GCHF 1O36A 1SPJA 4Y71A 3S9AA 4NA7A 1TFXA 1C5YB 2G5NA 1EP6A 1TAWA 1IQMA 2UUKB 2ZF0H 5T6FA 5C1XA 2JETC 2PR3A 4RSPA 3PTBA 2GMTB 1C2KA 1F92A 1QBNA 2ZGCA 2HGTH 3M7UA 3SHAH 1SBWA 4FUCA 4AB8A 2BYAX 2HLCA 1UK3A 1DE7H 3OEHD 3PMAB 2BXTH 2BOKA 1QQUA 5J4QA 1Y5UT 1TYNA 3FANA 1OHHD 1XMNB 1O2XA 4GVUA 4NFFA 4E05H 1OXGA 1AFEH 1OX1A 1MZDA 5GXPA 2GDEH 3Q3YA 1O5DH 1ORFA 4FVDA 2PV9B 3EGKH 3RXSA 2ZFRH 3OAAD 4IC5A 2FOHA 5C2ZA 1C2FA 4HGCA 4RT1A 1TX6A 3ZYDA 4RKJB 1DWDH 1CHGA 1K1OA 1W14U 2FYRA 1G3CA 4BXSA 1WXRA 4BANB 2QF4A 2FOCA 3EQ0H 3Q3KA 3I77A 1HPGA 2Z94A 2OQ5A 2F9PA 3GY4A 3FVFB 5DPAA 1Z1IA 1T31A 4ABFA 3QDZB 3SNDA 3QO6A 3KYGA 2P93A 2ZHQH 1FQ3A 2Y80A 1GI6A 1MBQA 5GPIB 1ELEE 1O2SA 3MOCA 1OWKA 1CU1A 4GCHF 1FPHH 1BBRE 3A8DA 3V7TA 2OC1A 2PLXA 1K21H 3FAOA 5EXLA 5I46H 2J95A 1O2KA 1ZPZA 2CN0H 2PUXB 3M37A 3BG4C 3LDXH 1TGNA 1O3KA 3CS0A 1P2QA 2STBE 1HFDA 1E35B 1GJ8B 4B76A 3RXTA 1W2KH 1BZXE 3UR6A 5F8TA 4X2YA 3SORA 3MU8A 1O3AA 3NUMA 1C5XB 1EZXC 2TGPZ 4B73A 2I6SA 1MQ6A 1UVPA 3SI4H 1EXFA 3FP8E 1FAKH 1TNLA 2ZPQA 2Q6FA 2FS8A 2GX4A 4B1TA 1SGCA 1TE0A 2HWLB 1MTUA 1YF4A 3MH4A 2FWWA 4CRCA 1S84A 1O2RA 1A46H 1TNIA 4FXGH 3BTQE 1UTOA 1ZR0A 2F9BH 3MFJA 1C2DA 1UTJA 1LMWB 3S0NA 4ZXYH 1NT1A 1W3CA 4JZFH 4UDWH 4NSVA 1FDPA 5C94A 1A5IA 4SGAE 1F0SA 1BIOA 2EQNA 1P09A 1YCPH 1DFPA 3W95A 1WUNH 2P8OB 5A2MH 3U1JB 4AOQA 3TIUA 5HYOA 2ZFPH 1A0JA 1FY1A 3FP6E 1BRCE 1C1NA 3QZQA 1SHHB 5E2PA 1P2IA 2A0QB 5KGOA 1GJCB 1VJAU 3FP7E 1NFYA 1O3HA 1GJ6A 1ID5H 1T8MA 3BEIB 5GDSH 4I31A 2UUYA 1C2LA 1BT7A 3ZZ8A 1H9HE 1GI5A 1E37B 4CHAB 5A8ZA 2R0LA 3ZZ7A 4KELA 1KIGH 5HIZA 2GTBA 4FOUC 2K8IA 2O8UA 2ZHWH 1PPBH 1HJ8A 1GHVH 1O2LA 5A8XA 2FEQH 1C1UH 1BA8B 5HIYA 2GVFA 1EQ9A 2Q1JA 4HG6A 2Y5HA 3DFJA 1CA0B 2KAIB 2W3KA 2ZDAH 2VVCA 1LKBA 1O30A 3MU0A 1KMHB 1WU1A 2IN2A 1GHAF 3UUZA 3V0XA 3S9CA 2Y82A 5C5NA 1PJPA 1W0KD 3KQCA 1DT2A 3ATWA 5TJXA 1S81A 1FPCH 4X1SU 3FO8D 5B6OA 1SHYA 4B6EA 1CHOF 4NIVA 3HATH 1FN6A 2HNTE 1GDNA 3ZVEA 3F0OA 1BRAA 4ZKNU 1WTGH 4ZXXH 3M5LA 3OY5U 1NU9A 1YBWA 3SI3H 3FOAA 1J8AA 2Y81A 4WY3A 1P2KA 3KQDA 4OS2A 1O39A 3U28C 4E06H 1GI8B 1SGIB 1AVGH 2F83A 1FIZA 2VVVA 4X6NA 3RXFA 4B75A 2QA9E 8GCHG 5F6MA 2CHAC 1DANH 2WPLS 3B9FH 3S69A 2AYWA 1V2NT 2BXUH 2BDCA 2FI4E 5FL7D 2R9PA 1HGTH 1DY8A 4MDSA 3BTDE 3U9AH 3OX7U 5JBTA 2KR7A 4A1VA 3O8CA 1SMFE 1O2JA 1BMNH 1DUAA 5KEDA 1ZMNA 1DXPA 3IITA 1UK4A 1V2QT 4H4FA 4UFFH 1UTQA 2PGQB 1LCYA 2BLWA 2WUBA 3ZVBA 3A7XA 1ZJKA 2W6JD 1KDQA 1O5AB 1JOUB 3P8OA 4X2WA 3MH6A 5LPEA 3QGJA 5DP5A 5CHBA 3TITA 3UNQA 1Y3YA 2AERH 1V3XA 1SGNE 4YO9A 2OC7A 3BTWE 2ZDMA 1DWBH 4H42U 2PSYA 4R8TB 1HBTH 1TX8A 1C5OH 2O8MA 3ZVDA 1QJ1B 4KP0A 1PPHE 1HYLA 4HI3A 5E0GA 2JJ1D 1TRMA 4IS5A 1KYNA 1HAGE 2J98A 1Y59T 3ATIA 3SQEE 2WSSD 2WHXA 1TA2A 3LJOA 1HAXB 1AWFH 4UEHH 4F48B 3QWCH 4OS7A 4Y8YA 5H4IB 1O2WA 2BDAA 2ZU4A 3HGPA 4I33A 2TPIZ 2L74A 1O2YA 1SGEE 2SNVA 1K2I1 3MU1A 1F0TA 4VGCB 2H1UA 2ULLA 2KCOA 3IWMA 3E1XB 4F49A 2NU0E 2PHBA 2CJIA 5LH8A 2DE9A 1ZHRA 3A82A 1E0FD 1RRKA 4MNWA 3SU0A 1LPKB 4OGXA 1O3LA 3N7EA 1T8OA 4KGAA 4B2BA 4WMEA 6LPRA 1AUJA 3QGNB 3MNXA 1Z6JH 5HKKD 1W11U 2ODQA 1D9IA 2NWNA 1SLWB 1D4PB 1AKSB 3QTOH 2PTNA 3BTGE 1C5SA 3GCHB 2GDDA 4U32A 4ZKOU 2O8LA 4BTIB 1TRYA 4CREA 1ELAA 1NRPH 5EW1H 2AEIH 3QUMP 2ZFFH 3K2UA 3M7QA 1CT2E 4X8VH 2B7DH 2PKAA 4AG1A 3LGWA 2QAAA 3DT0H 4WF8A 1KY9A 1UTKA 4O3TA 2BD3A 4Q4LA 3ZZ9A 4BXWA 1OPHB 1WQVH 1YPKH 3KHVA 3RXIA 2ZTYA 8LPRA 4ABGA 1P2MA 1A5GH 2D1JA 2VIOA 2ZGHA 3RM0H 2A2QH 1O3IA 1DOJA 1SLUB 1BTXA 3VGCB 4DIIH 1P2NA 1UJ1A 1MU8B 1P3EA 1SOTA 1MCTA 1LPZB 5EXMA 3OTPA 2WYJA 4TPYA 3DD2H 3MNCA 5SGAE 2TIOA 1GMHF 5DP3A 1DSTA 3WY8A 4IC6A 2UWLA 1W0ZU 5E0HA 2NU2E 3OSYA 3A81A 2RCEA 2VIQA 3BTFE 1BTWA 3BN9A 4FUEA 2OUAA 3VB7A 1BUIA 5F03A 1QRWA 1EZQA 2QXGA 4MTBA 2Z9GA 2UUJB 3TJNA 1AE8H 1ZSLA 1ZSKA 2ALPA 4I86A 4KTSA 4Y7AA 1MTSA 1GHAG 3VEQB 4BOHA 2AH4X 4MNXA 1UVOA 3RXAA 1AUTC 4OS6A 2GMTC 4ABBA 1UTPA 2D8WA 3PTNA 3TJVA 5A09A 1HXFH 1MQ5A 2HRVA 1F0UA 1TNJA 3F2FA 2PTCE 1CHOG 1CGHA 5T3HA 1KTSB 1S0RA 2WUCA 1SGYE 3A85A 2YOLA 1YLNA 1HLTH 3SU3A 1C1PA 4IW4E 1MKWK 3QZRA 4P00A 5EG4A 1KXAA 4RT0A 4ZHLU 3SV9A 2RFKC 1GVLA 2ZCLP 1O5EH 8ESTE 2V6NA 4GUXA 2FS9A 5L30H 3BTME 3BTHE 3MU5A 2ZO3H 4AZ2B 1GL1A 2FESH 2Y5FA 1QBOA 1QGFA 3ODDA 4AFSA 3QX5H 3UREA 3A83A 4D7GA 1H8ED 1EB2A 3ATKA 2QYIA 3RXBA 1A0HB 1OS8A 1GBDA 2ZPSA 3U1IB 2ZQ2A 1E34B 1C5TA 3E8LA 3M3SA 3F9HA 1VCQA 1GJ5H 2FX4A 4NIWA 1Z71A 1QJ7B 1N1LA 4AFUA 3P8GA 3PRBA 1GBEA 4CH8B 5EOKA 1D6RA 2UUFB 3BG8A 3ZZ4A 1FZZA 2OXSA 1OWJA 5GJ4B 1GBBA 2FTLE 3M3TA 3ZZCA 2AMQA 3A7VA 4X0WU 1E1RD 3AAVA 3HKJB 2FP7B 2A7JA 1KTTB 3HGNA 1M9UA 1HAPH 3K6ZA 1BRBE 4LK4A 4JYVH 8KME2 3KQBA 1BBRK 4ABDA 2GKVE 2FI3E 1JRSA 1UCYK 1FLEE 1C5ZB 4AG2A 3JZ2B 1TOMH 1FNIA 3SUDA 5DO4H 2GGVB 2WINI 1NRQH 5AHGH 5T6DA 5FX5A 1D3TB 4ZROA 7KMEH 3O8RA 3HKIB 3KN2A 1DXWA 2ANMH 2VVUA 2W3IA 1AU8A 3UNSA 5C3NA 1KLJH 2J94A 5IK2D 1UVSH 1CGJE 1A0LA 5DK1A 4JK5A 2R2WU 1LVOA 4NFEA 1F7ZA 1WTHD 2VIDA 3CNRA 3LKWA 2ZC9H 1TNHA 1QB6A 2TGDA 4K1TA 1C2HA 1XX9A 1PPEE 2Y5GA 1EZSC 2BDIA 2TGAA 1G32B 1EJMA 1IHTH 4XE4A 1EFRD 3UOPA 1RD3B 1C9TA 4Q2KA 2A4QA 2OC0A 1Y8TA 4Q7XA 1LHCH 1ZPBA 1Z1JA 1SI5H 2P8OC 1GI9B 4YOJA 1SVPA 5EU8A 2R3UA 2FLRH 4MPUA 1VR1H 1TMUH 3BSQA 2B8OH 3RLYH 1QNJA 3G01A 5A0BA 4CHAC 3ZZ3A 2FIRH 4IBLH 2P3TB 1TGSZ 1ZMJA 3I78A 2F43B 2QN5T 2XOKD 2WV4A 3A8BA 3E0PB 6ESTA 3RC6A 5A0AE 3E3TA 1O2MA 1D3DB 1SGFA 1DDJA 2ZGBH 3IG6B 1C2MA 1T4UH 3A7ZA 3PMHB 1CA0C 1H8IH 1LKAA 4A92A 1NPMA 5DSFA 2V3OH 5E2OA 5FBIA 1GBLA 1P9SA 1XM1A 3BEFB 4K60A 1G3BA 1K1MA 4X1PU 5T6GA 5HM2A 3FN8A 2AGEX 4MNYA 5DP8A 4YLUA 1EATA 5L2YH 2PW8H 4NIXA 1O34A 1DX5M 2QGRA 2FXRA 3BEUA 1EPTA 2ZU3A 1GMHG 3SZEA 1UTLM 3DSGA 1LO6A 4WMDA 4F4OC 3TH3H 1YWUA 1FY5A 3NZIA 2BX3A 4X1QU 1O2PA 2H5DA 1PQAA 2ZA5A 1DITH 2OBQA 5HGGA 4FUJA 5C20A 1YCPM 3F0PA 2C3SA 1Q31A 4X8UH 2AIQA 2KFWA 1YPEH 1RGQA 3QTVH 2F9VA 1PPFE 1H4WA 3PB1E 1Q2WA 4B71A 1WBGB 3UIRA 2FOEA 3MYWA 4IN2A 5EQRA 2Y7XA 1WV7H 1NU7B 4WXIA 1ANDA 5C5OA 1SKYE 4FUHA 4ZAEA 3Q77A 1O2IA 3RXEA 2G51A 4I7YH 2BDYA 1HJAB 1TOCB 2WPJS 3LT3A 4ZHMU 2EC9H 2XBYA 4YXWD 2R3YA 2FZZA 1K1PA 1LVMA 4OS1A 3TGJE 4AFQA 3UAIC 3SU4A 2ZU5A 3SNCA 5FCRA 1ZRBA 3SGAE 2FOMB 1GBAA 1SLXB 4MQAA 5L6NH 2WPDD 1C1RA 1A7SA 2F91A 1WAYB 4ZMAH 1TA6A 3SV2H 1OYTH 3WW7A 1XXDA 2A45B 1UCYE 5A8YA 1KXFA 2CF8H 1O3FA 4J1YA 1CSOE 3A88A 4AN7A 5DJ7A 1U6QA 2BD2A 2GZ9A 3PO1C 4ABAA 2B5TB 3MH5A 1EOJA 2ZP0H 4ACAA 1O38A 2TBSA 6GCHF 1TPSA 2CGAA 5GNDA 3LIWA 4Y79A 1LVBA 2P94A 1ACBE 3VB3A 2ZEBA 1G36A 5T1VA 3I29A 1A3BH 3VPKA 2F3CE 1C5RA 1OP0A 4D9RA 4VGCC 1OSSA 1Z8IB 1ZPCA 3UOUA 2A2XH 4NZLA 2PWXA 1P01A 3LONA 3ZIAD 2ZGXH 1NESE 3PWBA 2Z9LA 1AI8H 4D8NA 4WH6A 4FUBA 3NCLA 1H9IE 2BZAA 1MKXK 2FMJA 1V2UT 3O8DA 1J16A 2HPPH 1XUJA 1OWDA 1W0JD 1GGDC 1YPLH 2CK3D 2Z9KA 3D65E 5EJLA 2OK5A 4B2CA 4I32A 3GCHC 2VBCA 3T5FH 1HNEE 5DN6D 1YPHC 4B2AA 4BAHB 1A5HA 1V2PT 2EI6A 2H9HA 2ZI2H 4AC9A 2ZGJA 3A86A 1GMCF 4CRAA 2QXHA 1O2GH 1PFXC 1QL9A 1HIAB 1QRZA 2M5TA 2AS9A 1QB9A 1HAVA 1JWTA 3D49H 1HCGA 2C90B 1EAIA 4BNRA 2K1QA 1VGCB 1THPB 3E91A 2G81E 1MD7A 3SW2B 2KCYA 3RC5A 2BD7A 2F9UA 1BMLA 5AFZH 3T28A 1KDQB 1HUTH 1MMJN 1WQSA 2W7SA 1BHXF 1EZUC 3F9EA 1KXCA 1NTPA 3VGCC 4AORA 3PV5A 1AQ7A 2QV1A 4CRGA 1MTNB 4JZEH 1ZJDA 1LDTT 4K8BA 1FY8E 3HPTB 4K69A 1SGQE 5ESTE 3TNSA 2GV6A 1JIRA 3QLPH 5EXNA 3GOVB 1H8HD 1C1QA 1VITF 3D23A 2NU4E 4MPWA 1LQDB 3SJKA 2AFQB 1NS3A 2BY8X 3P70B 3DA9B 3URCA 1AIXH 2Z9JA 2BLQA 3VB4A 2GZ7A 2ZFQH 4KKDA 3UY9A 1QR3E 2CV3A 1V2KT 3GCOA 1P05A 3EYDA 4CBOA 3VFEA 1P10A 3EA9A 4K5ZA 4O3UA 1ELVA 1YLDA 1LPGB 2C8WB 2W7UA 1G2LA 4AYVB 3RC4A 3URDA 1T7CA 5DKMA 3F68H 4AGKA 4ISIH 1DM4B 2GZ8A 1UO6A 1MABB 1QRXA 3UR9A 1Z8JB 1GVKB 2J4IA 9ESTA 2HNTF 3FZZA 4DIHH 3T26A 1DLEA 2GD4B 1XUKA 4I8HA 2FOAA 2FM2A 2BLOA 4THNH 5F8XA 1P06A 5DP4A 2BDHA 3OEED 4INLA 4MLFB 1W10U 3TH4H 2Y7ZA 1C1TA 2CXVA 1ELGA 1WOFA 1IQHA 2F4LA 2K0QA 3WWBA 1C2IA 1WYKA 5JB9S 1C5UA 3N7OA 3EAJA 3KNXA 1P03A 3M5MA 4M7GA 1CE5A 1C5MD 1QA0A 1BMMH 1ZLRA 3MNSA 1JXPA 4MPXA 4X2VA 1DICA 2ZCHP 1J14A 4D7FA 9LPRA 2XTTB 4X2XA 1GI1A 2H2ZA 1O2UA 2VH0A 3GDSA 2BDGA 1L1GA 1GG6C 1QIXB 3KF2A 5IDKA 1BJVA 1GI7B 2ODPA 3TJUA 1RIWB 1C5QA 3TPIZ 3ATMA 2FOFA 1L4ZA 1C5WB 3ELAH 2XNIA 1F5KU 4YESB 2J2UA 4FUGA 7LPRA 3A80A 3PO1B 2V0BA 4Y7BA 4DGJA 3RXUA 1GL0E 4X6MA 1Z7KA 4Z6AH 1O2VA 1G3DA 4NIYA 1BB0B 1CGIE 1BOQA 1P11E 2G00A 4RI0A 4ABJA 5C0TA 1S0QA 1SR5C 4D9QA 3ZZ6A 1LVYA 1SQTA 1YM0A 1O33A 1AN1E 3P8FA 4GHTA 3DFLA 5DP7A 5DG6A 3MMGA 1OP2A 1O3GA 1D6WA 1V2LT 3AVZA 6GCHG 1ELBA 1TX7A 3MWIU 1CVWH 1LHDH 1AGJA 4JCNA 3E6PH 1YP9A 1BBRH 1VZQH 1HAYB 3KYFA 2W5EA 3CENA 4B6FA 5A0CA 3ZVFA 3WWFA 1WDIA 3VXFH 1SG8B 1YCPK 1EJNA 4WJG2 1P12E 5BPEA 3U8TH 1GGDB 1ZTJA 1IQGA 4YLQH 3S9BA 4AB9A 1FXYA 1AFQB 5EJ1A 2XC5A 1O3DA 4FETA 1P2OA 1SC8U 2VGCC 1UVTH 5FXLA 3SUGA 1QZ8A 1IQIA 2P3UB 2WYGA 1SFIA 7ESTE 2LELA 2P16A 5K0HA 1QJ6B 2G5VA 1CBWC 4GSOA 2A7HA 4YT7H 1ZZZA 4NCYA 4ZH8A 3RXHA 1S85A 2B9LA 1PPCE 1GMCG 1TRNA 2G55A 1COWD 2SGAA 2OD3B 3KEEA 5JYIA 3DSOA 4DJZB 1UHBA 4K2YA 4DCDA 2BY9X 2GJGA 3TLOA 1AZ8A 4TT3D 1SFQB 2SGFE 1FMGA 1FY4A 1TABE 2KZ4A 4KTCA 2ESTE 4I8JA 1W13U 1MU6B 3SQHE 1E1QD 4TPIZ 4MG3A 3DCLA 3GDUA 2PFEA 3RXOA 3SZNA 3F9GA 3RDZA 2R2MB 2PUQH 2ZTZA 1HAOH 1GBCA 1FI8A 2AHME 1KXEA 5CHAB 1O2OA 1VITG 5DP9A 3LGIA 4TWWA 2AGGX 1VITH 1RFNA 1ZHPA 2BQ6B 4Y8ZA 1DVAH 4X6PA 2V35A 2VIWA 4YTAA 2GP9B 1TNGA 3P6ZB 2ZFSA 2BVSH 1E79D 2P59A 3LGTA 3M5OA 1NZQH 3ENSB 1TBQH 1OP8A 1D3QB 2CF9H 3MHWU 1KLIH 3PROA 2IPHA 1GI3A 3EE7A 3A7YA 4YZUA 3S7HB 1GDQA 2J34A 3STIA 1QCPA 2C8YB 5B6LA 1IOEA 5F53A 3SYJA 3M36A 2OCVB 1HJAC 4ZHAA 2DE8A 1EJAA 1DPOA 5FPTA 2ZDVH 3M5NA 1QURH 1CT4E 1XUHA 3EDXB 4NZQA 1O5CB 3RM2H 2PKSC 3TH2H 1QA7A 2HNTC 5CE1A 1GG6B 1W8BH 2SGQE 2JH6D 1O5BB 2Y6TA 3GY8A 1MTWA 2ODYB 1A2CH 3RXRA 3TGIE 2BD9A 3SNEA 3ZZDA 1XVOA 1GJBB 1FUJA 4OGYA 1Y5BT 2W6ID 1Z8GA 4A6LA 1GI0A 3M35A 2KX4A 4CRDA 5FAHA 3F6UH 4KTUA 1V2VT 1NN6A 3AASA 1NFUA 1ZTLA 3PYHA 3RU4E 2SGEE 5IYTA 1O37A 1DY9A 2OLGA 1A4WH 1MD8A 1SQOA 2QXJA 3SV7A 2Z3EA 3P92A 1UTMA 5DGJA 4WVPE 2FDAA 2A7CA 1EKBB 1NRRH 4FVBA 1TWXB 2VU8E 3K6YA 3L6PA 2UWPA 1XKAC 1ZMLA 1TGTA 2GCHF 3P8NA 4O03A 3RXQA 1T8LA 3ZZAA 4Q80A 1GBKA 3U69H 2XC4A 3ZYEA 2OBOA 2GCTC 2ZHEH 1C4U2 4BTUB 1E36B 5I25A 1V2MT 1SGRE 1TONA 1HRTH 3PMJA 1FY3A 2SGDE 1F0RA 1IQJA 1BTYA 1EB1H 1YPMH 4DURA 2WZQA 4HFPB 1PYTC 3A89A 3K9XB 1XUIA 2LP6A 1J15A 1TBZH 2QIQA 2IPQX 3Q00A 1QB1A 3KQ5A 4OS4A 1B5GH 1XXFA 3GY7A 1AB9B 4Q7YA 2AGIX 1L0ZA 4Q63A 4AYYB 2O9QA 1AVXA 2VGCB 3DUXH 4OM9A 3GYLB 2PP6A 3RP2A 2A5AA 3F2HA 2NU3E 2ZHFH 3OFND 3LJJA 7GCHF 5J4SA 3SN8A 5LPFA 3PV2A 1W0YH 1ABIH 1GJDB 1JIMA 2IJOB 2XW9A 3LC5A 4P02A 1NRSH 3R3GB 2VWOA 1AD8H 1GHZA 3VXEH 1P02A 5CMXH 1CBWB 4XDEA 1HAZB 5BRRE 4I8LA 3NPSA 2XC0A 1VGCC 2GV7A 3ZV8A 5FPYA 2ZCKP 1K28D 1TQ7B 3TK9A 1BQYA 4BAKB 4NA8A 1K1LA 1IQEA 3BIVH 3GCTF 3N7DA 1HJ9A 1TNKA 3E0NB 5LGOA 5G4BA 4DY7B 1GCDA 1ANCA 4ISHH 1XUFA 2BVRH 2G52A 4ACBA 4CH2B 1TPAE 3LGVA 1AE5A 1MTNC 1LTOA 5EQQA 1NO9H 1P9UA 2BTCE 1C5VA 1BDAA 1TALA 3VB6A 1K1JA 1Q3XA 5FCKA 2FO9A 1PYTD 3PLBA 1ARBA 1EP5A 1KLTA 3TU7H 4U30A 1DLKB 4O97A 3GICB 1XKBC 2JIZD 2OINA 4FU8A 4ASHA 1CO7E 1O3EA 3Q3XA 1O3CA 4GAWA 1BHXB 2QC2A 2XNDD 1F2SE 2XBVA 3PRDA 3A8CA 3GY6A 4ISLA 4Y11E 3H7OA 2H9TH 2ASUB 1C1WH 2WPMS 3SJ9A 1EUFA 1S82A 2YMSD 2FODA 1C2JA 1Y5AT 5AFYH 4MVNA 2G4TA 5EGMA 3VB5A 2IJD1 4RKOB 1TBRH 1C5NH 1MAXA 2HPQH 4JZ1A 1N6YA 5JBCS 3MO3A 1W12U 3E90B 4ZCNA 4WMFA 1P57B 1C5PA 4NGAH 1NY22 1QQ4A 3STJA 1Y3VA 1O2HA 1JRTA 3R0FA 5E0JA 3LC3A 1HB0B 2ZU2A 1ETRH 3M61U 1ANEA 1HAIH 1THSH 2FLBH 4AFZA 4X1NU 1FX0B 2H9EH 1VJ9U 2A4RA 2PKSB 3MO9A 3RXDA 1UMAH 3N99A 2BDBA 2F9NA 1HAVB 1GWAA 4I8GA 2ZKSA 1ZTKA 3B23B 1GPZA 1OOKB 1GJ9B 2P95A 3BTKE 3SJIA 1B0EA 1BMAA 2SNWA 3GCNA 1V2RT 1ESBA 1V2OT 1RIWC 1L2EA 1ZRKA 3GISB 3SBKA 1BITA 1GBMA 4YM9A 5HMAA 1ELCA 1MTVA 2F9OA 2XWBI 4AGJA 3GY5A 3SGQE 5EIYA 1UTNA 2YNAA 1CQQA 1KXDA 2BD5A 2ZPRA 1K0HA 1O35A 1XUGA 3T2NA 4TYDA 2RDEA 2WPIS 1H9LB 1SGDE 2C8XB 2QCYA 1T4VH 2C93B 3KL6A 2HVXA 1TGBA 1O2ZA 1YC0A 3SNAA 4H6SB 5FX6A 1NRNH 4JZIA 4R0IA 1KXBA 2GCTB 2XCNA 2D2DA 1O2QA 4JYTA 2HALA 1LQEA 1V6DA 2EI7A 1GMDF 4K3JA 1O3PB 1N8OC 3FZDA 5K7RA 3PLKA 5TCCA 4ISOA 1QFKH 1SQAA 3FFGA 2ZHDA 3KQEA 3CS7A 3TVJB 1ZGIA 2GCHG 2ZZUH 2OTVA 1G30B 1NBME 3ITIA 1BTZA 4I8KA 4GLYA 4H6TA 1AVWA 3SU5A 3SV8A 3BIUH 3RXGA 3AW1A 4NSYA 1C1OA 1AFQC 3UQOA 1O3BA 2Z3CA 3RMOH 4E7NA 2BZ6H 1ZSJA 2XYAA 3T29A 3OE7D 1GBHA 3OYPA 3QK1A 3U8RH 2GT7A 1C5LH 3RU4T 1GI2A 3MTYA 2YMSB 1H8DH 1TPPA 4HZHA 1BCUH 1GBTA 3MO6A 3A7WA 3UFAA 1LHEH 4UONA 1GCTB 2VB0A 3RXPA 3RXKA 1UW7A 4XD7D 4A1XA 7GCHG 4IGDA 5TCAA 1TMBH 1FONA 1Y3XA 3GS9A 2Z3DA 4ABIA 4FUFA 3GY2A 4A5TS 2ZNKH 4AX9H 2O8TA 1C9PA 1J9CH 4LXBH 1C4V2 1FJSA 3RMNH 1FAXA 2FPZA 3FKSD 5HM9A 3SOSA 3UQVA 1PQ7A 1FN8A 1PQ5A 4LZ4B 4ASUD 1ETTH 2VNTA 2H5CA 3LGYA 1QHRB 1BTPA 3GCTG 3OU0A 4ZKRU 2ZECA 3U8OH 2D26C 4INHA 1IQKA 3UWJH 1B0FA 3GY3A 1GBFA 1L1NA 2J98B 3AAUA 3F1SB 2PGBB 1C1MA 1YKTA 1K22H 2JH5D 3BTTE 4NG9H 1DWCH 1AY6H 4K1SA 1MCVA 1T8NA 4TY7A 5CHAC 5GCHF 1S83A 4BAQB 3NWUA 1GVZA 4ZKSU 1YGCH 4Y8XA 1GHXH 4GPGA 3RU4D 1ZGVA 1O31A 1P2JA 4UFDH 4IN1A 2VWLA 1INCA 4LZ1H 1S6HA 4TWYA 2BVXH 2JETB 1AHTH 1XVMA 1V2JT 1EAXA 1T32A 2BM2A 1C2EA 1P3CA 4Y76A 1MAYA 1S5SA 1GHBF 1L4DA 4LOYH 4ABEA 2J5UA 4Y10E 3E16B 1ELFA 1HAHH 3B8JA 3TK5A 1X7AC 1FV9A 2AIPA 2H6MA 2IOTA 3ZZBA 5E8EH 1BTUA 4J2YB 5ESBA 1EAUA 4K8YA 2M2AA 2VIVA 1P0SH 3SNBA 1HIAA 2QF0A 2V3HH 5AVDA 2XBXA 3MNBA 3ZVAA 3LH3A 3C1KA 3PWCA 1MKWH 5JBAS 3QN7A 1E38B 1K1NA 3HK6B 3V12A 1DSUA 3SJOA 4DOQA 1QL8A 2PKAB 3LPRA 3V13A 1SGFG 4XSKU 1TMTH 3HK3B 2LPRA 3A8AA 2KCPA 1C1VH 1Y3UA 2BQ7B 3A7TA 1GBIA 1IQLA 4RN6A 2A5KA 1A1RA 2OQUA 4CRFA 3RUOA 1VCWA 1NFWA 3EA7A 5ETXA 3RXJA 1OWIA 1IHSH 2KAIA 2W26A 3T25A 1UHBB 2Z6BD 1C4Y2 2YNBA 1AMHA 2J97A 2OP9A 3W1EA 1UVUH 5EODA 5GIBA 2WV9A 1ESAA 1KSNA 2A31A 2ZU1A 3NRLA 1RTKA 1QL7A 1S6FA 1Y3WA 5JBBS 1O3OA 2WV5A 5PTPA 3SUFA 3BG4B 1F5LA 2BY6X 1IQFA 3RLWH 1O0DH 2ILNA 5EPNA 4DVAU 3MH7A 1GBJA 4TY6A 1AO5A 1WCZA 2UWOA 1J17T 4GCHG 1EAWA 2VWNA 1HV7A 2RA3A 1N8OB 1SB1H 2EA3A 1SL3A 4K1EA 1EPTC 1BTHH 2ZDNA 4CR9A 3SGBE 3F2GA 1UCYH 4YOGA 4XBCA 4BTTB 4ESTE 2ZFTA 2J38A 2QF5A 3MQKC 1ESTA 1OYQA 3P95A 5EJZA 1AB9C 2AMPA 1SLVB 1GMDG 3SHCH 1NC6A 2BX4A 3RXVA 5ABWA 3T27A 2BMGB 3SU1A 1RS0A 5F8ZA 1NROH 3L3TA 4XRNA 2QXIA 1F5RA 4X8SH 3M7TA 5C0UA 1BJUA 4UFEH 2QE7D 2THFB 3NK8A 4JK6A 1THRH 1G37A 5FPSA 4JMYA 1GJAB 4U01A 3PMBB 2HLDD 2BHGA 1O32A 1TQ0B 3ZVGA 1SOZA 1V2TT 2VINA 4CRBA 3ATLA 2FYQA 2ANWA 5JPMH 1C1SA 3KGPA 1EASA 4CBNA 2VIPA 5LPRA 4QT8C 2VWMA 1B7XB 2ANYA 1TIOA 3SUEA 3ZVCA 3EA8A 3SU6A 1LHGH 3C27B 4Y0ZE 3ODFA 1RTLA 2C8ZB 1YLCA 1GJ7B 3S7KB 1MZAA 3ZZ5A 5L2ZH 3U98H 2ZQ1A 3AK5A 4O9VA 2JJ2D 4M9FA 2A32A 3W94A 2STAE 2RG3A 1GI4A 1QTFA 3NXPA 1HDTH 2TGTA 1GHWH 1HXEH 1SSXA 3DSPA 4F55A 2BQWB 1IAUA 1TLDA 2SFAA 2XCFA 3RMMH 3Q76A 4ISNA 3TJOA 2BY7X 2PSXA 5EPYA 4BAMB 1EX3A 3K65B 1ELTA 3MI4A 6CHAC 2CMYA 5FBEA 3UNRA 3CP7A 4E7RG 1A3EH 5HXFA 3BF6H 2J9NA 1AZZA 3F3BA 1RXPA 1IQNA 4FUIA 1TGCA 1N6XA 1YPJH 4GHQA 1O3NA 5GCHG 1JBUH 3LOXA 2G4UA 3PLPA 4MNVA 1L1JA 3O8BA 3TGKE 2VJ1A 1AKSA 3UTUH 1O2NA 2ALVA 1P8VC 1RTFB 2BD8A 1YYY1 2A1DB 4B74A 3TK6A 2CHAB 1C2GA 3TNTA 4Z1MD 3PM3A 3V3MA 1ABJH 3D62A 4XOJA 1ELDE 5C1YA 1FIWA 3H09A 3LH1A 4YOIA 4XFQA 1D3PB 1G9IE 1GHBG 2ZWLH 2QF3A 5JB8S 1TB6H 1ETSH 3BV9B 1NBMD 1P04A 4WWYA 1O5FH 5DP6A 4NWKA 2A4GA 4IMQA 4UFGH 3LU9B 1AWHB 2WPHS 4FUDA 1SGTA 1K1IA 2Q6DA 4TSFD 1NM6A 1G3EA 3AW0A 1OKXA 3DHKH 5C67A 1Z8RA 1V2WT 4OS5A 4XBDA 2AMDA 1VCPA 3KCGH 2HOBA 1W7GH 1O3MA 2BD4A 3UB0A 4ABHA 1DUEA 1UK2A 3UWIA 2C4FH 2Z7FE 1YY3A 4INKA 3BTEE 2V3MA 3SO3A 2LNCA
chains in the Genus database with same CATH topology
3SV6A 1YPHE 3M3VA 3NKKA 1GHYH 5EQSA 5C1UA 2XWAA 3LGUA 1NFXA 2G8TA 3ESTA 2FX6A 1DWEH 2ZG0H 2TRMA 2A5IA 4Y0YE 2BB4A 2A4OA 3GYMA 5GWZA 2XXLA 3UPEA 4NWLA 1YPGH 4X8TH 5FHTA 2BLVA 2R0KA 1PPGE 4DW2U 1GJ4H 3RXCA 4FU9A 3L33A 4NA9H 1EPTB 1O5GH 2RA0A 4DG4A 1DS2E 1TPOA 4WXVA 1CA8B 1MUEB 1ZYOA 4YT6H 2P3FH 3JZ1B 3H7TA 2EI8A 3PV4A 2J92A 1PPZA 4U2WA 1JMOH 1MH0A 1ARCA 1ZHMA 1O2TA 4X6OA 2FOBA 3P17H 3F9FA 4BAOB 3SU2A 2I6QA 2RDLA 4JYUH 2ZDKA 3OY6U 4Y6DA 2XRCA 1Z6EA 3EE0B 2WPKS 3ZV9A 1EOLA 2O8WA 3RXMA 5JDUB 4XBBA 2GT8A 1OWHA 1V2ST 1GCTC 1MKXH 3A87A 1RJXB 2BY5X 2Z9IA 1LHFH 4Q7ZA 2ZIQH 4D76A 1WSSH 1MBMA 1QBVH 3OTJE 4WH8A 3SJ8A 3RXLA 1O3JA 2JH0D 4X1RU 3A84A 5AF9H 3T62A 1H1BA 3GDVA 1W7XH 4SGBE 2DUCA 1PQ8A 5EW2H 4UD9H 3RMLH 1BRUP 1GDUA 2XBWA 2BOHB 2JKHA 4FU7A 4ZUHA 2QY0B 2ZTXA 1ANBA 2FI5E 4CR5A 2VH6A 2FOGA 1OWEA 4Z0KA 4JZDH 4PROA 2FTMA 4DT7B 1CT0E 3KIDU 2B0FA 4UE7H 4HTCH 2Q6GA 4A1TA 1K9OE 4MPVA 2ANKH 6CHAB 1QY6A 2NU1E 4IMZA 3H5CB 3MU4A 2SGPE 2ZDLA 1G2MA 2EEKA 2OC8A 1A61H 1ZOMA 4A7IB 1SGPE 8GCHF 1O36A 1SPJA 4Y71A 3S9AA 4NA7A 1TFXA 1C5YB 2G5NA 1EP6A 1TAWA 1IQMA 2UUKB 2ZF0H 5T6FA 5C1XA 2JETC 2PR3A 4RSPA 3PTBA 2GMTB 1C2KA 1F92A 1QBNA 2ZGCA 2HGTH 3M7UA 3SHAH 1SBWA 4FUCA 4AB8A 2BYAX 2HLCA 1UK3A 1DE7H 3PMAB 2BXTH 2BOKA 1QQUA 5J4QA 1Y5UT 1TYNA 3FANA 1XMNB 1O2XA 4GVUA 4NFFA 4E05H 1OXGA 1AFEH 1OX1A 1MZDA 5GXPA 2GDEH 3Q3YA 1O5DH 1ORFA 4FVDA 2PV9B 3EGKH 3RXSA 2ZFRH 4IC5A 2FOHA 5C2ZA 1C2FA 4HGCA 1TX6A 3ZYDA 4RKJB 1DWDH 1CHGA 1K1OA 1W14U 2FYRA 1G3CA 4BXSA 4BANB 2FOCA 3EQ0H 3Q3KA 3I77A 1HPGA 2Z94A 2OQ5A 2F9PA 3GY4A 3FVFB 5DPAA 1Z1IA 1T31A 4ABFA 3QDZB 3SNDA 3QO6A 2P93A 2ZHQH 1FQ3A 2Y80A 1GI6A 1MBQA 5GPIB 1ELEE 1O2SA 3MOCA 1OWKA 1CU1A 4GCHF 1FPHH 1BBRE 3A8DA 3V7TA 2OC1A 2PLXA 1K21H 3FAOA 5EXLA 5I46H 2J95A 1O2KA 1ZPZA 2CN0H 2PUXB 3M37A 3BG4C 3LDXH 1TGNA 1O3KA 3CS0A 1P2QA 2STBE 1HFDA 1E35B 1GJ8B 4B76A 3RXTA 1W2KH 1BZXE 3UR6A 5F8TA 4X2YA 3SORA 3MU8A 1O3AA 3NUMA 1C5XB 1EZXC 2TGPZ 4B73A 2I6SA 1MQ6A 1UVPA 3SI4H 1EXFA 3FP8E 1FAKH 1TNLA 2ZPQA 2Q6FA 2FS8A 2GX4A 4B1TA 1SGCA 1TE0A 2HWLB 1MTUA 1YF4A 3MH4A 2FWWA 4CRCA 1S84A 1O2RA 1A46H 1TNIA 4FXGH 3BTQE 1UTOA 1ZR0A 2F9BH 3MFJA 1C2DA 1UTJA 1LMWB 3S0NA 4ZXYH 1NT1A 1W3CA 4JZFH 4UDWH 4NSVA 1FDPA 1A5IA 4SGAE 1F0SA 1BIOA 1P09A 1YCPH 1DFPA 3W95A 1WUNH 2P8OB 5A2MH 3U1JB 4AOQA 3TIUA 5HYOA 2ZFPH 1A0JA 1FY1A 3FP6E 1BRCE 1C1NA 3QZQA 1SHHB 5E2PA 1P2IA 2A0QB 1GJCB 1VJAU 3FP7E 1NFYA 1O3HA 1GJ6A 1ID5H 1T8MA 3BEIB 5GDSH 4I31A 2UUYA 1C2LA 1BT7A 3ZZ8A 1H9HE 1GI5A 1E37B 4CHAB 5A8ZA 2R0LA 3ZZ7A 4KELA 1KIGH 2GTBA 2O8UA 2ZHWH 1PPBH 1HJ8A 1GHVH 1O2LA 5A8XA 2FEQH 1C1UH 1BA8B 2GVFA 1EQ9A 2Q1JA 2Y5HA 3DFJA 1CA0B 2KAIB 2W3KA 2ZDAH 2VVCA 1LKBA 1O30A 3MU0A 2IN2A 1WU1A 3UUZA 1GHAF 3V0XA 3S9CA 2Y82A 5C5NA 1PJPA 3KQCA 1DT2A 3ATWA 5TJXA 1S81A 1FPCH 4X1SU 5B6OA 1SHYA 1CHOF 4NIVA 3HATH 1FN6A 2HNTE 1GDNA 3ZVEA 1BRAA 4ZKNU 1WTGH 4ZXXH 3M5LA 3OY5U 1NU9A 1YBWA 3SI3H 1J8AA 2Y81A 4WY3A 1P2KA 3KQDA 4OS2A 1O39A 4E06H 1GI8B 1SGIB 1AVGH 2F83A 1FIZA 2VVVA 4X6NA 3RXFA 4B75A 2QA9E 8GCHG 5F6MA 2CHAC 1DANH 2WPLS 3B9FH 3S69A 2AYWA 1V2NT 2BXUH 2BDCA 2FI4E 2R9PA 1HGTH 1DY8A 4MDSA 3BTDE 3U9AH 3OX7U 5JBTA 4A1VA 3O8CA 1SMFE 1O2JA 1BMNH 1DUAA 1ZMNA 1DXPA 3IITA 1UK4A 1V2QT 4H4FA 4UFFH 1UTQA 2PGQB 1LCYA 2BLWA 2WUBA 3ZVBA 3A7XA 1ZJKA 1KDQA 1O5AB 1JOUB 3P8OA 4X2WA 3MH6A 5LPEA 3QGJA 5DP5A 3TITA 3UNQA 1Y3YA 2AERH 1V3XA 1SGNE 4YO9A 2OC7A 3BTWE 2ZDMA 1DWBH 4H42U 2PSYA 4R8TB 1HBTH 1TX8A 1C5OH 2O8MA 3ZVDA 1QJ1B 4KP0A 1PPHE 1HYLA 4HI3A 5E0GA 1TRMA 4IS5A 1KYNA 1HAGE 1Y59T 3ATIA 3SQEE 1TA2A 3LJOA 1HAXB 1AWFH 4UEHH 3QWCH 4OS7A 4Y8YA 5H4IB 1O2WA 2BDAA 2ZU4A 3HGPA 4I33A 2TPIZ 1O2YA 1SGEE 2SNVA 1K2I1 3MU1A 1F0TA 4VGCB 2H1UA 2ULLA 3IWMA 3E1XB 4F49A 2NU0E 2PHBA 2CJIA 5LH8A 2DE9A 1ZHRA 3A82A 1E0FD 1RRKA 4MNWA 3SU0A 1LPKB 4OGXA 1O3LA 4B2BA 1T8OA 4KGAA 4WMEA 6LPRA 1AUJA 3QGNB 3MNXA 1Z6JH 1W11U 2ODQA 1D9IA 2NWNA 1SLWB 1D4PB 1AKSB 3QTOH 2PTNA 3BTGE 1C5SA 3GCHB 2GDDA 4U32A 4ZKOU 2O8LA 4BTIB 1TRYA 4CREA 1ELAA 1NRPH 5EW1H 2AEIH 3QUMP 2ZFFH 3K2UA 3M7QA 1CT2E 4X8VH 2B7DH 2PKAA 4AG1A 3LGWA 2QAAA 3DT0H 4WF8A 1KY9A 1UTKA 4O3TA 2BD3A 3ZZ9A 4BXWA 1OPHB 1WQVH 1YPKH 3KHVA 3RXIA 2ZTYA 8LPRA 4ABGA 1P2MA 1A5GH 2D1JA 2VIOA 2ZGHA 3RM0H 2A2QH 1O3IA 1DOJA 1SLUB 1BTXA 3VGCB 4DIIH 1P2NA 1UJ1A 1MU8B 1P3EA 1SOTA 1MCTA 1LPZB 5EXMA 2WYJA 4TPYA 3DD2H 3MNCA 5SGAE 2TIOA 1GMHF 5DP3A 1DSTA 3WY8A 4IC6A 2UWLA 1W0ZU 5E0HA 2NU2E 3OSYA 3A81A 2RCEA 2VIQA 3BTFE 1BTWA 3BN9A 4FUEA 2OUAA 3VB7A 1BUIA 5F03A 1QRWA 1EZQA 2QXGA 4MTBA 2Z9GA 2UUJB 3TJNA 1AE8H 1ZSLA 1ZSKA 2ALPA 4KTSA 4Y7AA 1MTSA 1GHAG 3VEQB 4BOHA 2AH4X 4MNXA 1UVOA 3RXAA 1AUTC 4OS6A 2GMTC 4ABBA 1UTPA 2D8WA 3PTNA 3TJVA 5A09A 1HXFH 1MQ5A 2HRVA 1F0UA 1TNJA 2PTCE 1CHOG 1CGHA 5T3HA 1KTSB 1S0RA 2WUCA 1SGYE 3A85A 2YOLA 1HLTH 3SU3A 1C1PA 4IW4E 1MKWK 3QZRA 5EG4A 1KXAA 4ZHLU 3SV9A 1GVLA 2ZCLP 1O5EH 8ESTE 2V6NA 4GUXA 2FS9A 5L30H 3BTME 3BTHE 3MU5A 2ZO3H 4AZ2B 1GL1A 2FESH 2Y5FA 1QBOA 1QGFA 3ODDA 4AFSA 3QX5H 3UREA 3A83A 4D7GA 1EB2A 3ATKA 2QYIA 3RXBA 1A0HB 1OS8A 1GBDA 2ZPSA 3U1IB 2ZQ2A 1E34B 1C5TA 3E8LA 3M3SA 3F9HA 1VCQA 1GJ5H 2FX4A 4NIWA 1Z71A 1QJ7B 1N1LA 4AFUA 3P8GA 4CH8B 1GBEA 5EOKA 1D6RA 2UUFB 3BG8A 3ZZ4A 1FZZA 2OXSA 1OWJA 5GJ4B 1GBBA 2FTLE 3M3TA 3ZZCA 2AMQA 3A7VA 4X0WU 3AAVA 3HKJB 2FP7B 2A7JA 1KTTB 3HGNA 1M9UA 1HAPH 3K6ZA 1BRBE 4LK4A 4JYVH 8KME2 3KQBA 1BBRK 4ABDA 2GKVE 2FI3E 1JRSA 1UCYK 1FLEE 1C5ZB 4AG2A 3JZ2B 1TOMH 1FNIA 3SUDA 5DO4H 2GGVB 2WINI 1NRQH 5AHGH 5T6DA 5FX5A 1D3TB 4ZROA 7KMEH 3O8RA 3HKIB 3KN2A 1DXWA 2ANMH 2VVUA 2W3IA 1AU8A 3UNSA 5C3NA 1KLJH 2J94A 1UVSH 1CGJE 1A0LA 5DK1A 4JK5A 2R2WU 1LVOA 4NFEA 1F7ZA 1WTHD 2VIDA 3LKWA 2ZC9H 1TNHA 1QB6A 2TGDA 4K1TA 1C2HA 1XX9A 1PPEE 2Y5GA 1EZSC 2BDIA 2TGAA 1G32B 1EJMA 1IHTH 4XE4A 3UOPA 1RD3B 1C9TA 4Q2KA 2A4QA 2OC0A 1Y8TA 4Q7XA 1LHCH 1ZPBA 1Z1JA 1SI5H 2P8OC 1GI9B 4YOJA 1SVPA 5EU8A 2R3UA 2FLRH 4MPUA 1VR1H 1TMUH 3BSQA 2B8OH 3RLYH 1QNJA 3G01A 5A0BA 4CHAC 3ZZ3A 2FIRH 4IBLH 2P3TB 1TGSZ 1ZMJA 3I78A 2QN5T 2WV4A 3A8BA 3E0PB 6ESTA 3RC6A 5A0AE 3E3TA 1O2MA 1D3DB 1SGFA 1DDJA 2ZGBH 3IG6B 1C2MA 1T4UH 3A7ZA 3PMHB 1CA0C 1H8IH 1LKAA 4A92A 1NPMA 2V3OH 5E2OA 5FBIA 1GBLA 1P9SA 1XM1A 3BEFB 4K60A 1G3BA 1K1MA 4X1PU 5T6GA 5HM2A 2AGEX 4MNYA 5DP8A 4YLUA 1EATA 5L2YH 2PW8H 4NIXA 1O34A 1DX5M 2QGRA 2FXRA 3BEUA 1EPTA 2ZU3A 1GMHG 1UTLM 1LO6A 4WMDA 4F4OC 3TH3H 1FY5A 3NZIA 2BX3A 4X1QU 1O2PA 2H5DA 1PQAA 2ZA5A 1DITH 2OBQA 5HGGA 4FUJA 5C20A 1YCPM 2C3SA 1Q31A 4X8UH 2AIQA 1YPEH 1RGQA 3QTVH 2F9VA 1PPFE 1H4WA 3PB1E 1Q2WA 4B71A 1WBGB 3UIRA 2FOEA 3MYWA 4IN2A 5EQRA 2Y7XA 1WV7H 1NU7B 4WXIA 1ANDA 5C5OA 4FUHA 4ZAEA 3Q77A 1O2IA 3RXEA 2G51A 4I7YH 2BDYA 1HJAB 1TOCB 2WPJS 3LT3A 4ZHMU 2EC9H 2XBYA 2R3YA 2FZZA 1K1PA 1LVMA 4OS1A 3TGJE 4AFQA 3SU4A 2ZU5A 3SNCA 5FCRA 1ZRBA 3SGAE 2FOMB 1GBAA 1SLXB 4MQAA 5L6NH 1C1RA 1A7SA 2F91A 1WAYB 4ZMAH 1TA6A 3SV2H 1OYTH 1XXDA 2A45B 1UCYE 1KXFA 2CF8H 1O3FA 4J1YA 1CSOE 3A88A 4AN7A 5DJ7A 1U6QA 2BD2A 2GZ9A 3PO1C 4ABAA 2B5TB 3MH5A 1EOJA 2ZP0H 1O38A 2TBSA 6GCHF 1TPSA 2CGAA 3LIWA 4Y79A 1LVBA 2P94A 1ACBE 3VB3A 2ZEBA 1G36A 3I29A 1A3BH 3VPKA 2F3CE 1C5RA 1OP0A 4D9RA 4VGCC 1OSSA 1Z8IB 1ZPCA 3UOUA 2A2XH 4NZLA 2PWXA 1P01A 3LONA 2ZGXH 1NESE 3PWBA 2Z9LA 1AI8H 4D8NA 4WH6A 4FUBA 3NCLA 1H9IE 2BZAA 1MKXK 2FMJA 1V2UT 3O8DA 1J16A 1XUJA 2HPPH 1OWDA 1YPLH 1GGDC 2Z9KA 3D65E 4B2CA 5A8YA 4I32A 3GCHC 3T5FH 1HNEE 1YPHC 4B2AA 4BAHB 1A5HA 1V2PT 2EI6A 2H9HA 2ZI2H 2ZGJA 3A86A 1GMCF 4CRAA 2QXHA 1O2GH 1PFXC 1QL9A 1HIAB 1QRZA 2M5TA 2AS9A 1QB9A 1HAVA 1JWTA 3D49H 1HCGA 2C90B 1EAIA 4BNRA 2K1QA 1VGCB 1THPB 3E91A 2G81E 1MD7A 3SW2B 3RC5A 2BD7A 2F9UA 1BMLA 5AFZH 3T28A 1KDQB 1HUTH 1MMJN 1WQSA 2W7SA 1BHXF 1EZUC 3F9EA 1KXCA 1NTPA 3VGCC 4AORA 1AQ7A 2QV1A 4CRGA 1MTNB 4JZEH 1ZJDA 1LDTT 4K8BA 1FY8E 3HPTB 4K69A 1SGQE 5ESTE 3TNSA 2GV6A 1JIRA 3QLPH 5EXNA 3GOVB 1VITF 1C1QA 3D23A 2NU4E 4MPWA 1LQDB 3SJKA 2AFQB 1NS3A 2BY8X 3P70B 3DA9B 3URCA 1AIXH 2Z9JA 2BLQA 3VB4A 2GZ7A 2ZFQH